3TX1A

X-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
295
Chain Sequence
MNNLQTKFPHIAIKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRGVILHLDLLQTIERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKYRSTIAEKNYIVLDATFSLALEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGEDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title X-ray crystal structure of Listeria monocytogenes EGD-e UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
rcsb
source organism Listeria monocytogenes
molecule tags Oxidoreductase
total genus 82
structure length 295
sequence length 298
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tx1A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tx1A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3tx1A03
1E0YA 1DIIA 1N62C 3TSJA 3FWAA 5FXPA 1QLUA 1UXYA 2PLSA 1MBTA 3BW7A 2PLIA 1JROA 3S1FA 1AHVA 5FXDA 5HQXA 1WVEA 2BVFA 5AE3A 1W1LA 1AHUA 2VFTA 5G5HB 3SR6B 1N5XA 2MBRA 3JS8A 3D2HA 1W1QA 1FO4A 1ZXIC 3NVZB 1FIQB 4EC3A 2P4PA 3AM9A 4ML8A 2YVSA 2I0KA 2VFRA 2VFVA 4PVHA 1SB3B 2P13A 2GQUA 1W1SA 2W3RA 3GSYA 4PZFA 3S1EA 2W3SA 1WYGA 2VFSA 4PVJA 3I99A 2O3GA 3S1DA 3AN1A 5AE2A 1RM6B 3LLBA 2NQWA 4BCAA 3TX1A 1FFVC 4BC9A 2BVGA 4DNSA 2R8DA 1E8HA 5G5GB 4PWCA 2Q4WA 4OALA 3ETRB 1VDVA 3FW7A 3B9JB 4BBYA 1ZR6A 3D2JA 3TSHA 2OAIA 2VFUA 1W1OA 4JB1A 4PVEA 1WVFA 3D2DA 1DIQA 1T3QC 1W1JA 1W1MA 2W55A 1QLTA 3EUB3 2RK5A 3DQ0A 2VAOA 3FW8A 5FXFA 3W8XA 1N63C 1AHZA 3DEDA 2GQTA 4MLAA 3FW9A 4PVKA 4HG0A 5FXEA 1FFUC 2AXRA 3KJMA 3HRDC 1N5WC 1V97A 3C0PA 3NS1B 3S1CA 3PM9A 4O95A 2Q85A 5HHZA 1N60C 1F0XA 2EXRA 2QPMA 4PYTA 3VTEA 1W1KA 1N61C 3NVVB 2W54A 5ADZA 2P3HA 2E3TA 1W1RA 2QKNA 3W8WA 1MBBA 2R2ZA 5D79A 4JAYA 4BC7A 3NVWB 3LAEA 1I19A 4PWBA 4UD8A 1DZNA 1E8FA 4XLOA 3NRZB 3AMZA 1JRPA 4ZOHB 1VAOA 2BVHA 5AE1A 1HSKA 1E8GA 3NVYB 5HMRA 3W8ZA
chains in the Genus database with same CATH superfamily
1E0YA 3EJDB 1DIIA 1N62C 3TSJA 3FWAA 5FXPA 1QLUA 1UXYA 3EJBB 2PLSA 1MBTA 3BW7A 2PLIA 1JROA 3RJAA 3S1FA 2Y4GA 1AHVA 5FXDA 5HQXA 1WVEA 2BVFA 5AE3A 1W1LA 1AHUA 2VFTA 5G5HB 3SR6B 1N5XA 2MBRA 2Y08A 3JS8A 3D2HA 5L6GA 1W1QA 1FO4A 1ZXIC 3NVZB 1FIQB 4EC3A 2P4PA 3AM9A 4ML8A 2YVSA 2I0KA 2VFRA 2IPIA 2VFVA 4PVHA 1SB3B 2P13A 2GQUA 1W1SA 2W3RA 3GSYA 4PZFA 3S1EA 2W3SA 1WYGA 2VFSA 3POPA 4PVJA 3I99A 2O3GA 3S1DA 3AN1A 3EJEB 5AE2A 2Y3RA 1RM6B 3LLBA 2NQWA 4BCAA 2UUUA 3TX1A 1FFVC 4BC9A 2BVGA 4DNSA 2R8DA 1E8HA 5G5GB 4PWCA 2Q4WA 4OALA 3ETRB 1VDVA 3FW7A 3B9JB 4BBYA 1ZR6A 3D2JA 3TSHA 2OAIA 2VFUA 1W1OA 4JB1A 4PVEA 1WVFA 3D2DA 1DIQA 1T3QC 1W1JA 1W1MA 2W55A 1QLTA 3EUB3 2RK5A 3DQ0A 2VAOA 3FW8A 5FXFA 3W8XA 3PQBA 1N63C 5K8EA 1AHZA 3DEDA 2GQTA 4MLAA 3FW9A 4PVKA 2Y3SA 4HG0A 5FXEA 5L6FA 1FFUC 2AXRA 3KJMA 3HRDC 1N5WC 1V97A 3C0PA 5AWVA 3NS1B 3S1CA 3PM9A 4O95A 5I1WA 2Q85A 5HHZA 1N60C 3RJ8A 2UUVA 1F0XA 2EXRA 2QPMA 4PYTA 3VTEA 1W1KA 1N61C 3NVVB 2W54A 5ADZA 2P3HA 2E3TA 1W1RA 2QKNA 3W8WA 1MBBA 2R2ZA 5D79A 4JAYA 3NVWB 4BC7A 3LAEA 1I19A 4PWBA 4UD8A 5I1VA 1DZNA 1E8FA 4XLOA 3NRZB 3AMZA 1JRPA 4ZOHB 1VAOA 2BVHA 5AE1A 1HSKA 1E8GA 3NVYB 5HMRA 2WDWA 3W8ZA 3HSUA
chains in the Genus database with same CATH topology
1E0YA 1DIIA 1N62C 3TSJA 3FWAA 5FXPA 1QLUA 1UXYA 2PLSA 1MBTA 3BW7A 2PLIA 1JROA 3RJAA 3S1FA 2Y4GA 1AHVA 5FXDA 5HQXA 1WVEA 2BVFA 5AE3A 1W1LA 1AHUA 2VFTA 5G5HB 3SR6B 1N5XA 2MBRA 2Y08A 3JS8A 3D2HA 5L6GA 1W1QA 1FO4A 1ZXIC 3NVZB 1FIQB 4EC3A 2P4PA 3AM9A 4ML8A 2YVSA 2I0KA 2VFRA 2IPIA 2VFVA 4PVHA 1SB3B 2P13A 2GQUA 1W1SA 2W3RA 3GSYA 4PZFA 3S1EA 2W3SA 1WYGA 2VFSA 3POPA 4PVJA 3I99A 2O3GA 3S1DA 3AN1A 5AE2A 2Y3RA 1RM6B 3LLBA 2NQWA 4BCAA 2UUUA 3TX1A 1FFVC 4BC9A 2BVGA 4DNSA 2R8DA 1E8HA 5G5GB 4PWCA 2Q4WA 4OALA 3ETRB 1VDVA 3FW7A 3B9JB 4BBYA 1ZR6A 3D2JA 3TSHA 2OAIA 2VFUA 1W1OA 4JB1A 4PVEA 1WVFA 3D2DA 1DIQA 1T3QC 1W1JA 1W1MA 2W55A 1QLTA 3EUB3 2RK5A 3DQ0A 2VAOA 3FW8A 5FXFA 3W8XA 3PQBA 1N63C 5K8EA 1AHZA 3DEDA 2GQTA 4MLAA 3FW9A 4PVKA 2Y3SA 4HG0A 5FXEA 5L6FA 1FFUC 2AXRA 3KJMA 3HRDC 1N5WC 1V97A 3C0PA 5AWVA 3NS1B 3S1CA 3PM9A 4O95A 5I1WA 2Q85A 5HHZA 1N60C 3RJ8A 2UUVA 1F0XA 2EXRA 2QPMA 4PYTA 3VTEA 1W1KA 1N61C 3NVVB 2W54A 5ADZA 2P3HA 2E3TA 1W1RA 2QKNA 3W8WA 1MBBA 2R2ZA 5D79A 4JAYA 4BC7A 3NVWB 3LAEA 1I19A 4PWBA 4UD8A 5I1VA 1DZNA 1E8FA 4XLOA 3NRZB 3AMZA 1JRPA 4ZOHB 1VAOA 2BVHA 5AE1A 1HSKA 1E8GA 3NVYB 5HMRA 2WDWA 3W8ZA 3HSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0Y A;  1DII A;  1N62 C;  3TSJ A;  3FWA A;  5FXP A;  1QLU A;  1UXY A;  2PLS A;  1MBT A;  3BW7 A;  2PLI A;  1JRO A;  3S1F A;  1AHV A;  5FXD A;  5HQX A;  1WVE A;  2BVF A;  5AE3 A;  1W1L A;  1AHU A;  2VFT A;  5G5H B;  3SR6 B;  1N5X A;  2MBR A;  3JS8 A;  3D2H A;  1W1Q A;  1FO4 A;  1ZXI C;  3NVZ B;  1FIQ B;  4EC3 A;  2P4P A;  3AM9 A;  4ML8 A;  2YVS A;  2I0K A;  2VFR A;  2VFV A;  4PVH A;  1SB3 B;  2P13 A;  2GQU A;  1W1S A;  2W3R A;  3GSY A;  4PZF A;  3S1E A;  2W3S A;  1WYG A;  2VFS A;  4PVJ A;  3I99 A;  2O3G A;  3S1D A;  3AN1 A;  5AE2 A;  1RM6 B;  3LLB A;  2NQW A;  4BCA A;  3TX1 A;  1FFV C;  4BC9 A;  2BVG A;  4DNS A;  2R8D A;  1E8H A;  5G5G B;  4PWC A;  2Q4W A;  4OAL A;  3ETR B;  1VDV A;  3FW7 A;  3B9J B;  4BBY A;  1ZR6 A;  3D2J A;  3TSH A;  2OAI A;  2VFU A;  1W1O A;  4JB1 A;  4PVE A;  1WVF A;  3D2D A;  1DIQ A;  1T3Q C;  1W1J A;  1W1M A;  2W55 A;  1QLT A;  3EUB 3;  2RK5 A;  3DQ0 A;  2VAO A;  3FW8 A;  5FXF A;  3W8X A;  1N63 C;  1AHZ A;  3DED A;  2GQT A;  4MLA A;  3FW9 A;  4PVK A;  4HG0 A;  5FXE A;  1FFU C;  2AXR A;  3KJM A;  3HRD C;  1N5W C;  1V97 A;  3C0P A;  3NS1 B;  3S1C A;  3PM9 A;  4O95 A;  2Q85 A;  5HHZ A;  1N60 C;  1F0X A;  2EXR A;  2QPM A;  4PYT A;  3VTE A;  1W1K A;  1N61 C;  3NVV B;  2W54 A;  5ADZ A;  2P3H A;  2E3T A;  1W1R A;  2QKN A;  3W8W A;  1MBB A;  2R2Z A;  5D79 A;  4JAY A;  4BC7 A;  3NVW B;  3LAE A;  1I19 A;  4PWB A;  4UD8 A;  1DZN A;  1E8F A;  4XLO A;  3NRZ B;  3AMZ A;  1JRP A;  4ZOH B;  1VAO A;  2BVH A;  5AE1 A;  1HSK A;  1E8G A;  3NVY B;  5HMR A;  3W8Z A; 
#chains in the Genus database with same CATH topology
 1E0Y A;  3EJD B;  1DII A;  1N62 C;  3TSJ A;  3FWA A;  5FXP A;  1QLU A;  1UXY A;  3EJB B;  2PLS A;  1MBT A;  3BW7 A;  2PLI A;  1JRO A;  3RJA A;  3S1F A;  2Y4G A;  1AHV A;  5FXD A;  5HQX A;  1WVE A;  2BVF A;  5AE3 A;  1W1L A;  1AHU A;  2VFT A;  5G5H B;  3SR6 B;  1N5X A;  2MBR A;  2Y08 A;  3JS8 A;  3D2H A;  5L6G A;  1W1Q A;  1FO4 A;  1ZXI C;  3NVZ B;  1FIQ B;  4EC3 A;  2P4P A;  3AM9 A;  4ML8 A;  2YVS A;  2I0K A;  2VFR A;  2IPI A;  2VFV A;  4PVH A;  1SB3 B;  2P13 A;  2GQU A;  1W1S A;  2W3R A;  3GSY A;  4PZF A;  3S1E A;  2W3S A;  1WYG A;  2VFS A;  3POP A;  4PVJ A;  3I99 A;  2O3G A;  3S1D A;  3AN1 A;  3EJE B;  5AE2 A;  2Y3R A;  1RM6 B;  3LLB A;  2NQW A;  4BCA A;  2UUU A;  3TX1 A;  1FFV C;  4BC9 A;  2BVG A;  4DNS A;  2R8D A;  1E8H A;  5G5G B;  4PWC A;  2Q4W A;  4OAL A;  3ETR B;  1VDV A;  3FW7 A;  3B9J B;  4BBY A;  1ZR6 A;  3D2J A;  3TSH A;  2OAI A;  2VFU A;  1W1O A;  4JB1 A;  4PVE A;  1WVF A;  3D2D A;  1DIQ A;  1T3Q C;  1W1J A;  1W1M A;  2W55 A;  1QLT A;  3EUB 3;  2RK5 A;  3DQ0 A;  2VAO A;  3FW8 A;  5FXF A;  3W8X A;  3PQB A;  1N63 C;  5K8E A;  1AHZ A;  3DED A;  2GQT A;  4MLA A;  3FW9 A;  4PVK A;  2Y3S A;  4HG0 A;  5FXE A;  5L6F A;  1FFU C;  2AXR A;  3KJM A;  3HRD C;  1N5W C;  1V97 A;  3C0P A;  5AWV A;  3NS1 B;  3S1C A;  3PM9 A;  4O95 A;  5I1W A;  2Q85 A;  5HHZ A;  1N60 C;  3RJ8 A;  2UUV A;  1F0X A;  2EXR A;  2QPM A;  4PYT A;  3VTE A;  1W1K A;  1N61 C;  3NVV B;  2W54 A;  5ADZ A;  2P3H A;  2E3T A;  1W1R A;  2QKN A;  3W8W A;  1MBB A;  2R2Z A;  5D79 A;  4JAY A;  3NVW B;  4BC7 A;  3LAE A;  1I19 A;  4PWB A;  4UD8 A;  5I1V A;  1DZN A;  1E8F A;  4XLO A;  3NRZ B;  3AMZ A;  1JRP A;  4ZOH B;  1VAO A;  2BVH A;  5AE1 A;  1HSK A;  1E8G A;  3NVY B;  5HMR A;  2WDW A;  3W8Z A;  3HSU A; 
#chains in the Genus database with same CATH homology
 1E0Y A;  1DII A;  1N62 C;  3TSJ A;  3FWA A;  5FXP A;  1QLU A;  1UXY A;  2PLS A;  1MBT A;  3BW7 A;  2PLI A;  1JRO A;  3RJA A;  3S1F A;  2Y4G A;  1AHV A;  5FXD A;  5HQX A;  1WVE A;  2BVF A;  5AE3 A;  1W1L A;  1AHU A;  2VFT A;  5G5H B;  3SR6 B;  1N5X A;  2MBR A;  2Y08 A;  3JS8 A;  3D2H A;  5L6G A;  1W1Q A;  1FO4 A;  1ZXI C;  3NVZ B;  1FIQ B;  4EC3 A;  2P4P A;  3AM9 A;  4ML8 A;  2YVS A;  2I0K A;  2VFR A;  2IPI A;  2VFV A;  4PVH A;  1SB3 B;  2P13 A;  2GQU A;  1W1S A;  2W3R A;  3GSY A;  4PZF A;  3S1E A;  2W3S A;  1WYG A;  2VFS A;  3POP A;  4PVJ A;  3I99 A;  2O3G A;  3S1D A;  3AN1 A;  5AE2 A;  2Y3R A;  1RM6 B;  3LLB A;  2NQW A;  4BCA A;  2UUU A;  3TX1 A;  1FFV C;  4BC9 A;  2BVG A;  4DNS A;  2R8D A;  1E8H A;  5G5G B;  4PWC A;  2Q4W A;  4OAL A;  3ETR B;  1VDV A;  3FW7 A;  3B9J B;  4BBY A;  1ZR6 A;  3D2J A;  3TSH A;  2OAI A;  2VFU A;  1W1O A;  4JB1 A;  4PVE A;  1WVF A;  3D2D A;  1DIQ A;  1T3Q C;  1W1J A;  1W1M A;  2W55 A;  1QLT A;  3EUB 3;  2RK5 A;  3DQ0 A;  2VAO A;  3FW8 A;  5FXF A;  3W8X A;  3PQB A;  1N63 C;  5K8E A;  1AHZ A;  3DED A;  2GQT A;  4MLA A;  3FW9 A;  4PVK A;  2Y3S A;  4HG0 A;  5FXE A;  5L6F A;  1FFU C;  2AXR A;  3KJM A;  3HRD C;  1N5W C;  1V97 A;  3C0P A;  5AWV A;  3NS1 B;  3S1C A;  3PM9 A;  4O95 A;  5I1W A;  2Q85 A;  5HHZ A;  1N60 C;  3RJ8 A;  2UUV A;  1F0X A;  2EXR A;  2QPM A;  4PYT A;  3VTE A;  1W1K A;  1N61 C;  3NVV B;  2W54 A;  5ADZ A;  2P3H A;  2E3T A;  1W1R A;  2QKN A;  3W8W A;  1MBB A;  2R2Z A;  5D79 A;  4JAY A;  4BC7 A;  3NVW B;  3LAE A;  1I19 A;  4PWB A;  4UD8 A;  5I1V A;  1DZN A;  1E8F A;  4XLO A;  3NRZ B;  3AMZ A;  1JRP A;  4ZOH B;  1VAO A;  2BVH A;  5AE1 A;  1HSK A;  1E8G A;  3NVY B;  5HMR A;  2WDW A;  3W8Z A;  3HSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...