3TX1A

X-ray crystal structure of listeria monocytogenes egd-e udp-n-acetylenolpyruvylglucosamine reductase (murb)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
295
Chain Sequence
MNNLQTKFPHIAIKLNEPLSKYTYTKTGGAADVFVMPKTIEEAQEVVAYCHQNKIPLTILGNGSNLIIKDGGIRGVILHLDLLQTIERNNTQIVAMSGAKLIDTAKFALNESLSGLEFACGIPGSIGGALHMNAGAYGGEISDVLEAATVLTQTGELKKLKRSELKYRSTIAEKNYIVLDATFSLALEEKNLIQAKMDELTAAREAKQPLEYPSCGSVFKRPPGHFAGKLIQDSGLQGHIIGGAQVSLKHAGFIVNIGGATATDYMNLIAYVQQTVREKFDVELETEVKIIGEDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title X-ray crystal structure of Listeria monocytogenes EGD-e UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
rcsb
source organism Listeria monocytogenes
total genus 82
structure length 295
sequence length 298
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3tx1A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3tx1A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3tx1A03
2VFSA 2P3HA 3FW8A 1W1SA 3LLBA 4JB1A 1E8HA 1W1RA 3AM9A 1AHVA 1W1KA 2W54A 3D2JA 3AN1A 2W55A 3FW9A 3NVVB 5G5GB 3AMZA 2P4PA 3NVZB 2VFUA 4MLAA 5ADZA 1VDVA 4BC7A 1SB3B 4PWBA 3KJMA 1T3QC 3DQ0A 1JRPA 2QKNA 3PM9A 3EUB3 4OALA 5HMRA 2PLIA 4EC3A 1AHZA 1JROA 5FXEA 1W1JA 2Q85A 5AE3A 1W1LA 1N62C 5FXDA 3NRZB 3JS8A 3TSHA 4DNSA 1E0YA 4PVKA 4O95A 1DIQA 3W8ZA 2VFVA 1E8GA 4PVEA 3TSJA 3FWAA 4BBYA 3NVYB 2YVSA 2GQUA 1WVFA 2I0KA 3BW7A 1RM6B 3C0PA 3SR6B 2OAIA 4PZFA 1FFUC 2Q4WA 3D2HA 3S1DA 1FIQB 1F0XA 1N5WC 3B9JB 2O3GA 1FFVC 1N61C 3I99A 3NVWB 4ZOHB 1QLTA 2R8DA 4BCAA 3VTEA 1AHUA 3DEDA 2W3SA 2R2ZA 1N60C 3HRDC 2BVHA 2RK5A 1UXYA 1DIIA 5G5HB 3GSYA 1ZR6A 3NS1B 1W1OA 2AXRA 1QLUA 1WVEA 3S1FA 3W8XA 5FXPA 5HQXA 4PVHA 4UD8A 4HG0A 1HSKA 1E8FA 3S1CA 1N5XA 3W8WA 1W1MA 2VFTA 5AE2A 5FXFA 3D2DA 3LAEA 2BVGA 4PYTA 5HHZA 1FO4A 3TX1A 2E3TA 2PLSA 2BVFA 2QPMA 1DZNA 2VFRA 4PVJA 2GQTA 2NQWA 1WYGA 3ETRB 1I19A 4PWCA 1MBBA 1N63C 2VAOA 3FW7A 1V97A 1W1QA 1VAOA 2MBRA 4JAYA 3S1EA 1ZXIC 4ML8A 4XLOA 4BC9A 2P13A 2W3RA 1MBTA 2EXRA 5D79A 5AE1A
chains in the Genus database with same CATH superfamily
2VFSA 2P3HA 3FW8A 1W1SA 3LLBA 4JB1A 2IPIA 1E8HA 1W1RA 3AM9A 1AHVA 3PQBA 1W1KA 2W54A 3D2JA 3AN1A 2W55A 3FW9A 3NVVB 5G5GB 3AMZA 2P4PA 3NVZB 2VFUA 4MLAA 5ADZA 1VDVA 4BC7A 1SB3B 4PWBA 3KJMA 1T3QC 3DQ0A 1JRPA 2QKNA 3PM9A 3EUB3 4OALA 5HMRA 2PLIA 4EC3A 1AHZA 1JROA 5FXEA 2UUVA 1W1JA 2Y4GA 2Q85A 5AE3A 1W1LA 1N62C 5FXDA 3NRZB 3JS8A 3TSHA 4DNSA 3RJAA 1E0YA 4PVKA 3POPA 5I1VA 4O95A 1DIQA 3W8ZA 2VFVA 1E8GA 4PVEA 3TSJA 3FWAA 3NVYB 4BBYA 2YVSA 2GQUA 1WVFA 2I0KA 3BW7A 1RM6B 3C0PA 3SR6B 2OAIA 4PZFA 1FFUC 2Q4WA 3D2HA 3S1DA 3RJ8A 1FIQB 1F0XA 1N5WC 3B9JB 2Y08A 2O3GA 1FFVC 1N61C 3I99A 3NVWB 4ZOHB 1QLTA 2R8DA 3HSUA 4BCAA 3VTEA 1AHUA 3DEDA 2UUUA 2W3SA 2R2ZA 1N60C 3HRDC 2BVHA 2Y3SA 2RK5A 1UXYA 1DIIA 5G5HB 3GSYA 1ZR6A 3NS1B 1W1OA 2AXRA 1QLUA 1WVEA 3S1FA 3W8XA 5FXPA 5HQXA 5AWVA 4PVHA 5I1WA 4UD8A 4HG0A 1HSKA 3EJBB 1E8FA 3S1CA 2Y3RA 1N5XA 3W8WA 1W1MA 2VFTA 5AE2A 5FXFA 3D2DA 3LAEA 2BVGA 4PYTA 5HHZA 1FO4A 3TX1A 2E3TA 2PLSA 2BVFA 2QPMA 3EJEB 1DZNA 2VFRA 4PVJA 5L6GA 2GQTA 2NQWA 5L6FA 1WYGA 3ETRB 1I19A 5K8EA 4PWCA 1MBBA 1N63C 2VAOA 3FW7A 1V97A 1W1QA 1VAOA 2MBRA 4JAYA 3S1EA 1ZXIC 4ML8A 4XLOA 4BC9A 2P13A 2WDWA 2W3RA 1MBTA 3EJDB 2EXRA 5D79A 5AE1A
chains in the Genus database with same CATH topology
2VFSA 2P3HA 3FW8A 1W1SA 3LLBA 4JB1A 2IPIA 1E8HA 1W1RA 3AM9A 1AHVA 3PQBA 1W1KA 2W54A 3D2JA 3AN1A 2W55A 3FW9A 3NVVB 5G5GB 3AMZA 2P4PA 3NVZB 2VFUA 4MLAA 5ADZA 1VDVA 4BC7A 1SB3B 4PWBA 3KJMA 1T3QC 3DQ0A 1JRPA 2QKNA 3PM9A 3EUB3 4OALA 5HMRA 2PLIA 4EC3A 1AHZA 1JROA 5FXEA 2UUVA 1W1JA 2Y4GA 2Q85A 5AE3A 1W1LA 1N62C 5FXDA 3NRZB 3JS8A 3TSHA 4DNSA 3RJAA 1E0YA 4PVKA 3POPA 5I1VA 4O95A 1DIQA 3W8ZA 2VFVA 1E8GA 4PVEA 3TSJA 3FWAA 4BBYA 3NVYB 2YVSA 2GQUA 1WVFA 2I0KA 3BW7A 1RM6B 3C0PA 3SR6B 2OAIA 4PZFA 1FFUC 2Q4WA 3D2HA 3S1DA 3RJ8A 1FIQB 1F0XA 1N5WC 3B9JB 2Y08A 2O3GA 1FFVC 1N61C 3I99A 3NVWB 4ZOHB 1QLTA 2R8DA 3HSUA 4BCAA 3VTEA 1AHUA 3DEDA 2UUUA 2W3SA 2R2ZA 1N60C 3HRDC 2BVHA 2Y3SA 2RK5A 1UXYA 1DIIA 5G5HB 3GSYA 1ZR6A 3NS1B 1W1OA 2AXRA 1QLUA 1WVEA 3S1FA 3W8XA 5FXPA 5HQXA 5AWVA 4PVHA 5I1WA 4UD8A 4HG0A 1HSKA 1E8FA 3S1CA 2Y3RA 1N5XA 3W8WA 1W1MA 2VFTA 5AE2A 5FXFA 3D2DA 3LAEA 2BVGA 4PYTA 5HHZA 1FO4A 3TX1A 2E3TA 2PLSA 2BVFA 2QPMA 1DZNA 2VFRA 4PVJA 5L6GA 2GQTA 2NQWA 5L6FA 1WYGA 3ETRB 1I19A 5K8EA 4PWCA 1MBBA 1N63C 2VAOA 3FW7A 1V97A 1W1QA 1VAOA 2MBRA 4JAYA 3S1EA 1ZXIC 4ML8A 4XLOA 4BC9A 2P13A 2WDWA 2W3RA 1MBTA 2EXRA 5D79A 5AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFS A;  2P3H A;  3FW8 A;  1W1S A;  3LLB A;  4JB1 A;  1E8H A;  1W1R A;  3AM9 A;  1AHV A;  1W1K A;  2W54 A;  3D2J A;  3AN1 A;  2W55 A;  3FW9 A;  3NVV B;  5G5G B;  3AMZ A;  2P4P A;  3NVZ B;  2VFU A;  4MLA A;  5ADZ A;  1VDV A;  4BC7 A;  1SB3 B;  4PWB A;  3KJM A;  1T3Q C;  3DQ0 A;  1JRP A;  2QKN A;  3PM9 A;  3EUB 3;  4OAL A;  5HMR A;  2PLI A;  4EC3 A;  1AHZ A;  1JRO A;  5FXE A;  1W1J A;  2Q85 A;  5AE3 A;  1W1L A;  1N62 C;  5FXD A;  3NRZ B;  3JS8 A;  3TSH A;  4DNS A;  1E0Y A;  4PVK A;  4O95 A;  1DIQ A;  3W8Z A;  2VFV A;  1E8G A;  4PVE A;  3TSJ A;  3FWA A;  4BBY A;  3NVY B;  2YVS A;  2GQU A;  1WVF A;  2I0K A;  3BW7 A;  1RM6 B;  3C0P A;  3SR6 B;  2OAI A;  4PZF A;  1FFU C;  2Q4W A;  3D2H A;  3S1D A;  1FIQ B;  1F0X A;  1N5W C;  3B9J B;  2O3G A;  1FFV C;  1N61 C;  3I99 A;  3NVW B;  4ZOH B;  1QLT A;  2R8D A;  4BCA A;  3VTE A;  1AHU A;  3DED A;  2W3S A;  2R2Z A;  1N60 C;  3HRD C;  2BVH A;  2RK5 A;  1UXY A;  1DII A;  5G5H B;  3GSY A;  1ZR6 A;  3NS1 B;  1W1O A;  2AXR A;  1QLU A;  1WVE A;  3S1F A;  3W8X A;  5FXP A;  5HQX A;  4PVH A;  4UD8 A;  4HG0 A;  1HSK A;  1E8F A;  3S1C A;  1N5X A;  3W8W A;  1W1M A;  2VFT A;  5AE2 A;  5FXF A;  3D2D A;  3LAE A;  2BVG A;  4PYT A;  5HHZ A;  1FO4 A;  3TX1 A;  2E3T A;  2PLS A;  2BVF A;  2QPM A;  1DZN A;  2VFR A;  4PVJ A;  2GQT A;  2NQW A;  1WYG A;  3ETR B;  1I19 A;  4PWC A;  1MBB A;  1N63 C;  2VAO A;  3FW7 A;  1V97 A;  1W1Q A;  1VAO A;  2MBR A;  4JAY A;  3S1E A;  1ZXI C;  4ML8 A;  4XLO A;  4BC9 A;  2P13 A;  2W3R A;  1MBT A;  2EXR A;  5D79 A;  5AE1 A; 
#chains in the Genus database with same CATH topology
 2VFS A;  2P3H A;  3FW8 A;  1W1S A;  3LLB A;  4JB1 A;  2IPI A;  1E8H A;  1W1R A;  3AM9 A;  1AHV A;  3PQB A;  1W1K A;  2W54 A;  3D2J A;  3AN1 A;  2W55 A;  3FW9 A;  3NVV B;  5G5G B;  3AMZ A;  2P4P A;  3NVZ B;  2VFU A;  4MLA A;  5ADZ A;  1VDV A;  4BC7 A;  1SB3 B;  4PWB A;  3KJM A;  1T3Q C;  3DQ0 A;  1JRP A;  2QKN A;  3PM9 A;  3EUB 3;  4OAL A;  5HMR A;  2PLI A;  4EC3 A;  1AHZ A;  1JRO A;  5FXE A;  2UUV A;  1W1J A;  2Y4G A;  2Q85 A;  5AE3 A;  1W1L A;  1N62 C;  5FXD A;  3NRZ B;  3JS8 A;  3TSH A;  4DNS A;  3RJA A;  1E0Y A;  4PVK A;  3POP A;  5I1V A;  4O95 A;  1DIQ A;  3W8Z A;  2VFV A;  1E8G A;  4PVE A;  3TSJ A;  3FWA A;  3NVY B;  4BBY A;  2YVS A;  2GQU A;  1WVF A;  2I0K A;  3BW7 A;  1RM6 B;  3C0P A;  3SR6 B;  2OAI A;  4PZF A;  1FFU C;  2Q4W A;  3D2H A;  3S1D A;  3RJ8 A;  1FIQ B;  1F0X A;  1N5W C;  3B9J B;  2Y08 A;  2O3G A;  1FFV C;  1N61 C;  3I99 A;  3NVW B;  4ZOH B;  1QLT A;  2R8D A;  3HSU A;  4BCA A;  3VTE A;  1AHU A;  3DED A;  2UUU A;  2W3S A;  2R2Z A;  1N60 C;  3HRD C;  2BVH A;  2Y3S A;  2RK5 A;  1UXY A;  1DII A;  5G5H B;  3GSY A;  1ZR6 A;  3NS1 B;  1W1O A;  2AXR A;  1QLU A;  1WVE A;  3S1F A;  3W8X A;  5FXP A;  5HQX A;  5AWV A;  4PVH A;  5I1W A;  4UD8 A;  4HG0 A;  1HSK A;  3EJB B;  1E8F A;  3S1C A;  2Y3R A;  1N5X A;  3W8W A;  1W1M A;  2VFT A;  5AE2 A;  5FXF A;  3D2D A;  3LAE A;  2BVG A;  4PYT A;  5HHZ A;  1FO4 A;  3TX1 A;  2E3T A;  2PLS A;  2BVF A;  2QPM A;  3EJE B;  1DZN A;  2VFR A;  4PVJ A;  5L6G A;  2GQT A;  2NQW A;  5L6F A;  1WYG A;  3ETR B;  1I19 A;  5K8E A;  4PWC A;  1MBB A;  1N63 C;  2VAO A;  3FW7 A;  1V97 A;  1W1Q A;  1VAO A;  2MBR A;  4JAY A;  3S1E A;  1ZXI C;  4ML8 A;  4XLO A;  4BC9 A;  2P13 A;  2WDW A;  2W3R A;  1MBT A;  3EJD B;  2EXR A;  5D79 A;  5AE1 A; 
#chains in the Genus database with same CATH homology
 2VFS A;  2P3H A;  3FW8 A;  1W1S A;  3LLB A;  4JB1 A;  2IPI A;  1E8H A;  1W1R A;  3AM9 A;  1AHV A;  3PQB A;  1W1K A;  2W54 A;  3D2J A;  3AN1 A;  2W55 A;  3FW9 A;  3NVV B;  5G5G B;  3AMZ A;  2P4P A;  3NVZ B;  2VFU A;  4MLA A;  5ADZ A;  1VDV A;  4BC7 A;  1SB3 B;  4PWB A;  3KJM A;  1T3Q C;  3DQ0 A;  1JRP A;  2QKN A;  3PM9 A;  3EUB 3;  4OAL A;  5HMR A;  2PLI A;  4EC3 A;  1AHZ A;  1JRO A;  5FXE A;  2UUV A;  1W1J A;  2Y4G A;  2Q85 A;  5AE3 A;  1W1L A;  1N62 C;  5FXD A;  3NRZ B;  3JS8 A;  3TSH A;  4DNS A;  3RJA A;  1E0Y A;  4PVK A;  3POP A;  5I1V A;  4O95 A;  1DIQ A;  3W8Z A;  2VFV A;  1E8G A;  4PVE A;  3TSJ A;  3FWA A;  4BBY A;  3NVY B;  2YVS A;  2GQU A;  1WVF A;  2I0K A;  3BW7 A;  1RM6 B;  3C0P A;  3SR6 B;  2OAI A;  4PZF A;  1FFU C;  2Q4W A;  3D2H A;  3S1D A;  3RJ8 A;  1FIQ B;  1F0X A;  1N5W C;  3B9J B;  2Y08 A;  2O3G A;  1FFV C;  1N61 C;  3I99 A;  3NVW B;  4ZOH B;  1QLT A;  2R8D A;  3HSU A;  4BCA A;  3VTE A;  1AHU A;  3DED A;  2UUU A;  2W3S A;  2R2Z A;  1N60 C;  3HRD C;  2BVH A;  2Y3S A;  2RK5 A;  1UXY A;  1DII A;  5G5H B;  3GSY A;  1ZR6 A;  3NS1 B;  1W1O A;  2AXR A;  1QLU A;  1WVE A;  3S1F A;  3W8X A;  5FXP A;  5HQX A;  5AWV A;  4PVH A;  5I1W A;  4UD8 A;  4HG0 A;  1HSK A;  1E8F A;  3S1C A;  2Y3R A;  1N5X A;  3W8W A;  1W1M A;  2VFT A;  5AE2 A;  5FXF A;  3D2D A;  3LAE A;  2BVG A;  4PYT A;  5HHZ A;  1FO4 A;  3TX1 A;  2E3T A;  2PLS A;  2BVF A;  2QPM A;  1DZN A;  2VFR A;  4PVJ A;  5L6G A;  2GQT A;  2NQW A;  5L6F A;  1WYG A;  3ETR B;  1I19 A;  5K8E A;  4PWC A;  1MBB A;  1N63 C;  2VAO A;  3FW7 A;  1V97 A;  1W1Q A;  1VAO A;  2MBR A;  4JAY A;  3S1E A;  1ZXI C;  4ML8 A;  4XLO A;  4BC9 A;  2P13 A;  2WDW A;  2W3R A;  1MBT A;  2EXR A;  5D79 A;  5AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...