2Y3SA

Structure of the tirandamycine-bound fad-dependent tirandamycin oxidase taml in c2 space group
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
497
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
molecule keywords TAML
total genus 167
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3sA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3sA02
3W8ZA 5I1VA 3D2DA 2WDWA 3RJ8A 3GSYA 4PVKA 4PVEA 4EC3A 2BVFA 1ZR6A 5D79A 2Y3RA 2Y08A 5K8EA 3W8WA 4DNSA 3FW7A 5AWVA 3POPA 3TSHA 3FW8A 3FW9A 3D2HA 4XLOA 2AXRA 3RJAA 5L6FA 3PQBA 2UUUA 3FWAA 4UD8A 5L6GA 4PWCA 3VTEA 2Y3SA 2BVHA 4PVJA 2Y4GA 2IPIA 3W8XA 4PZFA 4PWBA 4PVHA 5I1WA 3HSUA 2UUVA 3D2JA 3TSJA 2BVGA
chains in the Genus database with same CATH superfamily
1QLTA 2GQTA 1MBBA 1N61C 3I99A 3RJ8A 3NVWB 1N63C 4BCAA 4EC3A 1E8GA 1FFVC 5K8EA 3W8WA 2RK5A 5AWVA 2EXRA 3FW8A 3NVVB 1VAOA 3NVYB 3KJMA 2P13A 1DIQA 2QPMA 2NQWA 2BVHA 4PVJA 2VFTA 2IPIA 4PZFA 4JB1A 4HG0A 2W54A 2OAIA 3NS1B 4PVHA 5I1WA 4JAYA 1W1KA 3D2JA 2BVGA 1E8FA 3W8ZA 5I1VA 3D2DA 4PVEA 4PVKA 3BW7A 5D79A 5ADZA 1QLUA 2GQUA 1HSKA 2PLIA 3EUB3 3POPA 4MLAA 1JRPA 3FW9A 4XLOA 2P4PA 4PYTA 3RJAA 3PQBA 2YVSA 1WVEA 1F0XA 1DZNA 4PWCA 5L6GA 3AMZA 1AHUA 3S1DA 1VDVA 2Q85A 1V97A 5FXFA 4BBYA 3LLBA 1WYGA 2UUVA 5HQXA 1T3QC 5AE1A 3PM9A 3SR6B 3TSJA 3JS8A 3S1CA 2WDWA 5AE3A 1DIIA 5FXDA 5FXEA 2BVFA 4BC9A 2P3HA 1ZR6A 3AM9A 1E8HA 2Y08A 3S1FA 5HHZA 3NRZB 5FXPA 3TSHA 1W1MA 3S1EA 1SB3B 1FFUC 2Q4WA 3D2HA 2AXRA 5AE2A 5L6FA 2UUUA 3FWAA 5G5HB 1W1RA 3C0PA 4OALA 3TX1A 2Y3SA 4BC7A 1WVFA 2QKNA 2R8DA 3AN1A 4ML8A 4PWBA 1FIQB 2E3TA 1AHVA 3LAEA 1W1QA 1W1OA 2MBRA 4O95A 3ETRB 1JROA 1W1LA 3GSYA 1W1SA 1AHZA 3NVZB 1MBTA 2VFVA 3B9JB 2Y3RA 3DEDA 2I0KA 4DNSA 1RM6B 3FW7A 2R2ZA 1FO4A 1E0YA 1N5XA 2VFRA 5HMRA 2W3RA 4UD8A 2VAOA 3VTEA 1UXYA 1ZXIC 1I19A 4ZOHB 2W3SA 2Y4GA 5G5GB 3W8XA 2VFSA 3HRDC 1N5WC 3HSUA 1N62C 2O3GA 2W55A 1W1JA 3DQ0A 1N60C 2VFUA 2PLSA
chains in the Genus database with same CATH topology
1QLTA 2GQTA 1MBBA 1N61C 3I99A 3RJ8A 3NVWB 1N63C 4BCAA 4EC3A 1E8GA 1FFVC 5K8EA 3W8WA 2RK5A 5AWVA 2EXRA 3FW8A 3NVVB 1VAOA 3NVYB 3KJMA 2P13A 1DIQA 2QPMA 2NQWA 2BVHA 4PVJA 2VFTA 2IPIA 4PZFA 4JB1A 4HG0A 2W54A 2OAIA 3NS1B 4PVHA 5I1WA 4JAYA 1W1KA 3D2JA 2BVGA 1E8FA 3W8ZA 5I1VA 3D2DA 4PVEA 4PVKA 3BW7A 5D79A 5ADZA 1QLUA 2GQUA 1HSKA 2PLIA 3EUB3 3POPA 4MLAA 1JRPA 3FW9A 4XLOA 2P4PA 4PYTA 3RJAA 3PQBA 2YVSA 1WVEA 1F0XA 1DZNA 4PWCA 5L6GA 3AMZA 1AHUA 3S1DA 1VDVA 2Q85A 1V97A 5FXFA 4BBYA 3LLBA 1WYGA 2UUVA 5HQXA 1T3QC 5AE1A 3PM9A 3SR6B 3TSJA 3JS8A 3S1CA 2WDWA 5AE3A 1DIIA 5FXDA 5FXEA 2BVFA 4BC9A 2P3HA 1ZR6A 3AM9A 1E8HA 2Y08A 3S1FA 5HHZA 3NRZB 5FXPA 3TSHA 1W1MA 3S1EA 1SB3B 1FFUC 2Q4WA 3D2HA 2AXRA 5AE2A 5L6FA 2UUUA 3FWAA 5G5HB 1W1RA 3C0PA 4OALA 3TX1A 2Y3SA 4BC7A 1WVFA 2QKNA 2R8DA 3AN1A 4ML8A 4PWBA 1FIQB 2E3TA 1AHVA 3LAEA 1W1QA 1W1OA 2MBRA 4O95A 3ETRB 1JROA 1W1LA 3GSYA 1W1SA 1AHZA 3NVZB 1MBTA 2VFVA 3B9JB 2Y3RA 3DEDA 2I0KA 4DNSA 1RM6B 3FW7A 2R2ZA 1FO4A 1E0YA 1N5XA 2VFRA 5HMRA 2W3RA 4UD8A 2VAOA 3VTEA 1UXYA 1ZXIC 1I19A 4ZOHB 2W3SA 2Y4GA 5G5GB 3W8XA 2VFSA 3HRDC 1N5WC 3HSUA 1N62C 2O3GA 2W55A 1W1JA 3DQ0A 1N60C 2VFUA 2PLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8Z A;  5I1V A;  3D2D A;  2WDW A;  3RJ8 A;  3GSY A;  4PVK A;  4PVE A;  4EC3 A;  2BVF A;  1ZR6 A;  5D79 A;  2Y3R A;  2Y08 A;  5K8E A;  3W8W A;  4DNS A;  3FW7 A;  5AWV A;  3POP A;  3TSH A;  3FW8 A;  3FW9 A;  3D2H A;  4XLO A;  2AXR A;  3RJA A;  5L6F A;  3PQB A;  2UUU A;  3FWA A;  4UD8 A;  5L6G A;  4PWC A;  3VTE A;  2Y3S A;  2BVH A;  4PVJ A;  2Y4G A;  2IPI A;  3W8X A;  4PZF A;  4PWB A;  4PVH A;  5I1W A;  3HSU A;  2UUV A;  3D2J A;  3TSJ A;  2BVG A; 
#chains in the Genus database with same CATH topology
 1QLT A;  2GQT A;  1MBB A;  1N61 C;  3I99 A;  3RJ8 A;  3NVW B;  1N63 C;  4BCA A;  4EC3 A;  1E8G A;  1FFV C;  5K8E A;  3W8W A;  2RK5 A;  5AWV A;  2EXR A;  3FW8 A;  3NVV B;  1VAO A;  3NVY B;  3KJM A;  2P13 A;  1DIQ A;  2QPM A;  2NQW A;  2BVH A;  4PVJ A;  2VFT A;  2IPI A;  4PZF A;  4JB1 A;  4HG0 A;  2W54 A;  2OAI A;  3NS1 B;  4PVH A;  5I1W A;  4JAY A;  1W1K A;  3D2J A;  2BVG A;  1E8F A;  3W8Z A;  5I1V A;  3D2D A;  4PVE A;  4PVK A;  3BW7 A;  5D79 A;  5ADZ A;  1QLU A;  2GQU A;  1HSK A;  2PLI A;  3EUB 3;  3POP A;  4MLA A;  1JRP A;  3FW9 A;  4XLO A;  2P4P A;  4PYT A;  3RJA A;  3PQB A;  2YVS A;  1WVE A;  1F0X A;  1DZN A;  4PWC A;  5L6G A;  3AMZ A;  1AHU A;  3S1D A;  1VDV A;  2Q85 A;  1V97 A;  5FXF A;  4BBY A;  3LLB A;  1WYG A;  2UUV A;  5HQX A;  1T3Q C;  5AE1 A;  3PM9 A;  3SR6 B;  3TSJ A;  3JS8 A;  3S1C A;  2WDW A;  5AE3 A;  1DII A;  5FXD A;  5FXE A;  2BVF A;  4BC9 A;  2P3H A;  1ZR6 A;  3AM9 A;  1E8H A;  2Y08 A;  3S1F A;  5HHZ A;  3NRZ B;  5FXP A;  3TSH A;  1W1M A;  3S1E A;  1SB3 B;  1FFU C;  2Q4W A;  3D2H A;  2AXR A;  5AE2 A;  5L6F A;  2UUU A;  3FWA A;  5G5H B;  1W1R A;  3C0P A;  4OAL A;  3TX1 A;  2Y3S A;  4BC7 A;  1WVF A;  2QKN A;  2R8D A;  3AN1 A;  4ML8 A;  4PWB A;  1FIQ B;  2E3T A;  1AHV A;  3LAE A;  1W1Q A;  1W1O A;  2MBR A;  4O95 A;  3ETR B;  1JRO A;  1W1L A;  3GSY A;  1W1S A;  1AHZ A;  3NVZ B;  1MBT A;  2VFV A;  3B9J B;  2Y3R A;  3DED A;  2I0K A;  4DNS A;  1RM6 B;  3FW7 A;  2R2Z A;  1FO4 A;  1E0Y A;  1N5X A;  2VFR A;  5HMR A;  2W3R A;  4UD8 A;  2VAO A;  3VTE A;  1UXY A;  1ZXI C;  1I19 A;  4ZOH B;  2W3S A;  2Y4G A;  5G5G B;  3W8X A;  2VFS A;  3HRD C;  1N5W C;  3HSU A;  1N62 C;  2O3G A;  2W55 A;  1W1J A;  3DQ0 A;  1N60 C;  2VFU A;  2PLS A; 
#chains in the Genus database with same CATH homology
 1QLT A;  2GQT A;  1MBB A;  1N61 C;  3I99 A;  3RJ8 A;  3NVW B;  1N63 C;  4BCA A;  4EC3 A;  1E8G A;  1FFV C;  5K8E A;  3W8W A;  2RK5 A;  5AWV A;  2EXR A;  3FW8 A;  3NVV B;  1VAO A;  3NVY B;  3KJM A;  2P13 A;  1DIQ A;  2QPM A;  2NQW A;  2BVH A;  4PVJ A;  2VFT A;  2IPI A;  4PZF A;  4JB1 A;  4HG0 A;  2W54 A;  2OAI A;  3NS1 B;  4PVH A;  5I1W A;  4JAY A;  1W1K A;  3D2J A;  2BVG A;  1E8F A;  3W8Z A;  5I1V A;  3D2D A;  4PVE A;  4PVK A;  3BW7 A;  5D79 A;  5ADZ A;  1QLU A;  2GQU A;  1HSK A;  2PLI A;  3EUB 3;  3POP A;  4MLA A;  1JRP A;  3FW9 A;  4XLO A;  2P4P A;  4PYT A;  3RJA A;  3PQB A;  2YVS A;  1WVE A;  1F0X A;  1DZN A;  4PWC A;  5L6G A;  3AMZ A;  1AHU A;  3S1D A;  1VDV A;  2Q85 A;  1V97 A;  5FXF A;  4BBY A;  3LLB A;  1WYG A;  2UUV A;  5HQX A;  1T3Q C;  5AE1 A;  3PM9 A;  3SR6 B;  3TSJ A;  3JS8 A;  3S1C A;  2WDW A;  5AE3 A;  1DII A;  5FXD A;  5FXE A;  2BVF A;  4BC9 A;  2P3H A;  1ZR6 A;  3AM9 A;  1E8H A;  2Y08 A;  3S1F A;  5HHZ A;  3NRZ B;  5FXP A;  3TSH A;  1W1M A;  3S1E A;  1SB3 B;  1FFU C;  2Q4W A;  3D2H A;  2AXR A;  5AE2 A;  5L6F A;  2UUU A;  3FWA A;  5G5H B;  1W1R A;  3C0P A;  4OAL A;  3TX1 A;  2Y3S A;  4BC7 A;  1WVF A;  2QKN A;  2R8D A;  3AN1 A;  4ML8 A;  4PWB A;  1FIQ B;  2E3T A;  1AHV A;  3LAE A;  1W1Q A;  1W1O A;  2MBR A;  4O95 A;  3ETR B;  1JRO A;  1W1L A;  3GSY A;  1W1S A;  1AHZ A;  3NVZ B;  1MBT A;  2VFV A;  3B9J B;  2Y3R A;  3DED A;  2I0K A;  4DNS A;  1RM6 B;  3FW7 A;  2R2Z A;  1FO4 A;  1E0Y A;  1N5X A;  2VFR A;  5HMR A;  2W3R A;  4UD8 A;  2VAO A;  3VTE A;  1UXY A;  1ZXI C;  1I19 A;  4ZOH B;  2W3S A;  2Y4G A;  5G5G B;  3W8X A;  2VFS A;  3HRD C;  1N5W C;  3HSU A;  1N62 C;  2O3G A;  2W55 A;  1W1J A;  3DQ0 A;  1N60 C;  2VFU A;  2PLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...