2Y3SA

Structure of the tirandamycine-bound fad-dependent tirandamycin oxidase taml in c2 space group
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
497
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 167
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3sA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3sA02
5AWVA 1ZR6A 4UD8A 2UUUA 3POPA 4PVKA 4PWCA 2BVFA 4EC3A 4PVEA 4PZFA 3W8WA 2BVHA 3TSJA 3TSHA 2AXRA 3HSUA 3RJAA 4PWBA 5D79A 2Y4GA 5L6FA 3D2JA 2BVGA 3W8XA 5K8EA 5I1WA 5I1VA 2Y08A 3D2DA 3FW9A 3FW8A 3RJ8A 2Y3SA 2Y3RA 3FW7A 5L6GA 4PVJA 3D2HA 4DNSA 3GSYA 3PQBA 2UUVA 4XLOA 4PVHA 3W8ZA 3VTEA 2WDWA 2IPIA 3FWAA
chains in the Genus database with same CATH superfamily
1DZNA 2VFUA 4O95A 5FXEA 2OAIA 1N61C 4PWCA 4BBYA 1N62C 2BVHA 5AE3A 1SB3B 4JAYA 2R2ZA 1WVFA 5K8EA 3DEDA 5I1VA 4ZOHB 3D2DA 5FXDA 3FW8A 3ETRB 1RM6B 5FXPA 4BC7A 3FW7A 2RK5A 1MBTA 3LAEA 1W1KA 3PQBA 2W55A 2QPMA 2BVFA 3AN1A 3NVYB 4JB1A 3NS1B 3S1CA 1AHVA 4BC9A 2YVSA 2GQUA 2UUUA 3NVWB 1FFVC 3BW7A 4PVKA 1W1MA 4PZFA 4OALA 1F0XA 2NQWA 3TSJA 4MLAA 3HSUA 1W1SA 2BVGA 3AM9A 3AMZA 4PYTA 2P4PA 5AE2A 1QLTA 2E3TA 3TX1A 2O3GA 4HG0A 5HQXA 3D2HA 5HMRA 3GSYA 2R8DA 4PVHA 3W8ZA 2WDWA 1WVEA 1VAOA 3FW9A 1JRPA 3I99A 3PM9A 1ZXIC 1N5XA 5AWVA 1W1QA 2MBRA 2VAOA 4EC3A 4PVEA 2VFTA 2W3SA 2VFVA 5G5HB 2W3RA 2AXRA 3B9JB 2Q4WA 1QLUA 5D79A 3D2JA 1E8GA 2P13A 1N5WC 2Y08A 2QKNA 2GQTA 2Q85A 1DIIA 3RJ8A 1I19A 2Y3SA 1E8FA 2EXRA 2Y3RA 4PVJA 5AE1A 1T3QC 2W54A 1HSKA 2P3HA 5ADZA 3KJMA 1W1RA 1W1OA 1N63C 2IPIA 3VTEA 2VFSA 3C0PA 1UXYA 1ZR6A 3S1EA 3LLBA 4UD8A 3POPA 3S1FA 1FIQB 3NVZB 5FXFA 1MBBA 1W1JA 1E0YA 1JROA 1AHZA 2PLIA 3NRZB 1N60C 3W8WA 3TSHA 1V97A 4PWBA 3RJAA 2Y4GA 1FFUC 5L6FA 3W8XA 3NVVB 5I1WA 3DQ0A 1DIQA 3EUB3 1WYGA 3JS8A 3SR6B 1AHUA 1W1LA 1FO4A 1E8HA 5G5GB 3S1DA 4BCAA 4DNSA 5HHZA 4ML8A 2I0KA 2PLSA 5L6GA 2UUVA 3HRDC 4XLOA 2VFRA 3FWAA 1VDVA
chains in the Genus database with same CATH topology
1DZNA 2VFUA 4O95A 5FXEA 2OAIA 1N61C 4PWCA 4BBYA 1N62C 2BVHA 5AE3A 1SB3B 4JAYA 2R2ZA 1WVFA 5K8EA 3DEDA 5I1VA 4ZOHB 3D2DA 5FXDA 3FW8A 3ETRB 1RM6B 5FXPA 4BC7A 3FW7A 2RK5A 1MBTA 3LAEA 1W1KA 3PQBA 2W55A 2QPMA 2BVFA 3AN1A 3NVYB 4JB1A 3NS1B 3S1CA 1AHVA 4BC9A 2YVSA 2GQUA 2UUUA 3NVWB 1FFVC 3BW7A 4PVKA 1W1MA 4PZFA 4OALA 1F0XA 2NQWA 3TSJA 4MLAA 3HSUA 1W1SA 2BVGA 3AM9A 3AMZA 4PYTA 2P4PA 5AE2A 1QLTA 2E3TA 3TX1A 2O3GA 4HG0A 5HQXA 3D2HA 5HMRA 3GSYA 2R8DA 4PVHA 3W8ZA 2WDWA 1WVEA 1VAOA 3FW9A 1JRPA 3I99A 3PM9A 1ZXIC 1N5XA 5AWVA 1W1QA 2MBRA 2VAOA 4EC3A 4PVEA 2VFTA 2W3SA 2VFVA 5G5HB 2W3RA 2AXRA 3B9JB 2Q4WA 1QLUA 5D79A 3D2JA 1E8GA 2P13A 1N5WC 2Y08A 2QKNA 2GQTA 2Q85A 1DIIA 3RJ8A 1I19A 2Y3SA 1E8FA 2EXRA 2Y3RA 4PVJA 5AE1A 1T3QC 2W54A 1HSKA 2P3HA 5ADZA 3KJMA 1W1RA 1W1OA 1N63C 2IPIA 3VTEA 2VFSA 3C0PA 1UXYA 1ZR6A 3S1EA 3LLBA 4UD8A 3POPA 3S1FA 1FIQB 3NVZB 5FXFA 1MBBA 1W1JA 1E0YA 1JROA 1AHZA 2PLIA 3NRZB 1N60C 3W8WA 3TSHA 1V97A 4PWBA 3RJAA 2Y4GA 1FFUC 5L6FA 3W8XA 3NVVB 5I1WA 3DQ0A 1DIQA 3EUB3 1WYGA 3JS8A 3SR6B 1AHUA 1W1LA 1FO4A 1E8HA 5G5GB 3S1DA 4BCAA 4DNSA 5HHZA 4ML8A 2I0KA 2PLSA 5L6GA 2UUVA 3HRDC 4XLOA 2VFRA 3FWAA 1VDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AWV A;  1ZR6 A;  4UD8 A;  2UUU A;  3POP A;  4PVK A;  4PWC A;  2BVF A;  4EC3 A;  4PVE A;  4PZF A;  3W8W A;  2BVH A;  3TSJ A;  3TSH A;  2AXR A;  3HSU A;  3RJA A;  4PWB A;  5D79 A;  2Y4G A;  5L6F A;  3D2J A;  2BVG A;  3W8X A;  5K8E A;  5I1W A;  5I1V A;  2Y08 A;  3D2D A;  3FW9 A;  3FW8 A;  3RJ8 A;  2Y3S A;  2Y3R A;  3FW7 A;  5L6G A;  4PVJ A;  3D2H A;  4DNS A;  3GSY A;  3PQB A;  2UUV A;  4XLO A;  4PVH A;  3W8Z A;  3VTE A;  2WDW A;  2IPI A;  3FWA A; 
#chains in the Genus database with same CATH topology
 1DZN A;  2VFU A;  4O95 A;  5FXE A;  2OAI A;  1N61 C;  4PWC A;  4BBY A;  1N62 C;  2BVH A;  5AE3 A;  1SB3 B;  4JAY A;  2R2Z A;  1WVF A;  5K8E A;  3DED A;  5I1V A;  4ZOH B;  3D2D A;  5FXD A;  3FW8 A;  3ETR B;  1RM6 B;  5FXP A;  4BC7 A;  3FW7 A;  2RK5 A;  1MBT A;  3LAE A;  1W1K A;  3PQB A;  2W55 A;  2QPM A;  2BVF A;  3AN1 A;  3NVY B;  4JB1 A;  3NS1 B;  3S1C A;  1AHV A;  4BC9 A;  2YVS A;  2GQU A;  2UUU A;  3NVW B;  1FFV C;  3BW7 A;  4PVK A;  1W1M A;  4PZF A;  4OAL A;  1F0X A;  2NQW A;  3TSJ A;  4MLA A;  3HSU A;  1W1S A;  2BVG A;  3AM9 A;  3AMZ A;  4PYT A;  2P4P A;  5AE2 A;  1QLT A;  2E3T A;  3TX1 A;  2O3G A;  4HG0 A;  5HQX A;  3D2H A;  5HMR A;  3GSY A;  2R8D A;  4PVH A;  3W8Z A;  2WDW A;  1WVE A;  1VAO A;  3FW9 A;  1JRP A;  3I99 A;  3PM9 A;  1ZXI C;  1N5X A;  5AWV A;  1W1Q A;  2MBR A;  2VAO A;  4EC3 A;  4PVE A;  2VFT A;  2W3S A;  2VFV A;  5G5H B;  2W3R A;  2AXR A;  3B9J B;  2Q4W A;  1QLU A;  5D79 A;  3D2J A;  1E8G A;  2P13 A;  1N5W C;  2Y08 A;  2QKN A;  2GQT A;  2Q85 A;  1DII A;  3RJ8 A;  1I19 A;  2Y3S A;  1E8F A;  2EXR A;  2Y3R A;  4PVJ A;  5AE1 A;  1T3Q C;  2W54 A;  1HSK A;  2P3H A;  5ADZ A;  3KJM A;  1W1R A;  1W1O A;  1N63 C;  2IPI A;  3VTE A;  2VFS A;  3C0P A;  1UXY A;  1ZR6 A;  3S1E A;  3LLB A;  4UD8 A;  3POP A;  3S1F A;  1FIQ B;  3NVZ B;  5FXF A;  1MBB A;  1W1J A;  1E0Y A;  1JRO A;  1AHZ A;  2PLI A;  3NRZ B;  1N60 C;  3W8W A;  3TSH A;  1V97 A;  4PWB A;  3RJA A;  2Y4G A;  1FFU C;  5L6F A;  3W8X A;  3NVV B;  5I1W A;  3DQ0 A;  1DIQ A;  3EUB 3;  1WYG A;  3JS8 A;  3SR6 B;  1AHU A;  1W1L A;  1FO4 A;  1E8H A;  5G5G B;  3S1D A;  4BCA A;  4DNS A;  5HHZ A;  4ML8 A;  2I0K A;  2PLS A;  5L6G A;  2UUV A;  3HRD C;  4XLO A;  2VFR A;  3FWA A;  1VDV A; 
#chains in the Genus database with same CATH homology
 1DZN A;  2VFU A;  4O95 A;  5FXE A;  2OAI A;  1N61 C;  4PWC A;  4BBY A;  1N62 C;  2BVH A;  5AE3 A;  1SB3 B;  4JAY A;  2R2Z A;  1WVF A;  5K8E A;  3DED A;  5I1V A;  4ZOH B;  3D2D A;  5FXD A;  3FW8 A;  3ETR B;  1RM6 B;  5FXP A;  4BC7 A;  3FW7 A;  2RK5 A;  1MBT A;  3LAE A;  1W1K A;  3PQB A;  2W55 A;  2QPM A;  2BVF A;  3AN1 A;  3NVY B;  4JB1 A;  3NS1 B;  3S1C A;  1AHV A;  4BC9 A;  2YVS A;  2GQU A;  2UUU A;  3NVW B;  1FFV C;  3BW7 A;  4PVK A;  1W1M A;  4PZF A;  4OAL A;  1F0X A;  2NQW A;  3TSJ A;  4MLA A;  3HSU A;  1W1S A;  2BVG A;  3AM9 A;  3AMZ A;  4PYT A;  2P4P A;  5AE2 A;  1QLT A;  2E3T A;  3TX1 A;  2O3G A;  4HG0 A;  5HQX A;  3D2H A;  5HMR A;  3GSY A;  2R8D A;  4PVH A;  3W8Z A;  2WDW A;  1WVE A;  1VAO A;  3FW9 A;  1JRP A;  3I99 A;  3PM9 A;  1ZXI C;  1N5X A;  5AWV A;  1W1Q A;  2MBR A;  2VAO A;  4EC3 A;  4PVE A;  2VFT A;  2W3S A;  2VFV A;  5G5H B;  2W3R A;  2AXR A;  3B9J B;  2Q4W A;  1QLU A;  5D79 A;  3D2J A;  1E8G A;  2P13 A;  1N5W C;  2Y08 A;  2QKN A;  2GQT A;  2Q85 A;  1DII A;  3RJ8 A;  1I19 A;  2Y3S A;  1E8F A;  2EXR A;  2Y3R A;  4PVJ A;  5AE1 A;  1T3Q C;  2W54 A;  1HSK A;  2P3H A;  5ADZ A;  3KJM A;  1W1R A;  1W1O A;  1N63 C;  2IPI A;  3VTE A;  2VFS A;  3C0P A;  1UXY A;  1ZR6 A;  3S1E A;  3LLB A;  4UD8 A;  3POP A;  3S1F A;  1FIQ B;  3NVZ B;  5FXF A;  1MBB A;  1W1J A;  1E0Y A;  1JRO A;  1AHZ A;  2PLI A;  3NRZ B;  1N60 C;  3W8W A;  3TSH A;  1V97 A;  4PWB A;  3RJA A;  2Y4G A;  1FFU C;  5L6F A;  3W8X A;  3NVV B;  5I1W A;  3DQ0 A;  1DIQ A;  3EUB 3;  1WYG A;  3JS8 A;  3SR6 B;  1AHU A;  1W1L A;  1FO4 A;  1E8H A;  5G5G B;  3S1D A;  4BCA A;  4DNS A;  5HHZ A;  4ML8 A;  2I0K A;  2PLS A;  5L6G A;  2UUV A;  3HRD C;  4XLO A;  2VFR A;  3FWA A;  1VDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...