2Y3SA

Structure of the tirandamycine-bound fad-dependent tirandamycin oxidase taml in c2 space group
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
497
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 167
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3sA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3sA02
5D79A 4PWBA 3D2HA 2BVGA 4EC3A 4DNSA 3FW8A 5L6FA 3D2DA 2UUVA 3HSUA 2Y3SA 5K8EA 3FW9A 4PVJA 3TSHA 2BVFA 4UD8A 4PVHA 3RJ8A 4PZFA 3W8WA 3FW7A 1ZR6A 3FWAA 3GSYA 4PVEA 3POPA 3W8XA 5AWVA 2IPIA 2BVHA 4PVKA 2Y4GA 2Y3RA 2AXRA 2Y08A 3W8ZA 4PWCA 3TSJA 2UUUA 3RJAA 5I1WA 3D2JA 5I1VA 5L6GA 4XLOA 2WDWA 3VTEA 3PQBA
chains in the Genus database with same CATH superfamily
5D79A 2BVGA 4DNSA 1UXYA 2VFSA 4HG0A 3KJMA 4ML8A 2YVSA 3TSHA 2BVFA 1FIQB 1ZXIC 1I19A 1E8GA 1ZR6A 3FWAA 1SB3B 2VFVA 5FXEA 1T3QC 2NQWA 2BVHA 2W3RA 3S1EA 1N60C 1FFVC 2I0KA 2E3TA 3NVYB 2R8DA 2EXRA 2Y4GA 4BC9A 3W8ZA 1N62C 2Q4WA 1MBBA 1W1SA 3HRDC 4MLAA 5L6GA 3TX1A 1HSKA 1N61C 3AMZA 3I99A 5G5GB 5ADZA 2PLSA 3DEDA 3EUB3 3JS8A 5L6FA 1WVEA 1VAOA 2OAIA 5AE3A 3RJ8A 2VFRA 2W3SA 3GSYA 5G5HB 3W8XA 5FXFA 4BCAA 1JROA 5AE2A 3LAEA 2W55A 4JB1A 1V97A 5FXDA 4PYTA 4OALA 3DQ0A 4BBYA 3ETRB 1W1KA 3S1FA 2WDWA 2GQUA 4UD8A 3NVZB 2PLIA 1AHVA 4PWBA 1QLTA 3D2DA 2W54A 3AM9A 2UUVA 4BC7A 4PVHA 3W8WA 2O3GA 2QKNA 1FFUC 2R2ZA 1N63C 1AHZA 1N5WC 3POPA 1QLUA 1N5XA 5HMRA 2VAOA 2IPIA 2GQTA 5HQXA 1E0YA 2Q85A 2MBRA 1W1QA 3NVWB 2P3HA 4PVKA 1DIQA 1AHUA 4PWCA 3BW7A 3PM9A 3RJAA 3TSJA 3D2JA 3B9JB 5I1VA 1RM6B 3NVVB 2QPMA 3D2HA 4EC3A 2VFUA 3AN1A 3FW8A 3NRZB 3C0PA 1W1MA 1WYGA 2Y3SA 1MBTA 3HSUA 4O95A 3FW9A 4PVJA 5K8EA 1FO4A 1W1OA 4PZFA 2RK5A 3FW7A 4PVEA 1WVFA 1W1JA 1W1RA 3S1DA 1DIIA 5AWVA 2VFTA 5AE1A 3S1CA 3LLBA 4JAYA 5FXPA 3NS1B 2Y3RA 1W1LA 2AXRA 2P4PA 1E8HA 2Y08A 5HHZA 4ZOHB 1F0XA 2UUUA 3SR6B 2P13A 5I1WA 1JRPA 1VDVA 1E8FA 4XLOA 3VTEA 1DZNA 3PQBA
chains in the Genus database with same CATH topology
5D79A 2BVGA 4DNSA 1UXYA 2VFSA 4HG0A 3KJMA 4ML8A 2YVSA 3TSHA 2BVFA 1FIQB 1ZXIC 1I19A 1E8GA 1ZR6A 3FWAA 1SB3B 2VFVA 5FXEA 1T3QC 2NQWA 2BVHA 2W3RA 3S1EA 1N60C 1FFVC 2I0KA 2E3TA 3NVYB 2R8DA 2EXRA 2Y4GA 4BC9A 3W8ZA 1N62C 2Q4WA 1MBBA 1W1SA 3HRDC 4MLAA 5L6GA 3TX1A 1HSKA 1N61C 3AMZA 3I99A 5G5GB 5ADZA 2PLSA 3DEDA 3EUB3 3JS8A 5L6FA 1WVEA 1VAOA 2OAIA 5AE3A 3RJ8A 2VFRA 2W3SA 3GSYA 5G5HB 3W8XA 5FXFA 4BCAA 1JROA 5AE2A 3LAEA 2W55A 4JB1A 1V97A 5FXDA 4PYTA 4OALA 3DQ0A 4BBYA 3ETRB 1W1KA 3S1FA 2WDWA 2GQUA 4UD8A 3NVZB 2PLIA 1AHVA 4PWBA 1QLTA 3D2DA 2W54A 3AM9A 2UUVA 4BC7A 4PVHA 3W8WA 2O3GA 2QKNA 1FFUC 2R2ZA 1N63C 1AHZA 1N5WC 3POPA 1QLUA 1N5XA 5HMRA 2VAOA 2IPIA 2GQTA 5HQXA 1E0YA 2Q85A 2MBRA 1W1QA 3NVWB 2P3HA 4PVKA 1DIQA 1AHUA 4PWCA 3BW7A 3PM9A 3RJAA 3TSJA 3D2JA 3B9JB 5I1VA 1RM6B 3NVVB 2QPMA 3D2HA 4EC3A 2VFUA 3AN1A 3FW8A 3NRZB 3C0PA 1W1MA 1WYGA 2Y3SA 1MBTA 3HSUA 4O95A 3FW9A 4PVJA 5K8EA 1FO4A 1W1OA 4PZFA 2RK5A 3FW7A 4PVEA 1WVFA 1W1JA 1W1RA 3S1DA 1DIIA 5AWVA 2VFTA 5AE1A 3S1CA 3LLBA 4JAYA 5FXPA 3NS1B 2Y3RA 1W1LA 2AXRA 2P4PA 1E8HA 2Y08A 5HHZA 4ZOHB 1F0XA 2UUUA 3SR6B 2P13A 5I1WA 1JRPA 1VDVA 1E8FA 4XLOA 3VTEA 1DZNA 3PQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D79 A;  4PWB A;  3D2H A;  2BVG A;  4EC3 A;  4DNS A;  3FW8 A;  5L6F A;  3D2D A;  2UUV A;  3HSU A;  2Y3S A;  5K8E A;  3FW9 A;  4PVJ A;  3TSH A;  2BVF A;  4UD8 A;  4PVH A;  3RJ8 A;  4PZF A;  3W8W A;  3FW7 A;  1ZR6 A;  3FWA A;  3GSY A;  4PVE A;  3POP A;  3W8X A;  5AWV A;  2IPI A;  2BVH A;  4PVK A;  2Y4G A;  2Y3R A;  2AXR A;  2Y08 A;  3W8Z A;  4PWC A;  3TSJ A;  2UUU A;  3RJA A;  5I1W A;  3D2J A;  5I1V A;  5L6G A;  4XLO A;  2WDW A;  3VTE A;  3PQB A; 
#chains in the Genus database with same CATH topology
 5D79 A;  2BVG A;  4DNS A;  1UXY A;  2VFS A;  4HG0 A;  3KJM A;  4ML8 A;  2YVS A;  3TSH A;  2BVF A;  1FIQ B;  1ZXI C;  1I19 A;  1E8G A;  1ZR6 A;  3FWA A;  1SB3 B;  2VFV A;  5FXE A;  1T3Q C;  2NQW A;  2BVH A;  2W3R A;  3S1E A;  1N60 C;  1FFV C;  2I0K A;  2E3T A;  3NVY B;  2R8D A;  2EXR A;  2Y4G A;  4BC9 A;  3W8Z A;  1N62 C;  2Q4W A;  1MBB A;  1W1S A;  3HRD C;  4MLA A;  5L6G A;  3TX1 A;  1HSK A;  1N61 C;  3AMZ A;  3I99 A;  5G5G B;  5ADZ A;  2PLS A;  3DED A;  3EUB 3;  3JS8 A;  5L6F A;  1WVE A;  1VAO A;  2OAI A;  5AE3 A;  3RJ8 A;  2VFR A;  2W3S A;  3GSY A;  5G5H B;  3W8X A;  5FXF A;  4BCA A;  1JRO A;  5AE2 A;  3LAE A;  2W55 A;  4JB1 A;  1V97 A;  5FXD A;  4PYT A;  4OAL A;  3DQ0 A;  4BBY A;  3ETR B;  1W1K A;  3S1F A;  2WDW A;  2GQU A;  4UD8 A;  3NVZ B;  2PLI A;  1AHV A;  4PWB A;  1QLT A;  3D2D A;  2W54 A;  3AM9 A;  2UUV A;  4BC7 A;  4PVH A;  3W8W A;  2O3G A;  2QKN A;  1FFU C;  2R2Z A;  1N63 C;  1AHZ A;  1N5W C;  3POP A;  1QLU A;  1N5X A;  5HMR A;  2VAO A;  2IPI A;  2GQT A;  5HQX A;  1E0Y A;  2Q85 A;  2MBR A;  1W1Q A;  3NVW B;  2P3H A;  4PVK A;  1DIQ A;  1AHU A;  4PWC A;  3BW7 A;  3PM9 A;  3RJA A;  3TSJ A;  3D2J A;  3B9J B;  5I1V A;  1RM6 B;  3NVV B;  2QPM A;  3D2H A;  4EC3 A;  2VFU A;  3AN1 A;  3FW8 A;  3NRZ B;  3C0P A;  1W1M A;  1WYG A;  2Y3S A;  1MBT A;  3HSU A;  4O95 A;  3FW9 A;  4PVJ A;  5K8E A;  1FO4 A;  1W1O A;  4PZF A;  2RK5 A;  3FW7 A;  4PVE A;  1WVF A;  1W1J A;  1W1R A;  3S1D A;  1DII A;  5AWV A;  2VFT A;  5AE1 A;  3S1C A;  3LLB A;  4JAY A;  5FXP A;  3NS1 B;  2Y3R A;  1W1L A;  2AXR A;  2P4P A;  1E8H A;  2Y08 A;  5HHZ A;  4ZOH B;  1F0X A;  2UUU A;  3SR6 B;  2P13 A;  5I1W A;  1JRP A;  1VDV A;  1E8F A;  4XLO A;  3VTE A;  1DZN A;  3PQB A; 
#chains in the Genus database with same CATH homology
 5D79 A;  2BVG A;  4DNS A;  1UXY A;  2VFS A;  4HG0 A;  3KJM A;  4ML8 A;  2YVS A;  3TSH A;  2BVF A;  1FIQ B;  1ZXI C;  1I19 A;  1E8G A;  1ZR6 A;  3FWA A;  1SB3 B;  2VFV A;  5FXE A;  1T3Q C;  2NQW A;  2BVH A;  2W3R A;  3S1E A;  1N60 C;  1FFV C;  2I0K A;  2E3T A;  3NVY B;  2R8D A;  2EXR A;  2Y4G A;  4BC9 A;  3W8Z A;  1N62 C;  2Q4W A;  1MBB A;  1W1S A;  3HRD C;  4MLA A;  5L6G A;  3TX1 A;  1HSK A;  1N61 C;  3AMZ A;  3I99 A;  5G5G B;  5ADZ A;  2PLS A;  3DED A;  3EUB 3;  3JS8 A;  5L6F A;  1WVE A;  1VAO A;  2OAI A;  5AE3 A;  3RJ8 A;  2VFR A;  2W3S A;  3GSY A;  5G5H B;  3W8X A;  5FXF A;  4BCA A;  1JRO A;  5AE2 A;  3LAE A;  2W55 A;  4JB1 A;  1V97 A;  5FXD A;  4PYT A;  4OAL A;  3DQ0 A;  4BBY A;  3ETR B;  1W1K A;  3S1F A;  2WDW A;  2GQU A;  4UD8 A;  3NVZ B;  2PLI A;  1AHV A;  4PWB A;  1QLT A;  3D2D A;  2W54 A;  3AM9 A;  2UUV A;  4BC7 A;  4PVH A;  3W8W A;  2O3G A;  2QKN A;  1FFU C;  2R2Z A;  1N63 C;  1AHZ A;  1N5W C;  3POP A;  1QLU A;  1N5X A;  5HMR A;  2VAO A;  2IPI A;  2GQT A;  5HQX A;  1E0Y A;  2Q85 A;  2MBR A;  1W1Q A;  3NVW B;  2P3H A;  4PVK A;  1DIQ A;  1AHU A;  4PWC A;  3BW7 A;  3PM9 A;  3RJA A;  3TSJ A;  3D2J A;  3B9J B;  5I1V A;  1RM6 B;  3NVV B;  2QPM A;  3D2H A;  4EC3 A;  2VFU A;  3AN1 A;  3FW8 A;  3NRZ B;  3C0P A;  1W1M A;  1WYG A;  2Y3S A;  1MBT A;  3HSU A;  4O95 A;  3FW9 A;  4PVJ A;  5K8E A;  1FO4 A;  1W1O A;  4PZF A;  2RK5 A;  3FW7 A;  4PVE A;  1WVF A;  1W1J A;  1W1R A;  3S1D A;  1DII A;  5AWV A;  2VFT A;  5AE1 A;  3S1C A;  3LLB A;  4JAY A;  5FXP A;  3NS1 B;  2Y3R A;  1W1L A;  2AXR A;  2P4P A;  1E8H A;  2Y08 A;  5HHZ A;  4ZOH B;  1F0X A;  2UUU A;  3SR6 B;  2P13 A;  5I1W A;  1JRP A;  1VDV A;  1E8F A;  4XLO A;  3VTE A;  1DZN A;  3PQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...