2Y3SA

Structure of the tirandamycine-bound fad-dependent tirandamycin oxidase taml in c2 space group
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
497
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
total genus 167
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3sA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3sA02
3HSUA 4PVJA 5I1VA 5AWVA 2IPIA 4PWCA 4XLOA 5K8EA 5L6GA 2Y4GA 5I1WA 4PVKA 2Y3SA 3D2JA 3W8WA 2Y08A 3D2DA 3FW7A 3TSHA 2AXRA 5L6FA 3TSJA 4PWBA 2BVGA 4PVHA 4PZFA 4UD8A 3POPA 2UUUA 3PQBA 2Y3RA 1ZR6A 3VTEA 2BVHA 3FW8A 3W8ZA 3D2HA 2WDWA 4EC3A 2BVFA 4DNSA 5D79A 3RJ8A 3W8XA 3FWAA 4PVEA 3FW9A 3RJAA 2UUVA 3GSYA
chains in the Genus database with same CATH superfamily
3HSUA 2Y4GA 5HQXA 5I1WA 1WYGA 3AM9A 1DZNA 3HRDC 3FW7A 1FFUC 2VFVA 1FO4A 4PWBA 4PZFA 2I0KA 2MBRA 3B9JB 4JB1A 3S1FA 3POPA 1JRPA 1DIQA 2UUUA 2E3TA 1ZR6A 1E0YA 2W3SA 2BVHA 2QPMA 5AE3A 1N5XA 2P13A 2WDWA 4EC3A 2BVFA 2VFRA 1QLUA 2VFUA 1W1OA 1W1KA 1E8FA 5AE1A 2RK5A 3FWAA 2P3HA 2R2ZA 3AMZA 2W55A 5G5HB 5FXEA 3W8ZA 3GSYA 3PM9A 4PVJA 2VFTA 4PWCA 2EXRA 2IPIA 5ADZA 4ZOHB 5AE2A 5FXPA 5L6GA 3AN1A 3EUB3 2O3GA 1MBTA 2Y3SA 3D2JA 2NQWA 3D2DA 3DQ0A 3TSHA 2AXRA 1N63C 5L6FA 4BC9A 4BCAA 4BBYA 3NVYB 3ETRB 3S1EA 3JS8A 3TX1A 2PLSA 5FXDA 2P4PA 3D2HA 4O95A 2VAOA 4JAYA 2Q85A 1I19A 3C0PA 4PVEA 1N60C 3LLBA 2UUVA 1T3QC 4XLOA 1HSKA 1WVFA 2R8DA 2W3RA 5K8EA 1FFVC 1JROA 3W8WA 1ZXIC 3S1DA 2GQTA 2Y08A 1AHUA 4OALA 2GQUA 3LAEA 1AHZA 3I99A 3BW7A 1W1LA 1E8HA 1FIQB 3VTEA 1F0XA 1RM6B 2Q4WA 3NVZB 3DEDA 2VFSA 5G5GB 5D79A 3KJMA 3W8XA 3S1CA 1W1RA 1SB3B 1W1JA 3NS1B 1E8GA 3FW9A 5HMRA 1VAOA 1W1MA 3RJAA 3SR6B 5I1VA 5AWVA 1VDVA 3NVWB 4BC7A 1W1SA 4PYTA 4PVKA 1N61C 3NRZB 1QLTA 4HG0A 1W1QA 1N62C 5FXFA 1N5WC 3TSJA 2QKNA 4PVHA 2BVGA 1UXYA 4UD8A 3PQBA 1V97A 5HHZA 2Y3RA 1WVEA 2PLIA 1MBBA 3FW8A 2YVSA 2OAIA 1DIIA 4DNSA 3NVVB 3RJ8A 4MLAA 4ML8A 2W54A 1AHVA
chains in the Genus database with same CATH topology
3HSUA 2Y4GA 5HQXA 5I1WA 1WYGA 3AM9A 1DZNA 3HRDC 3FW7A 1FFUC 2VFVA 1FO4A 4PWBA 4PZFA 2I0KA 2MBRA 3B9JB 4JB1A 3S1FA 3POPA 1JRPA 1DIQA 2UUUA 2E3TA 1ZR6A 1E0YA 2W3SA 2BVHA 2QPMA 5AE3A 1N5XA 2P13A 2WDWA 4EC3A 2BVFA 2VFRA 1QLUA 2VFUA 1W1OA 1W1KA 1E8FA 5AE1A 2RK5A 3FWAA 2P3HA 2R2ZA 3AMZA 2W55A 5G5HB 5FXEA 3W8ZA 3GSYA 3PM9A 4PVJA 2VFTA 4PWCA 2EXRA 2IPIA 5ADZA 4ZOHB 5AE2A 5FXPA 5L6GA 3AN1A 3EUB3 2O3GA 1MBTA 2Y3SA 3D2JA 2NQWA 3D2DA 3DQ0A 3TSHA 2AXRA 1N63C 5L6FA 4BC9A 4BCAA 4BBYA 3NVYB 3ETRB 3S1EA 3JS8A 3TX1A 2PLSA 5FXDA 2P4PA 3D2HA 4O95A 2VAOA 4JAYA 2Q85A 1I19A 3C0PA 4PVEA 1N60C 3LLBA 2UUVA 1T3QC 4XLOA 1HSKA 1WVFA 2R8DA 2W3RA 5K8EA 1FFVC 1JROA 3W8WA 1ZXIC 3S1DA 2GQTA 2Y08A 1AHUA 4OALA 2GQUA 3LAEA 1AHZA 3I99A 3BW7A 1W1LA 1E8HA 1FIQB 3VTEA 1F0XA 1RM6B 2Q4WA 3NVZB 3DEDA 2VFSA 5G5GB 5D79A 3KJMA 3W8XA 3S1CA 1W1RA 1SB3B 1W1JA 3NS1B 1E8GA 3FW9A 5HMRA 1VAOA 1W1MA 3RJAA 3SR6B 5I1VA 5AWVA 1VDVA 3NVWB 4BC7A 1W1SA 4PYTA 4PVKA 1N61C 3NRZB 1QLTA 4HG0A 1W1QA 1N62C 5FXFA 1N5WC 3TSJA 2QKNA 4PVHA 2BVGA 1UXYA 4UD8A 3PQBA 1V97A 5HHZA 2Y3RA 1WVEA 2PLIA 1MBBA 3FW8A 2YVSA 2OAIA 1DIIA 4DNSA 3NVVB 3RJ8A 4MLAA 4ML8A 2W54A 1AHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSU A;  4PVJ A;  5I1V A;  5AWV A;  2IPI A;  4PWC A;  4XLO A;  5K8E A;  5L6G A;  2Y4G A;  5I1W A;  4PVK A;  2Y3S A;  3D2J A;  3W8W A;  2Y08 A;  3D2D A;  3FW7 A;  3TSH A;  2AXR A;  5L6F A;  3TSJ A;  4PWB A;  2BVG A;  4PVH A;  4PZF A;  4UD8 A;  3POP A;  2UUU A;  3PQB A;  2Y3R A;  1ZR6 A;  3VTE A;  2BVH A;  3FW8 A;  3W8Z A;  3D2H A;  2WDW A;  4EC3 A;  2BVF A;  4DNS A;  5D79 A;  3RJ8 A;  3W8X A;  3FWA A;  4PVE A;  3FW9 A;  3RJA A;  2UUV A;  3GSY A; 
#chains in the Genus database with same CATH topology
 3HSU A;  2Y4G A;  5HQX A;  5I1W A;  1WYG A;  3AM9 A;  1DZN A;  3HRD C;  3FW7 A;  1FFU C;  2VFV A;  1FO4 A;  4PWB A;  4PZF A;  2I0K A;  2MBR A;  3B9J B;  4JB1 A;  3S1F A;  3POP A;  1JRP A;  1DIQ A;  2UUU A;  2E3T A;  1ZR6 A;  1E0Y A;  2W3S A;  2BVH A;  2QPM A;  5AE3 A;  1N5X A;  2P13 A;  2WDW A;  4EC3 A;  2BVF A;  2VFR A;  1QLU A;  2VFU A;  1W1O A;  1W1K A;  1E8F A;  5AE1 A;  2RK5 A;  3FWA A;  2P3H A;  2R2Z A;  3AMZ A;  2W55 A;  5G5H B;  5FXE A;  3W8Z A;  3GSY A;  3PM9 A;  4PVJ A;  2VFT A;  4PWC A;  2EXR A;  2IPI A;  5ADZ A;  4ZOH B;  5AE2 A;  5FXP A;  5L6G A;  3AN1 A;  3EUB 3;  2O3G A;  1MBT A;  2Y3S A;  3D2J A;  2NQW A;  3D2D A;  3DQ0 A;  3TSH A;  2AXR A;  1N63 C;  5L6F A;  4BC9 A;  4BCA A;  4BBY A;  3NVY B;  3ETR B;  3S1E A;  3JS8 A;  3TX1 A;  2PLS A;  5FXD A;  2P4P A;  3D2H A;  4O95 A;  2VAO A;  4JAY A;  2Q85 A;  1I19 A;  3C0P A;  4PVE A;  1N60 C;  3LLB A;  2UUV A;  1T3Q C;  4XLO A;  1HSK A;  1WVF A;  2R8D A;  2W3R A;  5K8E A;  1FFV C;  1JRO A;  3W8W A;  1ZXI C;  3S1D A;  2GQT A;  2Y08 A;  1AHU A;  4OAL A;  2GQU A;  3LAE A;  1AHZ A;  3I99 A;  3BW7 A;  1W1L A;  1E8H A;  1FIQ B;  3VTE A;  1F0X A;  1RM6 B;  2Q4W A;  3NVZ B;  3DED A;  2VFS A;  5G5G B;  5D79 A;  3KJM A;  3W8X A;  3S1C A;  1W1R A;  1SB3 B;  1W1J A;  3NS1 B;  1E8G A;  3FW9 A;  5HMR A;  1VAO A;  1W1M A;  3RJA A;  3SR6 B;  5I1V A;  5AWV A;  1VDV A;  3NVW B;  4BC7 A;  1W1S A;  4PYT A;  4PVK A;  1N61 C;  3NRZ B;  1QLT A;  4HG0 A;  1W1Q A;  1N62 C;  5FXF A;  1N5W C;  3TSJ A;  2QKN A;  4PVH A;  2BVG A;  1UXY A;  4UD8 A;  3PQB A;  1V97 A;  5HHZ A;  2Y3R A;  1WVE A;  2PLI A;  1MBB A;  3FW8 A;  2YVS A;  2OAI A;  1DII A;  4DNS A;  3NVV B;  3RJ8 A;  4MLA A;  4ML8 A;  2W54 A;  1AHV A; 
#chains in the Genus database with same CATH homology
 3HSU A;  2Y4G A;  5HQX A;  5I1W A;  1WYG A;  3AM9 A;  1DZN A;  3HRD C;  3FW7 A;  1FFU C;  2VFV A;  1FO4 A;  4PWB A;  4PZF A;  2I0K A;  2MBR A;  3B9J B;  4JB1 A;  3S1F A;  3POP A;  1JRP A;  1DIQ A;  2UUU A;  2E3T A;  1ZR6 A;  1E0Y A;  2W3S A;  2BVH A;  2QPM A;  5AE3 A;  1N5X A;  2P13 A;  2WDW A;  4EC3 A;  2BVF A;  2VFR A;  1QLU A;  2VFU A;  1W1O A;  1W1K A;  1E8F A;  5AE1 A;  2RK5 A;  3FWA A;  2P3H A;  2R2Z A;  3AMZ A;  2W55 A;  5G5H B;  5FXE A;  3W8Z A;  3GSY A;  3PM9 A;  4PVJ A;  2VFT A;  4PWC A;  2EXR A;  2IPI A;  5ADZ A;  4ZOH B;  5AE2 A;  5FXP A;  5L6G A;  3AN1 A;  3EUB 3;  2O3G A;  1MBT A;  2Y3S A;  3D2J A;  2NQW A;  3D2D A;  3DQ0 A;  3TSH A;  2AXR A;  1N63 C;  5L6F A;  4BC9 A;  4BCA A;  4BBY A;  3NVY B;  3ETR B;  3S1E A;  3JS8 A;  3TX1 A;  2PLS A;  5FXD A;  2P4P A;  3D2H A;  4O95 A;  2VAO A;  4JAY A;  2Q85 A;  1I19 A;  3C0P A;  4PVE A;  1N60 C;  3LLB A;  2UUV A;  1T3Q C;  4XLO A;  1HSK A;  1WVF A;  2R8D A;  2W3R A;  5K8E A;  1FFV C;  1JRO A;  3W8W A;  1ZXI C;  3S1D A;  2GQT A;  2Y08 A;  1AHU A;  4OAL A;  2GQU A;  3LAE A;  1AHZ A;  3I99 A;  3BW7 A;  1W1L A;  1E8H A;  1FIQ B;  3VTE A;  1F0X A;  1RM6 B;  2Q4W A;  3NVZ B;  3DED A;  2VFS A;  5G5G B;  5D79 A;  3KJM A;  3W8X A;  3S1C A;  1W1R A;  1SB3 B;  1W1J A;  3NS1 B;  1E8G A;  3FW9 A;  5HMR A;  1VAO A;  1W1M A;  3RJA A;  3SR6 B;  5I1V A;  5AWV A;  1VDV A;  3NVW B;  4BC7 A;  1W1S A;  4PYT A;  4PVK A;  1N61 C;  3NRZ B;  1QLT A;  4HG0 A;  1W1Q A;  1N62 C;  5FXF A;  1N5W C;  3TSJ A;  2QKN A;  4PVH A;  2BVG A;  1UXY A;  4UD8 A;  3PQB A;  1V97 A;  5HHZ A;  2Y3R A;  1WVE A;  2PLI A;  1MBB A;  3FW8 A;  2YVS A;  2OAI A;  1DII A;  4DNS A;  3NVV B;  3RJ8 A;  4MLA A;  4ML8 A;  2W54 A;  1AHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...