2Y3SA

Structure of the tirandamycine-bound fad-dependent tirandamycin oxidase taml in c2 space group
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
497
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
molecule keywords TAML
total genus 167
structure length 497
sequence length 497
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3sA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3sA02
4EC3A 5AWVA 3RJAA 4PWBA 3TSJA 4PZFA 3RJ8A 3POPA 3D2HA 5I1WA 3FWAA 3PQBA 3FW8A 3GSYA 2BVGA 4UD8A 3W8ZA 4DNSA 4PVHA 4XLOA 4PWCA 2IPIA 2Y4GA 2Y3SA 2UUVA 4PVJA 2UUUA 2Y08A 3HSUA 5I1VA 3D2JA 4PVKA 3W8WA 5K8EA 4PVEA 2BVHA 3W8XA 2WDWA 3TSHA 5L6GA 2AXRA 2BVFA 3VTEA 3D2DA 5D79A 5L6FA 3FW7A 2Y3RA 1ZR6A 3FW9A
chains in the Genus database with same CATH superfamily
3AMZA 3NVVB 4EC3A 2W54A 2O3GA 2P4PA 5HMRA 2YVSA 4BC7A 3FW8A 1JROA 3NVWB 1I19A 4XLOA 1N61C 2IPIA 4PWCA 2UUVA 4JAYA 1W1LA 2EXRA 1E8GA 3HSUA 1AHZA 1E8FA 2I0KA 3W8WA 4ZOHB 5AE2A 5HQXA 1WVEA 2BVHA 3W8XA 5L6GA 5FXEA 5AE1A 3B9JB 5AE3A 1MBTA 1W1JA 5FXDA 1W1KA 1N5XA 4O95A 1ZXIC 4PWBA 1QLTA 2VFVA 3TSJA 1T3QC 5FXFA 3POPA 1FFVC 3D2HA 3FWAA 3PQBA 1DIQA 2Y4GA 2Q4WA 2QPMA 1FO4A 4OALA 3LAEA 1WVFA 5I1VA 1W1OA 1WYGA 4PVKA 1N60C 3PM9A 2NQWA 4BCAA 4BC9A 2Q85A 2RK5A 5FXPA 3TSHA 2AXRA 1SB3B 3VTEA 5G5HB 2PLIA 1W1QA 3NRZB 2VFUA 3FW7A 3SR6B 2VFRA 3EUB3 2VFSA 1V97A 3KJMA 4JB1A 4PZFA 3S1DA 2W55A 1AHVA 3LLBA 3AN1A 3NS1B 4PYTA 3GSYA 1E0YA 2BVGA 3HRDC 3W8ZA 4MLAA 3TX1A 2P13A 1E8HA 2UUUA 2Y08A 2R8DA 1HSKA 2P3HA 5HHZA 1N63C 1FFUC 4HG0A 1UXYA 2PLSA 2MBRA 3DEDA 3S1CA 2QKNA 2W3RA 2E3TA 3AM9A 3JS8A 2R2ZA 1AHUA 1JRPA 1W1SA 1QLUA 2GQTA 3NVYB 5D79A 5L6FA 2BVFA 2Y3RA 1ZR6A 5G5GB 5ADZA 3FW9A 2OAIA 5AWVA 3RJAA 1N5WC 3RJ8A 5I1WA 1VDVA 4UD8A 1W1MA 1DIIA 1F0XA 4DNSA 4PVHA 2Y3SA 3S1FA 4PVJA 1W1RA 2GQUA 2VFTA 3D2JA 1N62C 5K8EA 4PVEA 2WDWA 1FIQB 1RM6B 3C0PA 2VAOA 1DZNA 1VAOA 3I99A 4BBYA 2W3SA 3BW7A 1MBBA 3DQ0A 3NVZB 4ML8A 3D2DA 3S1EA 3ETRB
chains in the Genus database with same CATH topology
3AMZA 3NVVB 4EC3A 2W54A 2O3GA 2P4PA 5HMRA 2YVSA 4BC7A 3FW8A 1JROA 3NVWB 1I19A 4XLOA 1N61C 2IPIA 4PWCA 2UUVA 4JAYA 1W1LA 2EXRA 1E8GA 3HSUA 1AHZA 1E8FA 2I0KA 3W8WA 4ZOHB 5AE2A 5HQXA 1WVEA 2BVHA 3W8XA 5L6GA 5FXEA 5AE1A 3B9JB 5AE3A 1MBTA 1W1JA 5FXDA 1W1KA 1N5XA 4O95A 1ZXIC 4PWBA 1QLTA 2VFVA 3TSJA 1T3QC 5FXFA 3POPA 1FFVC 3D2HA 3FWAA 3PQBA 1DIQA 2Y4GA 2Q4WA 2QPMA 1FO4A 4OALA 3LAEA 1WVFA 5I1VA 1W1OA 1WYGA 4PVKA 1N60C 3PM9A 2NQWA 4BCAA 4BC9A 2Q85A 2RK5A 5FXPA 3TSHA 2AXRA 1SB3B 3VTEA 5G5HB 2PLIA 1W1QA 3NRZB 2VFUA 3FW7A 3SR6B 2VFRA 3EUB3 2VFSA 1V97A 3KJMA 4JB1A 4PZFA 3S1DA 2W55A 1AHVA 3LLBA 3AN1A 3NS1B 4PYTA 3GSYA 1E0YA 2BVGA 3HRDC 3W8ZA 4MLAA 3TX1A 2P13A 1E8HA 2UUUA 2Y08A 2R8DA 1HSKA 2P3HA 5HHZA 1N63C 1FFUC 4HG0A 1UXYA 2PLSA 2MBRA 3DEDA 3S1CA 2QKNA 2W3RA 2E3TA 3AM9A 3JS8A 2R2ZA 1AHUA 1JRPA 1W1SA 1QLUA 2GQTA 3NVYB 5D79A 5L6FA 2BVFA 2Y3RA 1ZR6A 5G5GB 5ADZA 3FW9A 2OAIA 5AWVA 3RJAA 1N5WC 3RJ8A 5I1WA 1VDVA 4UD8A 1W1MA 1DIIA 1F0XA 4DNSA 4PVHA 2Y3SA 3S1FA 4PVJA 1W1RA 2GQUA 2VFTA 3D2JA 1N62C 5K8EA 4PVEA 2WDWA 1FIQB 1RM6B 3C0PA 2VAOA 1DZNA 1VAOA 3I99A 4BBYA 2W3SA 3BW7A 1MBBA 3DQ0A 3NVZB 4ML8A 3D2DA 3S1EA 3ETRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EC3 A;  5AWV A;  3RJA A;  4PWB A;  3TSJ A;  4PZF A;  3RJ8 A;  3POP A;  3D2H A;  5I1W A;  3FWA A;  3PQB A;  3FW8 A;  3GSY A;  2BVG A;  4UD8 A;  3W8Z A;  4DNS A;  4PVH A;  4XLO A;  4PWC A;  2IPI A;  2Y4G A;  2Y3S A;  2UUV A;  4PVJ A;  2UUU A;  2Y08 A;  3HSU A;  5I1V A;  3D2J A;  4PVK A;  3W8W A;  5K8E A;  4PVE A;  2BVH A;  3W8X A;  2WDW A;  3TSH A;  5L6G A;  2AXR A;  2BVF A;  3VTE A;  3D2D A;  5D79 A;  5L6F A;  3FW7 A;  2Y3R A;  1ZR6 A;  3FW9 A; 
#chains in the Genus database with same CATH topology
 3AMZ A;  3NVV B;  4EC3 A;  2W54 A;  2O3G A;  2P4P A;  5HMR A;  2YVS A;  4BC7 A;  3FW8 A;  1JRO A;  3NVW B;  1I19 A;  4XLO A;  1N61 C;  2IPI A;  4PWC A;  2UUV A;  4JAY A;  1W1L A;  2EXR A;  1E8G A;  3HSU A;  1AHZ A;  1E8F A;  2I0K A;  3W8W A;  4ZOH B;  5AE2 A;  5HQX A;  1WVE A;  2BVH A;  3W8X A;  5L6G A;  5FXE A;  5AE1 A;  3B9J B;  5AE3 A;  1MBT A;  1W1J A;  5FXD A;  1W1K A;  1N5X A;  4O95 A;  1ZXI C;  4PWB A;  1QLT A;  2VFV A;  3TSJ A;  1T3Q C;  5FXF A;  3POP A;  1FFV C;  3D2H A;  3FWA A;  3PQB A;  1DIQ A;  2Y4G A;  2Q4W A;  2QPM A;  1FO4 A;  4OAL A;  3LAE A;  1WVF A;  5I1V A;  1W1O A;  1WYG A;  4PVK A;  1N60 C;  3PM9 A;  2NQW A;  4BCA A;  4BC9 A;  2Q85 A;  2RK5 A;  5FXP A;  3TSH A;  2AXR A;  1SB3 B;  3VTE A;  5G5H B;  2PLI A;  1W1Q A;  3NRZ B;  2VFU A;  3FW7 A;  3SR6 B;  2VFR A;  3EUB 3;  2VFS A;  1V97 A;  3KJM A;  4JB1 A;  4PZF A;  3S1D A;  2W55 A;  1AHV A;  3LLB A;  3AN1 A;  3NS1 B;  4PYT A;  3GSY A;  1E0Y A;  2BVG A;  3HRD C;  3W8Z A;  4MLA A;  3TX1 A;  2P13 A;  1E8H A;  2UUU A;  2Y08 A;  2R8D A;  1HSK A;  2P3H A;  5HHZ A;  1N63 C;  1FFU C;  4HG0 A;  1UXY A;  2PLS A;  2MBR A;  3DED A;  3S1C A;  2QKN A;  2W3R A;  2E3T A;  3AM9 A;  3JS8 A;  2R2Z A;  1AHU A;  1JRP A;  1W1S A;  1QLU A;  2GQT A;  3NVY B;  5D79 A;  5L6F A;  2BVF A;  2Y3R A;  1ZR6 A;  5G5G B;  5ADZ A;  3FW9 A;  2OAI A;  5AWV A;  3RJA A;  1N5W C;  3RJ8 A;  5I1W A;  1VDV A;  4UD8 A;  1W1M A;  1DII A;  1F0X A;  4DNS A;  4PVH A;  2Y3S A;  3S1F A;  4PVJ A;  1W1R A;  2GQU A;  2VFT A;  3D2J A;  1N62 C;  5K8E A;  4PVE A;  2WDW A;  1FIQ B;  1RM6 B;  3C0P A;  2VAO A;  1DZN A;  1VAO A;  3I99 A;  4BBY A;  2W3S A;  3BW7 A;  1MBB A;  3DQ0 A;  3NVZ B;  4ML8 A;  3D2D A;  3S1E A;  3ETR B; 
#chains in the Genus database with same CATH homology
 3AMZ A;  3NVV B;  4EC3 A;  2W54 A;  2O3G A;  2P4P A;  5HMR A;  2YVS A;  4BC7 A;  3FW8 A;  1JRO A;  3NVW B;  1I19 A;  4XLO A;  1N61 C;  2IPI A;  4PWC A;  2UUV A;  4JAY A;  1W1L A;  2EXR A;  1E8G A;  3HSU A;  1AHZ A;  1E8F A;  2I0K A;  3W8W A;  4ZOH B;  5AE2 A;  5HQX A;  1WVE A;  2BVH A;  3W8X A;  5L6G A;  5FXE A;  5AE1 A;  3B9J B;  5AE3 A;  1MBT A;  1W1J A;  5FXD A;  1W1K A;  1N5X A;  4O95 A;  1ZXI C;  4PWB A;  1QLT A;  2VFV A;  3TSJ A;  1T3Q C;  5FXF A;  3POP A;  1FFV C;  3D2H A;  3FWA A;  3PQB A;  1DIQ A;  2Y4G A;  2Q4W A;  2QPM A;  1FO4 A;  4OAL A;  3LAE A;  1WVF A;  5I1V A;  1W1O A;  1WYG A;  4PVK A;  1N60 C;  3PM9 A;  2NQW A;  4BCA A;  4BC9 A;  2Q85 A;  2RK5 A;  5FXP A;  3TSH A;  2AXR A;  1SB3 B;  3VTE A;  5G5H B;  2PLI A;  1W1Q A;  3NRZ B;  2VFU A;  3FW7 A;  3SR6 B;  2VFR A;  3EUB 3;  2VFS A;  1V97 A;  3KJM A;  4JB1 A;  4PZF A;  3S1D A;  2W55 A;  1AHV A;  3LLB A;  3AN1 A;  3NS1 B;  4PYT A;  3GSY A;  1E0Y A;  2BVG A;  3HRD C;  3W8Z A;  4MLA A;  3TX1 A;  2P13 A;  1E8H A;  2UUU A;  2Y08 A;  2R8D A;  1HSK A;  2P3H A;  5HHZ A;  1N63 C;  1FFU C;  4HG0 A;  1UXY A;  2PLS A;  2MBR A;  3DED A;  3S1C A;  2QKN A;  2W3R A;  2E3T A;  3AM9 A;  3JS8 A;  2R2Z A;  1AHU A;  1JRP A;  1W1S A;  1QLU A;  2GQT A;  3NVY B;  5D79 A;  5L6F A;  2BVF A;  2Y3R A;  1ZR6 A;  5G5G B;  5ADZ A;  3FW9 A;  2OAI A;  5AWV A;  3RJA A;  1N5W C;  3RJ8 A;  5I1W A;  1VDV A;  4UD8 A;  1W1M A;  1DII A;  1F0X A;  4DNS A;  4PVH A;  2Y3S A;  3S1F A;  4PVJ A;  1W1R A;  2GQU A;  2VFT A;  3D2J A;  1N62 C;  5K8E A;  4PVE A;  2WDW A;  1FIQ B;  1RM6 B;  3C0P A;  2VAO A;  1DZN A;  1VAO A;  3I99 A;  4BBY A;  2W3S A;  3BW7 A;  1MBB A;  3DQ0 A;  3NVZ B;  4ML8 A;  3D2D A;  3S1E A;  3ETR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...