1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords xanthine dehydrogenase, chain A
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
1HSKA 2GQUA 2CJOA 3JS8A 2ACZB 2JX5A 1E7PB 2KAJA 2BVFA 1T3QC 1PFDA 3EUB3 5GXGB 3S1DA 2RK5A 1KF6B 2BT6A 3FC4A 5ADZA 2Q85A 1L0VB 3FAHA 1TKEA 2B76B 4XLOA 2BS3B 1RFKA 1DOXA 1AYFA 1V8CA 3ABVB 3S1FA 1UWMA 1XLOA 4O95A 1ZP0B 1J7AA 2GQTA 3DWGC 3CWIA 2OHFA 1QT9A 1MBBA 5H92C 2YVSA 5FXDA 2MH7A 4YSZB 4ZHOA 1NI3A 1XO3A 3ETRA 1RM6B 2PLIA 2M56B 1AWDA 4C7ZA 4PYTA 1JWAD 2WDQB 3LXFA 2WLBA 1I19A 2Q4WA 4FXCA 1GAQB 1I7HA 3NVWB 1DIIA 4YTNB 3AE2B 1N61A 4YXDB 2W55A 4WQMA 1ZXIC 4JWUC 1N61C 3AH7A 3TX1A 4USAA 1E0ZA 3AE7B 1FXAA 1FFVA 1L6UA 4LTUA 1CZPA 3NVZB 4TVWA 1N5XA 3AEAB 1MBTA 1QLBB 1NYRA 2L52A 4A9AA 1ZXIA 4BCAA 1SB3C 1FFUC 3A7RA 1R7SA 4HG0A 2WP9B 2BS2B 2E5AA 1J7BA 3ZYYX 3R07C 1NVID 1DZNA 3B9JB 1ZR6A 4ML8A 2MJ3A 2AXRA 5HQXA 1N62A 2K5PA 1JQ4A 5FXEA 3NVZA 2BS4B 1KRHA 1W1JA 3BIID 3HUIA 1QF6A 2PIAA 2PVOD 3AECB 1FFVC 1OQQA 1L6VA 2W3SA 3AE6B 1JROA 3VR8B 3S1CA 1JRPA 2PVGC 2MJEA 2W54A 3NVWA 1ZUD2 1FO4A 3L4PA 5H8YE 3DEDA 2K9XA 1TYGB 3S1EA 1F0ZA 2VFSA 3AMZA 1QOAA 3W5VB 2R8DA 1FIQA 4BBYA 1FRDA 1SB3B 1N60C 3W8ZA 4YSXB 4ITKA 2QJLA 2MBRA 5EE3A 2BVHA 1PUTA 1WWTA 4MLAA 4HRSA 2VFVA 4KX6B 4BC9A 1WVFA 5HHZA 1CJEA 2WDRB 1ROEA 2R2ZA 1AHVA 3VRBB 1ZOYB 3B2GA 2H89B 5G5HA 3AEGB 2G1EA 2AX5A 1W1SA 4ZOHC 2LEKA 4JX1C 1E9MA 3VR9B 4WWMA 5EE1A 1YJIA 2WU5B 2CU3A 1OFFA 3AN1A 1F0XA 1VAOA 1YJJA 2WQYB 3P63A 1DOIA 3PM9A 1N62C 5G5HB 1X2GA 1VDVA 1NEKB 3NVVB 3P1MA 1N63C 2PKOA 2P4PA 1SIJA 2DWQA 1E8HA 1A70A 1WVEA 3AV8A 3HRDD 5AE1A 3SR6A 3W8WA 2Q5WD 1AHZA 1W1QA 2I0KA 5FXPA 1E8GA 1TJEA 3W9CB 1QLTA 4JAYA 1VJKA 4US9A 3LLBA 5EE9A 4YTPB 1PDXA 1VLBA 3BW7A 4YSYB 1GPXA 5C3JB 2VFTA 3NS1A 3NVVA 1JWBD 3AEDB 2E3TA 1JALA 2EKIA 4OALA 1X2HA 4US8A 1AHUA 1DIQA 3CIRB 2PLSA 3P4RB 3W5UB 4JB1A 5G5GB 2KMMA 3B9JA 1XLPA 1B9RA 4C80A 1YQ4B 2EXRA 1FRRA 1QOBA 1W1RA 5FXFA 1FIQB 2VAOA 3AE4B 2OAIA 1JW9D 1NYQA 5AE3A 1N60A 4N59A 1QOGA 1FXIA 1OQRA 3AB5A 5AUIA 1N5WC 3PO0A 2MJDA 1T3QA 2VFUA 1WYGA 1DOYA 2DBYA 3SFEB 3W8XA 5HMRA 3C0PA 3LB8C 3P4PB 5G5GA 5C2TB 1V97A 3AEFB 2CJNA 2BVGA 1XLNA 1TKGA 3B2FA 2Y5CA 2P13A 1E6EB 3SR6B 1QOFA 4N58A 5EE0A 1UXYA 2FBWB 2WS3B 1WXQA 1RYJA 3NS1B 1FM0D 2P3HA 1SF0A 3ETRB 1XLQA 1IUEA 2O3GA 1E10A 1NENB 1DGJA 1E8FA 1FFUA 4ZOHB 2H88B 3AE1B 3RPFC 2QKNA 1E0YA 4C7YA 3NVYA 1TKYA 3HVZA 5AUKA 3NRZB 3KJMA 2JQRB 1VQZA 5AE2A 1RWSA 3AE8B 1EWYC 3NVYB 4ZHPA 3A7UA 1J7CA 3AE3B 1QLUA 3I99A 4BC7A 1W1KA 4JWSC 4HROA 2K22A 3VRAB 2W3RA 4YTMB 1L5PA 5MPOA 3P4SB 1WRIA 1RM6C 4IDIA 1W1MA 3AM9A 3NRZA 3AE9B 2NQWA 3KWLA 1N5WA 2QPMA 3DWMA 2VFRA 3AEBB 4N6EB 4YT0B 2N0SB 1W1OA 3A7AA 3WCQA 2L83A 4P6VF 3HRDC 1W1LA 3DQ0A 3P4QB 1YQ3B 3AEEB 1FMAD 3AE5B 2WDVB 3SFDB 1N63A 3EUB2 1KFYB 2M19A 1WGKA 3LAEA 2WU2B 4TVYA 2QIEB 2HTME
chains in the Genus database with same CATH superfamily
2XH4A 3SV4A 2OQYA 4LVSA 3JW0X 2CU1A 1T94A 1UHUA 2BYEA 2YMQA 2ACZB 5AK4A 2GGIA 3BWUD 4M2YA 3HSUA 3THVA 3I4KA 1JMSA 3T3NA 2L5YA 4EWJA 1ZQZA 3IJLA 5ALUA 2KTQA 1NI2A 2BT6A 2MX2A 2VANA 3QU9A 4WAAA 3MR2A 3PTFC 3TI0A 3DJGX 1C76A 3MKCA 3NJTA 3ZDTA 2LYBA 3MFIA 1ZQYA 2K4HA 2IBIB 2Y5PA 4AJWA 2ZJAA 3N4FA 3RGTA 2QB0B 3F5EA 1E90A 3HW2A 5JCIA 1MQ2A 2N7EA 2IY0B 3AU4A 2K8AA 2XH0A 5IIKA 5CR0A 3BQ2A 2Y3SA 1KFSA 5JZEB 2BB6A 2QDDA 3GO2A 3L5KA 1V5TA 2KK0A 3GV7B 2W9MA 3CF6E 2CR5A 1PK3A 4LJPB 1NU5A 4UBBA 4E4UA 1EBDA 4J56A 2KNJA 4Q2JA 1FEAA 5L1JA 4GU2A 4P1CC 1L2NA 1GRFA 3C5GA 3IG3A 4W9HA 2GQTA 1TE2A 4OJLA 2KWVB 1NOMA 5KL1B 3CWIA 2OWOA 4I2HA 3NZUA 1SWVA 2KWDA 3ZNID 1HTQA 5AM5A 3D2DA 5L1MA 2HDOA 3V6JA 4J3OD 4H4RA 5FMHA 4FX9A 2DAFA 5KFXA 3PR4A 1D8LA 2JRHA 4QZGA 2LI5A 1SJDA 2W04A 1XHCA 1SJED 1X40A 9ICEA 3W1YA 3IG8A 1ZQKA 2YVSA 3A9JA 1ZQQA 4EMJA 3RRHA 1PZNA 2X99A 2BQQA 3TTEA 1SL1A 3QU4A 1S1QB 2UVUA 2KLGA 2WX0A 3RRAA 2KN7A 2ODGA 2XY5A 2N9XA 5IA7A 3ZJTA 1TZOA 5L6FA 1Z2MA 5AICA 3UMBA 5J8YA 4XYCA 4IOIE 4LDTB 3U26A 2RABA 1EWCA 1KKOA 2NS5A 3UGVA 4A55A 1MA7A 3CRXA 1KFTA 5AI8A 4F1SA 2XGZA 3ZW3A 1JWAD 3NO1A 1C79A 2N9KA 4FXCA 5KFTA 4ZRKA 3TJ4A 4F3OA 1QZEA 4RQ4A 1JIHA 1B1ZA 1T0YA 4XUSA 3A9KA 3Q45A 5AKZA 4WWNA 3NVWB 2LZ6A 3CSFA 4RGOS 2RP5A 4BURA 2KICA 1SBBB 1V1PA 2PMZF 1Y8RC 4YXDB 2HW3A 1PQSA 2WOWA 2D3BA 4WQMA 2DNFA 3FW7A 4IQWA 4IG7B 1ZXIC 4M0WB 2V3AA 1BGXT 3EKGA 5AKIA 3AH7A 3OP2A 1ZQUA 2AKZA 2HDEA 4R64A 4ELVA 1WJUA 3UXLA 2Z0EB 2GGHA 4RPXA 2EZZA 1TK8A 5KT4A 3Q8PB 2E6XA 4ZRQA 1RYUA 1N5XA 3DCGA 3AXCA 3ECIA 5L95C 1Z19A 4NY8A 1I4PA 4DOBA 1LKYA 3TMPB 3PX4A 3I6TA 1C4AA 3PY8A 3PLUA 2AQ0A 2XSXA 4I6PA 4YWOA 3NRWA 4NJCA 1XF5L 4A9AA 3R1ZA 2AU0A 2FE9A 1MHXA 9ICFA 5ALZA 4Z6DA 3A7RA 4X5VA 2Z0DB 5KFEA 1VZ8A 2XY7A 3W1SC 1JPDX 3PWIA 4K2SA 3KYDD 4NM2A 4BKSA 1ZQTA 2JXXA 1QQRA 4M6WA 3KUMA 4EENA 1PUZA 2J0KA 3BYYB 4BZAA 2W0HA 3ZYYX 4FJZA 1NVID 2XIDA 2ONEA 1HE8A 3PS6A 2PU0A 1ZD3A 4UDUC 4O5CA 1EBHA 2MJ3A 5AWVA 1FNVA 4K3CA 1M4VA 1E8ZA 3LDAA 1VD2A 3BQTA 2LVPA 4F72A 1STEA 5DGAA 1F8WA 1AN8A 3NVZA 1BWCA 3SAHA 2LHTA 3QX7A 2R8IA 4O5EA 3PHXB 3GU3A 4JMUA 3JPPA 2AGPA 2Y3RA 4TUUA 2PVOD 3AECB 2JGAA 4QWCA 1HEKA 4CHKA 2EQ6A 2JWUA 1Q3VA 2KFKA 3PV8A 1OQQA 4WJPA 2IPIA 2KMCA 2W3SA 3VQIA 4MGKE 4O3OA 4QNLA 3PSEB 4MDKE 5KG6A 1I4QA 4TUPA 3EW9A 2LM1A 1GRGA 3NVWA 1WX9A 1ZUD2 3PG6A 1FO4A 3BQ0A 2K8CA 1SIFA 4GDLB 3RZWC 1EXNA 2ISPA 2PXIA 4HNCA 3DGZA 4RQ5A 1T0SC 1GXFA 5DQGA 5KFIA 3N28A 4LCDE 4RPZA 3S1EA 3H9DA 1GRAA 2GH1A 2MA1A 1SE3A 3PMNA 2NRVA 4MSMB 2ZTCA 3W5VB 4FI4A 4H4XA 4BBYA 2L00B 5IIOA 2YMPA 1E7VA 1XS9D 4XDCA 5D3DA 1DXSA 3H0MB 4RPYA 3CGDA 2ZJ5A 2UUUA 4ITKA 2A8XA 3TSJA 4MACA 4BDPA 5EE3A 8ICJA 2BVHA 2IYDB 2MUTB 5L1KA 3FW8A 3QEAZ 3SYZA 1JRUA 2KK8A 4NLCA 1N6ZA 2M8SA 2P8CA 2W11A 5IAAC 1JCTA 2F76X 4EC3A 3HK0A 1JXEA 4F4YA 1E8WA 2R2ZA 4Q8FA 3RT3B 2PLSA 5DG9A 3K4GA 3L8KA 1RDFA 3ISDA 3B2GA 2DQNB 2H89B 5EWFA 4EE2A 4O3MA 4TUQA 1XNSA 4C8MA 2G1EA 1A77A 4OJOA 2K8BB 2JZ3B 4H4UA 4QIWC 3G6YA 3QLDA 4JX1C 3NUQA 5ALVA 4PH5A 1E9MA 3VR9B 2CXYA 3UINB 3DGHA 4NEVA 1UUPA 4IS7A 4ZRJA 2IGGA 3T5LA 1RXVA 1PK1B 2LMCA 3MBYA 4QZIA 2WU5B 3Q6BA 2JR5A 4BOZB 2CU3A 3QX1A 4TMAB 3C0RB 5BYQA 1Z00A 2GL5A 2EZYA 1F0XA 1V59A 5KFPA 2DW7A 1XO0A 3OW1A 2GGJA 2YY6A 5C23A 2BYTA 5E79U 2BTEA 2CFYA 2BCRA 1J8CA 4NLBA 2QJMA 3ISBA 3DDMA 2NCNA 5L9XA 3TBLD 3PZDA 2BQUA 2WXJA 2FLNA 2GBJA 5FP0A 2NRZA 3SMVA 2AH5A 3PZPA 5I4DA 3U52E 3BVMA 4DHJB 4RM8A 1JOAA 4LNIA 2EANA 5J0SA 8ICVA 1BNOA 3GD3A 1RFAA 4GC7A 4C8OA 4F7ZA 4M04A 3EFCA 2LI6A 5KFWA 2OZTA 5J04A 4F4ZA 5T14A 2RR9A 3RFAA 2KOXA 2P35A 3UXPA 4DHZB 4KLHA 1IGCA 5DPWA 1ZKQA 2YMMA 4UAVA 2YVGA 3AV8A 3GZNB 3UQAA 4RM9A 7ICTA 3TEWA 1NJWA 3CGCA 5HR6A 2NQLA 1MVKA 2F5ZA 5DPRA 2Q5WD 1IYFA 3CP8A 1EU4A 3HT3A 1M6IA 3Q8SB 4OD0A 3MUCA 3H7IA 3I76A 4I29A 5LXIB 2JUOA 2EELA 3ZD8A 2G5IB 4AYBC 4ED3A 3M62B 1N56A 2HOQA 5IP4D 5J2AA 5EE9A 2V4QA 3RNEC 1EO6A 4I2BA 3ALBA 2XI9A 5KFGA 9ICVA 3APFA 1S10A 2D3DA 2ZIXA 3H4KA 3IRUA 4PVKA 4QZFA 1GSNA 2VFTA 2BKRB 4L2YA 4ACOA 3NS1A 1SJAA 3OZYA 3V5CA 2E8MA 3NVVA 3LVWA 1EC9A 3AEDB 4RNAA 2A19A 2OLAA 3DDCB 4FA6A 2EKIA 2ASQA 2IOFK 1RPLA 1KCZA 4KDIC 2ES6A 3T5HA 5KFAA 1HQRD 2R9ZA 5I1VA 1D3ZA 1XSPA 4DCCA 1ZQAA 3HM6X 5CHFA 2PTYA 1AHUA 2JT4B 1HJPA 3JPTA 1ZRMA 2RDIA 3CIRB 2RDXA 3OC4A 1C20A 5J0OA 1RZTA 1GG3A 3OWEB 3R11A 4W9FA 1Z00B 3ORYA 3QU7A 1XLPA 1WR6E 2ZW1A 5GTHU 2IZVB 4DS4A 4ZYSA 2WAQC 1GREA 1KBUA 3FG2P 3QCAA 1ZX9A 4REZA 2ZIXB 2AGOA 4C8KA 3HJEA 4LNKA 3EAOA 2GBKA 1ENFA 2EXRA 5DKWA 4HJGE 1QOBA 3DG6A 3PLVA 1RAXA 4A35A 5BOEA 8ICMA 3PSPA 2AQ3B 4YXJA 4OZAA 1NYQA 3VCBA 4O3QA 2OYYA 1D9FA 3MC1A 1YEYA 1GO3F 5E6OA 1FXIA 4I2CA 5J2FA 3Q8EA 3R0KA 4QWBA 2ZUBA 2XO7A 4ECRA 3MFHA 2C2EA 2V4LA 2N9PC 2G3QB 1CQVA 1UELA 2ZVOA 3PO0A 1T3QA 3MR6A 3BZKA 2ZUCA 3GIMA 4J9LA 3M6KA 2R61A 3VC5A 1WYGA 2PGWA 2HHVA 1JWMD 5ALOA 5KAFU 3RZFA 5J2KA 8ICZA 4ECWA 3CSTA 3P4PB 5G5GA 4E3CA 1SJCA 4FHKA 1XDIA 4F4WA 2VH2A 5B66U 1V97A 2BYVE 2INCC 1CRXA 3AEFB 2BVGA 3IBEA 2VA2A 3OPXA 1TAUA 3Q3JA 1ONEA 1HEZE 5BMHA 3MC8A 3TEZA 2F44A 2KJ6A 2FMSA 2V3SA 3FV9A 4OCZA 5ALNA 1WWVA 1WXVA 4KIKA 4BWJA 3GC2A 2JXTA 4N58A 3KOOA 1JI7A 2CHXA 9ICGA 4PHAA 4HKQA 4GDKB 3RNAC 2P3ZA 4HNLA 4X2PA 3KHHA 2UYZB 2NBUA 2AKMA 2GI9A 2N7JA 3UIPB 2PMQA 2ATLA 4H2AA 1GESA 2NVUI 5ALJA 2HHWA 5T8IA 3NS1B 1NJZA 3OJSA 4XE0A 4E74A 3U2SC 1SF0A 1TAMA 2W7PA 2LGSA 2K89A 1SE2A 3IHQB 2WX1A 3ZLHA 2MNRA 2H3VA 3B97A 1IUEA 1KKRA 2XNAC 4IKGA 4M9NA 1S8OA 3TCSA 2WHIA 1T0QC 2M0XA 4B6WA 1BPZA 3RJGA 1XT9B 5AM2A 1NK6A 2HVHA 1RRBA 1ZQNA 4UB3A 3N4EA 1TS3A 4H4SA 3QUBA 5HMLA 3WKDA 4ICUA 3LB8A 4O3SA 3WK8A 4DL3A 3JPNA 1BQGA 4LZDA 4LNFA 3SD7A 3HVZA 3L5OA 3TEYA 5JRTA 3ZGZA 3RBEA 2JQRB 2HHXA 1IGDA 1V80A 4ECTA 1JDFA 2AL3A 3P2BA 1RWSA 2Z7JA 5ALQA 2GMIC 3JPSA 4ZHPA 3NVYB 4QZCA 2MP2A 1PGBA 3A7UA 2FPMA 3AU6A 3PO4A 4G50A 4M01A 3ZO5B 4II2B 1RVKA 1ZDLA 1KM7A 2WDWA 5HG2A 1RLFA 3I99A 4MFAA 5IOIA 2HQMA 4BC7A 2C5LC 4FP1A 4FZNA 3CGBA 1WR1A 1W1KA 2AL1A 4NV0A 2O6KA 5J2CA 2OZ3A 4FS2A 4UB8U 3C2LA 4Y2PA 4BXOB 3V7LA 4YQWA 3ENEA 3VRAB 3V3XA 2EQYA 4B95A 5KL8B 4PK1A 1RM6C 2JU6X 4IDIA 5ALWA 4J57A 3GIKA 3KBBA 4QZ9A 5JU5A 2PTLA 4F5PA 1SJBA 2KVRA 4DXGA 1X1MA 1XSLA 3M9OB 2VFRA 4HPNA 1IXRA 1U47A 4YT0B 3D2NA 4GISA 4DSFA 4GIRA 3WK6A 1KRPA 4P0PB 2KDEB 2BC1A 2P88A 2QARB 2PCEA 3PW0A 3LADA 2O6VB 4GIVA 3TANA 1ZETA 3FILB 4DWDA 2PFOA 4RH6A 3N7SC 4I2JA 2W9BA 1SXDA 4K4HA 2G06A 3AEEB 3SQSA 2WOVA 5KFCA 3N20C 1NK7A 2ZJ8A 4DSKA 2G5HB 2J4XA 3DIPA 3RJHA 1KFYB 5I1WA 1WGKA 2FNJB 3IJQA 3Q8BA 3B08A 4UAWA 5ALFA 1XO1A 4E71A 4UBCA 4TVYA 4YL8A 3NZSA 3L17A 3HM3A 1UWXA 1PK1A 2QIEB 2KSOB 1MN8A 3MQTA 1ZQIA 2X8XX 2FPKA 2W8KA 3EPIA 3HIZA 2KFZA 5CJ7A 2KKPA 4EKUA 2KC1A 3DVNU 4HKZE 2F1HA 1GRHA 4H83A 2GQUA 1E7PB 2KAJA 3GRTA 3JS8A 1T3QC 1TBEA 1WE6A 2CS4A 2JSVX 1GERA 2ZC8A 2MBHA 2WPCA 2JEIA 1GNUA 2L76A 4B6JA 5J0QA 5KTQA 4Y2UA 3MSYA 2QHOA 1KF6B 2CHZA 3EGRA 4GMEA 3ZLFA 3UQBA 4IP5A 3FC4A 8ICQA 3RNCC 3WIMA 5KFZA 1SE9A 1B4FA 4MH0E 1ZQBA 4RQMA 3DFYA 1STZA 1L0VB 2QSDA 4R8UA 1COOA 1SKRA 2F8KA 2WYQA 3AI5A 3U8ZA 1XCQL 4Z6CA 3TFSA 2AQ4A 3SEBA 1RFKA 3QUCA 3N7PD 2LFIA 1ZOLA 1UA1A 1F77A 2PTXA 3UCDA 3GV5B 2KTFA 4WJOA 2DZJA 2YB1A 1Q46A 1S76D 2PE9A 3H1UA 3C2MA 4HYKA 5DPTA 4O95A 5ALKA 4RT2A 3K75D 2Y08A 3DHIC 1Q3UA 1VRAB 4DX3A 2MSNA 1MHHE 2H3QA 3QEBZ 4AP4C 3DWGC 1ZQPA 3BS7A 2F3NA 1MPEA 4CE6A 1AROP 1UCVA 4PZNA 4XRHA 3FYHA 4KLQA 2HJ8A 4M9HA 5ALMA 1WM3A 5DQHA 4Z6FA 4Y2XA 4HK2A 3EZ5A 5KT2A 2BPCA 1P1AA 5ALPA 2EQ8A 5FXDA 4KZ0A 4D2KA 3VFCA 4GLSC 3Q8QB 2ZG6A 1XO3A 2JZPA 1F0MA 1TS4A 1E8XA 2KX0A 4RUAA 2H3FA 4C8NA 2MW5A 3DBSA 1EC7A 2D11A 4P7IA 2PLIA 1D5ZC 2ZZ0A 4HYRA 4ZH4A 1SGGA 1BZLA 1FCCC 1HUZA 5AKGA 1WXMA 4HDQA 1ECQA 3WAMA 4TSSA 4C7ZA 5FJRA 3TADA 2ZW0A 3JSVA 1R4MI 9ICOA 4HEA1 3RR8A 3VH4B 4CCHA 2Q4WA 2DHZA 3GZFA 3M63B 2B0CA 3P42A 2KOBA 4RNNA 1ZQMA 1GAQB 4B9TA 2CN1A 3TACB 4EX6A 3OTQA 4ARCA 2OFJA 3IP4B 1MJDA 4HCHA 5AI4A 2JZBB 3AE2B 3GQCA 1LGRA 4XA5A 3O0HA 4I6LB 1B43A 3WKBA 4NJ8A 1ZDXA 4CF4A 3SQPA 3FW9A 2W55A 5DDYA 4GGHA 2DYOA 1BVSA 1M6YA 2PFQA 4W9EA 5J2RA 1N61C 4DHGA 5JRBA 4KMUA 3X0WA 3NTUA 2KQ7A 1L7NA 4YCXA 3EWAA 1BPXA 1WY8A 3RNBC 4KLLA 4HPMB 2YVJA 3V6KA 4WWOA 2CRXA 1J0GA 2C60A 2WFAA 1V86A 1CZPA 1OTRB 4ED8A 2LGIA 3U4FA 2HVIA 2Y1JA 3IDWA 5CHGA 3H40A 3MC0B 4L1BA 4P1BC 2MUCA 1NKCA 2P8BA 1NK4A 3RUIB 3UJEA 1KOTA 7ICFA 5KT5A 2MBOA 1U48A 7ICNA 4IW0A 1ZXIA 2GOLA 1P43A 2BCUA 4I27A 2KYWA 3F53A 1SZPA 1SB3C 1M94A 2G0AA 4ECQA 3TL5A 3KVFB 1R7SA 5J2JA 5CEHA 4AUQC 3PK7A 3UJ2A 5JH5C 2K39A 3KH0A 2K60A 2QB1A 3T3OA 2E5AA 2GRIA 4KWSA 3RAQA 2A5UA 1MC8A 2QDEA 1JWUD 4NY0A 2KACA 1KSPA 1DZNA 1EF1A 3H4BA 3FJ4A 3SN4A 2IPKD 5J0RA 3UF8A 3RB4A 1HZ6A 2G45B 2NPTA 7ICHA 2BBCA 4PWBA 1NJYA 4YR0A 1JQ4A 3UJSA 4DN1A 1MI0A 5FXEA 3NOBA 5CP2A 1NHRA 2ZNVB 1MDLA 4UW9A 1KRHA 2K25A 5KFHA 1GB1A 3QTPA 3L10B 4M0AA 3BIID 4OW0A 2X8GA 1TZZA 4P0QB 1FFVC 5ALHA 2R8GA 1MQ3A 4IRKA 1YIWA 2WXFA 3IAM1 3CXOA 3UJFA 1ZRNA 1JROA 2KEYA 1PVQA 1BPYA 2KKCA 2I2YA 1XU4A 9ICXA 1N48A 2W54A 1QCKA 5J0PA 4N9F4 2DKXA 2WAQF 5AKHA 4FBUA 5B5EU 2L05A 3L4PA 3LWMA 2F1JA 2GO7A 2Z59B 1GRBA 3DEDA 1L0YB 2HHQA 1ZQFA 3UI3A 4JHMA 4GGBA 1TYGB 5AHXA 3ZDCA 3FXGA 4IQUA 3UMGA 1EU3A 1L7YA 2R8DA 3GZNI 4JE3B 2XH2A 1FRDA 1IP9A 2Y4GA 4KLTA 2YEPB 2XCPA 3OAWA 3VUXA 3L54A 1IIPA 2QJLA 3S5SA 4FS1A 2E1FA 1PUTA 3PRPB 3V4BA 2QEJC 5FS8A 8ICRA 2KZMA 2N7DA 4KEMA 2VFVA 5ALIA 4FULA 2I6XA 2WF7A 3RCZA 1QH9A 3K1ZA 1WGYA 2OH2A 1CJEA 3DBRB 4RCOA 4C4RA 2NYVA 2WDRB 1KDHA 2VZKD 4I2AA 9ICJA 1SEBD 7ICSA 2K6DB 3VRBB 1C4PA 2JEJA 1ZOYB 4RF0A 1Q8KA 2PFNA 4TQ1A 5G5HA 4ED7A 5BYSA 4MJSA 4ZOHC 1TY0A 3C5FA 2WHEA 2HXUA 5C0YA 9ICBA 1XEEA 4K1WA 1QQ5A 1MO9A 2KFNA 3FCPA 2CHWA 4ECUA 4EMWA 2FUG1 3G6XA 2GBMA 2ZEQA 1Q5WB 1JX4A 2BR0A 2LWPA 3DDHA 2TSSA 5IIMA 4NL9C 1BKHA 4PPXA 2RRDA 3E58A 5CB1A 4P4PA 3PGEA 3EECA 3L13A 2BQRA 1ZE3D 4ECVA 2PE6B 4DF4A 5KFFA 1P48A 3A0HU 5BOFA 4PHEA 3QA8A 1NDAA 2WPEA 1S3SG 4URKA 3P63A 1O03A 3HKZC 4KX3A 3F5AA 5BO4B 2AQ2B 1V6EA 3PM9A 2KHVA 3R3MA 4NM1A 5KAIU 3ZI4A 2VKQA 4DS5A 3Q4DA 7ICOA 1X66A 2AQ1B 2UWQA 3V60A 3W2DA 3P3BA 4DF8A 3PT2B 5G5HB 2KHQA 3CNHA 3MDCA 1MUCA 3ZVVA 1WGDA 2WWZA 3WAOA 3Q2AC 4GYPC 3B0YA 3WK4A 4BX9C 3VTWA 5DGBA 4EZ9A 4W9JA 5KFLA 3ED5A 2MRPA 2W9CA 4LDTD 1OGWA 4OZCA 4NNJB 1SV0C 2GWSA 2OOBB 3LJ3A 1EUVB 4EQRA 5AI5A 5IDZA 4J03A 2LJ5A 3V05A 2I38A 8ICLA 4DFJA 2MSED 3QK0A 3V6HA 5GRTA 4RUCA 4KLMA 4ED1A 4TQ0A 7ICKA 1TY2A 1CUKA 2Y9TA 2QCZA 2NTTA 3AU5A 2BCPA 1OUQA 4YN4A 1W1QA 3Q69A 1EM7A 2V6OA 4HPLB 2BPGA 1E8GA 2NO5A 7ICMA 2RDGA 3OJ3A 2JEGA 1QLTA 4JAYA 1VJ5A 2NTSA 3IK4A 5KG3A 3LLBA 4JB3A 4DK5A 4AOFA 1E7UA 2M0AA 2OX4A 4OHJA 2D07B 3ZDEA 5DCNA 1GPXA 1NHSA 1V1OA 3K9PB 5C3JB 3T9LA 3PW2A 3B0XA 4DLEA 3TUOA 5LXHA 3PRZA 4RQ6A 5FS9A 1L7PA 1RQLA 1ZY8A 1TIFA 1V1PB 1Q10A 5L83A 4YMOA 1FEHA 3QN3A 5J2GA 4KV2A 5IIIA 2IO2B 2K3UA 4PVHA 3GILA 4DLGA 2Y9UA 4M6WB 3SD5A 4EEKA 5KFDA 3P4RB 4HVBA 1DRGA 5KFMA 4DXFA 4CNQA 8ICTA 1V81A 4J9PA 2RPQA 1YQZA 4K7ZA 4E5TA 1X6IA 2KMMA 1U49A 3KQ4A 4PVEA 4IHCA 9ICTA 2BGFA 3IN5A 3QUTA 2ZIUA 3WU2U 4I28A 1RXWA 1TAQA 8ICBA 3QUQA 1L7OA 8ICOA 3FILA 4MKSA 5K8EA 5CWRA 1ZQDA 4C80A 1T7PA 1YQ4B 2KZRA 1OEPA 4DSEA 2W43A 3KHRA 2KVSA 1FRRA 2XC9A 3DK8A 1W1RA 2PI5A 4DWFA 3R2TA 2TPRA 3AE4B 2KWCA 4Q8EA 3RI7C 3IVFA 1SXEA 2V3BA 3JSVB 4J9OA 4FLHA 4N59A 2YQEA 8ICGA 1QOGA 1WGGA 2ZTDA 4WJNA 2ZPNA 4RQ8A 4H4TA 2KJ5A 3D6JA 3I28A 3N30A 3U4EG 2WF6A 5J0XA 1MOKA 3SSZA 3ZJVA 1GV4A 1HIWA 1U45A 1TKDA 1N5WC 3U7ZA 3GRSA 3GIIA 4HCLA 1FEBA 3T8QA 5U25A 2ZXHA 2DBYA 3UMCA 3SFEB 3W8XA 5HMRA 3WK7A 1D9DA 1H38A 1ZQEA 1V2YA 2MEKA 3VDGA 3C0PA 3NY5A 4Y2JA 3Q8LA 5KG5A 1TVAA 2FLPA 2M1MA 4S0RA 2KMDA 2O6VD 3ZTDA 5HFYA 3ZLZA 5FJOA 5AK5A 4YVZA 3MY9A 5EWEA 1TKGA 3B2FA 2Y5CA 3F2CA 1R6WA 9ICUA 1WSPA 4HJKA 2UUVA 2ALZA 2PTWA 1CI4A 1R0MA 2LD9A 3NZ3A 4KGTA 1QOFA 5EE0A 4CGZA 1WRDB 5DLGA 5J2HA 4NL9A 2IHNA 4KLJA 2MHJA 4ACFA 4EOYA 1UXYA 2WS3B 1B0XA 3EPGA 1R4NI 1SV4A 7ICJA 4TQRA 2HBJA 4A8XC 4AP9A 3PR5B 2NMQA 4I2FA 5AM4A 3BJYA 2KE7A 3T79A 2P3HA 2P66A 5AZHA 1LVHA 2I1JA 4FADA 1F2RI 3ETRB 3MZNA 2FI1A 1F2RC 3GP7A 4HDOA 3S6JA 3DBLB 4DNSA 2O3GA 2ZZCA 2K8BA 1L3UA 1NENB 1WMHB 4IC9A 2KN5A 2RLTA 3JPQA 4F5QA 3PPAA 3R7RA 1ZQVA 5ALLA 2P0IA 2XK5B 1E8FA 2I5QA 2KXJA 2MAXA 2IY1B 2D6FC 1FFUA 4GYPA 1XANA 3EC8A 2QQ6A 3Q8MA 3T6CA 4M00A 3DEQA 2Y0SF 3OSNA 2YVFA 1ZMDA 1H2IA 2WGSA 3MHZA 3AE1B 5ALTA 3AL0B 1NZBA 4NLNA 2KX3A 1VZ7A 4HCDA 5BPCA 5DB9A 1E0YA 2QKNA 2O2VA 5ALRA 3NVYA 5J0YA 3Q3NC 4HCPB 5DBBA 4AWJA 3ALRA 3UXNA 5J17A 3UM9A 2ZIVA 3RJFA 4JPSA 3SDLC 2Y0SC 2C22A 2PU1A 3NRZB 3KJMA 1VQZA 2B6GA 2FKPA 2PGEA 2PPGA 2DZMA 3N1XC 4LIIA 2N4FA 1HUOA 3ZVHA 5J8YC 1QQ6A 1KD0A 2EDUA 2A3VA 1ZKHA 4IWPA 4ANVA 7ICQA 1V5OA 2YEPF 4GR1A 4MHVA 3OZMA 4JWSC 2J6UA 1EC8A 4HROA 3RJKA 3GD6A 5D46A 2K0PA 2K22A 4IWQA 4PL2A 5KFYA 4Y2QA 3H0RB 1TK0A 3BJSA 2W3RA 2MQJA 3A4RA 4YTMB 5MPOA 3MABA 3DBLI 2F8LA 3T5KA 1K50A 5JHAA 1W1MA 3ZIMA 2MWSB 4MM3A 3AE9B 4ASWC 3RH6A 4NZLB 2JF5A 4EZKA 3KWLA 3O13A 1N5WA 2NQWA 2QPMA 9ICAA 2PP3A 5JCNA 5E6NA 2WF8A 4EELA 3MR5A 2INDC 2DPIA 2WXOA 3P93A 1LQBA 4CF5A 4MGGA 3CYJA 2EKEC 3LVVA 2NBVB 3AULA 3PFRA 5ALXA 5IILA 2JZZA 3RB0A 1TFRA 2K6QA 4O3NA 3A7AA 1JCKB 4KLEA 4EZLA 3WCQA 1ZQCA 2J53A 8ICKA 4GN1A 4NAMA 3ZDMC 2EQ7A 3HRDC 5D94A 1W1LA 2AEHA 5KFUA 3TIXA 4DSJA 4B0MA 4KVGB 2JEFA 1X6JA 1X9XA 5JHBA 4J3ZA 2HHSA 4B9SA 3AE5B 3BK1A 3DBRI 3CK5A 1IG6A 2RDHA 3TWBA 2HOFA 1J2MA 3WK9A 3SFDB 1NKEA 1NHPA 1N63A 2W9AA 2J52A 3C23A 3EUB2 2JH7A 5DBAA 3RJIA 3RB3A 2UVWA 4KMOB 4DFDA 1F52A 5KT7A 2GH5A 4UB4A 5IO9A 2ZZBA 3BVZA 1GC7A 5JCMA 1LV5A 2WU2B 3VC6A 3VTEA 2BYFA 2IOFA 2HTME 1MFWA 4KLDA 3R25A 5IIJA 5KFSA 1L5UA 4RU9A 4DSIA 1S7MA 1CMXB 1TYTA 4DQSA 2QARA 2POZA 3B0AA 3K1GA 5TSSA 2WF5A 7ICIA 4F5RA 4J6IA 3EUB3 3V7KA 4ECSA 2VZKB 4DDID 2KNBA 4JDRA 3Q8KA 3T3FA 3TAQA 2HHUA 1GUAB 2MBBB 4BKSD 3S1DA 2FAZA 2JVCA 3D9XA 1R4MB 5AI0A 2ASDA 2BKFA 3RJ8A 4PZOA 3QKEA 2KJRA 4OVUA 5HI1A 3MDAA 4FN2A 3R9KA 2PKEA 1BPEA 4B9MA 2JH1A 4P0QA 4DQQA 4HWIB 4M47A 2Q85A 2H3ZA 2C3DA 2YVCA 1P3QU 3IT4B 2EAMA 8ICNA 1TKEA 4IR9A 1OXJA 1KFDA 4XLOA 2FYMA 1ZQXA 4KGSA 2AL6A 3KHLA 2HJ1A 4RT3A 3ZQ4A 4MH8A 4UQGA 1ZQHA 2MA9B 1AYFA 4ANWA 1V8CA 2K4IA 2KSOA 4NLZA 1MSWD 2QAEA 4TUSA 1DK3A 2LXCA 2WXIA 3FYYA 3S1FA 5GMVA 3R8BA 4G9BA 4ZRIA 4H2HA 3AU2A 3LYSA 2PODA 1LVLA 1TGZB 1SV0A 1OEYJ 1GETA 2D3CA 2O56A 3I9V1 4EEWA 1TTNA 2GRTA 2KWUB 4A6QA 5AKEA 2B21A 3L0WB 4UAUA 3N97B 2D8CA 2KLCA 4QZEA 3RH5A 3PZ8A 2LGXA 2WXRA 2FCNA 4YP3A 5GTIU 3Q8FA 2D3AA 5BOLA 1MBBA 4DL2A 1PDZA 4KLFA 5JUMA 3QARA 2XICA 4J9MA 1YX5B 5EWGA 2IGDA 5JTIA 5H92C 5BOMA 3QNMA 4JWMA 1ZPSA 2C7HA 2MH7A 2OG9A 4ZHOA 2D5GA 3PW4A 2LM4A 4BBNF 1FD6A 1NI3A 3ICXA 2LUEA 3SJNA 2JV3A 4F2RA 2ONQA 2D2QA 2PTZA 4JQWC 3UPQA 4EM4A 4F2SA 1AWDA 3I3TB 1Z4NA 4WQOB 5DPSA 1ONFA 4PL1A 5AEKB 4P2HA 1A6SA 1QKZA 2BDPA 3JPRA 6ENLA 4PYTA 1C77A 2WDQB 4K4IA 1RYSA 2E8OA 4WURA 3KLJA 4R66A 1YD8U 1K1QA 2K4EA 4F5NA 3WKCA 4K7UA 5CRXA 4MFCA 3Q8AA 4K3BA 1IYXA 3D2SA 4RGNA 1I7HA 1KN0A 3VTVA 3ZNHB 4KSKC 2ZZPB 1DIIA 2D3GA 4YTNB 4CYEA 4J1OA 3D32A 1UBQA 3UJRA 2CHRA 3KUCB 1I4XA 4JWUC 3EEZA 1AQ6A 3TX1A 3ETLA 4PYZA 4KTQA 1NK0A 2I1KA 3AE7B 1E0ZA 3T5JA 3CT2A 4ADWA 1BMLC 2RHFA 8ICXA 4I6NB 4E4FA 1L6UA 1X2IA 2W9CB 4C4TA 3OGUA 4OZBA 4NPNA 3RF9A 3LK9A 3AEAB 1MNSA 3CGEA 4P0PA 1QLBB 1PYWD 4IZGA 2VRRB 2QJNA 1NYRA 2DYMA 2CPRA 1ZYQA 2KZ3A 4BCAA 5HHDG 3POPA 1QSLA 1WIAA 1WYWB 1YQBA 3SN1A 3IXSA 3VHTC 3L08A 1KEJA 3T8MA 3VUWA 3SI8A 3OHBA 2KG5A 1J7BA 2DLBA 4BVUC 3NASA 2KJ8A 2G4DB 5KNIA 3R07C 2I9GA 1C78A 4EZJA 1BPDA 1WXSA 3B9JB 3DGBA 3LXDA 1Q1RA 2MCNB 4ML8A 4Z17A 2O6VA 2KP7A 1GRTA 3TARA 1MDRA 5HQXA 2FJ6A 1N62A 2F2AB 5CA7A 2PMZC 4YMNA 1KL9A 4U7CA 1D8YA 2KDFB 2BS4B 2BWES 1W1JA 2KC2A 3ONNA 1WMHA 4OVZA 3NFUA 1ZD2P 5DB7A 4TKNA 4H4WA 3PW7A 4MF2A 3HUIA 4JK1A 3QYPA 3SAGA 1WE7A 3C8YA 1WZ0A 2J6TA 4JLCA 1N2XA 3DK4A 2BKEA 4A3OA 5HMMA 2KJHB 2AHOB 1L6VA 4G8TA 3DV9A 5E6PA 3VR8B 3ES7A 3S1CA 4MM3B 1ZQRA 2OEHA 1JRPA 5L6GA 4MFFA 2PVGC 3H7VA 5DB8A 2BCVA 3MGVA 3A4SC 3OHAA 3ONSA 3PSTA 3QQ8B 2OVLA 2WB1F 2N9LA 3DESA 1ET9A 2PPHA 4HCNB 3RR7A 3H4DA 1WJNA 3N9YC 2J7QB 1KQQA 2K9XA 1WUDA 5KFOA 2DW6A 4ICAA 1ZJNA 4KPRA 5ALYA 2NPTB 1DTNA 3M9NB 4ECZA 1N60C 4RFBA 2W82A 2HE7A 5FR6A 2V9HA 4EBDA 4JV1A 2WXNA 4YSXB 1P9DU 2OO6A 1NK5A 4IRDA 1WJ4A 2RD0A 4ZRPA 4MLAA 1NK8A 5FJPA 1K8RB 1LO5D 2XGPA 1J97A 2WNMA 4G3XB 4KX6B 4EMIA 4BC9A 4AQ7A 3TJIA 2INNE 1WVFA 5KHOA 2ZXIA 2DPJA 4J9SA 4GLXA 4F4KA 1ROEA 3MFGA 4Y2YA 4FHJA 1AHVA 4QJFB 3PZ7A 1ESFA 5AZFA 1YZ7A 2BHNA 1NZPA 2M9NA 5TZVA 2P6UA 1I4RA 2BVCA 2DF4B 3Q8CA 4KIKB 2NV3A 4YFKA 1WH3A 1S9FA 4EQXA 4GDKA 3AEGB 2V0GA 2PLPA 2HXTA 3WANA 2LYAA 3C1ZA 1W1SA 2ON8A 2PS2A 1XQQA 3IG5A 2SAKA 1HZ5A 3IV6A 1O08A 5EOZA 2QGYA 3RJJA 1T8EA 3ZXVA 1WF9A 3A0BU 3C2KA 2Y5BB 4PT5A 3JW7A 1ECWA 1D5MC 5CX3A 3PW5A 1MG4A 1YJIA 2LXAA 2LGYA 2LMRA 4S17A 3DERA 2E8NA 9ICLA 4GIBA 3FVDA 2SEBD 1Z1BA 3SBFA 3ZVIA 3CB3A 3I1YA 4MGYE 3TOYA 1VAOA 1YJJA 4IL0A 2AWTA 2FUHB 4GRTA 1WI0A 4NLKA 4DWIA 1IPGA 4DQRA 3N4MB 3DHHC 1S0NA 3KTQA 4WIPA 2X38A 1TS2A 4GFJA 2KO3A 3KFUF 4B9VA 4XWWA 2NBWB 4MSQB 4YR3A 9ICWA 2EAOA 1N62C 3OSPA 3J9CA 5EDSA 4BFRA 4PS3A 3KUZA 1I35A 1X2GA 1VDVA 2VA8A 4IQTA 1NEKB 2EZXA 1FXTB 2KTRB 1N63C 2AL2A 3IT6B 1FHVA 2X8HA 5TR5A 2PKOA 3VXWA 2JXJA 5HNKA 3CXBA 2V1YA 1UA0A 3LYYA 2P4PA 3U7DA 4FE3A 2O2VB 2C7NB 2DWQA 2V9WA 4W9LA 5L1IA 1E8HA 4B0EA 1A70A 2X8CA 3DFHA 1WVEA 1QLNA 1DNCA 1C4CA 3CMMB 1S97A 3E56A 2R8JA 2CKHB 4IP4A 1S0VA 4P4OA 2DGZA 3SR6A 4Q43A 1J2NA 1GJZA 1AHZA 3K9OB 4MT5A 3BS5A 3RCYA 3KHGA 4BXOA 3U30A 2I0KA 4QZAA 1RG6A 1YJ1A 1LKYB 3ZDDA 3BINA 4E0DA 5D4BA 3VA8A 2PP0A 2RDBC 2RGFA 3B1LX 4NJ7A 1TE6A 1VJKA 4US9A 3DVNV 2LPEA 2XCAA 3HPOA 3JPOA 4YTPB 4I2EA 2R8HA 3CYMA 1KTKA 1VLBA 2A1AA 3OLMD 3NGDA 2LGDA 4F71A 5CHVC 2WPFA 3HVDA 5ER0A 4A8EA 2QILA 2ASJA 5KFQA 3QIJA 3DEEA 2WXHA 5FS6A 2J0MA 8ICHA 1JALA 2E5SA 4RQ0A 2GBNA 2N1VA 2CDUA 3ZXRA 3T9PA 4OALA 2QB0A 1T0RC 5IKCM 1X2HA 7ICEA 4PHPA 2V3PA 2K1FA 3Q3MC 1DIQA 5KG7A 1ZQSA 9ICMA 1KLGD 9ICHA 2HHTA 2MBQA 3ML8A 1Q0WB 4BJQA 3SU8X 3WKAA 2R2QA 1NPXA 2HCFA 5AKYA 4KITB 4RNMA 3BZCA 1MG8A 3E2EA 2KHWB 2L0TA 2OJRA 2QDFA 2WXLA 2YMLA 3NG0A 4LNNA 3KKAA 4KKIA 1B9RA 4KLUA 1JMLA 1A76A 1I4HA 4HAIA 2LRWA 3JZUA 3GSYA 4UB2A 2KFKB 4QW9A 3MGHA 1BT0A 1CEZA 7ICLA 3C29A 3TSSA 2KN4A 3WK5A 2PEAA 4UB1A 4C0ZA 1L4ZB 1FIQB 5KFNA 3Q6JA 3DOWA 4DL6A 5KG0A 2VAOA 2V4RA 4Y2SA 1JW9D 4IM0A 5AE3A 1N60A 3D2QA 1WUFA 2EH9A 2K8CB 4GDLA 2H5XA 4FJVB 1K52A 5AIAA 1OQRA 3AB5A 2WXQA 1DK2A 3APCA 1YT3A 2DKZA 1SJHD 3QFBA 3QXGA 3PO5A 4BV6A 4OJPA 1NK9A 1LM8B 2MJDA 9ICKA 3QU5A 1S0OA 1UD7A 4ANXA 3EANA 2VFUA 3QJZA 3I63C 3R2IA 1C9FA 1WCNA 1GB4A 5CTRC 1JN3A 2AL2B 2AGQA 5JCKA 2MLBA 3K1RB 3LB8C 5C2TB 1EBGA 2AAQA 3TFRA 5KFBA 2IDYA 2WB1C 5DBCA 3UQ0A 2ZIUB 5KFVA 5DG7A 3L16A 4APNA 2EMSA 4NAWB 3II4A 3SV3A 9ICCA 9ICSA 2CJNA 3QWZB 4MJSB 4FFDA 1ZMCA 3RNMA 4YXMA 1XLNA 3GV8B 2ZIWA 3SENA 3T4WA 1SZHA 1W6TA 2MRLA 2P13A 3M6ZA 1UT8A 3M8SA 2IMWP 1FPYA 2WP5A 3SR6B 3A9KB 2KVCA 3RTVA 3PSFA 4C8LA 1AARA 2BWFA 2FBWB 3RR1A 2GGEA 3WALA 1WXQA 1ACCA 3ZRCA 1L8PA 4KN4A 2OJWA 1OEYA 4DFPA 4H19A 3OJUA 5J2DA 1L6NA 5K4LA 4O3RA 2KQ4X 4O0IA 1WUEA 1WX8A 2FMPA 3NS8A 5J0UA 9ICQA 3V7JA 1ZD5A 4M0WA 2ZJDA 1L0XB 3A33B 1D4BA 4DO9A 4EEYA 2OEDA 5AI6A 1DGJA 4R63A 1OW5A 2J0JA 4KN7A 2K8HA 4ECXA 2INPE 3IAS1 3GOEA 2A1JB 4C4VB 3D47A 2XN9C 3MGIA 3H7SA 2R2OA 2H88B 4XC2A 4WJ3B 3N6HA 2AYOB 4TQSA 4F4XA 2PFPA 2WXPA 3FKYA 1S5LU 5AIBA 4R65A 2IA6A 4C7YA 1KJTA 1A0PA 4QWDA 2WXKA 3DHGC 3U9IA 3PVLA 2HBKA 4EX7A 2JRZA 4DL5A 3M95A 1TKYA 2EQ9A 2OQHA 2GQWA 1SL0A 4CF3A 2GB1A 4EFOA 3TEXA 4LZGA 3DPDA 3DJJA 3WKEA 4RQ2A 4K8DA 4DL4A 3AE8B 1Z5SB 3URYA 1EWYC 4KDLB 1PDYA 2GR1A 2XK5A 1T3NA 1PVPA 1J7CA 1TT5B 1X9WA 4WJQA 4NLGA 2JZBA 1QLUA 2VA3A 2LUMA 4ANUA 1UT5A 3SQIA 1F9JA 8ICUA 4FBJB 5DDMA 4M6UA 5J0WA 3GE3C 3SEIA 3HPFA 1Z1VA 3H8SA 1YN4A 3MJWA 1ZXHA 1C7YA 3E0FA 3E9SA 4W9IA 2KD0A 2N1RA 2JYEA 2LVQA 3P4SB 3PREA 4G11A 4EM3A 3MHSD 3AM9A 3NRZA 3AQFA 3M9MB 4J9KA 4MGIE 2ICIA 5BYRA 3D2JA 1DOQA 2OZ8A 5H2FU 4A6GA 4F8RA 3VFKA 3PQBA 1LFDA 2L1AA 3KWVA 4MELA 4JV0A 3C19A 2G09A 2J42A 2RDJA 4PGXA 4K7SA 2J6SA 4W9DA 2LJIA 2YB4A 3OTRA 9ICRA 1VCBA 3MTNB 3RN9C 2BC0A 5KG1A 5HP4A 2VJ5A 4M9GA 2XY6A 2N0SB 5D2MB 1W1OA 2KJ9A 5DQIA 4UAZA 1V49A 3VVWB 8ICYA 1TK5A 4QZDA 3DG7A 2LVOA 4DQPA 4H50A 1DGSA 3DQ0A 5AM1A 2L3ZA 3P4QB 3MC9A 3MWCA 2ZCBA 1E5WA 4GXBA 1YQ3B 4H4VA 2ESEA 3PNCA 1FMAD 1EF5A 4GMVA 3WAPA 4DQIA 8ICEA 1LB2B 3OG5A 3DVGX 1I42A 2Q4TA 3TJPA 2GSHA 1X42A 4MF8A 1XXGA 1F3PA 2HD5B 3C1YA 2G07A 4K1RB 4W9KA 4JGHB 3HX0A 2ISOA 3R7QA 1KTQA 2JWZA 2YN4A 1HSKA 2ZADA 5D7GA 1XS2A 1KN5A 2CJOA 3VH3B 2WP6A 4J9RA 2JX5A 2KDBA 2FDRA 3IC9A 1NNLA 5AKJA 4F93B 1PFDA 2OCEA 1ZGUB 2JRIB 5ALSA 3V72A 3JYUA 5GXGB 3W1SA 4EZ6A 3SHQA 2Y1IA 3V61A 2RK5A 4J9NA 2LYHA 3PV1A 5CHWA 4EUTA 2H3IA 2DUYA 4RQ1A 4Y2VA 4G7FA 3VAWA 3C28A 4GGQA 5ADZA 2BCSA 1TV9A 2F1IA 4EBCA 4U6PA 1QILA 3RJEA 5ALGA 3ZTCA 1C1YB 5JXVA 1IBXA 3FAHA 4G3IA 3BY4B 4Y2RA 2C9WB 2B76B 3TQPA 4I2GA 4BGDA 3N7RC 2BS3B 4FBTA 1SWWA 1DOXA 1P7FA 2REXA 1HA5A 7ICRA 3BK2A 3ABVB 4KX5A 1UWMA 5EBKA 4DNAA 3RO6A 2QC8A 4BKGA 1CK1A 2PI4A 3PX0A 3OJ4B 1XLOA 4LJXA 4AJYB 2QJJA 5JCLA 1K1SA 3KLSX 3UGBB 1LXDA 3HW8A 1ZP0B 1ELSA 3RJAA 3GB1A 1J7AA 4O9MA 3BYTB 2KFJA 2IO0B 1FHUA 3THUA 3RFZB 3M1YA 4A20A 2OHFA 4F5OA 2VJ4A 1QT9A 4DHJD 4RQNA 1COKA 4JV2A 3QE9Y 3APDA 4CRXA 4ZDVA 4H4QA 5KFJA 4GXIA 5FR3A 4G0NB 1Z3EB 1JWSD 4YSZB 2R8KA 7ICVA 3GD4A 4TV3A 1G6JA 3SN0A 2HOIA 3ETRA 2UVVA 1UBIA 2ZCCA 1RM6B 2L8JA 3TSHA 2M56B 2KDIA 2M17A 2JY6A 3TWAA 1K5OA 3DQVA 4BUGA 1P98A 2NRWA 2W9BB 1ZQGA 2GDQA 2LASA 4MEYA 3RYTA 2RSUA 2WLBA 3TKAA 3LXFA 1XSNA 1WG8A 2QMTA 1I19A 3FM9A 1WZ3A 5FJTA 1LPFA 1BXTA 1L8OA 4YD1A 1U4AA 3ENLA 1KH0A 5G55A 3QZ8A 1SXTA 4IL2A 5J29A 1AOGA 2IOHA 4YD2A 1N61A 1XPYA 3ISCA 1ZDVA 2HZGA 3V3WA 2X50A 4QZHA 4YWSA 2NO4A 2RMMA 1IM4A 2FCSA 2NPXA 4CDGA 1WX7A 3GE8C 1F9CA 4LLGM 4QIWF 4USAA 2WF9A 3EHVA 3Q14C 4M52A 1FXAA 1FFVA 4DBGA 3G6VA 2KTRA 4C00A 2GGGA 1YN3A 2XBBC 4LTUA 3SAFA 1SSNA 2LHDA 2WBAA 4W9CA 3NVZB 4PHDA 4K8GA 4TVWA 3F2BA 4OJ5A 1ZK7A 5IN7A 2KT7A 2HBMA 1UPHA 1GC6A 4I2DA 5KVIA 1MBTA 2PW9A 1D5XC 2BB5A 3DBHB 3GS2A 3RNGC 3I57A 4EQWA 2KVZA 2L52A 1TYPA 3DK9A 4R8UB 3EF6A 3DH9A 3PX6A 4BWMA 3A1QA 1WGRA 4KSLC 2ZIVB 4LNOA 1FFUC 5D79A 1V9JA 3RD2A 4O1NA 1A5RA 3UXKA 4LK0M 2F77X 4OO1J 1P0RA 7ICPA 2YQUA 4DEZA 8ICAA 2KD1A 2WP9B 2G9HD 4HG0A 1YX6B 2FMQA 4XZ4A 3RULA 8ICCA 5AK3A 3IM1A 2J3NA 2PA6A 2BS2B 2GOWA 4M9LA 3RRGA 3RNFC 3VUYA 4MGZE 1L7MA 1T5XD 4ED2A 1MRAA 3BSMA 1KLUD 1ZR6A 4TURA 5AKLA 2AXRA 2B3AA 1H8CA 1Q1WA 3H7PA 2G4SA 3ZUNA 1B22A 2K5PA 3ZJUA 4HN8A 2RPVA 4ROPA 2BVFA 2OAIA 2XVTA 5C5JA 4J9QA 4DXAB 4DYEA 2ZUDA 2HSZA 1QF6A 2PIAA 1X9MA 1C3TA 3AUOA 2IO3B 4DSLA 1F1HA 3EFUA 2N9EB 4BBNC 3PWGA 3HP6A 2FPLA 2BW2A 1U9LA 2E1EA 1JPMA 3AE6B 4C56C 1RYRA 1H6VA 1ISNA 5F3XB 5HHHA 4LJOB 2MUTA 2KMAA 4ELTA 4Q45A 3MP9A 4XGAB 5FK9C 5HKHA 2MJEA 4Q44A 1TS5A 4R3DA 5D6JB 4HLEA 4RQ3A 1FECA 8ICIA 4ZCWA 4RQ7A 3ZNZB 1SGHA 5G2NA 5H8YE 1S77D 1XWLA 4MEMA 8ICPA 3F2DA 2NVKX 4CO7A 3KZXA 1F0ZA 1QQ7A 2VFSA 3AMZA 3AEVA 3H8WA 1QOAA 2GBRA 4PYUA 1FIQA 1V9PA 4B9UA 9ICPA 5DB6A 3UIOB 2YLMA 4MEXA 1SB3B 4JQ9A 4JN7A 4ZA0A 4WWPA 1K4QA 5KG2A 4ELUA 1ZQWA 3W8ZA 4H4ZA 4YWGG 1DXLA 1E8YA 2DYBA 2KIWA 2MBRA 3M8RA 5IINA 3UCCA 3BQ1A 1DYQA 1WWTA 4RF1A 4X57B 5FKAC 3NXLA 4IUMB 3AQEA 1YOVB 2QVHA 3H70A 4HRSA 2HTHA 4QZBA 1TZ1A 5HHZA 1UQVA 4M9JA 2HNEA 3O65B 1P7EA 3CW2C 4YMMA 1IV8A 4ED6A 4XWTA 4FJYA 1ZD4A 2WDTB 5ALDA 3A1QB 2GR2A 4NJ6A 3CAWA 2AX5A 1L8LA 2BQ3A 7ENLA 1YNTE 4JIOU 2DZKA 9ICNA 2LEKA 4IQVA 2BGWA 3PHWB 2ZIWB 1NDDA 5AM3A 4KLIA 5BMGA 5D49A 4YG2A 4WWMA 2FIFA 5EE1A 8ICSA 4KLOA 3GIJA 4DOAA 2WTFA 2L32A 2KQSA 3KUDB 1OFFA 3AN1A 2MU2A 1RQNA 3R66C 4ARIA 5ALEA 2A4ZA 3N1ZC 1NKBA 2WQYB 5D3IB 2WXMA 4I2IA 3ZKJC 4Z1YA 3HKZF 2Z8LA 3ES8A 1DOIA 1HTOA 3QU2A 4FZLA 2PSNA 1SE4A 2WXGA 4FDCB 5TR3A 4IM3A 3Q3FA 4RGMA 2KZZA 1Y56A 3VDZA 3VTUA 3IHPC 1V85A 1FNUA 3R0UA 5EU9A 4QAYA 2WOIA 3NHEB 1ED1A 2BDUA 2HBLA 1I4GA 1YMHE 3P1MA 4RGTA 3NVVB 4E6MA 4K4GA 3BZDB 3QFAA 3H6NA 4A3RA 3M7DA 5ENLA 3ZVHB 4JWNA 2KV2A 4PWCA 4WH4A 4DQOC 1SIJA 1NJXA 4JN8A 4A3PA 4BOSC 2HI0A 4CQNA 1KLNA 5AM0A 3GY1A 2NRTA 4ED0A 3HWTA 3PVXA 3HRDD 3ZLGA 2D10A 4H4PA 5AE1A 1URJA 1UNSA 1WWUA 2KKVA 2DZIA 1H4RA 3W8WA 2W03A 4XX5A 2AXTU 3H8JA 5KFRA 1SKSA 3ZDBA 1ZW7A 3O0FA 4H4YA 2ZVNA 3N1YC 5FXPA 3BQ7A 2JHDA 1TJEA 2IGHA 2JMGA 4F50A 1WM2A 3W9CB 3LWLA 3V62A 2XEWA 2C3CA 4JL9A 4P16A 5DG8A 3P0WA 3RB6A 1PDXA 3NZGA 1WCLA 3TAPA 4IWOA 1V38A 5AI9A 4M02A 1F44A 4YSYB 4B9KA 2YX8A 4O3PA 4H1ZA 3BW7A 1TKKA 3J81j 1UGMA 1J19A 4DFMA 2C7MB 2IO1B 4NQKE 1YN5A 4GXJA 3V6EB 3FDSA 3KKAC 1JWBD 3RH4A 2NR2A 3DVGY 3QC8B 2PMVA 1WGHA 1R4NB 1UF0A 2E3TA 1T4GA 4KPLA 2LBOA 2AJQA 2L0FA 1JEHA 3GDXA 1S0MA 4NWIA 5KG4A 4US8A 4DOCA 4GSWA 3QPEA 3RBDA 1D8BA 2QLTA 5LNK1 2C2RA 2IHMA 3JVZX 5BMIA 4RNOA 2FLLA 2DFLA 4UB6U 4GB9A 3BS5B 4HPPA 3W5UB 4EQSA 2Q0ZX 4JB1A 3JVAA 4IRCA 2L7RA 2MBEA 5G5GB 3B9JA 2XH7A 2GR0A 4UARA 1XC9A 2RQ5A 3H12A 4NQLB 1D7YA 4QWEA 5HR7A 2QKQA 3H8HA 2GLSA 3ML9A 4PGYA 1PVRA 3H8AA 3VCNA 3SZ2A 1ZJMA 1BUIC 1E9IA 4M0XA 2W9NA 2M4NA 5FXFA 3V5FA 8ICWA 4EYHB 3RAXA 3ZRFA 2ASLA 3VC8A 5TISU 1X9SA 2K4PA 4PJ0U 1OQYA 2IBKA 3D46A 3KZIU 3H8MA 2ZPYA 3N32A 5AUIA 2N1WA 5J18A 1ZQLA 3X23A 4QWAA 4DL7A 4GFIA 3ZDAA 1BPBA 2DX5B 4F8CB 1XCTL 1DOYA 4ZYNA 1JXLA 2DENB 4IC7B 1NHQA 4EBEA 4BKTA 2KDMA 1L4DB 4Z6EA 1KLVA 4A90A 5KT6A 7ICGA 4K81A 1UGJA 4ENLA 5AKKA 1F5SA 4NEWA 3KD3A 2BF8B 3N6JA 1ZQOA 4FZMA 3HHMA 2I1QA 4PGQA 1FEZA 9ICIA 4AYBF 1E6EB 4QZ8A 2IJ0A 3TCAA 1IBXB 5J2EA 3H7PB 3RMKC 5KFKA 4KKJA 4DHZE 4HXDA 4UATA 2OKTA 4PZFA 3MR3A 1FCLA 2JYTA 3BDPA 4GXKA 1WFYA 1FNWA 2GR3A 5A0LA 1RYJA 8ICFA 5J2BA 3I6EA 1FM0D 4L23A 5AZGA 3UXOA 2NRXA 2EMTA 4LA1A 5KT3A 4YR2A 2G08A 3S47A 5AKXA 1UH6A 2UU7A 2BPFA 4KZCA 1QSYA 4M8MA 4UB5A 2FE8A 4II3B 1NELA 1QTMA 3V6CB 1XLQA 3UQ2A 2A1JA 2LRUA 4C4VA 3EA6A 1E10A 1KKXA 3M3JA 3L3FX 2MP2B 2BZFA 1BNPA 2YAUA 1KW4A 4QW8A 4GC6A 2VH1A 2DL0A 2YTUA 3ZD9A 4PS7A 4ZOHB 4NAWA 5FS7A 1ZQJA 4W9GA 4AS1A 1JUDA 2GLEA 1GOZA 3D2HA 3RPFC 2LKYA 3BVGA 1OJTA 4B9NA 3ZNGC 2PP1A 5F9LA 2W7OA 1SKWA 3TQ1A 7ICUA 2W8LA 5J2IA 2HMXA 1GEUA 1ET6A 1VZ6A 4GOCA 2I5HA 3PSIA 5AUKA 2M0NA 1PGAA 1WJ6A 2DAJA 4IM2A 5AE2A 5KHQA 1WXAA 4DXKA 2Y3AA 2P6RA 2V4IB 4KLSA 2E8PA 4KT2A 3BOXA 4ECYA 1UZXB 5F9NA 4JUZA 1AW7A 2FCQA 4UAYA 3AE3B 4KGRA 4OVVA 2OPJA 3STPA 2VIXA 4Y2TA 4RMAA 3QZ7A 4C4SA 4MMWA 2ZNVC 3OPSA 4PS8A 3RITA 2C28A 5L1LA 1K51A 2KANA 4P4MA 5DLFA 3KYCD 4WAFA 2KIVA 5HHIA 4O5KA 3URHA 2FCMA 3PRMB 1L5PA 5LLIA 3N3KB 5FJUA 1HXYD 1WRIA 2UVRA 4K7WA 2OM6A 4UD8A 4B9LA 1D6EC 3LDZE 3TADC 2OXOA 3DG3A 3GFKB 2JPHA 1SL2A 1VR9A 5C1ZA 5KVHA 3FWAA 1Z4OA 3VCCA 5J0TA 2LHEA 3TW9A 4NXZA 1XD3B 5AK6A 4IL6U 3A9JB 3DWMA 3AEBB 4N6EB 5E6JA 5U1OA 3EYZA 4FO6A 4F92B 4OJ6A 4XQ8A 3Q3OC 1L3TA 1PGXA 1Y88A 3Q8RB 3HILA 1NBFC 3NUHB 4PVJA 2R18A 2BPSA 2L83A 2ZTEA 4P6VF 1T6BX 3DBHI 1YZ6A 2C2DA 2BCQA 1QSSA 3KW5B 4KLGA 4DDGD 4DFKA 4EYIB 3S2AA 3PMLA 2V3NA 3C21A 3I5JC 4F91B 2XGQA 3IFWB 2WDVB 2JK6A 4XDDA 1Q1OA 1P7DA 3R10A 3QHTA 1L3SA 3QAQA 4M8NA 4BAXA 4E8GA 1ZQ1C 3MJ5A 2M19A 3H0LB 1U4BA 2PJHA 4IR1A 2FIDA 4IT1A 3LAEA 2EAPA 4UASA 3WA0A 3IJIA 4ICVA 4RZRA 1K53A 4F4RA 1L3VA
chains in the Genus database with same CATH topology
1HSKA 5D7GA 2GQUA 2CJOA 4HKZE 3JS8A 2ACZB 2JX5A 1E7PB 2KAJA 5TSSA 2BVFA 1T3QC 1PFDA 2JSVX 3EUB3 3BWUD 3HSUA 2VZKB 3W1SA 5GXGB 3S1DA 3T3NA 2RK5A 3RJ8A 1KF6B 3EGRA 2BT6A 5HI1A 3FC4A 5ADZA 1C76A 1QILA 2Q85A 2Y5PA 5JXVA 1IBXA 1L0VB 3FAHA 3IT4B 2QSDA 1TKEA 2B76B 2Y3SA 4XLOA 1XCQL 2BS3B 3SEBA 4KGSA 1RFKA 2BB6A 3ZQ4A 4MH8A 2LFIA 1P7FA 1DOXA 1AYFA 1HA5A 3BK2A 1F77A 1V8CA 3ABVB 2WXIA 1UWMA 3S1FA 3R8BA 1CK1A 1XLOA 4O95A 3I9V1 4Q2JA 3KLSX 2Y08A 1ZP0B 4A6QA 3RJAA 3GB1A 1VRAB 1J7AA 1MHHE 3BYTB 2GQTA 3DWGC 3RFZB 1MPEA 3PZ8A 3CWIA 2OHFA 2WXRA 1QT9A 2KWDA 3D2DA 3Q8FA 1MBBA 4J3OD 5H92C 2IGDA 1SJED 5FR3A 2YVSA 5FXDA 1ZPSA 2MH7A 1JWSD 4YSZB 4D2KA 2D5GA 4ZHOA 4GLSC 1FD6A 1NI3A 1XO3A 2JZPA 1TS4A 2ONQA 3ETRA 3TSHA 1RM6B 2PLIA 2M56B 1D5ZC 1TZOA 3ZJTA 5L6FA 1AWDA 4IOIE 1FCCC 1EWCA 1QKZA 4TSSA 4A55A 4C7ZA 4PYTA 2ZW0A 1C77A 1JWAD 2WDQB 3LXFA 2WLBA 1I19A 1C79A 4HEA1 4WURA 2QMTA 2Q4WA 2N9KA 4FXCA 3P42A 3Q8AA 1GAQB 1BXTA 4RGNA 1B1ZA 1I7HA 1KH0A 3NVWB 4ARCA 1SXTA 4RGOS 1DIIA 4YTNB 3AE2B 1SBBB 1V1PA 1N61A 4YXDB 1ZDXA 1ZDVA 3FW9A 2W55A 4WQMA 3FW7A 1I4XA 2DYOA 2RMMA 4JWUC 1N61C 1ZXIC 3AH7A 3TX1A 4LLGM 4USAA 2HDEA 1E0ZA 3AE7B 1FXAA 1FFVA 1BMLC 1L6UA 1YN3A 4LTUA 1SSNA 2LHDA 4ZRQA 1CZPA 2E6XA 4OZBA 3NVZB 4TVWA 1N5XA 2LGIA 3AEAB 1MBTA 1I4PA 4L1BA 3MC0B 1QLBB 1PYWD 2PW9A 1C4AA 1D5XC 1NYRA 2BB5A 2DYMA 3GS2A 3I57A 2L52A 4NJCA 4A9AA 1XF5L 1ZXIA 4BCAA 5HHDG 3POPA 1MHXA 1SB3C 1FFUC 5D79A 3A7RA 4O1NA 1R7SA 4LK0M 1VZ8A 3IXSA 4HG0A 2WP9B 2G9HD 1QQRA 3T3OA 2BS2B 2GRIA 2E5AA 1J7BA 2DLBA 3BYYB 1JWUD 1T5XD 3ZYYX 2KACA 1NVID 3R07C 1C78A 1DZNA 3B9JB 4UDUC 1KLUD 1ZR6A 4ML8A 2MJ3A 2IPKD 5AWVA 1FNVA 1M4VA 2AXRA 1HZ6A 5HQXA 1N62A 3ZJUA 2K5PA 2BBCA 4PWBA 2RPVA 1JQ4A 1STEA 5FXEA 1AN8A 3NVZA 1MI0A 2BS4B 1KRHA 1GB1A 1W1JA 4OVZA 4OW0A 3BIID 3HUIA 1QF6A 2Y3RA 2PIAA 2PVOD 3C8YA 3AECB 1FFVC 2JWUA 1OQQA 2IPIA 2WXFA 1L6VA 2BW2A 3IAM1 2W3SA 3AE6B 3VQIA 1JROA 3VR8B 4C56C 3S1CA 4MM3B 1JRPA 5L6GA 1I4QA 2PVGC 3MP9A 5FK9C 2I2YA 2MJEA 2W54A 1TS5A 4R3DA 3NVWA 1ZUD2 1FO4A 4GDLB 3L4PA 5H8YE 3DEDA 2N9LA 1ET9A 1L0YB 3UI3A 3N9YC 2K9XA 1TYGB 3S1EA 1F0ZA 1SE3A 2VFSA 3AMZA 1QOAA 1EU3A 3W5VB 2R8DA 1FIQA 4JE3B 4BBYA 1FRDA 1SB3B 1N60C 2Y4GA 4RFBA 4XDCA 2W82A 2YEPB 5D3DA 2UUUA 3W8ZA 2WXNA 4YSXB 4ITKA 4YWGG 2QJLA 3TSJA 4MACA 2MBRA 4ZRPA 5EE3A 4RF1A 1DYQA 1PUTA 1WWTA 2QEJC 5FKAC 2BVHA 4MLAA 3FW8A 1LO5D 4HRSA 2VFVA 4KX6B 2WNMA 4BC9A 4AQ7A 1WVFA 2INNE 5HHZA 1CJEA 4RCOA 4EC3A 2WDRB 1ROEA 3MFGA 2R2ZA 1AHVA 2VZKD 1P7EA 3PZ7A 1ESFA 1SEBD 3VRBB 1C4PA 3Q8CA 1I4RA 1ZOYB 3B2GA 4RF0A 4XWTA 4TQ1A 2H89B 4EE2A 5G5HA 3AEGB 2V0GA 2PLPA 5BYSA 2G1EA 2AX5A 1W1SA 4ZOHC 1TY0A 2ON8A 1YNTE 2LEKA 2SAKA 1HZ5A 4JX1C 1XEEA 1E9MA 3VR9B 5BMGA 1UUPA 4PT5A 2FUG1 2IGGA 4WWMA 1D5MC 2TSSA 2LMCA 5EE1A 1YJIA 2WU5B 2L32A 2CU3A 4TMAB 5BYQA 1OFFA 3AN1A 1F0XA 2SEBD 4ARIA 1ZE3D 1VAOA 1YJJA 2BYTA 2WQYB 2BTEA 5D3IB 2WXMA 2Z8LA 3P63A 1DOIA 2AQ2B 4WIPA 3PM9A 1SE4A 1TS2A 2WXJA 2WXGA 2X38A 4XWWA 5I4DA 2AQ1B 3W2DA 3U52E 3BVMA 1N62C 4RGMA 5G5HB 1Y56A 3J9CA 1FNUA 1X2GA 1VDVA 1NEKB 1YMHE 1I4GA 3P1MA 4RGTA 1N63C 3NVVB 3IT6B 3BZDB 2PKOA 4OZCA 2P4PA 4WH4A 3LYYA 4DQOC 1SIJA 1IGCA 2DWQA 3V05A 2I38A 1E8HA 4B0EA 1A70A 4CQNA 3AV8A 1WVEA 3TEWA 4TQ0A 1C4CA 3HRDD 1TY2A 3E56A 5AE1A 3SR6A 1MVKA 1UNSA 2NTTA 2Q5WD 3W8WA 1AHZA 1EU4A 4MT5A 1W1QA 3Q69A 1EM7A 2I0KA 5FXPA 1E8GA 2RDGA 1TJEA 2EELA 2IGHA 3W9CB 1QLTA 4JAYA 2NTSA 1VJKA 4US9A 4P16A 3LLBA 5EE9A 4YTPB 1PDXA 2M0AA 1KTKA 1VLBA 3BW7A 4OHJA 4YSYB 1GPXA 4PVKA 1V1OA 5C3JB 2VFTA 4L2YA 3NS1A 1YN5A 3HVDA 3TUOA 3NVVA 1JWBD 2QILA 2PMVA 3AEDB 4RNAA 2WXHA 2E3TA 1JALA 2EKIA 1V1PB 1Q10A 1FEHA 4OALA 1HQRD 5I1VA 1X2HA 2V3PA 4US8A 2K3UA 1AHUA 1DIQA 4PVHA 5LNK1 1KLGD 3CIRB 5BMIA 2PLSA 3P4RB 3W5UB 4JB1A 3OWEB 4DXFA 2WXLA 5G5GB 4PVEA 2KMMA 3KQ4A 3B9JA 4KKIA 1XLPA 1B9RA 1I4HA 1JMLA 2ZW1A 3GSYA 4ZYSA 3FILA 4REZA 5K8EA 3H8HA 4C80A 1YQ4B 3TSSA 1ENFA 1BUIC 4HJGE 1FRRA 1QOBA 2EXRA 2KN4A 1W1RA 5FXFA 3R2TA 1L4ZB 1FIQB 2VAOA 2AQ3B 3AE4B 4OZAA 2OAIA 1JW9D 1NYQA 5AE3A 1N60A 4N59A 1QOGA 1K52A 1FXIA 1OQRA 3AB5A 2WXQA 3Q8EA 5AUIA 3U4EG 1SJHD 3ZJVA 1CQVA 3PO0A 2MJDA 3U7ZA 1N5WC 1T3QA 2VFUA 3R2IA 2R61A 1WYGA 1XCTL 1C9FA 2DBYA 3SFEB 1JWMD 1DOYA 1GB4A 3W8XA 2MEKA 3C0PA 5HMRA 3LB8C 2KDMA 5G5GA 1L4DB 1K53A 3P4PB 5C2TB 4A90A 2IDYA 1UGJA 5HFYA 4NAWB 1V97A 3AEFB 2CJNA 2BVGA 1XLNA 1TKGA 3B2FA 2Y5CA 1HEZE 5BMHA 3TEZA 2P13A 1WSPA 1E6EB 1IBXB 2UUVA 2IJ0A 3SR6B 4KKJA 3NZ3A 2JXTA 1QOFA 4KGTA 4N58A 5EE0A 1UXYA 4PZFA 2FBWB 4GDKB 2JYTA 4HKQA 1FCLA 2WS3B 1WXQA 1ACCA 1FNWA 2GI9A 2N7JA 1RYJA 4H2AA 4A8XC 3NS1B 2NMQA 5T8IA 4PWCA 1FM0D 4L23A 2P3HA 4XE0A 2KQ4X 3U2SC 1SF0A 1F2RI 2FE8A 1SE2A 3ETRB 4M0WA 1F2RC 1XLQA 3GP7A 1L0XB 1IUEA 1D4BA 2O3GA 4DNSA 2XNAC 3EA6A 2OEDA 1E10A 1NENB 4IKGA 1DGJA 1E8FA 2INPE 1FFUA 3IAS1 2XN9C 4ZOHB 2H88B 4AS1A 1GOZA 3MHZA 2WXPA 3AE1B 3BVGA 1TS3A 3RPFC 2QKNA 3D2HA 1VZ7A 1E0YA 4C7YA 2WXKA 3NVYA 1TKYA 1ET6A 3HVZA 1VZ6A 4JPSA 3TEYA 5AUKA 2GB1A 3ZGZA 1PGAA 3TEXA 2JQRB 1VQZA 1IGDA 3NRZB 3KJMA 5AE2A 1RWSA 3AE8B 3URYA 1EWYC 2Y3AA 3NVYB 4ZHPA 2V4IB 1PGBA 3A7UA 1J7CA 1AW7A 4KGRA 3AE3B 1QLUA 2LUMA 2WDWA 2YEPF 5HG2A 3I99A 4BC7A 1W1KA 4JWSC 4HROA 2K0PA 4WAFA 1K51A 2K22A 1YN4A 3VRAB 2W3RA 1ZXHA 3E9SA 1L5PA 3V3XA 3P4SB 2JYEA 4YTMB 5MPOA 1HXYD 1WRIA 1RM6C 2JU6X 1K50A 4IDIA 1W1MA 3AM9A 3NRZA 1D6EC 4UD8A 5BYRA 3D2JA 2ICIA 3AE9B 4NZLB 2NQWA 3KWLA 3O13A 1N5WA 2QPMA 3FWAA 1VR9A 2PTLA 3PQBA 2LHEA 2WXOA 2L1AA 3KWVA 4DXGA 2J42A 2LJIA 3DWMA 2VFRA 3AEBB 4N6EB 4YT0B 5E6JA 2N0SB 1W1OA 1PGXA 3A7AA 1JCKB 3NUHB 3WCQA 2L83A 4P6VF 2J53A 4NAMA 3HRDC 4PVJA 1T6BX 1W1LA 3DQ0A 3P4QB 3FILB 4B0MA 2V3NA 4RH6A 1YQ3B 3AEEB 1FMAD 3AE5B 2WDVB 3BK1A 2RDHA 4XDDA 3SFDB 2J4XA 1N63A 2J52A 3EUB2 1KFYB 2M19A 1WGKA 3MJ5A 5I1WA 3Q8BA 3LAEA 3BVZA 1XXGA 2WU2B 4TVYA 3VTEA 1UWXA 2QIEB 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSK A;  2GQU A;  2CJO A;  3JS8 A;  2ACZ B;  2JX5 A;  1E7P B;  2KAJ A;  2BVF A;  1T3Q C;  1PFD A;  3EUB 3;  5GXG B;  3S1D A;  2RK5 A;  1KF6 B;  2BT6 A;  3FC4 A;  5ADZ A;  2Q85 A;  1L0V B;  3FAH A;  1TKE A;  2B76 B;  4XLO A;  2BS3 B;  1RFK A;  1DOX A;  1AYF A;  1V8C A;  3ABV B;  3S1F A;  1UWM A;  1XLO A;  4O95 A;  1ZP0 B;  1J7A A;  2GQT A;  3DWG C;  3CWI A;  2OHF A;  1QT9 A;  1MBB A;  5H92 C;  2YVS A;  5FXD A;  2MH7 A;  4YSZ B;  4ZHO A;  1NI3 A;  1XO3 A;  3ETR A;  1RM6 B;  2PLI A;  2M56 B;  1AWD A;  4C7Z A;  4PYT A;  1JWA D;  2WDQ B;  3LXF A;  2WLB A;  1I19 A;  2Q4W A;  4FXC A;  1GAQ B;  1I7H A;  3NVW B;  1DII A;  4YTN B;  3AE2 B;  1N61 A;  4YXD B;  2W55 A;  4WQM A;  1ZXI C;  4JWU C;  1N61 C;  3AH7 A;  3TX1 A;  4USA A;  1E0Z A;  3AE7 B;  1FXA A;  1FFV A;  1L6U A;  4LTU A;  1CZP A;  3NVZ B;  4TVW A;  1N5X A;  3AEA B;  1MBT A;  1QLB B;  1NYR A;  2L52 A;  4A9A A;  1ZXI A;  4BCA A;  1SB3 C;  1FFU C;  3A7R A;  1R7S A;  4HG0 A;  2WP9 B;  2BS2 B;  2E5A A;  1J7B A;  3ZYY X;  3R07 C;  1NVI D;  1DZN A;  3B9J B;  1ZR6 A;  4ML8 A;  2MJ3 A;  2AXR A;  5HQX A;  1N62 A;  2K5P A;  1JQ4 A;  5FXE A;  3NVZ A;  2BS4 B;  1KRH A;  1W1J A;  3BII D;  3HUI A;  1QF6 A;  2PIA A;  2PVO D;  3AEC B;  1FFV C;  1OQQ A;  1L6V A;  2W3S A;  3AE6 B;  1JRO A;  3VR8 B;  3S1C A;  1JRP A;  2PVG C;  2MJE A;  2W54 A;  3NVW A;  1ZUD 2;  1FO4 A;  3L4P A;  5H8Y E;  3DED A;  2K9X A;  1TYG B;  3S1E A;  1F0Z A;  2VFS A;  3AMZ A;  1QOA A;  3W5V B;  2R8D A;  1FIQ A;  4BBY A;  1FRD A;  1SB3 B;  1N60 C;  3W8Z A;  4YSX B;  4ITK A;  2QJL A;  2MBR A;  5EE3 A;  2BVH A;  1PUT A;  1WWT A;  4MLA A;  4HRS A;  2VFV A;  4KX6 B;  4BC9 A;  1WVF A;  5HHZ A;  1CJE A;  2WDR B;  1ROE A;  2R2Z A;  1AHV A;  3VRB B;  1ZOY B;  3B2G A;  2H89 B;  5G5H A;  3AEG B;  2G1E A;  2AX5 A;  1W1S A;  4ZOH C;  2LEK A;  4JX1 C;  1E9M A;  3VR9 B;  4WWM A;  5EE1 A;  1YJI A;  2WU5 B;  2CU3 A;  1OFF A;  3AN1 A;  1F0X A;  1VAO A;  1YJJ A;  2WQY B;  3P63 A;  1DOI A;  3PM9 A;  1N62 C;  5G5H B;  1X2G A;  1VDV A;  1NEK B;  3NVV B;  3P1M A;  1N63 C;  2PKO A;  2P4P A;  1SIJ A;  2DWQ A;  1E8H A;  1A70 A;  1WVE A;  3AV8 A;  3HRD D;  5AE1 A;  3SR6 A;  3W8W A;  2Q5W D;  1AHZ A;  1W1Q A;  2I0K A;  5FXP A;  1E8G A;  1TJE A;  3W9C B;  1QLT A;  4JAY A;  1VJK A;  4US9 A;  3LLB A;  5EE9 A;  4YTP B;  1PDX A;  1VLB A;  3BW7 A;  4YSY B;  1GPX A;  5C3J B;  2VFT A;  3NS1 A;  3NVV A;  1JWB D;  3AED B;  2E3T A;  1JAL A;  2EKI A;  4OAL A;  1X2H A;  4US8 A;  1AHU A;  1DIQ A;  3CIR B;  2PLS A;  3P4R B;  3W5U B;  4JB1 A;  5G5G B;  2KMM A;  3B9J A;  1XLP A;  1B9R A;  4C80 A;  1YQ4 B;  2EXR A;  1FRR A;  1QOB A;  1W1R A;  5FXF A;  1FIQ B;  2VAO A;  3AE4 B;  2OAI A;  1JW9 D;  1NYQ A;  5AE3 A;  1N60 A;  4N59 A;  1QOG A;  1FXI A;  1OQR A;  3AB5 A;  5AUI A;  1N5W C;  3PO0 A;  2MJD A;  1T3Q A;  2VFU A;  1WYG A;  1DOY A;  2DBY A;  3SFE B;  3W8X A;  5HMR A;  3C0P A;  3LB8 C;  3P4P B;  5G5G A;  5C2T B;  1V97 A;  3AEF B;  2CJN A;  2BVG A;  1XLN A;  1TKG A;  3B2F A;  2Y5C A;  2P13 A;  1E6E B;  3SR6 B;  1QOF A;  4N58 A;  5EE0 A;  1UXY A;  2FBW B;  2WS3 B;  1WXQ A;  1RYJ A;  3NS1 B;  1FM0 D;  2P3H A;  1SF0 A;  3ETR B;  1XLQ A;  1IUE A;  2O3G A;  1E10 A;  1NEN B;  1DGJ A;  1E8F A;  1FFU A;  4ZOH B;  2H88 B;  3AE1 B;  3RPF C;  2QKN A;  1E0Y A;  4C7Y A;  3NVY A;  1TKY A;  3HVZ A;  5AUK A;  3NRZ B;  3KJM A;  2JQR B;  1VQZ A;  5AE2 A;  1RWS A;  3AE8 B;  1EWY C;  3NVY B;  4ZHP A;  3A7U A;  1J7C A;  3AE3 B;  1QLU A;  3I99 A;  4BC7 A;  1W1K A;  4JWS C;  4HRO A;  2K22 A;  3VRA B;  2W3R A;  4YTM B;  1L5P A;  5MPO A;  3P4S B;  1WRI A;  1RM6 C;  4IDI A;  1W1M A;  3AM9 A;  3NRZ A;  3AE9 B;  2NQW A;  3KWL A;  1N5W A;  2QPM A;  3DWM A;  2VFR A;  3AEB B;  4N6E B;  4YT0 B;  2N0S B;  1W1O A;  3A7A A;  3WCQ A;  2L83 A;  4P6V F;  3HRD C;  1W1L A;  3DQ0 A;  3P4Q B;  1YQ3 B;  3AEE B;  1FMA D;  3AE5 B;  2WDV B;  3SFD B;  1N63 A;  3EUB 2;  1KFY B;  2M19 A;  1WGK A;  3LAE A;  2WU2 B;  4TVY A;  2QIE B;  2HTM E; 
#chains in the Genus database with same CATH topology
 2XH4 A;  3SV4 A;  2OQY A;  4LVS A;  3JW0 X;  2CU1 A;  1T94 A;  1UHU A;  2BYE A;  2YMQ A;  2ACZ B;  5AK4 A;  2GGI A;  3BWU D;  4M2Y A;  3HSU A;  3THV A;  3I4K A;  1JMS A;  3T3N A;  2L5Y A;  4EWJ A;  1ZQZ A;  3IJL A;  5ALU A;  2KTQ A;  1NI2 A;  2BT6 A;  2MX2 A;  2VAN A;  3QU9 A;  4WAA A;  3MR2 A;  3PTF C;  3TI0 A;  3DJG X;  1C76 A;  3MKC A;  3NJT A;  3ZDT A;  2LYB A;  3MFI A;  1ZQY A;  2K4H A;  2IBI B;  2Y5P A;  4AJW A;  2ZJA A;  3N4F A;  3RGT A;  2QB0 B;  3F5E A;  1E90 A;  3HW2 A;  5JCI A;  1MQ2 A;  2N7E A;  2IY0 B;  3AU4 A;  2K8A A;  2XH0 A;  5IIK A;  5CR0 A;  3BQ2 A;  2Y3S A;  1KFS A;  5JZE B;  2BB6 A;  2QDD A;  3GO2 A;  3L5K A;  1V5T A;  2KK0 A;  3GV7 B;  2W9M A;  3CF6 E;  2CR5 A;  1PK3 A;  4LJP B;  1NU5 A;  4UBB A;  4E4U A;  1EBD A;  4J56 A;  2KNJ A;  4Q2J A;  1FEA A;  5L1J A;  4GU2 A;  4P1C C;  1L2N A;  1GRF A;  3C5G A;  3IG3 A;  4W9H A;  2GQT A;  1TE2 A;  4OJL A;  2KWV B;  1NOM A;  5KL1 B;  3CWI A;  2OWO A;  4I2H A;  3NZU A;  1SWV A;  2KWD A;  3ZNI D;  1HTQ A;  5AM5 A;  3D2D A;  5L1M A;  2HDO A;  3V6J A;  4J3O D;  4H4R A;  5FMH A;  4FX9 A;  2DAF A;  5KFX A;  3PR4 A;  1D8L A;  2JRH A;  4QZG A;  2LI5 A;  1SJD A;  2W04 A;  1XHC A;  1SJE D;  1X40 A;  9ICE A;  3W1Y A;  3IG8 A;  1ZQK A;  2YVS A;  3A9J A;  1ZQQ A;  4EMJ A;  3RRH A;  1PZN A;  2X99 A;  2BQQ A;  3TTE A;  1SL1 A;  3QU4 A;  1S1Q B;  2UVU A;  2KLG A;  2WX0 A;  3RRA A;  2KN7 A;  2ODG A;  2XY5 A;  2N9X A;  5IA7 A;  3ZJT A;  1TZO A;  5L6F A;  1Z2M A;  5AIC A;  3UMB A;  5J8Y A;  4XYC A;  4IOI E;  4LDT B;  3U26 A;  2RAB A;  1EWC A;  1KKO A;  2NS5 A;  3UGV A;  4A55 A;  1MA7 A;  3CRX A;  1KFT A;  5AI8 A;  4F1S A;  2XGZ A;  3ZW3 A;  1JWA D;  3NO1 A;  1C79 A;  2N9K A;  4FXC A;  5KFT A;  4ZRK A;  3TJ4 A;  4F3O A;  1QZE A;  4RQ4 A;  1JIH A;  1B1Z A;  1T0Y A;  4XUS A;  3A9K A;  3Q45 A;  5AKZ A;  4WWN A;  3NVW B;  2LZ6 A;  3CSF A;  4RGO S;  2RP5 A;  4BUR A;  2KIC A;  1SBB B;  1V1P A;  2PMZ F;  1Y8R C;  4YXD B;  2HW3 A;  1PQS A;  2WOW A;  2D3B A;  4WQM A;  2DNF A;  3FW7 A;  4IQW A;  4IG7 B;  1ZXI C;  4M0W B;  2V3A A;  1BGX T;  3EKG A;  5AKI A;  3AH7 A;  3OP2 A;  1ZQU A;  2AKZ A;  2HDE A;  4R64 A;  4ELV A;  1WJU A;  3UXL A;  2Z0E B;  2GGH A;  4RPX A;  2EZZ A;  1TK8 A;  5KT4 A;  3Q8P B;  2E6X A;  4ZRQ A;  1RYU A;  1N5X A;  3DCG A;  3AXC A;  3ECI A;  5L95 C;  1Z19 A;  4NY8 A;  1I4P A;  4DOB A;  1LKY A;  3TMP B;  3PX4 A;  3I6T A;  1C4A A;  3PY8 A;  3PLU A;  2AQ0 A;  2XSX A;  4I6P A;  4YWO A;  3NRW A;  4NJC A;  1XF5 L;  4A9A A;  3R1Z A;  2AU0 A;  2FE9 A;  1MHX A;  9ICF A;  5ALZ A;  4Z6D A;  3A7R A;  4X5V A;  2Z0D B;  5KFE A;  1VZ8 A;  2XY7 A;  3W1S C;  1JPD X;  3PWI A;  4K2S A;  3KYD D;  4NM2 A;  4BKS A;  1ZQT A;  2JXX A;  1QQR A;  4M6W A;  3KUM A;  4EEN A;  1PUZ A;  2J0K A;  3BYY B;  4BZA A;  2W0H A;  3ZYY X;  4FJZ A;  1NVI D;  2XID A;  2ONE A;  1HE8 A;  3PS6 A;  2PU0 A;  1ZD3 A;  4UDU C;  4O5C A;  1EBH A;  2MJ3 A;  5AWV A;  1FNV A;  4K3C A;  1M4V A;  1E8Z A;  3LDA A;  1VD2 A;  3BQT A;  2LVP A;  4F72 A;  1STE A;  5DGA A;  1F8W A;  1AN8 A;  3NVZ A;  1BWC A;  3SAH A;  2LHT A;  3QX7 A;  2R8I A;  4O5E A;  3PHX B;  3GU3 A;  4JMU A;  3JPP A;  2AGP A;  2Y3R A;  4TUU A;  2PVO D;  3AEC B;  2JGA A;  4QWC A;  1HEK A;  4CHK A;  2EQ6 A;  2JWU A;  1Q3V A;  2KFK A;  3PV8 A;  1OQQ A;  4WJP A;  2IPI A;  2KMC A;  2W3S A;  3VQI A;  4MGK E;  4O3O A;  4QNL A;  3PSE B;  4MDK E;  5KG6 A;  1I4Q A;  4TUP A;  3EW9 A;  2LM1 A;  1GRG A;  3NVW A;  1WX9 A;  1ZUD 2;  3PG6 A;  1FO4 A;  3BQ0 A;  2K8C A;  1SIF A;  4GDL B;  3RZW C;  1EXN A;  2ISP A;  2PXI A;  4HNC A;  3DGZ A;  4RQ5 A;  1T0S C;  1GXF A;  5DQG A;  5KFI A;  3N28 A;  4LCD E;  4RPZ A;  3S1E A;  3H9D A;  1GRA A;  2GH1 A;  2MA1 A;  1SE3 A;  3PMN A;  2NRV A;  4MSM B;  2ZTC A;  3W5V B;  4FI4 A;  4H4X A;  4BBY A;  2L00 B;  5IIO A;  2YMP A;  1E7V A;  1XS9 D;  4XDC A;  5D3D A;  1DXS A;  3H0M B;  4RPY A;  3CGD A;  2ZJ5 A;  2UUU A;  4ITK A;  2A8X A;  3TSJ A;  4MAC A;  4BDP A;  5EE3 A;  8ICJ A;  2BVH A;  2IYD B;  2MUT B;  5L1K A;  3FW8 A;  3QEA Z;  3SYZ A;  1JRU A;  2KK8 A;  4NLC A;  1N6Z A;  2M8S A;  2P8C A;  2W11 A;  5IAA C;  1JCT A;  2F76 X;  4EC3 A;  3HK0 A;  1JXE A;  4F4Y A;  1E8W A;  2R2Z A;  4Q8F A;  3RT3 B;  2PLS A;  5DG9 A;  3K4G A;  3L8K A;  1RDF A;  3ISD A;  3B2G A;  2DQN B;  2H89 B;  5EWF A;  4EE2 A;  4O3M A;  4TUQ A;  1XNS A;  4C8M A;  2G1E A;  1A77 A;  4OJO A;  2K8B B;  2JZ3 B;  4H4U A;  4QIW C;  3G6Y A;  3QLD A;  4JX1 C;  3NUQ A;  5ALV A;  4PH5 A;  1E9M A;  3VR9 B;  2CXY A;  3UIN B;  3DGH A;  4NEV A;  1UUP A;  4IS7 A;  4ZRJ A;  2IGG A;  3T5L A;  1RXV A;  1PK1 B;  2LMC A;  3MBY A;  4QZI A;  2WU5 B;  3Q6B A;  2JR5 A;  4BOZ B;  2CU3 A;  3QX1 A;  4TMA B;  3C0R B;  5BYQ A;  1Z00 A;  2GL5 A;  2EZY A;  1F0X A;  1V59 A;  5KFP A;  2DW7 A;  1XO0 A;  3OW1 A;  2GGJ A;  2YY6 A;  5C23 A;  2BYT A;  5E79 U;  2BTE A;  2CFY A;  2BCR A;  1J8C A;  4NLB A;  2QJM A;  3ISB A;  3DDM A;  2NCN A;  5L9X A;  3TBL D;  3PZD A;  2BQU A;  2WXJ A;  2FLN A;  2GBJ A;  5FP0 A;  2NRZ A;  3SMV A;  2AH5 A;  3PZP A;  5I4D A;  3U52 E;  3BVM A;  4DHJ B;  4RM8 A;  1JOA A;  4LNI A;  2EAN A;  5J0S A;  8ICV A;  1BNO A;  3GD3 A;  1RFA A;  4GC7 A;  4C8O A;  4F7Z A;  4M04 A;  3EFC A;  2LI6 A;  5KFW A;  2OZT A;  5J04 A;  4F4Z A;  5T14 A;  2RR9 A;  3RFA A;  2KOX A;  2P35 A;  3UXP A;  4DHZ B;  4KLH A;  1IGC A;  5DPW A;  1ZKQ A;  2YMM A;  4UAV A;  2YVG A;  3AV8 A;  3GZN B;  3UQA A;  4RM9 A;  7ICT A;  3TEW A;  1NJW A;  3CGC A;  5HR6 A;  2NQL A;  1MVK A;  2F5Z A;  5DPR A;  2Q5W D;  1IYF A;  3CP8 A;  1EU4 A;  3HT3 A;  1M6I A;  3Q8S B;  4OD0 A;  3MUC A;  3H7I A;  3I76 A;  4I29 A;  5LXI B;  2JUO A;  2EEL A;  3ZD8 A;  2G5I B;  4AYB C;  4ED3 A;  3M62 B;  1N56 A;  2HOQ A;  5IP4 D;  5J2A A;  5EE9 A;  2V4Q A;  3RNE C;  1EO6 A;  4I2B A;  3ALB A;  2XI9 A;  5KFG A;  9ICV A;  3APF A;  1S10 A;  2D3D A;  2ZIX A;  3H4K A;  3IRU A;  4PVK A;  4QZF A;  1GSN A;  2VFT A;  2BKR B;  4L2Y A;  4ACO A;  3NS1 A;  1SJA A;  3OZY A;  3V5C A;  2E8M A;  3NVV A;  3LVW A;  1EC9 A;  3AED B;  4RNA A;  2A19 A;  2OLA A;  3DDC B;  4FA6 A;  2EKI A;  2ASQ A;  2IOF K;  1RPL A;  1KCZ A;  4KDI C;  2ES6 A;  3T5H A;  5KFA A;  1HQR D;  2R9Z A;  5I1V A;  1D3Z A;  1XSP A;  4DCC A;  1ZQA A;  3HM6 X;  5CHF A;  2PTY A;  1AHU A;  2JT4 B;  1HJP A;  3JPT A;  1ZRM A;  2RDI A;  3CIR B;  2RDX A;  3OC4 A;  1C20 A;  5J0O A;  1RZT A;  1GG3 A;  3OWE B;  3R11 A;  4W9F A;  1Z00 B;  3ORY A;  3QU7 A;  1XLP A;  1WR6 E;  2ZW1 A;  5GTH U;  2IZV B;  4DS4 A;  4ZYS A;  2WAQ C;  1GRE A;  1KBU A;  3FG2 P;  3QCA A;  1ZX9 A;  4REZ A;  2ZIX B;  2AGO A;  4C8K A;  3HJE A;  4LNK A;  3EAO A;  2GBK A;  1ENF A;  2EXR A;  5DKW A;  4HJG E;  1QOB A;  3DG6 A;  3PLV A;  1RAX A;  4A35 A;  5BOE A;  8ICM A;  3PSP A;  2AQ3 B;  4YXJ A;  4OZA A;  1NYQ A;  3VCB A;  4O3Q A;  2OYY A;  1D9F A;  3MC1 A;  1YEY A;  1GO3 F;  5E6O A;  1FXI A;  4I2C A;  5J2F A;  3Q8E A;  3R0K A;  4QWB A;  2ZUB A;  2XO7 A;  4ECR A;  3MFH A;  2C2E A;  2V4L A;  2N9P C;  2G3Q B;  1CQV A;  1UEL A;  2ZVO A;  3PO0 A;  1T3Q A;  3MR6 A;  3BZK A;  2ZUC A;  3GIM A;  4J9L A;  3M6K A;  2R61 A;  3VC5 A;  1WYG A;  2PGW A;  2HHV A;  1JWM D;  5ALO A;  5KAF U;  3RZF A;  5J2K A;  8ICZ A;  4ECW A;  3CST A;  3P4P B;  5G5G A;  4E3C A;  1SJC A;  4FHK A;  1XDI A;  4F4W A;  2VH2 A;  5B66 U;  1V97 A;  2BYV E;  2INC C;  1CRX A;  3AEF B;  2BVG A;  3IBE A;  2VA2 A;  3OPX A;  1TAU A;  3Q3J A;  1ONE A;  1HEZ E;  5BMH A;  3MC8 A;  3TEZ A;  2F44 A;  2KJ6 A;  2FMS A;  2V3S A;  3FV9 A;  4OCZ A;  5ALN A;  1WWV A;  1WXV A;  4KIK A;  4BWJ A;  3GC2 A;  2JXT A;  4N58 A;  3KOO A;  1JI7 A;  2CHX A;  9ICG A;  4PHA A;  4HKQ A;  4GDK B;  3RNA C;  2P3Z A;  4HNL A;  4X2P A;  3KHH A;  2UYZ B;  2NBU A;  2AKM A;  2GI9 A;  2N7J A;  3UIP B;  2PMQ A;  2ATL A;  4H2A A;  1GES A;  2NVU I;  5ALJ A;  2HHW A;  5T8I A;  3NS1 B;  1NJZ A;  3OJS A;  4XE0 A;  4E74 A;  3U2S C;  1SF0 A;  1TAM A;  2W7P A;  2LGS A;  2K89 A;  1SE2 A;  3IHQ B;  2WX1 A;  3ZLH A;  2MNR A;  2H3V A;  3B97 A;  1IUE A;  1KKR A;  2XNA C;  4IKG A;  4M9N A;  1S8O A;  3TCS A;  2WHI A;  1T0Q C;  2M0X A;  4B6W A;  1BPZ A;  3RJG A;  1XT9 B;  5AM2 A;  1NK6 A;  2HVH A;  1RRB A;  1ZQN A;  4UB3 A;  3N4E A;  1TS3 A;  4H4S A;  3QUB A;  5HML A;  3WKD A;  4ICU A;  3LB8 A;  4O3S A;  3WK8 A;  4DL3 A;  3JPN A;  1BQG A;  4LZD A;  4LNF A;  3SD7 A;  3HVZ A;  3L5O A;  3TEY A;  5JRT A;  3ZGZ A;  3RBE A;  2JQR B;  2HHX A;  1IGD A;  1V80 A;  4ECT A;  1JDF A;  2AL3 A;  3P2B A;  1RWS A;  2Z7J A;  5ALQ A;  2GMI C;  3JPS A;  4ZHP A;  3NVY B;  4QZC A;  2MP2 A;  1PGB A;  3A7U A;  2FPM A;  3AU6 A;  3PO4 A;  4G50 A;  4M01 A;  3ZO5 B;  4II2 B;  1RVK A;  1ZDL A;  1KM7 A;  2WDW A;  5HG2 A;  1RLF A;  3I99 A;  4MFA A;  5IOI A;  2HQM A;  4BC7 A;  2C5L C;  4FP1 A;  4FZN A;  3CGB A;  1WR1 A;  1W1K A;  2AL1 A;  4NV0 A;  2O6K A;  5J2C A;  2OZ3 A;  4FS2 A;  4UB8 U;  3C2L A;  4Y2P A;  4BXO B;  3V7L A;  4YQW A;  3ENE A;  3VRA B;  3V3X A;  2EQY A;  4B95 A;  5KL8 B;  4PK1 A;  1RM6 C;  2JU6 X;  4IDI A;  5ALW A;  4J57 A;  3GIK A;  3KBB A;  4QZ9 A;  5JU5 A;  2PTL A;  4F5P A;  1SJB A;  2KVR A;  4DXG A;  1X1M A;  1XSL A;  3M9O B;  2VFR A;  4HPN A;  1IXR A;  1U47 A;  4YT0 B;  3D2N A;  4GIS A;  4DSF A;  4GIR A;  3WK6 A;  1KRP A;  4P0P B;  2KDE B;  2BC1 A;  2P88 A;  2QAR B;  2PCE A;  3PW0 A;  3LAD A;  2O6V B;  4GIV A;  3TAN A;  1ZET A;  3FIL B;  4DWD A;  2PFO A;  4RH6 A;  3N7S C;  4I2J A;  2W9B A;  1SXD A;  4K4H A;  2G06 A;  3AEE B;  3SQS A;  2WOV A;  5KFC A;  3N20 C;  1NK7 A;  2ZJ8 A;  4DSK A;  2G5H B;  2J4X A;  3DIP A;  3RJH A;  1KFY B;  5I1W A;  1WGK A;  2FNJ B;  3IJQ A;  3Q8B A;  3B08 A;  4UAW A;  5ALF A;  1XO1 A;  4E71 A;  4UBC A;  4TVY A;  4YL8 A;  3NZS A;  3L17 A;  3HM3 A;  1UWX A;  1PK1 A;  2QIE B;  2KSO B;  1MN8 A;  3MQT A;  1ZQI A;  2X8X X;  2FPK A;  2W8K A;  3EPI A;  3HIZ A;  2KFZ A;  5CJ7 A;  2KKP A;  4EKU A;  2KC1 A;  3DVN U;  4HKZ E;  2F1H A;  1GRH A;  4H83 A;  2GQU A;  1E7P B;  2KAJ A;  3GRT A;  3JS8 A;  1T3Q C;  1TBE A;  1WE6 A;  2CS4 A;  2JSV X;  1GER A;  2ZC8 A;  2MBH A;  2WPC A;  2JEI A;  1GNU A;  2L76 A;  4B6J A;  5J0Q A;  5KTQ A;  4Y2U A;  3MSY A;  2QHO A;  1KF6 B;  2CHZ A;  3EGR A;  4GME A;  3ZLF A;  3UQB A;  4IP5 A;  3FC4 A;  8ICQ A;  3RNC C;  3WIM A;  5KFZ A;  1SE9 A;  1B4F A;  4MH0 E;  1ZQB A;  4RQM A;  3DFY A;  1STZ A;  1L0V B;  2QSD A;  4R8U A;  1COO A;  1SKR A;  2F8K A;  2WYQ A;  3AI5 A;  3U8Z A;  1XCQ L;  4Z6C A;  3TFS A;  2AQ4 A;  3SEB A;  1RFK A;  3QUC A;  3N7P D;  2LFI A;  1ZOL A;  1UA1 A;  1F77 A;  2PTX A;  3UCD A;  3GV5 B;  2KTF A;  4WJO A;  2DZJ A;  2YB1 A;  1Q46 A;  1S76 D;  2PE9 A;  3H1U A;  3C2M A;  4HYK A;  5DPT A;  4O95 A;  5ALK A;  4RT2 A;  3K75 D;  2Y08 A;  3DHI C;  1Q3U A;  1VRA B;  4DX3 A;  2MSN A;  1MHH E;  2H3Q A;  3QEB Z;  4AP4 C;  3DWG C;  1ZQP A;  3BS7 A;  2F3N A;  1MPE A;  4CE6 A;  1ARO P;  1UCV A;  4PZN A;  4XRH A;  3FYH A;  4KLQ A;  2HJ8 A;  4M9H A;  5ALM A;  1WM3 A;  5DQH A;  4Z6F A;  4Y2X A;  4HK2 A;  3EZ5 A;  5KT2 A;  2BPC A;  1P1A A;  5ALP A;  2EQ8 A;  5FXD A;  4KZ0 A;  4D2K A;  3VFC A;  4GLS C;  3Q8Q B;  2ZG6 A;  1XO3 A;  2JZP A;  1F0M A;  1TS4 A;  1E8X A;  2KX0 A;  4RUA A;  2H3F A;  4C8N A;  2MW5 A;  3DBS A;  1EC7 A;  2D11 A;  4P7I A;  2PLI A;  1D5Z C;  2ZZ0 A;  4HYR A;  4ZH4 A;  1SGG A;  1BZL A;  1FCC C;  1HUZ A;  5AKG A;  1WXM A;  4HDQ A;  1ECQ A;  3WAM A;  4TSS A;  4C7Z A;  5FJR A;  3TAD A;  2ZW0 A;  3JSV A;  1R4M I;  9ICO A;  4HEA 1;  3RR8 A;  3VH4 B;  4CCH A;  2Q4W A;  2DHZ A;  3GZF A;  3M63 B;  2B0C A;  3P42 A;  2KOB A;  4RNN A;  1ZQM A;  1GAQ B;  4B9T A;  2CN1 A;  3TAC B;  4EX6 A;  3OTQ A;  4ARC A;  2OFJ A;  3IP4 B;  1MJD A;  4HCH A;  5AI4 A;  2JZB B;  3AE2 B;  3GQC A;  1LGR A;  4XA5 A;  3O0H A;  4I6L B;  1B43 A;  3WKB A;  4NJ8 A;  1ZDX A;  4CF4 A;  3SQP A;  3FW9 A;  2W55 A;  5DDY A;  4GGH A;  2DYO A;  1BVS A;  1M6Y A;  2PFQ A;  4W9E A;  5J2R A;  1N61 C;  4DHG A;  5JRB A;  4KMU A;  3X0W A;  3NTU A;  2KQ7 A;  1L7N A;  4YCX A;  3EWA A;  1BPX A;  1WY8 A;  3RNB C;  4KLL A;  4HPM B;  2YVJ A;  3V6K A;  4WWO A;  2CRX A;  1J0G A;  2C60 A;  2WFA A;  1V86 A;  1CZP A;  1OTR B;  4ED8 A;  2LGI A;  3U4F A;  2HVI A;  2Y1J A;  3IDW A;  5CHG A;  3H40 A;  3MC0 B;  4L1B A;  4P1B C;  2MUC A;  1NKC A;  2P8B A;  1NK4 A;  3RUI B;  3UJE A;  1KOT A;  7ICF A;  5KT5 A;  2MBO A;  1U48 A;  7ICN A;  4IW0 A;  1ZXI A;  2GOL A;  1P43 A;  2BCU A;  4I27 A;  2KYW A;  3F53 A;  1SZP A;  1SB3 C;  1M94 A;  2G0A A;  4ECQ A;  3TL5 A;  3KVF B;  1R7S A;  5J2J A;  5CEH A;  4AUQ C;  3PK7 A;  3UJ2 A;  5JH5 C;  2K39 A;  3KH0 A;  2K60 A;  2QB1 A;  3T3O A;  2E5A A;  2GRI A;  4KWS A;  3RAQ A;  2A5U A;  1MC8 A;  2QDE A;  1JWU D;  4NY0 A;  2KAC A;  1KSP A;  1DZN A;  1EF1 A;  3H4B A;  3FJ4 A;  3SN4 A;  2IPK D;  5J0R A;  3UF8 A;  3RB4 A;  1HZ6 A;  2G45 B;  2NPT A;  7ICH A;  2BBC A;  4PWB A;  1NJY A;  4YR0 A;  1JQ4 A;  3UJS A;  4DN1 A;  1MI0 A;  5FXE A;  3NOB A;  5CP2 A;  1NHR A;  2ZNV B;  1MDL A;  4UW9 A;  1KRH A;  2K25 A;  5KFH A;  1GB1 A;  3QTP A;  3L10 B;  4M0A A;  3BII D;  4OW0 A;  2X8G A;  1TZZ A;  4P0Q B;  1FFV C;  5ALH A;  2R8G A;  1MQ3 A;  4IRK A;  1YIW A;  2WXF A;  3IAM 1;  3CXO A;  3UJF A;  1ZRN A;  1JRO A;  2KEY A;  1PVQ A;  1BPY A;  2KKC A;  2I2Y A;  1XU4 A;  9ICX A;  1N48 A;  2W54 A;  1QCK A;  5J0P A;  4N9F 4;  2DKX A;  2WAQ F;  5AKH A;  4FBU A;  5B5E U;  2L05 A;  3L4P A;  3LWM A;  2F1J A;  2GO7 A;  2Z59 B;  1GRB A;  3DED A;  1L0Y B;  2HHQ A;  1ZQF A;  3UI3 A;  4JHM A;  4GGB A;  1TYG B;  5AHX A;  3ZDC A;  3FXG A;  4IQU A;  3UMG A;  1EU3 A;  1L7Y A;  2R8D A;  3GZN I;  4JE3 B;  2XH2 A;  1FRD A;  1IP9 A;  2Y4G A;  4KLT A;  2YEP B;  2XCP A;  3OAW A;  3VUX A;  3L54 A;  1IIP A;  2QJL A;  3S5S A;  4FS1 A;  2E1F A;  1PUT A;  3PRP B;  3V4B A;  2QEJ C;  5FS8 A;  8ICR A;  2KZM A;  2N7D A;  4KEM A;  2VFV A;  5ALI A;  4FUL A;  2I6X A;  2WF7 A;  3RCZ A;  1QH9 A;  3K1Z A;  1WGY A;  2OH2 A;  1CJE A;  3DBR B;  4RCO A;  4C4R A;  2NYV A;  2WDR B;  1KDH A;  2VZK D;  4I2A A;  9ICJ A;  1SEB D;  7ICS A;  2K6D B;  3VRB B;  1C4P A;  2JEJ A;  1ZOY B;  4RF0 A;  1Q8K A;  2PFN A;  4TQ1 A;  5G5H A;  4ED7 A;  5BYS A;  4MJS A;  4ZOH C;  1TY0 A;  3C5F A;  2WHE A;  2HXU A;  5C0Y A;  9ICB A;  1XEE A;  4K1W A;  1QQ5 A;  1MO9 A;  2KFN A;  3FCP A;  2CHW A;  4ECU A;  4EMW A;  2FUG 1;  3G6X A;  2GBM A;  2ZEQ A;  1Q5W B;  1JX4 A;  2BR0 A;  2LWP A;  3DDH A;  2TSS A;  5IIM A;  4NL9 C;  1BKH A;  4PPX A;  2RRD A;  3E58 A;  5CB1 A;  4P4P A;  3PGE A;  3EEC A;  3L13 A;  2BQR A;  1ZE3 D;  4ECV A;  2PE6 B;  4DF4 A;  5KFF A;  1P48 A;  3A0H U;  5BOF A;  4PHE A;  3QA8 A;  1NDA A;  2WPE A;  1S3S G;  4URK A;  3P63 A;  1O03 A;  3HKZ C;  4KX3 A;  3F5A A;  5BO4 B;  2AQ2 B;  1V6E A;  3PM9 A;  2KHV A;  3R3M A;  4NM1 A;  5KAI U;  3ZI4 A;  2VKQ A;  4DS5 A;  3Q4D A;  7ICO A;  1X66 A;  2AQ1 B;  2UWQ A;  3V60 A;  3W2D A;  3P3B A;  4DF8 A;  3PT2 B;  5G5H B;  2KHQ A;  3CNH A;  3MDC A;  1MUC A;  3ZVV A;  1WGD A;  2WWZ A;  3WAO A;  3Q2A C;  4GYP C;  3B0Y A;  3WK4 A;  4BX9 C;  3VTW A;  5DGB A;  4EZ9 A;  4W9J A;  5KFL A;  3ED5 A;  2MRP A;  2W9C A;  4LDT D;  1OGW A;  4OZC A;  4NNJ B;  1SV0 C;  2GWS A;  2OOB B;  3LJ3 A;  1EUV B;  4EQR A;  5AI5 A;  5IDZ A;  4J03 A;  2LJ5 A;  3V05 A;  2I38 A;  8ICL A;  4DFJ A;  2MSE D;  3QK0 A;  3V6H A;  5GRT A;  4RUC A;  4KLM A;  4ED1 A;  4TQ0 A;  7ICK A;  1TY2 A;  1CUK A;  2Y9T A;  2QCZ A;  2NTT A;  3AU5 A;  2BCP A;  1OUQ A;  4YN4 A;  1W1Q A;  3Q69 A;  1EM7 A;  2V6O A;  4HPL B;  2BPG A;  1E8G A;  2NO5 A;  7ICM A;  2RDG A;  3OJ3 A;  2JEG A;  1QLT A;  4JAY A;  1VJ5 A;  2NTS A;  3IK4 A;  5KG3 A;  3LLB A;  4JB3 A;  4DK5 A;  4AOF A;  1E7U A;  2M0A A;  2OX4 A;  4OHJ A;  2D07 B;  3ZDE A;  5DCN A;  1GPX A;  1NHS A;  1V1O A;  3K9P B;  5C3J B;  3T9L A;  3PW2 A;  3B0X A;  4DLE A;  3TUO A;  5LXH A;  3PRZ A;  4RQ6 A;  5FS9 A;  1L7P A;  1RQL A;  1ZY8 A;  1TIF A;  1V1P B;  1Q10 A;  5L83 A;  4YMO A;  1FEH A;  3QN3 A;  5J2G A;  4KV2 A;  5III A;  2IO2 B;  2K3U A;  4PVH A;  3GIL A;  4DLG A;  2Y9U A;  4M6W B;  3SD5 A;  4EEK A;  5KFD A;  3P4R B;  4HVB A;  1DRG A;  5KFM A;  4DXF A;  4CNQ A;  8ICT A;  1V81 A;  4J9P A;  2RPQ A;  1YQZ A;  4K7Z A;  4E5T A;  1X6I A;  2KMM A;  1U49 A;  3KQ4 A;  4PVE A;  4IHC A;  9ICT A;  2BGF A;  3IN5 A;  3QUT A;  2ZIU A;  3WU2 U;  4I28 A;  1RXW A;  1TAQ A;  8ICB A;  3QUQ A;  1L7O A;  8ICO A;  3FIL A;  4MKS A;  5K8E A;  5CWR A;  1ZQD A;  4C80 A;  1T7P A;  1YQ4 B;  2KZR A;  1OEP A;  4DSE A;  2W43 A;  3KHR A;  2KVS A;  1FRR A;  2XC9 A;  3DK8 A;  1W1R A;  2PI5 A;  4DWF A;  3R2T A;  2TPR A;  3AE4 B;  2KWC A;  4Q8E A;  3RI7 C;  3IVF A;  1SXE A;  2V3B A;  3JSV B;  4J9O A;  4FLH A;  4N59 A;  2YQE A;  8ICG A;  1QOG A;  1WGG A;  2ZTD A;  4WJN A;  2ZPN A;  4RQ8 A;  4H4T A;  2KJ5 A;  3D6J A;  3I28 A;  3N30 A;  3U4E G;  2WF6 A;  5J0X A;  1MOK A;  3SSZ A;  3ZJV A;  1GV4 A;  1HIW A;  1U45 A;  1TKD A;  1N5W C;  3U7Z A;  3GRS A;  3GII A;  4HCL A;  1FEB A;  3T8Q A;  5U25 A;  2ZXH A;  2DBY A;  3UMC A;  3SFE B;  3W8X A;  5HMR A;  3WK7 A;  1D9D A;  1H38 A;  1ZQE A;  1V2Y A;  2MEK A;  3VDG A;  3C0P A;  3NY5 A;  4Y2J A;  3Q8L A;  5KG5 A;  1TVA A;  2FLP A;  2M1M A;  4S0R A;  2KMD A;  2O6V D;  3ZTD A;  5HFY A;  3ZLZ A;  5FJO A;  5AK5 A;  4YVZ A;  3MY9 A;  5EWE A;  1TKG A;  3B2F A;  2Y5C A;  3F2C A;  1R6W A;  9ICU A;  1WSP A;  4HJK A;  2UUV A;  2ALZ A;  2PTW A;  1CI4 A;  1R0M A;  2LD9 A;  3NZ3 A;  4KGT A;  1QOF A;  5EE0 A;  4CGZ A;  1WRD B;  5DLG A;  5J2H A;  4NL9 A;  2IHN A;  4KLJ A;  2MHJ A;  4ACF A;  4EOY A;  1UXY A;  2WS3 B;  1B0X A;  3EPG A;  1R4N I;  1SV4 A;  7ICJ A;  4TQR A;  2HBJ A;  4A8X C;  4AP9 A;  3PR5 B;  2NMQ A;  4I2F A;  5AM4 A;  3BJY A;  2KE7 A;  3T79 A;  2P3H A;  2P66 A;  5AZH A;  1LVH A;  2I1J A;  4FAD A;  1F2R I;  3ETR B;  3MZN A;  2FI1 A;  1F2R C;  3GP7 A;  4HDO A;  3S6J A;  3DBL B;  4DNS A;  2O3G A;  2ZZC A;  2K8B A;  1L3U A;  1NEN B;  1WMH B;  4IC9 A;  2KN5 A;  2RLT A;  3JPQ A;  4F5Q A;  3PPA A;  3R7R A;  1ZQV A;  5ALL A;  2P0I A;  2XK5 B;  1E8F A;  2I5Q A;  2KXJ A;  2MAX A;  2IY1 B;  2D6F C;  1FFU A;  4GYP A;  1XAN A;  3EC8 A;  2QQ6 A;  3Q8M A;  3T6C A;  4M00 A;  3DEQ A;  2Y0S F;  3OSN A;  2YVF A;  1ZMD A;  1H2I A;  2WGS A;  3MHZ A;  3AE1 B;  5ALT A;  3AL0 B;  1NZB A;  4NLN A;  2KX3 A;  1VZ7 A;  4HCD A;  5BPC A;  5DB9 A;  1E0Y A;  2QKN A;  2O2V A;  5ALR A;  3NVY A;  5J0Y A;  3Q3N C;  4HCP B;  5DBB A;  4AWJ A;  3ALR A;  3UXN A;  5J17 A;  3UM9 A;  2ZIV A;  3RJF A;  4JPS A;  3SDL C;  2Y0S C;  2C22 A;  2PU1 A;  3NRZ B;  3KJM A;  1VQZ A;  2B6G A;  2FKP A;  2PGE A;  2PPG A;  2DZM A;  3N1X C;  4LII A;  2N4F A;  1HUO A;  3ZVH A;  5J8Y C;  1QQ6 A;  1KD0 A;  2EDU A;  2A3V A;  1ZKH A;  4IWP A;  4ANV A;  7ICQ A;  1V5O A;  2YEP F;  4GR1 A;  4MHV A;  3OZM A;  4JWS C;  2J6U A;  1EC8 A;  4HRO A;  3RJK A;  3GD6 A;  5D46 A;  2K0P A;  2K22 A;  4IWQ A;  4PL2 A;  5KFY A;  4Y2Q A;  3H0R B;  1TK0 A;  3BJS A;  2W3R A;  2MQJ A;  3A4R A;  4YTM B;  5MPO A;  3MAB A;  3DBL I;  2F8L A;  3T5K A;  1K50 A;  5JHA A;  1W1M A;  3ZIM A;  2MWS B;  4MM3 A;  3AE9 B;  4ASW C;  3RH6 A;  4NZL B;  2JF5 A;  4EZK A;  3KWL A;  3O13 A;  1N5W A;  2NQW A;  2QPM A;  9ICA A;  2PP3 A;  5JCN A;  5E6N A;  2WF8 A;  4EEL A;  3MR5 A;  2IND C;  2DPI A;  2WXO A;  3P93 A;  1LQB A;  4CF5 A;  4MGG A;  3CYJ A;  2EKE C;  3LVV A;  2NBV B;  3AUL A;  3PFR A;  5ALX A;  5IIL A;  2JZZ A;  3RB0 A;  1TFR A;  2K6Q A;  4O3N A;  3A7A A;  1JCK B;  4KLE A;  4EZL A;  3WCQ A;  1ZQC A;  2J53 A;  8ICK A;  4GN1 A;  4NAM A;  3ZDM C;  2EQ7 A;  3HRD C;  5D94 A;  1W1L A;  2AEH A;  5KFU A;  3TIX A;  4DSJ A;  4B0M A;  4KVG B;  2JEF A;  1X6J A;  1X9X A;  5JHB A;  4J3Z A;  2HHS A;  4B9S A;  3AE5 B;  3BK1 A;  3DBR I;  3CK5 A;  1IG6 A;  2RDH A;  3TWB A;  2HOF A;  1J2M A;  3WK9 A;  3SFD B;  1NKE A;  1NHP A;  1N63 A;  2W9A A;  2J52 A;  3C23 A;  3EUB 2;  2JH7 A;  5DBA A;  3RJI A;  3RB3 A;  2UVW A;  4KMO B;  4DFD A;  1F52 A;  5KT7 A;  2GH5 A;  4UB4 A;  5IO9 A;  2ZZB A;  3BVZ A;  1GC7 A;  5JCM A;  1LV5 A;  2WU2 B;  3VC6 A;  3VTE A;  2BYF A;  2IOF A;  2HTM E;  1MFW A;  4KLD A;  3R25 A;  5IIJ A;  5KFS A;  1L5U A;  4RU9 A;  4DSI A;  1S7M A;  1CMX B;  1TYT A;  4DQS A;  2QAR A;  2POZ A;  3B0A A;  3K1G A;  5TSS A;  2WF5 A;  7ICI A;  4F5R A;  4J6I A;  3EUB 3;  3V7K A;  4ECS A;  2VZK B;  4DDI D;  2KNB A;  4JDR A;  3Q8K A;  3T3F A;  3TAQ A;  2HHU A;  1GUA B;  2MBB B;  4BKS D;  3S1D A;  2FAZ A;  2JVC A;  3D9X A;  1R4M B;  5AI0 A;  2ASD A;  2BKF A;  3RJ8 A;  4PZO A;  3QKE A;  2KJR A;  4OVU A;  5HI1 A;  3MDA A;  4FN2 A;  3R9K A;  2PKE A;  1BPE A;  4B9M A;  2JH1 A;  4P0Q A;  4DQQ A;  4HWI B;  4M47 A;  2Q85 A;  2H3Z A;  2C3D A;  2YVC A;  1P3Q U;  3IT4 B;  2EAM A;  8ICN A;  1TKE A;  4IR9 A;  1OXJ A;  1KFD A;  4XLO A;  2FYM A;  1ZQX A;  4KGS A;  2AL6 A;  3KHL A;  2HJ1 A;  4RT3 A;  3ZQ4 A;  4MH8 A;  4UQG A;  1ZQH A;  2MA9 B;  1AYF A;  4ANW A;  1V8C A;  2K4I A;  2KSO A;  4NLZ A;  1MSW D;  2QAE A;  4TUS A;  1DK3 A;  2LXC A;  2WXI A;  3FYY A;  3S1F A;  5GMV A;  3R8B A;  4G9B A;  4ZRI A;  4H2H A;  3AU2 A;  3LYS A;  2POD A;  1LVL A;  1TGZ B;  1SV0 A;  1OEY J;  1GET A;  2D3C A;  2O56 A;  3I9V 1;  4EEW A;  1TTN A;  2GRT A;  2KWU B;  4A6Q A;  5AKE A;  2B21 A;  3L0W B;  4UAU A;  3N97 B;  2D8C A;  2KLC A;  4QZE A;  3RH5 A;  3PZ8 A;  2LGX A;  2WXR A;  2FCN A;  4YP3 A;  5GTI U;  3Q8F A;  2D3A A;  5BOL A;  1MBB A;  4DL2 A;  1PDZ A;  4KLF A;  5JUM A;  3QAR A;  2XIC A;  4J9M A;  1YX5 B;  5EWG A;  2IGD A;  5JTI A;  5H92 C;  5BOM A;  3QNM A;  4JWM A;  1ZPS A;  2C7H A;  2MH7 A;  2OG9 A;  4ZHO A;  2D5G A;  3PW4 A;  2LM4 A;  4BBN F;  1FD6 A;  1NI3 A;  3ICX A;  2LUE A;  3SJN A;  2JV3 A;  4F2R A;  2ONQ A;  2D2Q A;  2PTZ A;  4JQW C;  3UPQ A;  4EM4 A;  4F2S A;  1AWD A;  3I3T B;  1Z4N A;  4WQO B;  5DPS A;  1ONF A;  4PL1 A;  5AEK B;  4P2H A;  1A6S A;  1QKZ A;  2BDP A;  3JPR A;  6ENL A;  4PYT A;  1C77 A;  2WDQ B;  4K4I A;  1RYS A;  2E8O A;  4WUR A;  3KLJ A;  4R66 A;  1YD8 U;  1K1Q A;  2K4E A;  4F5N A;  3WKC A;  4K7U A;  5CRX A;  4MFC A;  3Q8A A;  4K3B A;  1IYX A;  3D2S A;  4RGN A;  1I7H A;  1KN0 A;  3VTV A;  3ZNH B;  4KSK C;  2ZZP B;  1DII A;  2D3G A;  4YTN B;  4CYE A;  4J1O A;  3D32 A;  1UBQ A;  3UJR A;  2CHR A;  3KUC B;  1I4X A;  4JWU C;  3EEZ A;  1AQ6 A;  3TX1 A;  3ETL A;  4PYZ A;  4KTQ A;  1NK0 A;  2I1K A;  3AE7 B;  1E0Z A;  3T5J A;  3CT2 A;  4ADW A;  1BML C;  2RHF A;  8ICX A;  4I6N B;  4E4F A;  1L6U A;  1X2I A;  2W9C B;  4C4T A;  3OGU A;  4OZB A;  4NPN A;  3RF9 A;  3LK9 A;  3AEA B;  1MNS A;  3CGE A;  4P0P A;  1QLB B;  1PYW D;  4IZG A;  2VRR B;  2QJN A;  1NYR A;  2DYM A;  2CPR A;  1ZYQ A;  2KZ3 A;  4BCA A;  5HHD G;  3POP A;  1QSL A;  1WIA A;  1WYW B;  1YQB A;  3SN1 A;  3IXS A;  3VHT C;  3L08 A;  1KEJ A;  3T8M A;  3VUW A;  3SI8 A;  3OHB A;  2KG5 A;  1J7B A;  2DLB A;  4BVU C;  3NAS A;  2KJ8 A;  2G4D B;  5KNI A;  3R07 C;  2I9G A;  1C78 A;  4EZJ A;  1BPD A;  1WXS A;  3B9J B;  3DGB A;  3LXD A;  1Q1R A;  2MCN B;  4ML8 A;  4Z17 A;  2O6V A;  2KP7 A;  1GRT A;  3TAR A;  1MDR A;  5HQX A;  2FJ6 A;  1N62 A;  2F2A B;  5CA7 A;  2PMZ C;  4YMN A;  1KL9 A;  4U7C A;  1D8Y A;  2KDF B;  2BS4 B;  2BWE S;  1W1J A;  2KC2 A;  3ONN A;  1WMH A;  4OVZ A;  3NFU A;  1ZD2 P;  5DB7 A;  4TKN A;  4H4W A;  3PW7 A;  4MF2 A;  3HUI A;  4JK1 A;  3QYP A;  3SAG A;  1WE7 A;  3C8Y A;  1WZ0 A;  2J6T A;  4JLC A;  1N2X A;  3DK4 A;  2BKE A;  4A3O A;  5HMM A;  2KJH B;  2AHO B;  1L6V A;  4G8T A;  3DV9 A;  5E6P A;  3VR8 B;  3ES7 A;  3S1C A;  4MM3 B;  1ZQR A;  2OEH A;  1JRP A;  5L6G A;  4MFF A;  2PVG C;  3H7V A;  5DB8 A;  2BCV A;  3MGV A;  3A4S C;  3OHA A;  3ONS A;  3PST A;  3QQ8 B;  2OVL A;  2WB1 F;  2N9L A;  3DES A;  1ET9 A;  2PPH A;  4HCN B;  3RR7 A;  3H4D A;  1WJN A;  3N9Y C;  2J7Q B;  1KQQ A;  2K9X A;  1WUD A;  5KFO A;  2DW6 A;  4ICA A;  1ZJN A;  4KPR A;  5ALY A;  2NPT B;  1DTN A;  3M9N B;  4ECZ A;  1N60 C;  4RFB A;  2W82 A;  2HE7 A;  5FR6 A;  2V9H A;  4EBD A;  4JV1 A;  2WXN A;  4YSX B;  1P9D U;  2OO6 A;  1NK5 A;  4IRD A;  1WJ4 A;  2RD0 A;  4ZRP A;  4MLA A;  1NK8 A;  5FJP A;  1K8R B;  1LO5 D;  2XGP A;  1J97 A;  2WNM A;  4G3X B;  4KX6 B;  4EMI A;  4BC9 A;  4AQ7 A;  3TJI A;  2INN E;  1WVF A;  5KHO A;  2ZXI A;  2DPJ A;  4J9S A;  4GLX A;  4F4K A;  1ROE A;  3MFG A;  4Y2Y A;  4FHJ A;  1AHV A;  4QJF B;  3PZ7 A;  1ESF A;  5AZF A;  1YZ7 A;  2BHN A;  1NZP A;  2M9N A;  5TZV A;  2P6U A;  1I4R A;  2BVC A;  2DF4 B;  3Q8C A;  4KIK B;  2NV3 A;  4YFK A;  1WH3 A;  1S9F A;  4EQX A;  4GDK A;  3AEG B;  2V0G A;  2PLP A;  2HXT A;  3WAN A;  2LYA A;  3C1Z A;  1W1S A;  2ON8 A;  2PS2 A;  1XQQ A;  3IG5 A;  2SAK A;  1HZ5 A;  3IV6 A;  1O08 A;  5EOZ A;  2QGY A;  3RJJ A;  1T8E A;  3ZXV A;  1WF9 A;  3A0B U;  3C2K A;  2Y5B B;  4PT5 A;  3JW7 A;  1ECW A;  1D5M C;  5CX3 A;  3PW5 A;  1MG4 A;  1YJI A;  2LXA A;  2LGY A;  2LMR A;  4S17 A;  3DER A;  2E8N A;  9ICL A;  4GIB A;  3FVD A;  2SEB D;  1Z1B A;  3SBF A;  3ZVI A;  3CB3 A;  3I1Y A;  4MGY E;  3TOY A;  1VAO A;  1YJJ A;  4IL0 A;  2AWT A;  2FUH B;  4GRT A;  1WI0 A;  4NLK A;  4DWI A;  1IPG A;  4DQR A;  3N4M B;  3DHH C;  1S0N A;  3KTQ A;  4WIP A;  2X38 A;  1TS2 A;  4GFJ A;  2KO3 A;  3KFU F;  4B9V A;  4XWW A;  2NBW B;  4MSQ B;  4YR3 A;  9ICW A;  2EAO A;  1N62 C;  3OSP A;  3J9C A;  5EDS A;  4BFR A;  4PS3 A;  3KUZ A;  1I35 A;  1X2G A;  1VDV A;  2VA8 A;  4IQT A;  1NEK B;  2EZX A;  1FXT B;  2KTR B;  1N63 C;  2AL2 A;  3IT6 B;  1FHV A;  2X8H A;  5TR5 A;  2PKO A;  3VXW A;  2JXJ A;  5HNK A;  3CXB A;  2V1Y A;  1UA0 A;  3LYY A;  2P4P A;  3U7D A;  4FE3 A;  2O2V B;  2C7N B;  2DWQ A;  2V9W A;  4W9L A;  5L1I A;  1E8H A;  4B0E A;  1A70 A;  2X8C A;  3DFH A;  1WVE A;  1QLN A;  1DNC A;  1C4C A;  3CMM B;  1S97 A;  3E56 A;  2R8J A;  2CKH B;  4IP4 A;  1S0V A;  4P4O A;  2DGZ A;  3SR6 A;  4Q43 A;  1J2N A;  1GJZ A;  1AHZ A;  3K9O B;  4MT5 A;  3BS5 A;  3RCY A;  3KHG A;  4BXO A;  3U30 A;  2I0K A;  4QZA A;  1RG6 A;  1YJ1 A;  1LKY B;  3ZDD A;  3BIN A;  4E0D A;  5D4B A;  3VA8 A;  2PP0 A;  2RDB C;  2RGF A;  3B1L X;  4NJ7 A;  1TE6 A;  1VJK A;  4US9 A;  3DVN V;  2LPE A;  2XCA A;  3HPO A;  3JPO A;  4YTP B;  4I2E A;  2R8H A;  3CYM A;  1KTK A;  1VLB A;  2A1A A;  3OLM D;  3NGD A;  2LGD A;  4F71 A;  5CHV C;  2WPF A;  3HVD A;  5ER0 A;  4A8E A;  2QIL A;  2ASJ A;  5KFQ A;  3QIJ A;  3DEE A;  2WXH A;  5FS6 A;  2J0M A;  8ICH A;  1JAL A;  2E5S A;  4RQ0 A;  2GBN A;  2N1V A;  2CDU A;  3ZXR A;  3T9P A;  4OAL A;  2QB0 A;  1T0R C;  5IKC M;  1X2H A;  7ICE A;  4PHP A;  2V3P A;  2K1F A;  3Q3M C;  1DIQ A;  5KG7 A;  1ZQS A;  9ICM A;  1KLG D;  9ICH A;  2HHT A;  2MBQ A;  3ML8 A;  1Q0W B;  4BJQ A;  3SU8 X;  3WKA A;  2R2Q A;  1NPX A;  2HCF A;  5AKY A;  4KIT B;  4RNM A;  3BZC A;  1MG8 A;  3E2E A;  2KHW B;  2L0T A;  2OJR A;  2QDF A;  2WXL A;  2YML A;  3NG0 A;  4LNN A;  3KKA A;  4KKI A;  1B9R A;  4KLU A;  1JML A;  1A76 A;  1I4H A;  4HAI A;  2LRW A;  3JZU A;  3GSY A;  4UB2 A;  2KFK B;  4QW9 A;  3MGH A;  1BT0 A;  1CEZ A;  7ICL A;  3C29 A;  3TSS A;  2KN4 A;  3WK5 A;  2PEA A;  4UB1 A;  4C0Z A;  1L4Z B;  1FIQ B;  5KFN A;  3Q6J A;  3DOW A;  4DL6 A;  5KG0 A;  2VAO A;  2V4R A;  4Y2S A;  1JW9 D;  4IM0 A;  5AE3 A;  1N60 A;  3D2Q A;  1WUF A;  2EH9 A;  2K8C B;  4GDL A;  2H5X A;  4FJV B;  1K52 A;  5AIA A;  1OQR A;  3AB5 A;  2WXQ A;  1DK2 A;  3APC A;  1YT3 A;  2DKZ A;  1SJH D;  3QFB A;  3QXG A;  3PO5 A;  4BV6 A;  4OJP A;  1NK9 A;  1LM8 B;  2MJD A;  9ICK A;  3QU5 A;  1S0O A;  1UD7 A;  4ANX A;  3EAN A;  2VFU A;  3QJZ A;  3I63 C;  3R2I A;  1C9F A;  1WCN A;  1GB4 A;  5CTR C;  1JN3 A;  2AL2 B;  2AGQ A;  5JCK A;  2MLB A;  3K1R B;  3LB8 C;  5C2T B;  1EBG A;  2AAQ A;  3TFR A;  5KFB A;  2IDY A;  2WB1 C;  5DBC A;  3UQ0 A;  2ZIU B;  5KFV A;  5DG7 A;  3L16 A;  4APN A;  2EMS A;  4NAW B;  3II4 A;  3SV3 A;  9ICC A;  9ICS A;  2CJN A;  3QWZ B;  4MJS B;  4FFD A;  1ZMC A;  3RNM A;  4YXM A;  1XLN A;  3GV8 B;  2ZIW A;  3SEN A;  3T4W A;  1SZH A;  1W6T A;  2MRL A;  2P13 A;  3M6Z A;  1UT8 A;  3M8S A;  2IMW P;  1FPY A;  2WP5 A;  3SR6 B;  3A9K B;  2KVC A;  3RTV A;  3PSF A;  4C8L A;  1AAR A;  2BWF A;  2FBW B;  3RR1 A;  2GGE A;  3WAL A;  1WXQ A;  1ACC A;  3ZRC A;  1L8P A;  4KN4 A;  2OJW A;  1OEY A;  4DFP A;  4H19 A;  3OJU A;  5J2D A;  1L6N A;  5K4L A;  4O3R A;  2KQ4 X;  4O0I A;  1WUE A;  1WX8 A;  2FMP A;  3NS8 A;  5J0U A;  9ICQ A;  3V7J A;  1ZD5 A;  4M0W A;  2ZJD A;  1L0X B;  3A33 B;  1D4B A;  4DO9 A;  4EEY A;  2OED A;  5AI6 A;  1DGJ A;  4R63 A;  1OW5 A;  2J0J A;  4KN7 A;  2K8H A;  4ECX A;  2INP E;  3IAS 1;  3GOE A;  2A1J B;  4C4V B;  3D47 A;  2XN9 C;  3MGI A;  3H7S A;  2R2O A;  2H88 B;  4XC2 A;  4WJ3 B;  3N6H A;  2AYO B;  4TQS A;  4F4X A;  2PFP A;  2WXP A;  3FKY A;  1S5L U;  5AIB A;  4R65 A;  2IA6 A;  4C7Y A;  1KJT A;  1A0P A;  4QWD A;  2WXK A;  3DHG C;  3U9I A;  3PVL A;  2HBK A;  4EX7 A;  2JRZ A;  4DL5 A;  3M95 A;  1TKY A;  2EQ9 A;  2OQH A;  2GQW A;  1SL0 A;  4CF3 A;  2GB1 A;  4EFO A;  3TEX A;  4LZG A;  3DPD A;  3DJJ A;  3WKE A;  4RQ2 A;  4K8D A;  4DL4 A;  3AE8 B;  1Z5S B;  3URY A;  1EWY C;  4KDL B;  1PDY A;  2GR1 A;  2XK5 A;  1T3N A;  1PVP A;  1J7C A;  1TT5 B;  1X9W A;  4WJQ A;  4NLG A;  2JZB A;  1QLU A;  2VA3 A;  2LUM A;  4ANU A;  1UT5 A;  3SQI A;  1F9J A;  8ICU A;  4FBJ B;  5DDM A;  4M6U A;  5J0W A;  3GE3 C;  3SEI A;  3HPF A;  1Z1V A;  3H8S A;  1YN4 A;  3MJW A;  1ZXH A;  1C7Y A;  3E0F A;  3E9S A;  4W9I A;  2KD0 A;  2N1R A;  2JYE A;  2LVQ A;  3P4S B;  3PRE A;  4G11 A;  4EM3 A;  3MHS D;  3AM9 A;  3NRZ A;  3AQF A;  3M9M B;  4J9K A;  4MGI E;  2ICI A;  5BYR A;  3D2J A;  1DOQ A;  2OZ8 A;  5H2F U;  4A6G A;  4F8R A;  3VFK A;  3PQB A;  1LFD A;  2L1A A;  3KWV A;  4MEL A;  4JV0 A;  3C19 A;  2G09 A;  2J42 A;  2RDJ A;  4PGX A;  4K7S A;  2J6S A;  4W9D A;  2LJI A;  2YB4 A;  3OTR A;  9ICR A;  1VCB A;  3MTN B;  3RN9 C;  2BC0 A;  5KG1 A;  5HP4 A;  2VJ5 A;  4M9G A;  2XY6 A;  2N0S B;  5D2M B;  1W1O A;  2KJ9 A;  5DQI A;  4UAZ A;  1V49 A;  3VVW B;  8ICY A;  1TK5 A;  4QZD A;  3DG7 A;  2LVO A;  4DQP A;  4H50 A;  1DGS A;  3DQ0 A;  5AM1 A;  2L3Z A;  3P4Q B;  3MC9 A;  3MWC A;  2ZCB A;  1E5W A;  4GXB A;  1YQ3 B;  4H4V A;  2ESE A;  3PNC A;  1FMA D;  1EF5 A;  4GMV A;  3WAP A;  4DQI A;  8ICE A;  1LB2 B;  3OG5 A;  3DVG X;  1I42 A;  2Q4T A;  3TJP A;  2GSH A;  1X42 A;  4MF8 A;  1XXG A;  1F3P A;  2HD5 B;  3C1Y A;  2G07 A;  4K1R B;  4W9K A;  4JGH B;  3HX0 A;  2ISO A;  3R7Q A;  1KTQ A;  2JWZ A;  2YN4 A;  1HSK A;  2ZAD A;  5D7G A;  1XS2 A;  1KN5 A;  2CJO A;  3VH3 B;  2WP6 A;  4J9R A;  2JX5 A;  2KDB A;  2FDR A;  3IC9 A;  1NNL A;  5AKJ A;  4F93 B;  1PFD A;  2OCE A;  1ZGU B;  2JRI B;  5ALS A;  3V72 A;  3JYU A;  5GXG B;  3W1S A;  4EZ6 A;  3SHQ A;  2Y1I A;  3V61 A;  2RK5 A;  4J9N A;  2LYH A;  3PV1 A;  5CHW A;  4EUT A;  2H3I A;  2DUY A;  4RQ1 A;  4Y2V A;  4G7F A;  3VAW A;  3C28 A;  4GGQ A;  5ADZ A;  2BCS A;  1TV9 A;  2F1I A;  4EBC A;  4U6P A;  1QIL A;  3RJE A;  5ALG A;  3ZTC A;  1C1Y B;  5JXV A;  1IBX A;  3FAH A;  4G3I A;  3BY4 B;  4Y2R A;  2C9W B;  2B76 B;  3TQP A;  4I2G A;  4BGD A;  3N7R C;  2BS3 B;  4FBT A;  1SWW A;  1DOX A;  1P7F A;  2REX A;  1HA5 A;  7ICR A;  3BK2 A;  3ABV B;  4KX5 A;  1UWM A;  5EBK A;  4DNA A;  3RO6 A;  2QC8 A;  4BKG A;  1CK1 A;  2PI4 A;  3PX0 A;  3OJ4 B;  1XLO A;  4LJX A;  4AJY B;  2QJJ A;  5JCL A;  1K1S A;  3KLS X;  3UGB B;  1LXD A;  3HW8 A;  1ZP0 B;  1ELS A;  3RJA A;  3GB1 A;  1J7A A;  4O9M A;  3BYT B;  2KFJ A;  2IO0 B;  1FHU A;  3THU A;  3RFZ B;  3M1Y A;  4A20 A;  2OHF A;  4F5O A;  2VJ4 A;  1QT9 A;  4DHJ D;  4RQN A;  1COK A;  4JV2 A;  3QE9 Y;  3APD A;  4CRX A;  4ZDV A;  4H4Q A;  5KFJ A;  4GXI A;  5FR3 A;  4G0N B;  1Z3E B;  1JWS D;  4YSZ B;  2R8K A;  7ICV A;  3GD4 A;  4TV3 A;  1G6J A;  3SN0 A;  2HOI A;  3ETR A;  2UVV A;  1UBI A;  2ZCC A;  1RM6 B;  2L8J A;  3TSH A;  2M56 B;  2KDI A;  2M17 A;  2JY6 A;  3TWA A;  1K5O A;  3DQV A;  4BUG A;  1P98 A;  2NRW A;  2W9B B;  1ZQG A;  2GDQ A;  2LAS A;  4MEY A;  3RYT A;  2RSU A;  2WLB A;  3TKA A;  3LXF A;  1XSN A;  1WG8 A;  2QMT A;  1I19 A;  3FM9 A;  1WZ3 A;  5FJT A;  1LPF A;  1BXT A;  1L8O A;  4YD1 A;  1U4A A;  3ENL A;  1KH0 A;  5G55 A;  3QZ8 A;  1SXT A;  4IL2 A;  5J29 A;  1AOG A;  2IOH A;  4YD2 A;  1N61 A;  1XPY A;  3ISC A;  1ZDV A;  2HZG A;  3V3W A;  2X50 A;  4QZH A;  4YWS A;  2NO4 A;  2RMM A;  1IM4 A;  2FCS A;  2NPX A;  4CDG A;  1WX7 A;  3GE8 C;  1F9C A;  4LLG M;  4QIW F;  4USA A;  2WF9 A;  3EHV A;  3Q14 C;  4M52 A;  1FXA A;  1FFV A;  4DBG A;  3G6V A;  2KTR A;  4C00 A;  2GGG A;  1YN3 A;  2XBB C;  4LTU A;  3SAF A;  1SSN A;  2LHD A;  2WBA A;  4W9C A;  3NVZ B;  4PHD A;  4K8G A;  4TVW A;  3F2B A;  4OJ5 A;  1ZK7 A;  5IN7 A;  2KT7 A;  2HBM A;  1UPH A;  1GC6 A;  4I2D A;  5KVI A;  1MBT A;  2PW9 A;  1D5X C;  2BB5 A;  3DBH B;  3GS2 A;  3RNG C;  3I57 A;  4EQW A;  2KVZ A;  2L52 A;  1TYP A;  3DK9 A;  4R8U B;  3EF6 A;  3DH9 A;  3PX6 A;  4BWM A;  3A1Q A;  1WGR A;  4KSL C;  2ZIV B;  4LNO A;  1FFU C;  5D79 A;  1V9J A;  3RD2 A;  4O1N A;  1A5R A;  3UXK A;  4LK0 M;  2F77 X;  4OO1 J;  1P0R A;  7ICP A;  2YQU A;  4DEZ A;  8ICA A;  2KD1 A;  2WP9 B;  2G9H D;  4HG0 A;  1YX6 B;  2FMQ A;  4XZ4 A;  3RUL A;  8ICC A;  5AK3 A;  3IM1 A;  2J3N A;  2PA6 A;  2BS2 B;  2GOW A;  4M9L A;  3RRG A;  3RNF C;  3VUY A;  4MGZ E;  1L7M A;  1T5X D;  4ED2 A;  1MRA A;  3BSM A;  1KLU D;  1ZR6 A;  4TUR A;  5AKL A;  2AXR A;  2B3A A;  1H8C A;  1Q1W A;  3H7P A;  2G4S A;  3ZUN A;  1B22 A;  2K5P A;  3ZJU A;  4HN8 A;  2RPV A;  4ROP A;  2BVF A;  2OAI A;  2XVT A;  5C5J A;  4J9Q A;  4DXA B;  4DYE A;  2ZUD A;  2HSZ A;  1QF6 A;  2PIA A;  1X9M A;  1C3T A;  3AUO A;  2IO3 B;  4DSL A;  1F1H A;  3EFU A;  2N9E B;  4BBN C;  3PWG A;  3HP6 A;  2FPL A;  2BW2 A;  1U9L A;  2E1E A;  1JPM A;  3AE6 B;  4C56 C;  1RYR A;  1H6V A;  1ISN A;  5F3X B;  5HHH A;  4LJO B;  2MUT A;  2KMA A;  4ELT A;  4Q45 A;  3MP9 A;  4XGA B;  5FK9 C;  5HKH A;  2MJE A;  4Q44 A;  1TS5 A;  4R3D A;  5D6J B;  4HLE A;  4RQ3 A;  1FEC A;  8ICI A;  4ZCW A;  4RQ7 A;  3ZNZ B;  1SGH A;  5G2N A;  5H8Y E;  1S77 D;  1XWL A;  4MEM A;  8ICP A;  3F2D A;  2NVK X;  4CO7 A;  3KZX A;  1F0Z A;  1QQ7 A;  2VFS A;  3AMZ A;  3AEV A;  3H8W A;  1QOA A;  2GBR A;  4PYU A;  1FIQ A;  1V9P A;  4B9U A;  9ICP A;  5DB6 A;  3UIO B;  2YLM A;  4MEX A;  1SB3 B;  4JQ9 A;  4JN7 A;  4ZA0 A;  4WWP A;  1K4Q A;  5KG2 A;  4ELU A;  1ZQW A;  3W8Z A;  4H4Z A;  4YWG G;  1DXL A;  1E8Y A;  2DYB A;  2KIW A;  2MBR A;  3M8R A;  5IIN A;  3UCC A;  3BQ1 A;  1DYQ A;  1WWT A;  4RF1 A;  4X57 B;  5FKA C;  3NXL A;  4IUM B;  3AQE A;  1YOV B;  2QVH A;  3H70 A;  4HRS A;  2HTH A;  4QZB A;  1TZ1 A;  5HHZ A;  1UQV A;  4M9J A;  2HNE A;  3O65 B;  1P7E A;  3CW2 C;  4YMM A;  1IV8 A;  4ED6 A;  4XWT A;  4FJY A;  1ZD4 A;  2WDT B;  5ALD A;  3A1Q B;  2GR2 A;  4NJ6 A;  3CAW A;  2AX5 A;  1L8L A;  2BQ3 A;  7ENL A;  1YNT E;  4JIO U;  2DZK A;  9ICN A;  2LEK A;  4IQV A;  2BGW A;  3PHW B;  2ZIW B;  1NDD A;  5AM3 A;  4KLI A;  5BMG A;  5D49 A;  4YG2 A;  4WWM A;  2FIF A;  5EE1 A;  8ICS A;  4KLO A;  3GIJ A;  4DOA A;  2WTF A;  2L32 A;  2KQS A;  3KUD B;  1OFF A;  3AN1 A;  2MU2 A;  1RQN A;  3R66 C;  4ARI A;  5ALE A;  2A4Z A;  3N1Z C;  1NKB A;  2WQY B;  5D3I B;  2WXM A;  4I2I A;  3ZKJ C;  4Z1Y A;  3HKZ F;  2Z8L A;  3ES8 A;  1DOI A;  1HTO A;  3QU2 A;  4FZL A;  2PSN A;  1SE4 A;  2WXG A;  4FDC B;  5TR3 A;  4IM3 A;  3Q3F A;  4RGM A;  2KZZ A;  1Y56 A;  3VDZ A;  3VTU A;  3IHP C;  1V85 A;  1FNU A;  3R0U A;  5EU9 A;  4QAY A;  2WOI A;  3NHE B;  1ED1 A;  2BDU A;  2HBL A;  1I4G A;  1YMH E;  3P1M A;  4RGT A;  3NVV B;  4E6M A;  4K4G A;  3BZD B;  3QFA A;  3H6N A;  4A3R A;  3M7D A;  5ENL A;  3ZVH B;  4JWN A;  2KV2 A;  4PWC A;  4WH4 A;  4DQO C;  1SIJ A;  1NJX A;  4JN8 A;  4A3P A;  4BOS C;  2HI0 A;  4CQN A;  1KLN A;  5AM0 A;  3GY1 A;  2NRT A;  4ED0 A;  3HWT A;  3PVX A;  3HRD D;  3ZLG A;  2D10 A;  4H4P A;  5AE1 A;  1URJ A;  1UNS A;  1WWU A;  2KKV A;  2DZI A;  1H4R A;  3W8W A;  2W03 A;  4XX5 A;  2AXT U;  3H8J A;  5KFR A;  1SKS A;  3ZDB A;  1ZW7 A;  3O0F A;  4H4Y A;  2ZVN A;  3N1Y C;  5FXP A;  3BQ7 A;  2JHD A;  1TJE A;  2IGH A;  2JMG A;  4F50 A;  1WM2 A;  3W9C B;  3LWL A;  3V62 A;  2XEW A;  2C3C A;  4JL9 A;  4P16 A;  5DG8 A;  3P0W A;  3RB6 A;  1PDX A;  3NZG A;  1WCL A;  3TAP A;  4IWO A;  1V38 A;  5AI9 A;  4M02 A;  1F44 A;  4YSY B;  4B9K A;  2YX8 A;  4O3P A;  4H1Z A;  3BW7 A;  1TKK A;  3J81 j;  1UGM A;  1J19 A;  4DFM A;  2C7M B;  2IO1 B;  4NQK E;  1YN5 A;  4GXJ A;  3V6E B;  3FDS A;  3KKA C;  1JWB D;  3RH4 A;  2NR2 A;  3DVG Y;  3QC8 B;  2PMV A;  1WGH A;  1R4N B;  1UF0 A;  2E3T A;  1T4G A;  4KPL A;  2LBO A;  2AJQ A;  2L0F A;  1JEH A;  3GDX A;  1S0M A;  4NWI A;  5KG4 A;  4US8 A;  4DOC A;  4GSW A;  3QPE A;  3RBD A;  1D8B A;  2QLT A;  5LNK 1;  2C2R A;  2IHM A;  3JVZ X;  5BMI A;  4RNO A;  2FLL A;  2DFL A;  4UB6 U;  4GB9 A;  3BS5 B;  4HPP A;  3W5U B;  4EQS A;  2Q0Z X;  4JB1 A;  3JVA A;  4IRC A;  2L7R A;  2MBE A;  5G5G B;  3B9J A;  2XH7 A;  2GR0 A;  4UAR A;  1XC9 A;  2RQ5 A;  3H12 A;  4NQL B;  1D7Y A;  4QWE A;  5HR7 A;  2QKQ A;  3H8H A;  2GLS A;  3ML9 A;  4PGY A;  1PVR A;  3H8A A;  3VCN A;  3SZ2 A;  1ZJM A;  1BUI C;  1E9I A;  4M0X A;  2W9N A;  2M4N A;  5FXF A;  3V5F A;  8ICW A;  4EYH B;  3RAX A;  3ZRF A;  2ASL A;  3VC8 A;  5TIS U;  1X9S A;  2K4P A;  4PJ0 U;  1OQY A;  2IBK A;  3D46 A;  3KZI U;  3H8M A;  2ZPY A;  3N32 A;  5AUI A;  2N1W A;  5J18 A;  1ZQL A;  3X23 A;  4QWA A;  4DL7 A;  4GFI A;  3ZDA A;  1BPB A;  2DX5 B;  4F8C B;  1XCT L;  1DOY A;  4ZYN A;  1JXL A;  2DEN B;  4IC7 B;  1NHQ A;  4EBE A;  4BKT A;  2KDM A;  1L4D B;  4Z6E A;  1KLV A;  4A90 A;  5KT6 A;  7ICG A;  4K81 A;  1UGJ A;  4ENL A;  5AKK A;  1F5S A;  4NEW A;  3KD3 A;  2BF8 B;  3N6J A;  1ZQO A;  4FZM A;  3HHM A;  2I1Q A;  4PGQ A;  1FEZ A;  9ICI A;  4AYB F;  1E6E B;  4QZ8 A;  2IJ0 A;  3TCA A;  1IBX B;  5J2E A;  3H7P B;  3RMK C;  5KFK A;  4KKJ A;  4DHZ E;  4HXD A;  4UAT A;  2OKT A;  4PZF A;  3MR3 A;  1FCL A;  2JYT A;  3BDP A;  4GXK A;  1WFY A;  1FNW A;  2GR3 A;  5A0L A;  1RYJ A;  8ICF A;  5J2B A;  3I6E A;  1FM0 D;  4L23 A;  5AZG A;  3UXO A;  2NRX A;  2EMT A;  4LA1 A;  5KT3 A;  4YR2 A;  2G08 A;  3S47 A;  5AKX A;  1UH6 A;  2UU7 A;  2BPF A;  4KZC A;  1QSY A;  4M8M A;  4UB5 A;  2FE8 A;  4II3 B;  1NEL A;  1QTM A;  3V6C B;  1XLQ A;  3UQ2 A;  2A1J A;  2LRU A;  4C4V A;  3EA6 A;  1E10 A;  1KKX A;  3M3J A;  3L3F X;  2MP2 B;  2BZF A;  1BNP A;  2YAU A;  1KW4 A;  4QW8 A;  4GC6 A;  2VH1 A;  2DL0 A;  2YTU A;  3ZD9 A;  4PS7 A;  4ZOH B;  4NAW A;  5FS7 A;  1ZQJ A;  4W9G A;  4AS1 A;  1JUD A;  2GLE A;  1GOZ A;  3D2H A;  3RPF C;  2LKY A;  3BVG A;  1OJT A;  4B9N A;  3ZNG C;  2PP1 A;  5F9L A;  2W7O A;  1SKW A;  3TQ1 A;  7ICU A;  2W8L A;  5J2I A;  2HMX A;  1GEU A;  1ET6 A;  1VZ6 A;  4GOC A;  2I5H A;  3PSI A;  5AUK A;  2M0N A;  1PGA A;  1WJ6 A;  2DAJ A;  4IM2 A;  5AE2 A;  5KHQ A;  1WXA A;  4DXK A;  2Y3A A;  2P6R A;  2V4I B;  4KLS A;  2E8P A;  4KT2 A;  3BOX A;  4ECY A;  1UZX B;  5F9N A;  4JUZ A;  1AW7 A;  2FCQ A;  4UAY A;  3AE3 B;  4KGR A;  4OVV A;  2OPJ A;  3STP A;  2VIX A;  4Y2T A;  4RMA A;  3QZ7 A;  4C4S A;  4MMW A;  2ZNV C;  3OPS A;  4PS8 A;  3RIT A;  2C28 A;  5L1L A;  1K51 A;  2KAN A;  4P4M A;  5DLF A;  3KYC D;  4WAF A;  2KIV A;  5HHI A;  4O5K A;  3URH A;  2FCM A;  3PRM B;  1L5P A;  5LLI A;  3N3K B;  5FJU A;  1HXY D;  1WRI A;  2UVR A;  4K7W A;  2OM6 A;  4UD8 A;  4B9L A;  1D6E C;  3LDZ E;  3TAD C;  2OXO A;  3DG3 A;  3GFK B;  2JPH A;  1SL2 A;  1VR9 A;  5C1Z A;  5KVH A;  3FWA A;  1Z4O A;  3VCC A;  5J0T A;  2LHE A;  3TW9 A;  4NXZ A;  1XD3 B;  5AK6 A;  4IL6 U;  3A9J B;  3DWM A;  3AEB B;  4N6E B;  5E6J A;  5U1O A;  3EYZ A;  4FO6 A;  4F92 B;  4OJ6 A;  4XQ8 A;  3Q3O C;  1L3T A;  1PGX A;  1Y88 A;  3Q8R B;  3HIL A;  1NBF C;  3NUH B;  4PVJ A;  2R18 A;  2BPS A;  2L83 A;  2ZTE A;  4P6V F;  1T6B X;  3DBH I;  1YZ6 A;  2C2D A;  2BCQ A;  1QSS A;  3KW5 B;  4KLG A;  4DDG D;  4DFK A;  4EYI B;  3S2A A;  3PML A;  2V3N A;  3C21 A;  3I5J C;  4F91 B;  2XGQ A;  3IFW B;  2WDV B;  2JK6 A;  4XDD A;  1Q1O A;  1P7D A;  3R10 A;  3QHT A;  1L3S A;  3QAQ A;  4M8N A;  4BAX A;  4E8G A;  1ZQ1 C;  3MJ5 A;  2M19 A;  3H0L B;  1U4B A;  2PJH A;  4IR1 A;  2FID A;  4IT1 A;  3LAE A;  2EAP A;  4UAS A;  3WA0 A;  3IJI A;  4ICV A;  4RZR A;  1K53 A;  4F4R A;  1L3V A; 
#chains in the Genus database with same CATH homology
 1HSK A;  5D7G A;  2GQU A;  2CJO A;  4HKZ E;  3JS8 A;  2ACZ B;  2JX5 A;  1E7P B;  2KAJ A;  5TSS A;  2BVF A;  1T3Q C;  1PFD A;  2JSV X;  3EUB 3;  3BWU D;  3HSU A;  2VZK B;  3W1S A;  5GXG B;  3S1D A;  3T3N A;  2RK5 A;  3RJ8 A;  1KF6 B;  3EGR A;  2BT6 A;  5HI1 A;  3FC4 A;  5ADZ A;  1C76 A;  1QIL A;  2Q85 A;  2Y5P A;  5JXV A;  1IBX A;  1L0V B;  3FAH A;  3IT4 B;  2QSD A;  1TKE A;  2B76 B;  2Y3S A;  4XLO A;  1XCQ L;  2BS3 B;  3SEB A;  4KGS A;  1RFK A;  2BB6 A;  3ZQ4 A;  4MH8 A;  2LFI A;  1P7F A;  1DOX A;  1AYF A;  1HA5 A;  3BK2 A;  1F77 A;  1V8C A;  3ABV B;  2WXI A;  1UWM A;  3S1F A;  3R8B A;  1CK1 A;  1XLO A;  4O95 A;  3I9V 1;  4Q2J A;  3KLS X;  2Y08 A;  1ZP0 B;  4A6Q A;  3RJA A;  3GB1 A;  1VRA B;  1J7A A;  1MHH E;  3BYT B;  2GQT A;  3DWG C;  3RFZ B;  1MPE A;  3PZ8 A;  3CWI A;  2OHF A;  2WXR A;  1QT9 A;  2KWD A;  3D2D A;  3Q8F A;  1MBB A;  4J3O D;  5H92 C;  2IGD A;  1SJE D;  5FR3 A;  2YVS A;  5FXD A;  1ZPS A;  2MH7 A;  1JWS D;  4YSZ B;  4D2K A;  2D5G A;  4ZHO A;  4GLS C;  1FD6 A;  1NI3 A;  1XO3 A;  2JZP A;  1TS4 A;  2ONQ A;  3ETR A;  3TSH A;  1RM6 B;  2PLI A;  2M56 B;  1D5Z C;  1TZO A;  3ZJT A;  5L6F A;  1AWD A;  4IOI E;  1FCC C;  1EWC A;  1QKZ A;  4TSS A;  4A55 A;  4C7Z A;  4PYT A;  2ZW0 A;  1C77 A;  1JWA D;  2WDQ B;  3LXF A;  2WLB A;  1I19 A;  1C79 A;  4HEA 1;  4WUR A;  2QMT A;  2Q4W A;  2N9K A;  4FXC A;  3P42 A;  3Q8A A;  1GAQ B;  1BXT A;  4RGN A;  1B1Z A;  1I7H A;  1KH0 A;  3NVW B;  4ARC A;  1SXT A;  4RGO S;  1DII A;  4YTN B;  3AE2 B;  1SBB B;  1V1P A;  1N61 A;  4YXD B;  1ZDX A;  1ZDV A;  3FW9 A;  2W55 A;  4WQM A;  3FW7 A;  1I4X A;  2DYO A;  2RMM A;  4JWU C;  1N61 C;  1ZXI C;  3AH7 A;  3TX1 A;  4LLG M;  4USA A;  2HDE A;  1E0Z A;  3AE7 B;  1FXA A;  1FFV A;  1BML C;  1L6U A;  1YN3 A;  4LTU A;  1SSN A;  2LHD A;  4ZRQ A;  1CZP A;  2E6X A;  4OZB A;  3NVZ B;  4TVW A;  1N5X A;  2LGI A;  3AEA B;  1MBT A;  1I4P A;  4L1B A;  3MC0 B;  1QLB B;  1PYW D;  2PW9 A;  1C4A A;  1D5X C;  1NYR A;  2BB5 A;  2DYM A;  3GS2 A;  3I57 A;  2L52 A;  4NJC A;  4A9A A;  1XF5 L;  1ZXI A;  4BCA A;  5HHD G;  3POP A;  1MHX A;  1SB3 C;  1FFU C;  5D79 A;  3A7R A;  4O1N A;  1R7S A;  4LK0 M;  1VZ8 A;  3IXS A;  4HG0 A;  2WP9 B;  2G9H D;  1QQR A;  3T3O A;  2BS2 B;  2GRI A;  2E5A A;  1J7B A;  2DLB A;  3BYY B;  1JWU D;  1T5X D;  3ZYY X;  2KAC A;  1NVI D;  3R07 C;  1C78 A;  1DZN A;  3B9J B;  4UDU C;  1KLU D;  1ZR6 A;  4ML8 A;  2MJ3 A;  2IPK D;  5AWV A;  1FNV A;  1M4V A;  2AXR A;  1HZ6 A;  5HQX A;  1N62 A;  3ZJU A;  2K5P A;  2BBC A;  4PWB A;  2RPV A;  1JQ4 A;  1STE A;  5FXE A;  1AN8 A;  3NVZ A;  1MI0 A;  2BS4 B;  1KRH A;  1GB1 A;  1W1J A;  4OVZ A;  4OW0 A;  3BII D;  3HUI A;  1QF6 A;  2Y3R A;  2PIA A;  2PVO D;  3C8Y A;  3AEC B;  1FFV C;  2JWU A;  1OQQ A;  2IPI A;  2WXF A;  1L6V A;  2BW2 A;  3IAM 1;  2W3S A;  3AE6 B;  3VQI A;  1JRO A;  3VR8 B;  4C56 C;  3S1C A;  4MM3 B;  1JRP A;  5L6G A;  1I4Q A;  2PVG C;  3MP9 A;  5FK9 C;  2I2Y A;  2MJE A;  2W54 A;  1TS5 A;  4R3D A;  3NVW A;  1ZUD 2;  1FO4 A;  4GDL B;  3L4P A;  5H8Y E;  3DED A;  2N9L A;  1ET9 A;  1L0Y B;  3UI3 A;  3N9Y C;  2K9X A;  1TYG B;  3S1E A;  1F0Z A;  1SE3 A;  2VFS A;  3AMZ A;  1QOA A;  1EU3 A;  3W5V B;  2R8D A;  1FIQ A;  4JE3 B;  4BBY A;  1FRD A;  1SB3 B;  1N60 C;  2Y4G A;  4RFB A;  4XDC A;  2W82 A;  2YEP B;  5D3D A;  2UUU A;  3W8Z A;  2WXN A;  4YSX B;  4ITK A;  4YWG G;  2QJL A;  3TSJ A;  4MAC A;  2MBR A;  4ZRP A;  5EE3 A;  4RF1 A;  1DYQ A;  1PUT A;  1WWT A;  2QEJ C;  5FKA C;  2BVH A;  4MLA A;  3FW8 A;  1LO5 D;  4HRS A;  2VFV A;  4KX6 B;  2WNM A;  4BC9 A;  4AQ7 A;  1WVF A;  2INN E;  5HHZ A;  1CJE A;  4RCO A;  4EC3 A;  2WDR B;  1ROE A;  3MFG A;  2R2Z A;  1AHV A;  2VZK D;  1P7E A;  3PZ7 A;  1ESF A;  1SEB D;  3VRB B;  1C4P A;  3Q8C A;  1I4R A;  1ZOY B;  3B2G A;  4RF0 A;  4XWT A;  4TQ1 A;  2H89 B;  4EE2 A;  5G5H A;  3AEG B;  2V0G A;  2PLP A;  5BYS A;  2G1E A;  2AX5 A;  1W1S A;  4ZOH C;  1TY0 A;  2ON8 A;  1YNT E;  2LEK A;  2SAK A;  1HZ5 A;  4JX1 C;  1XEE A;  1E9M A;  3VR9 B;  5BMG A;  1UUP A;  4PT5 A;  2FUG 1;  2IGG A;  4WWM A;  1D5M C;  2TSS A;  2LMC A;  5EE1 A;  1YJI A;  2WU5 B;  2L32 A;  2CU3 A;  4TMA B;  5BYQ A;  1OFF A;  3AN1 A;  1F0X A;  2SEB D;  4ARI A;  1ZE3 D;  1VAO A;  1YJJ A;  2BYT A;  2WQY B;  2BTE A;  5D3I B;  2WXM A;  2Z8L A;  3P63 A;  1DOI A;  2AQ2 B;  4WIP A;  3PM9 A;  1SE4 A;  1TS2 A;  2WXJ A;  2WXG A;  2X38 A;  4XWW A;  5I4D A;  2AQ1 B;  3W2D A;  3U52 E;  3BVM A;  1N62 C;  4RGM A;  5G5H B;  1Y56 A;  3J9C A;  1FNU A;  1X2G A;  1VDV A;  1NEK B;  1YMH E;  1I4G A;  3P1M A;  4RGT A;  1N63 C;  3NVV B;  3IT6 B;  3BZD B;  2PKO A;  4OZC A;  2P4P A;  4WH4 A;  3LYY A;  4DQO C;  1SIJ A;  1IGC A;  2DWQ A;  3V05 A;  2I38 A;  1E8H A;  4B0E A;  1A70 A;  4CQN A;  3AV8 A;  1WVE A;  3TEW A;  4TQ0 A;  1C4C A;  3HRD D;  1TY2 A;  3E56 A;  5AE1 A;  3SR6 A;  1MVK A;  1UNS A;  2NTT A;  2Q5W D;  3W8W A;  1AHZ A;  1EU4 A;  4MT5 A;  1W1Q A;  3Q69 A;  1EM7 A;  2I0K A;  5FXP A;  1E8G A;  2RDG A;  1TJE A;  2EEL A;  2IGH A;  3W9C B;  1QLT A;  4JAY A;  2NTS A;  1VJK A;  4US9 A;  4P16 A;  3LLB A;  5EE9 A;  4YTP B;  1PDX A;  2M0A A;  1KTK A;  1VLB A;  3BW7 A;  4OHJ A;  4YSY B;  1GPX A;  4PVK A;  1V1O A;  5C3J B;  2VFT A;  4L2Y A;  3NS1 A;  1YN5 A;  3HVD A;  3TUO A;  3NVV A;  1JWB D;  2QIL A;  2PMV A;  3AED B;  4RNA A;  2WXH A;  2E3T A;  1JAL A;  2EKI A;  1V1P B;  1Q10 A;  1FEH A;  4OAL A;  1HQR D;  5I1V A;  1X2H A;  2V3P A;  4US8 A;  2K3U A;  1AHU A;  1DIQ A;  4PVH A;  5LNK 1;  1KLG D;  3CIR B;  5BMI A;  2PLS A;  3P4R B;  3W5U B;  4JB1 A;  3OWE B;  4DXF A;  2WXL A;  5G5G B;  4PVE A;  2KMM A;  3KQ4 A;  3B9J A;  4KKI A;  1XLP A;  1B9R A;  1I4H A;  1JML A;  2ZW1 A;  3GSY A;  4ZYS A;  3FIL A;  4REZ A;  5K8E A;  3H8H A;  4C80 A;  1YQ4 B;  3TSS A;  1ENF A;  1BUI C;  4HJG E;  1FRR A;  1QOB A;  2EXR A;  2KN4 A;  1W1R A;  5FXF A;  3R2T A;  1L4Z B;  1FIQ B;  2VAO A;  2AQ3 B;  3AE4 B;  4OZA A;  2OAI A;  1JW9 D;  1NYQ A;  5AE3 A;  1N60 A;  4N59 A;  1QOG A;  1K52 A;  1FXI A;  1OQR A;  3AB5 A;  2WXQ A;  3Q8E A;  5AUI A;  3U4E G;  1SJH D;  3ZJV A;  1CQV A;  3PO0 A;  2MJD A;  3U7Z A;  1N5W C;  1T3Q A;  2VFU A;  3R2I A;  2R61 A;  1WYG A;  1XCT L;  1C9F A;  2DBY A;  3SFE B;  1JWM D;  1DOY A;  1GB4 A;  3W8X A;  2MEK A;  3C0P A;  5HMR A;  3LB8 C;  2KDM A;  5G5G A;  1L4D B;  1K53 A;  3P4P B;  5C2T B;  4A90 A;  2IDY A;  1UGJ A;  5HFY A;  4NAW B;  1V97 A;  3AEF B;  2CJN A;  2BVG A;  1XLN A;  1TKG A;  3B2F A;  2Y5C A;  1HEZ E;  5BMH A;  3TEZ A;  2P13 A;  1WSP A;  1E6E B;  1IBX B;  2UUV A;  2IJ0 A;  3SR6 B;  4KKJ A;  3NZ3 A;  2JXT A;  1QOF A;  4KGT A;  4N58 A;  5EE0 A;  1UXY A;  4PZF A;  2FBW B;  4GDK B;  2JYT A;  4HKQ A;  1FCL A;  2WS3 B;  1WXQ A;  1ACC A;  1FNW A;  2GI9 A;  2N7J A;  1RYJ A;  4H2A A;  4A8X C;  3NS1 B;  2NMQ A;  5T8I A;  4PWC A;  1FM0 D;  4L23 A;  2P3H A;  4XE0 A;  2KQ4 X;  3U2S C;  1SF0 A;  1F2R I;  2FE8 A;  1SE2 A;  3ETR B;  4M0W A;  1F2R C;  1XLQ A;  3GP7 A;  1L0X B;  1IUE A;  1D4B A;  2O3G A;  4DNS A;  2XNA C;  3EA6 A;  2OED A;  1E10 A;  1NEN B;  4IKG A;  1DGJ A;  1E8F A;  2INP E;  1FFU A;  3IAS 1;  2XN9 C;  4ZOH B;  2H88 B;  4AS1 A;  1GOZ A;  3MHZ A;  2WXP A;  3AE1 B;  3BVG A;  1TS3 A;  3RPF C;  2QKN A;  3D2H A;  1VZ7 A;  1E0Y A;  4C7Y A;  2WXK A;  3NVY A;  1TKY A;  1ET6 A;  3HVZ A;  1VZ6 A;  4JPS A;  3TEY A;  5AUK A;  2GB1 A;  3ZGZ A;  1PGA A;  3TEX A;  2JQR B;  1VQZ A;  1IGD A;  3NRZ B;  3KJM A;  5AE2 A;  1RWS A;  3AE8 B;  3URY A;  1EWY C;  2Y3A A;  3NVY B;  4ZHP A;  2V4I B;  1PGB A;  3A7U A;  1J7C A;  1AW7 A;  4KGR A;  3AE3 B;  1QLU A;  2LUM A;  2WDW A;  2YEP F;  5HG2 A;  3I99 A;  4BC7 A;  1W1K A;  4JWS C;  4HRO A;  2K0P A;  4WAF A;  1K51 A;  2K22 A;  1YN4 A;  3VRA B;  2W3R A;  1ZXH A;  3E9S A;  1L5P A;  3V3X A;  3P4S B;  2JYE A;  4YTM B;  5MPO A;  1HXY D;  1WRI A;  1RM6 C;  2JU6 X;  1K50 A;  4IDI A;  1W1M A;  3AM9 A;  3NRZ A;  1D6E C;  4UD8 A;  5BYR A;  3D2J A;  2ICI A;  3AE9 B;  4NZL B;  2NQW A;  3KWL A;  3O13 A;  1N5W A;  2QPM A;  3FWA A;  1VR9 A;  2PTL A;  3PQB A;  2LHE A;  2WXO A;  2L1A A;  3KWV A;  4DXG A;  2J42 A;  2LJI A;  3DWM A;  2VFR A;  3AEB B;  4N6E B;  4YT0 B;  5E6J A;  2N0S B;  1W1O A;  1PGX A;  3A7A A;  1JCK B;  3NUH B;  3WCQ A;  2L83 A;  4P6V F;  2J53 A;  4NAM A;  3HRD C;  4PVJ A;  1T6B X;  1W1L A;  3DQ0 A;  3P4Q B;  3FIL B;  4B0M A;  2V3N A;  4RH6 A;  1YQ3 B;  3AEE B;  1FMA D;  3AE5 B;  2WDV B;  3BK1 A;  2RDH A;  4XDD A;  3SFD B;  2J4X A;  1N63 A;  2J52 A;  3EUB 2;  1KFY B;  2M19 A;  1WGK A;  3MJ5 A;  5I1W A;  3Q8B A;  3LAE A;  3BVZ A;  1XXG A;  2WU2 B;  4TVY A;  3VTE A;  1UWX A;  2QIE B;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...