1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords xanthine dehydrogenase, chain A
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
3A7RA 3VRBB 3R07C 1DGJA 1FFVA 3BW7A 1AHUA 1N5WC 1NEKB 4ZHOA 3AEGB 1VJKA 4FXCA 3W9CB 1X2GA 1WRIA 1E0YA 1OQRA 1WVEA 3W8XA 3ETRA 2QIEB 5AE2A 1FXIA 2W54A 1E8GA 1UXYA 1SIJA 1N60C 1QLTA 1V8CA 1RM6B 4OALA 4C7YA 1FIQA 3SR6A 5FXPA 2WDQB 4N58A 3NVZA 1XLQA 3S1EA 2WLBA 1FMAD 3AE5B 1ZXIC 4JAYA 3LAEA 3W5UB 1X2HA 1L6VA 3AEDB 3HRDC 5C2TB 4JWSC 1FXAA 2BT6A 3P4RB 1QOGA 2WU2B 1T3QC 1R7SA 2JQRB 3P4PB 3P4QB 2Q85A 3S1FA 5G5HA 3AE1B 1YQ4B 5AE3A 1L6UA 1F0XA 2VFRA 4BCAA 3L4PA 1E7PB 3BIID 5H8YE 1PUTA 3NVZB 2QPMA 1QLBB 4LTUA 4HRSA 1AHVA 3ABVB 3P4SB 1VLBA 2I0KA 4ITKA 3HUIA 1ZR6A 2P3HA 1DOXA 4JX1C 1TJEA 4JWUC 1MBBA 3S1CA 3LXFA 3WCQA 1QOAA 1TKYA 4US9A 2CU3A 2JX5A 2KAJA 3EUB2 1E8HA 4YTPB 3NS1B 3JS8A 3W8ZA 5AE1A 1N60A 2MJEA 2WU5B 4TVWA 2HTME 1VQZA 3P63A 3W5VB 3PO0A 3W8WA 4XLOA 1N62C 1OQQA 1QLUA 3AM9A 1NI3A 3SFEB 2LEKA 2N0SB 1W1LA 1CJEA 3AE6B 4C7ZA 4BBYA 1JALA 3KJMA 2MJ3A 1F0ZA 1KRHA 1JW9D 1FRDA 3C0PA 5MPOA 2VFTA 2PKOA 2L83A 2WS3B 3NVVB 2NQWA 1L5PA 2W3SA 4WWMA 2OAIA 1KFYB 4P6VF 2L52A 2MH7A 2WDRB 2BVGA 1FFUC 1AWDA 1FFVC 1FFUA 1GAQB 5FXFA 1W1RA 2VFUA 1E10A 1RM6C 3HRDD 4N6EB 1QOFA 5H92C 3NVWB 3TX1A 3LB8C 1NENB 3AB5A 3AECB 2B76B 5GXGB 4PYTA 4ZHPA 4ZOHB 1AYFA 4ZOHC 4N59A 1JRPA 2K5PA 2W55A 1N5XA 1IUEA 4IDIA 1DIIA 3S1DA 1RFKA 3P1MA 2E5AA 1W1SA 3DWGC 1SB3C 2CJNA 2PIAA 2Q4WA 2CJOA 1N63C 1QT9A 1FO4A 1E8FA 5FXDA 2DWQA 3NVYB 2ACZB 2KMMA 1J7CA 1GPXA 4C80A 5EE1A 3B9JB 3AN1A 3AE3B 3B2FA 1RWSA 1SF0A 1N5WA 2QKNA 2O3GA 2AX5A 1QF6A 2H88B 2RK5A 1W1OA 3B9JA 2PVOD 2K9XA 2PLIA 1YJIA 1V97A 4YSZB 2EKIA 4YSXB 1XLOA 1L0VB 5EE3A 2Q5WD 4O95A 2GQUA 2AXRA 5G5HB 3AEFB 4YXDB 1DZNA 1JWBD 3FC4A 3AE7B 1N61C 3LLBA 1JQ4A 1YJJA 4JB1A 2DBYA 4YTMB 1T3QA 1SB3B 2QJLA 1NYQA 1KF6B 2R8DA 1WXQA 2FBWB 2P4PA 5EE0A 5HHZA 3AE4B 1MBTA 2VFSA 4USAA 1UWMA 1ZXIA 1TKGA 1OFFA 1FIQB 3SR6B 2E3TA 1I19A 2BS2B 4WQMA 1W1QA 5AUKA 4MLAA 2VAOA 3PM9A 1ZP0B 1ZOYB 3AE8B 1J7AA 3EUB3 3AEAB 1N61A 1N62A 2MJDA 3NS1A 3B2GA 3ETRB 3A7AA 2YVSA 3AE2B 4US8A 2EXRA 4BC7A 4YT0B 3DWMA 1PDXA 2P13A 1TYGB 3VR8B 1W1MA 5HMRA 3SFDB 1HSKA 1ROEA 4HROA 2W3RA 4YTNB 1A70A 2G1EA 1JWAD 2OHFA 1NYRA 1W1KA 3I99A 4BC9A 1RYJA 1QOBA 3CIRB 1XLNA 5EE9A 2WP9B 5C3JB 3A7UA 5G5GB 3AV8A 4ML8A 2PVGC 3ZYYX 1AHZA 3HVZA 1XO3A 2MBRA 1DOYA 1N63A 1VAOA 1VDVA 5ADZA 1DIQA 4HG0A 1E6EB 5AUIA 1FRRA 1DOIA 2M19A 2R2ZA 3NVWA 1I7HA 2H89B 2BVHA 3AE9B 3VR9B 5G5GA 4TVYA 3AEEB 1FM0D 1WWTA 2K22A 4YSYB 1WYGA 1E9MA 4A9AA 3NRZB 3AH7A 1B9RA 1YQ3B 1NVID 2BS3B 3CWIA 3DQ0A 3AMZA 3DEDA 1ZUD2 2WDVB 2PLSA 3KWLA 1EWYC 1W1JA 3NVYA 2VFVA 5FXEA 1J7BA 1E0ZA 3RPFC 1PFDA 4KX6B 3NRZA 2WQYB 1TKEA 3AEBB 1WVFA 1WGKA 1JROA 5HQXA 2BVFA 3VRAB 2M56B 1XLPA 3FAHA 2BS4B 2Y5CA 2GQTA 1CZPA 3NVVA
chains in the Genus database with same CATH superfamily
3Q14C 3A7RA 2KDEB 3TCAA 3R07C 4FBUA 3BZKA 4QWDA 1XSNA 4KITB 2Z0EB 4MGGA 1COOA 2AQ3B 4BOSC 1RXWA 1C1YB 3VTWA 3BW7A 1WCNA 1L7OA 1QCKA 2GO7A 4RQ5A 7ICMA 2VZKB 4E3CA 1WX7A 1AHUA 3F5AA 4RQ0A 1T0QC 4WQOB 3L08A 3E9SA 1VJKA 4B9VA 2JY6A 2NTSA 3LYYA 2HBJA 4G11A 2DYMA 1L6NA 1E7VA 4GOCA 2DUYA 2P35A 1FNWA 2QIEB 4IG7B 4RF1A 3VUWA 1JWSD 1MO9A 2ZUCA 5FP0A 4KTQA 3MFHA 2KFNA 4GIRA 5GTHU 3SEIA 3QZ7A 8ICYA 1QLTA 5J2BA 5KFDA 2KVCA 4YXMA 5KFCA 3DVNU 1TE6A 2GOWA 3MC8A 4IQTA 2OG9A 4I2EA 3NY5A 4ICUA 2Y3RA 2I2YA 5HHHA 2GI9A 4N58A 4YD2A 3RJJA 1DYQA 4DL7A 3P0WA 8ICFA 3LVWA 1C9FA 3VC6A 2HZGA 1KLUD 4M0WB 3DQVA 5DDYA 2YB1A 4DQIA 1SSNA 2OH2A 3NTUA 4W9EA 4C4RA 3SYZA 2EQYA 4CRXA 2POZA 2E8OA 2LBOA 1TT5B 2Y5PA 4DHZE 4CGZA 2BYTA 2KNJA 5JXVA 4DOBA 3TIXA 2W7OA 2K8CA 4WJNA 9ICRA 1I4XA 3LAEA 2KJ8A 2RDHA 4W9IA 3B97A 3GQCA 2BB6A 3ONSA 2HHSA 2G4DB 1T8EA 2AL2A 4ROPA 3AEDB 1TS3A 2KDBA 2KD1A 3K75D 3PW0A 4JWSC 3N4FA 3P4RB 4JV2A 3HK0A 4OHJA 1L7MA 1U47A 1LGRA 3ETLA 3ZVHA 3WU2U 1SXEA 1E5WA 1S0VA 2JQRB 2Y0SF 1M4VA 1XXGA 4LNKA 4XYCA 4CHKA 2Q85A 1ENFA 1J19A 3DVGY 4CQNA 2IHMA 2OJRA 4W9GA 4MMWA 1SEBD 2VANA 4CF5A 1KH0A 1TIFA 2PS2A 2INDC 1D5XC 2OVLA 4LZDA 2MNRA 4FX9A 3RJFA 2XSXA 4BCAA 2BZFA 3DVGX 4TKNA 1E7PB 1MUCA 3NVZB 3KLSX 4I2BA 5DKWA 4C4VA 8ICZA 2PCEA 4QNLA 2QPMA 3AQFA 3THVA 4B9TA 4HKQA 1QLBB 2MX2A 4RNMA 4HRSA 2XIDA 3F2CA 1Q5WB 5ALUA 1GEUA 5L1KA 1VZ6A 1LPFA 4NLNA 4IOIE 4PS8A 1WRDB 4EC3A 1HIWA 1ZQUA 3HUIA 9ICEA 2GGGA 3TKAA 2KVSA 2HXTA 1ZD5A 2W7PA 2FLPA 7ICJA 3ML8A 2Z7JA 3BS7A 1DOXA 1NKEA 2P3HA 2ZIUB 2JRIB 2K60A 3GIKA 1K4QA 4OJLA 2OYYA 4ED8A 1FPYA 2EQ8A 5FJPA 4BWJA 2E1FA 2CPRA 3N32A 4BBNC 3NXLA 3C2KA 4US9A 4DFMA 4B9SA 4EZLA 4PVJA 2RQ5A 2HVIA 4WURA 2W9BA 4GIBA 2ZPYA 4QZ8A 4O3RA 9ICMA 4F1SA 3QEBZ 2J6TA 4DQRA 2IBIB 3JS8A 2ZTDA 2IO3B 1SL2A 1B22A 5EWEA 4UAYA 4O9MA 4W9LA 3SD5A 4NJCA 3RBEA 4UB8U 3Q8RB 4FJYA 3RB0A 2DAFA 1T94A 2JZ3B 3ZVVA 3BJYA 2YQUA 3D47A 2BKRB 2HTME 4NJ6A 3M8RA 1VQZA 1NDDA 2I1QA 3MTNB 3PO0A 3W8WA 2M0AA 4K4IA 1N62C 5AKEA 4OJOA 2TPRA 4LLGM 4GISA 4B9LA 5HG2A 3KHLA 1ZQMA 3DESA 2LEKA 2ES6A 2PFPA 1IYFA 1W1LA 1MC8A 3KHHA 3C5GA 1PGBA 1T0RC 2KLCA 4HDOA 1DXLA 1UA1A 3QN3A 1TS4A 4JN7A 3T5HA 3B0AA 2MSED 3RB6A 1NU5A 3SAFA 1CEZA 1EU4A 1NHSA 5KVHA 4YWSA 1M6IA 3TOYA 5MPOA 3CGEA 3QIJA 3CGCA 1HTQA 2LGYA 4REZA 1KN5A 2GOLA 2DKXA 3L5KA 5KFHA 4PYZA 1GRGA 4I27A 4I2IA 3LJ3A 3PSTA 2JXXA 1KDHA 2W3SA 4IQVA 1V1PA 3HKZF 8ICNA 3M95A 4P6VF 1FEAA 2HDOA 3RFAA 2W9CB 3RRHA 3PZPA 4M2YA 3RJGA 2WXPA 2ZZPB 1T7PA 2W43A 2W9AA 2RD0A 3SMVA 4ECXA 1P7DA 3VFKA 2AXTU 1MDLA 1QQ7A 4DHJB 3LDAA 4BOZB 2EAMA 1FFUA 4EENA 4J3OD 3CB3A 1EUVB 2ZCBA 3TAQA 2VFUA 4IQWA 4XC2A 2HHQA 5FXFA 1RM6C 5D49A 2INPE 2CRXA 1D6EC 3H0RB 4II2B 4N6EB 1ZD2P 2ON8A 3B0XA 5AI0A 4F4WA 5H92C 3VQIA 4AJWA 3EFUA 3L10B 5L95C 4WJOA 3M6KA 1NK7A 1IIPA 4URKA 3WKEA 5TZVA 4M9NA 4NL9C 1L3UA 1QLNA 2I1JA 4ELUA 4GXKA 3RBDA 2L0TA 2WNMA 4ZHPA 2KZMA 1D4BA 2E8MA 2K4IA 3CGDA 1Q3VA 1S1QB 2HHVA 2GGJA 3WKDA 5FJOA 2YN4A 3TW9A 2XC9A 3I28A 2Y9UA 1NKCA 1JRPA 7ICSA 2W55A 2BKFA 1N5XA 3RTVA 1IUEA 2KFJA 4AS1A 2UVWA 3S47A 2ZIVA 4K8GA 4EEYA 5ALQA 4QWBA 3AUOA 4KLEA 5KFPA 3QPEA 3Q8KA 3CT2A 3SN0A 1KTQA 3ONNA 1V80A 3V5CA 4AP4C 5KFGA 4WAAA 2QEJC 3MKCA 3Q8FA 4ARCA 4O3PA 5D7GA 4PVEA 3PX4A 4HPLB 4RPYA 2A1JB 2EAPA 2PIAA 1T3NA 2Q4WA 4DNSA 3KUCB 3N1ZC 3WALA 1V5TA 2HJ8A 3GP7A 9ICFA 3L5OA 4P0PB 3NZSA 5ALGA 3A1QA 5FXDA 4K81A 2R2OA 9ICVA 4OZAA 5BYQA 3R7RA 3FCPA 3OHBA 3KYDD 3NVYB 2LVQA 3NZ3A 1DTNA 1GPXA 5IIKA 2VA2A 5JCIA 1CUKA 1P43A 4C80A 5BYSA 2RDJA 1L0XB 4ECUA 4J9MA 3ZQ4A 2REXA 4Y2QA 5JCNA 1MI0A 3QQ8B 1NZBA 3B2FA 1C3TA 3LXDA 2KKCA 3DBHB 1SF0A 9ICOA 4GLSC 3U30A 1C20A 3KHRA 4GXBA 2HD5B 3JPTA 2AX5A 2FIFA 4FE3A 2H88B 3QUTA 3I3TB 1EBDA 3B9JA 1Q3UA 5L1JA 5J2RA 2LI6A 2WXRA 3GILA 4UATA 3IAM1 4H19A 3DEQA 4P0QB 3SAHA 4RNNA 1YJIA 2JPHA 4NQLB 4YSZB 2RHFA 4WWNA 1ZQRA 4YSXB 1XLOA 2HOIA 3MGIA 4GMEA 1D8BA 5KFAA 1IBXA 1MQ3A 3AU5A 4MSQB 5EE3A 4KLQA 1P98A 3ZDTA 1KFTA 2NRTA 4I6PA 1ZQFA 3SD7A 4O95A 3H8WA 3DJGX 1Q10A 3PMNA 5DBAA 2JV3A 5G5HB 4PJ0U 3D9XA 2O3GA 7ICPA 4BVUC 4DHJD 2LRWA 4BKSA 5J0RA 4PVKA 1DZNA 1FEBA 4DOCA 2OXOA 2J52A 3AE7B 3JW7A 2OFJA 4E4FA 3LLBA 5ALVA 3I1YA 1GJZA 4UAZA 3OSNA 4YMOA 2ALZA 4KLGA 3VH3B 1JQ4A 5L83A 1Q46A 4QZBA 5KG2A 5KT5A 2KWCA 3J9CA 1TAMA 4O5CA 4BV6A 2W11A 3BVZA 1T3QA 2H3FA 2EANA 3NG0A 4PVHA 2E5SA 1MDRA 3KUZA 5AIAA 1ZQHA 2IO1B 2WXFA 3RJ8A 3OTRA 3M9MB 3EFCA 1OJTA 4GFJA 1ZOLA 1WXQA 2EELA 2FBWB 3GD6A 2N9LA 2WYQA 2FUG1 1ZDXA 3AE4B 4DSEA 1JRUA 4AYBC 4K4HA 1WX9A 2WTFA 1OXJA 2V9WA 1EWCA 4RQNA 1PK1B 4USAA 1FNVA 3QNMA 4F50A 1WGYA 1GRTA 1KLGD 2ZG6A 5KFFA 1YX6B 2GWSA 3ZKJC 3ZO5B 3SR6B 3TI0A 1H4RA 2NRWA 3DIPA 2ZIXB 3MFIA 3J81j 3RH6A 2WXGA 1I19A 2MAXA 2XY5A 1GC7A 3H8AA 5AUKA 3CW2C 3TQ1A 1BPYA 5CRXA 2INCC 4KDIC 1MVKA 5KFOA 1X9SA 3H7IA 2JYEA 3FM9A 3KOOA 5J8YC 5L1IA 2ZVOA 3RAQA 1EF1A 1FHVA 1Z4NA 2E1EA 3AEAB 1OW5A 4PL1A 1AW7A 3JVZX 4BXOB 4OZCA 3H9DA 5AHXA 2MJDA 3DHGC 5J17A 3IG8A 4BUGA 2PU0A 1C4CA 1MG8A 4IM3A 1ZMDA 3TL5A 2EXRA 5TR5A 3QE9Y 2XK5A 3N30A 2UU7A 2DL0A 4PGQA 9ICUA 1I4GA 2DYOA 2JRHA 4HEA1 5GRTA 1PDXA 2ZVNA 3VR8B 2ZXIA 1SWVA 1ZQZA 4ICAA 3DV9A 4M0AA 2CR5A 1HXYD 2ZIXA 2L0FA 3N28A 1ROEA 4JDRA 2KFKA 3CXBA 4R66A 7ICRA 5T8IA 4DYEA 1G6JA 1NK0A 4QW8A 2W3RA 3UQ2A 3ALRA 1A70A 4YTNB 3TEWA 4UB4A 1RLFA 3QFAA 2INNE 3Q3JA 3OGUA 4NAWB 3PV8A 1SJDA 4UQGA 4FZNA 2NO5A 5AM3A 4DDID 3V6KA 5LNK1 5DB8A 1NK6A 1WM2A 2XGQA 3KFUF 2NPXA 5JUMA 1ZQ1C 1QOBA 3W1SA 3CIRB 3HM6X 2IO2B 2HMXA 1XLNA 2KJHB 4ECRA 3QAQA 1E8WA 4KLUA 1GB4A 4R64A 4DL2A 3WK7A 2PVGC 3IC9A 3M8SA 3HVZA 3DH9A 1Q1OA 5AKHA 2WPFA 1N63A 4FO6A 1K50A 3L13A 2KANA 1MG4A 2RR9A 1A76A 1SV4A 1DRGA 5G55A 8ICHA 5K4LA 2IY0B 1E6EB 2BWES 3ZRFA 4EMIA 4A6QA 1XPYA 3KBBA 1DOIA 2ISPA 1FRRA 5E79U 4FULA 5EWGA 2KNBA 3RFZB 9ICKA 2OM6A 1RYUA 1GG3A 1JWMD 2LGXA 2HVHA 3URYA 1CK1A 2H89B 4JB3A 3TJ4A 4WWOA 5G5GA 4C8LA 3AEVA 2DAJA 4LNFA 3KKAA 4CNQA 4M47A 1EC7A 2I6XA 1KFDA 4UASA 4F3OA 1WYGA 5KG0A 4K3BA 3IFWB 4A90A 3RR8A 4RFBA 2C3DA 4RUAA 3D2QA 2WXIA 1IPGA 2BYFA 2PP3A 4QZFA 3D2HA 5CHFA 1U45A 1WGGA 2BS3B 2JXTA 3H4BA 3DK9A 1J2NA 4HWIB 4PWCA 2HXUA 1NDAA 3Q8QB 4DXGA 4RPZA 1ZX9A 3PW5A 1WFYA 1JIHA 1W1JA 1EWYC 5DBBA 1P1AA 4DK5A 2KXJA 3IN5A 3DJJA 1FXTB 4W9JA 1Y56A 3NGDA 3P3BA 1PQSA 2RDXA 2WX0A 4KGSA 4KGRA 3OZYA 3VA8A 1P9DU 4ECTA 3HIZA 4BKGA 1RXVA 2F77X 3SZ2A 1PFDA 2ZW1A 2H3QA 3MR5A 4FS2A 2KOBA 4PGXA 5IIOA 2N1VA 3BVGA 4M0XA 3NRZA 1ZDVA 2JHDA 3AEBB 3OHAA 4M00A 3WAMA 2X8CA 3N6JA 1NZPA 5TR3A 2Z0DB 2BVFA 2KT7A 1O03A 2PE9A 3VRAB 1GXFA 2HBLA 3ZNHB 3U52E 2KC1A 1GREA 2BPCA 2FDRA 3GB1A 3OP2A 1WIAA 1ZD4A 5KFRA 3L3FX 4IR1A 4BX9C 2FLLA 2MBHA 2Y5CA 3ZLZA 3ZNGC 5KHQA 4J9KA 1KKXA 2D10A 2OZTA 3ISDA 3H7VA 4DX3A 4XDDA 3K4GA 4HVBA 2KICA 9ICNA 1FFVA 4EQXA 4W9FA 4DL3A 8ICCA 3RRGA 1T5XD 3IHPC 4G8TA 1ZQOA 3Q4DA 2BB5A 3WA0A 2GR0A 4MHVA 1WWVA 4FJZA 2HHTA 4M6WA 4HNCA 2D6FC 2WOVA 2GH5A 1L8OA 2LFIA 3RNMA 1S76D 3MDAA 3QU7A 1YX5B 1WVEA 1ZQYA 2ZPNA 3H40A 3QYPA 2PTXA 4F2RA 1L7PA 3EW9A 3NUHB 2JWZA 3VAWA 1CI4A 4J9QA 3OAWA 1I42A 1GETA 2RABA 5AE2A 3GO2A 4OO1J 2MP2A 1UXYA 2KZ3A 2F1HA 1V85A 1SIJA 3IM1A 3RAXA 3BQ0A 1NK8A 4O3MA 4OALA 1LKYB 2GBMA 3QWZB 2FNJB 4C7YA 4P1BC 3CYMA 4ED0A 3MR6A 1I4HA 4IRDA 3HHMA 2LI5A 1FIQA 1UBIA 1UGMA 5FXPA 4YL8A 2EZYA 1ZQBA 2DPIA 4LVSA 3O0HA 1P0RA 1V1PB 4JIOU 5DB7A 2BPGA 5J2HA 4ICVA 3RCYA 1SIFA 2BF8B 4OW0A 3Q8AA 2R18A 3V7JA 1FMAD 1S0NA 3AE5B 3WKAA 4EX7A 3OG5A 3PY8A 3EANA 2QC8A 1GRFA 1XS2A 3PW4A 2NR2A 4PPXA 3V72A 4KLLA 4JAYA 3UJEA 2MRPA 5BMHA 1TZOA 4F72A 5AM1A 4UB6U 4DO9A 3SQIA 2MA1A 4PGYA 4M9JA 4ANWA 5CP2A 4Y2UA 1L6VA 2D8CA 3ISCA 3HRDC 4RQ4A 1PUZA 4J9LA 1ZQVA 4R65A 4K4GA 2BT6A 2NQLA 3RF9A 3TACB 3UGBB 4DWFA 5B66U 4QZIA 2K6DB 3PGEA 4KPRA 4P4MA 3RD2A 3MHZA 1E8ZA 4DSIA 3EHVA 9ICIA 2R8JA 3R9KA 3QUBA 2BW2A 2CHRA 9ICQA 3OSPA 3S1FA 5CX3A 3N9YC 1F44A 1TY0A 3MFGA 2G9HD 4ED1A 2QMTA 4MF8A 1LB2B 1XC9A 1L6UA 1F0XA 1NNLA 2FPMA 4B95A 2VA8A 5CHGA 4YR2A 2ZXHA 1GUAB 4M0WA 2LZ6A 4S17A 3N1XC 4KZ0A 2WB1C 3BQ7A 2IGDA 1PUTA 2LXCA 4ECSA 4Z6DA 1L3SA 3Q2AC 3K1RB 4QZCA 3QA8A 4FADA 1LVLA 2BCPA 1K1SA 3RRAA 4LTUA 5AZGA 1EO6A 1ZQKA 2HOQA 4F5QA 1VLBA 4P4PA 3JPPA 4UAUA 1ZXHA 2EZXA 1NPXA 3ZVIA 2I0KA 4WJ3B 3HW8A 4FZLA 4IC9A 5BYRA 3DERA 4PHAA 2OKTA 1ZR6A 4QW9A 3WK9A 3T5JA 4F93B 2L7RA 2WXMA 4H50A 3BQ2A 2AL6A 4JX1C 4Y2SA 1RPLA 8ICRA 4DSLA 1TJEA 1OEPA 3ZXRA 4P16A 3UQ0A 3ZNID 1SJED 2GB1A 3ALBA 1DGSA 2CHXA 3SI8A 2C22A 4TUSA 3WCQA 1QOAA 8ICTA 4C8MA 3SN4A 2FUHB 3TSSA 1BPDA 3TEZA 1SJCA 3EUB2 3GU3A 1WGHA 4RU9A 2JZZA 1MSWD 4HCHA 5AI5A 2Y1JA 4JPSA 3HJEA 3H1UA 5KT2A 4GXIA 2TSSA 2P3ZA 2C7NB 2SAKA 3DPDA 3Q8BA 3BYTB 2J53A 4QZEA 1L4ZB 4Q2JA 3HWTA 5AE1A 3WK5A 1J2MA 3P42A 1N60A 4PH5A 4HJKA 1NJYA 4AQ7A 2R8KA 1UNSA 3VC5A 2CKHB 5HMLA 3PRPB 3R7QA 4F8CB 3P63A 2G08A 1XHCA 4XA5A 5CA7A 4GDKA 5ALJA 4XLOA 2L1AA 4YWGG 2KMAA 3PS6A 1OQQA 5DPSA 1SWWA 4Q45A 1Z2MA 4PZFA 4JK1A 3F2BA 1YQBA 1NI3A 3PVLA 2ATLA 3R2TA 4A20A 4B0MA 3FW7A 3M62B 2HBKA 3QUQA 4P4OA 3OJ4B 1WZ0A 4J9PA 2N0SB 3ZNZB 4K1WA 2ZTEA 4IZGA 7ICGA 5B5EU 4KLIA 2H3VA 5BOMA 2W9BB 3AE6B 2BGFA 4BBYA 1Q8KA 2PMZC 5ALLA 2MJ3A 4Y2XA 3C2LA 1MN8A 2AWTA 3PFRA 2M1MA 1YZ7A 2G0AA 2IOHA 4K7SA 3HPFA 4C8OA 5J0OA 4M6UA 3RCZA 4HJGE 3NVVB 3QEAZ 1CMXB 1Z5SB 2C2EA 3L54A 4O3SA 3JYUA 5FJRA 3C1YA 2OZ3A 1JCKB 3PQBA 4ZYNA 1SXDA 1KFYB 3RI7C 4AWJA 1GV4A 2GMIC 3OPSA 1QQRA 4ED6A 2MH7A 3VTEA 1SZHA 4Z17A 5BOFA 1WSPA 1WXVA 3KLJA 1FFVC 5KG5A 5FS6A 2MBEA 2PODA 4I6NB 4ZRPA 2AXRA 2I1KA 1XSPA 4DLGA 2KHQA 1IGDA 3NVWB 1QQ5A 5ALTA 3ICXA 4RQ8A 3B08A 4KEMA 1NENB 1R4MI 3BJSA 2YMPA 4YCXA 1J0GA 4JLCA 2B76B 4MELA 1HE8A 3BZCA 5BMIA 3AQEA 1BPXA 3W1YA 2W04A 2G4SA 2ZW0A 2JT4B 3Q8PB 3CP8A 2LHEA 2OQHA 2WPCA 5I1VA 5DQHA 2MBBB 4DXFA 4UB3A 4HLEA 5I1WA 4ACOA 2F76X 4A8XC 1AQ6A 5ALHA 1BPZA 1YJ1A 1ZE3D 4EBEA 4YFKA 4OJPA 2MEKA 3KKAC 4H4SA 1BMLC 1KKRA 3BY4B 4G50A 2L32A 1OGWA 4ELVA 4M02A 5KFUA 4IC7B 3TUOA 4NLBA 1OEYJ 5KFBA 3WANA 1A77A 4Y2VA 2N1RA 1RZTA 2WXKA 2K4PA 1ZYQA 4JGHB 1BZLA 2MA9B 2CN1A 5JH5C 3VVWB 3DWGC 3V7KA 3CGBA 4F5OA 2KVZA 3EEZA 1CQVA 5DPRA 2JRZA 4Q8FA 2WOIA 2JH7A 2CJNA 2YMQA 4NLZA 1YNTE 2F1IA 1GO3F 4AP9A 4DWIA 1GRBA 2GR2A 3IRUA 3ISBA 5IIMA 1FO4A 1WX8A 3T9LA 2BVCA 2DWQA 4KLJA 1WJ6A 1SE3A 3KZIU 4E4UA 2YY6A 3N7PD 1VZ8A 2L8JA 3FJ4A 4M52A 4J3ZA 4BURA 3DBRI 4IWPA 4KMOB 2ZJ8A 2EQ9A 4KT2A 5CEHA 1WE6A 4EEWA 1RWSA 1WE7A 3EWAA 4YMMA 1N5WA 1X9MA 4I6LB 2ICIA 2RDGA 3PW2A 1S8OA 2PTWA 2LMRA 1UHUA 3T6CA 2K9XA 1UCVA 3G6YA 1ET9A 3R0UA 3TQPA 3DG7A 3R10A 4DF8A 5D3IB 3MGVA 1BKHA 9ICXA 3TARA 9ICBA 1JUDA 1RQLA 2KSOB 5ALZA 4LNOA 4P1CC 3RB3A 2C2DA 1A0PA 4LDTB 5DLGA 1WUDA 3KW5B 3V6EB 1S0OA 2V3PA 3EECA 4CDGA 4C4VB 5EWFA 1ZGUB 4D2KA 3B1LX 1JEHA 3NS8A 2O2VA 2WDTB 3V6CB 1VCBA 2BDPA 4PK1A 4ZDVA 4GB9A 1R0MA 2W9MA 4OJ5A 4DQQA 5KFVA 4I29A 4YXDB 4EYIB 5KHOA 3PK7A 3KD3A 3ORYA 4C8KA 1URJA 3KUMA 4ZH4A 3Q8EA 2ZIVB 9ICPA 3PMLA 4LJOB 2Y9TA 3RZWC 3FWAA 2FMSA 3IK4A 2DBYA 4RQMA 5CB1A 1ZW7A 2GRIA 4E6MA 1C78A 2RSUA 1V9JA 3TWAA 5AKJA 1WCLA 2HI0A 2QJLA 3MC9A 1TKKA 3UJ2A 2WF7A 1H2IA 2DPJA 3JSVA 3NASA 4JMUA 2KJRA 1YEYA 2RPVA 3QUCA 3QZ8A 2H3IA 3SV4A 3V6HA 2DLBA 4B9NA 3NO1A 5EDSA 2D5GA 3X23A 3DGZA 1WM3A 3PZ8A 2PEAA 3OC4A 2LUMA 4JQ9A 1TKGA 3UJRA 2WXQA 7ICFA 1E9IA 4DXAB 1OQYA 1F3PA 1B43A 4MLAA 1UGJA 2FMPA 3FW8A 1BPEA 1DK3A 2J4XA 4HCPB 2V6OA 4RGTA 1SE2A 5DGAA 2K3UA 4KIKA 2QVHA 3PSPA 2EZZA 3MSYA 2BQ3A 1RYRA 1L5UA 3KTQA 1R6WA 5KFTA 5CJ7A 2IDYA 2NVKX 1N61A 1TK0A 3VCCA 1E90A 3PT2B 5HR7A 4KLTA 4A3PA 4LA1A 5H2FU 2FKPA 4P7IA 4BGDA 1KN0A 1HJPA 3ETRB 4PL2A 4ACFA 3A7AA 3IVFA 4QWEA 2YVSA 3KYCD 3V05A 3SBFA 1HUOA 3JW0X 3X0WA 4DFPA 2K8BB 4QZAA 2JMGA 3UQAA 4DOAA 2LPEA 5J0TA 1S3SG 4NJ7A 4YT0B 7ICQA 4BC7A 4M8NA 1PDZA 1RVKA 4M9LA 3QCAA 4BJQA 4AOFA 3UQBA 1NI2A 2YVFA 3V3WA 2G09A 1UWXA 1ET6A 1WXSA 1F77A 1JXLA 4KPLA 1XCQL 3V61A 2G1EA 2G5IB 5F3XB 3QFBA 1JWAD 3LWMA 4IRCA 2AH5A 2OHFA 1WXAA 2MWSB 3DHIC 3TADA 3R25A 1UZXB 4UB1A 3CRXA 2KLGA 1F9JA 2LXAA 1ZRMA 4TUQA 3FILA 3D2DA 5AKYA 1W1KA 2J42A 1ZJMA 3I99A 3DBSA 4BC9A 2XK5B 1V86A 5ENLA 3JPSA 2LMCA 2KDIA 3MC0B 1JDFA 2D3DA 3TFSA 2JU6X 4RM8A 1PGXA 5C3JB 3A9JA 3NZGA 3E0FA 4ML8A 3QU2A 4QZGA 4WWPA 1H8CA 3KWVA 3ZYYX 3H4KA 2WF9A 5KFZA 3MY9A 1SV0C 1XO3A 4IW0A 3H4DA 1F1HA 3G6XA 2KVRA 1ZQWA 3IV6A 1DOYA 5L6GA 3DBHI 4NNJB 1S7MA 5ALFA 3OJSA 2F2AB 4FZMA 5KFMA 4DQSA 3UINB 3PHXB 3FKYA 2OQYA 2KC2A 3DDMA 3ZI4A 3MBYA 2K8BA 5J0WA 5JCMA 3Q3MC 5AUIA 1FCCC 5JCKA 2LM4A 2N9EB 1YN3A 2KN4A 2D3AA 4EZ6A 2R2ZA 5KTQA 2KHVA 3EA6A 3MR3A 1XT9B 3EGRA 4A35A 3V7LA 4IWQA 3RJKA 2ZJ5A 1EBGA 3WK4A 4P2HA 2VJ4A 2ZIUA 3LYSA 1MA7A 3UXNA 2BQRA 1I7HA 1XF5L 2GH1A 3ZDDA 3AE9B 3VR9B 3TMPB 4A6GA 4LDTD 2GSHA 1L3TA 2PA6A 1TZ1A 1TYPA 1JN3A 2GL5A 2V4RA 1E9MA 2N7EA 4YD1A 4G9BA 3HVDA 2OZ8A 3A0BU 3AH7A 4KSKC 2IPIA 2PFOA 5J18A 1NELA 1TS2A 1YQ3B 2FCSA 4GLXA 3PLVA 3H0LB 4F92B 4ENLA 1TTNA 2NBWB 5D46A 3V62A 4LZGA 3CWIA 2D3BA 4MFFA 1YMHE 5KL8B 2V4IB 2HTHA 4XDCA 3SU8X 2WDVB 1WH3A 2JEIA 2R61A 3O13A 3I4KA 2UUUA 2J0KA 2RDIA 2W03A 2KE7A 4I2JA 2N7DA 3KVFB 4QAYA 2W82A 3QX7A 2LRUA 5KT7A 4MGKE 1NK9A 2XY6A 5KFNA 3V3XA 4GC6A 2M9NA 4KX6B 1AN8A 2IGGA 1Z19A 2WQYB 4RQ3A 3Q45A 2M0XA 4DFKA 3PSFA 1SKRA 1F52A 3GV5B 4FLHA 5HQXA 4O0IA 1MPEA 2K4HA 1QSYA 5KAIU 8ICEA 2QKNA 2M56B 4ZCWA 4GDKB 4GGQA 1XLPA 2KK0A 5KFSA 5DB9A 2JK6A 3BOXA 4DL5A 3II4A 4NEVA 4TQRA 2Q0ZX 1RAXA 4H4YA 3PWIA 4MEYA 3GDXA 5ALWA 1S10A 1OTRB 1B1ZA 2C2RA 4GR1A 4MF2A 2JF5A 2X50A 2DFLA 4IL0A 1ZKQA 2GBKA 2MCNB 3DFHA 2KSOA 4WJPA 8ICSA 3E56A 9ICHA 4ZRQA 4MEMA 4DL6A 4K2SA 9ICTA 3BK1A 3LDZE 3AEGB 4RGOS 4A3RA 2P88A 5JHAA 1COKA 5G2NA 1X2GA 1WRIA 4J1OA 1UUPA 5AK3A 1E0YA 1OQRA 3NJTA 5JCLA 3W8XA 5D2MB 3ETRA 3GFKB 9ICCA 2GLSA 3TWBA 3C29A 5DG7A 3EPIA 2KN5A 4C0ZA 3MABA 8ICXA 2PFNA 4H4PA 3L17A 5KFKA 1ZQTA 1LQBA 1MRAA 2LVOA 1V8CA 5BOLA 4JWMA 4GGHA 3R8BA 3TBLD 2Y3AA 5AK5A 3AU2A 4DWDA 5FS8A 1WYWB 2WX1A 4TUUA 3RJIA 4K7UA 5J2EA 1L4DB 3E2EA 2KKPA 4DXKA 4UAVA 1KM7A 3RJEA 5E6NA 1UELA 2FPLA 8ICIA 1U4AA 4UAWA 4DL4A 4RQ6A 4RQ2A 1UA0A 2QSDA 4IS7A 5F9LA 2DGZA 1ZXIC 2DNFA 4MJSA 5I4DA 5FJUA 2Y1IA 2WHIA 3ZW3A 2MBOA 3D6JA 4OD0A 4F4YA 2KWUB 5D79A 2AQ0A 4HK2A 3IT4B 4ANUA 3C19A 3W5UB 1NBFC 1X2HA 3VC8A 4X5VA 1ONEA 3H12A 1PK1A 3N4MB 3VTUA 2W8KA 3AU4A 4BXOA 2ZCCA 1X9XA 4NJ8A 2BCUA 4W9DA 4OCZA 3VCBA 3H8HA 4UDUC 4XQ8A 5DQGA 1FD6A 8ICKA 2JZBB 4PZOA 4JQWC 1TAQA 2KJ6A 3HT3A 2N4FA 2WXNA 2ZJAA 2MQJA 2WU2B 1KOTA 1T3QC 4ADWA 3DGHA 1R7SA 3P4PB 4DQOC 1L7NA 2KMCA 2MU2A 1I4RA 3A4SC 2IOFA 3FG2P 1Z1BA 4I28A 4U6PA 2FIDA 3TJPA 1YQ4B 2MUCA 3UJFA 5AE3A 3TADC 1V38A 1STZA 1WMHA 1UT8A 8ICLA 4TMAB 4NAMA 2W9CA 2HQMA 3D32A 3UXKA 4AYBF 2VRRB 5H8YE 1PGAA 2B21A 1Y8RC 1T4GA 4FBTA 4HN8A 4J6IA 4KLSA 3JPNA 1YZ6A 3URHA 2FLNA 4PS3A 1AHVA 4HNLA 3ABVB 1Z00B 3P4SB 4W9KA 2KO3A 2PKEA 4H2AA 1SE9A 2WWZA 4WJQA 2X99A 4EQSA 1IYXA 4YP3A 3P93A 2MUTA 4NZLB 4EEKA 3GZFA 1D8YA 2XO7A 2NPTB 1C76A 2JZBA 3QU9A 3U4FA 1QTMA 3S1CA 2V3NA 3I57A 2C28A 3DEEA 2NRZA 3U7ZA 5LXHA 4ASWC 4Q8EA 2G3QB 2OEHA 3ES8A 3DGBA 1LVHA 4P0QA 3EYZA 1KBUA 1ZQJA 1TKYA 2K8AA 3APCA 4GIVA 4RMAA 4MACA 2JX5A 2KAJA 2JXJA 3TANA 1E8HA 2VFSA 3MC1A 4FN2A 2LJ5A 4GDLB 2VH1A 3PWGA 2IO0B 4LJXA 2D3GA 3M9NB 1ZJNA 4YTPB 5FS9A 2P8CA 5AM5A 4EKUA 1BWCA 2P6RA 3W8ZA 2ZIWB 1LM8B 4PHPA 2MJEA 2EKEC 1NK5A 3FDSA 4MGZE 1JOAA 8ICGA 4NLCA 2WU5B 1SJBA 2FE8A 4TVWA 4CO7A 3UIOB 3F5EA 1KCZA 3R11A 2ASDA 3B0YA 1S97A 4PT5A 2DZMA 3L8KA 1NK4A 4EQWA 3N3KB 2FCQA 3F53A 2PGWA 1QLUA 3ZJTA 4DCCA 3ZDMC 3HPOA 4EBCA 3H8JA 4NV0A 5KL1B 4ZRIA 3M6ZA 4KV2A 2AL3A 2OOBB 1ZRNA 3IHQB 1NJZA 1CJEA 2HBMA 2DZJA 4E8GA 4MSMB 3OJUA 2YVCA 4Y2JA 1SJAA 4KLFA 3MP9A 1JALA 4Z6CA 1ZQEA 3KJMA 1MFWA 2VH2A 1C79A 4WAFA 1F5SA 1JW9D 1FRDA 2BPSA 3DCGA 1ZQIA 2YTUA 1U48A 4UB5A 8ICBA 3A4RA 3R1ZA 4ECVA 3V5FA 4P0PA 4EM3A 4NL9A 1X42A 1X9WA 1NJWA 2AQ1B 2LJIA 2F8LA 1BT0A 2WS3B 3DBLI 2QB0B 1PVPA 5AWVA 2NQWA 8ICOA 1V5OA 5HHDG 3H8MA 3S6JA 8ICUA 8ICMA 2GBRA 5KFYA 2NMQA 1TE2A 5BPCA 5IDZA 4ECWA 2WXOA 1FFUC 2BQUA 1W6TA 5BO4B 2DF4B 3PR4A 4NLGA 7ICHA 1T6BX 2NVUI 3PZ7A 4MJSB 4EM4A 2Q4TA 2QGYA 1AWDA 3RNBC 4EELA 2QCZA 2O6VB 1GAQB 3NHEB 4N9F4 4OVUA 1W1RA 1E10A 3GIJA 4HPMB 2FI1A 4NWIA 3DBRB 1QOFA 3BZDB 1PVQA 4DSJA 1HZ6A 3TX1A 2KTFA 4ED7A 1F8WA 4W9HA 3U8ZA 1ZQQA 3TAPA 2G45B 3RYTA 1ZQGA 3AB5A 1EBHA 1ELSA 3RR1A 3AECB 1HTOA 1E8XA 5GXGB 4PYTA 2R9ZA 2NO4A 4Q44A 5CWRA 5E6PA 1UBQA 5BOEA 3TCSA 3IAS1 3M7DA 1AYFA 1JMSA 3GRSA 1XEEA 4F7ZA 2KIWA 4ZOHC 1TZZA 3UM9A 4LJPB 2XH0A 3HX0A 5DDMA 4DFJA 1A6SA 1YN4A 2KQSA 2ZJDA 4UW9A 9ICWA 3D2SA 4N59A 5TISU 4M8MA 4BKSD 2GR3A 5KFEA 2JEJA 1EU3A 2KYWA 2AKZA 3ZLFA 2O6VA 1ZQNA 4K1RB 3TEXA 4E71A 4OJ6A 3PG6A 3PTFC 4E5TA 2WDWA 2BGWA 1XO0A 1WZ3A 4LCDE 2WHEA 3CAWA 2K39A 1B0XA 1SKSA 1JXEA 2IOFK 5J0SA 4MFCA 2E5AA 3A0HU 4FS1A 3PHWB 2C3CA 1W1SA 4MEXA 3OPXA 4ANXA 5DG9A 1HEZE 1ZDLA 3V60A 4EWJA 2RP5A 1C4PA 4R3DA 4H4UA 5L6FA 3N97B 2ASQA 4FBJB 3TFRA 4KLDA 2RRDA 3QJZA 5J0UA 1I4PA 2K89A 1YQZA 2JR5A 2CXYA 3DDHA 3C2MA 2XH4A 1CRXA 1QT9A 3Q8CA 1LKYA 5DQIA 4F5NA 1S0MA 3R3MA 1E8FA 5DB6A 4YWOA 4I2HA 4H4TA 5ALEA 2Y4GA 1Z3EB 4KZCA 1XO1A 2RLTA 1UT5A 2ASLA 1FHUA 2WXLA 2BC1A 2ACZB 2GGHA 5DGBA 1QSLA 4GU2A 5AKXA 2XCAA 3IXSA 3DK8A 2LHTA 3UXOA 4J9RA 5EE1A 3THUA 2B6GA 2LYBA 3TJIA 3AN1A 1O08A 4PZNA 4ECQA 1QZEA 5TSSA 4F91B 3BINA 3MGHA 1ZQCA 3O65B 4GYPC 5DLFA 1SZPA 4QZ9A 1QF6A 3GD3A 3SQPA 4Q43A 3MUCA 2K8HA 2FAZA 2K25A 2OLAA 3Q3NC 2PVOD 2RDBC 2P6UA 5AK4A 3WAOA 2VKQA 1KQQA 5A0LA 4GMVA 1DNCA 1AOGA 3K1ZA 1JI7A 1DOQA 1WG8A 2WBAA 5EU9A 3ZUNA 4LK0M 5FKAC 1IP9A 2I9GA 3JPOA 1V97A 3WKBA 3SSZA 2UVRA 2V1YA 7ICUA 4H4XA 5IP4D 3KH0A 1UPHA 2GBJA 4II3B 2KJ5A 5J2KA 2KD0A 4XWWA 1X66A 5L9XA 5D3DA 4DN1A 2PI4A 1UF0A 1K5OA 1XANA 2GQUA 2AYOB 2XI9A 3ML9A 2A8XA 4O3QA 2NS5A 2O6VD 2PTLA 3AI5A 5U1OA 4DS4A 1PDYA 1TK8A 1Z00A 3AEFB 4XZ4A 4CYEA 4WH4A 3ZTDA 1A5RA 5IIIA 3LK9A 3PX6A 4S0RA 4M9HA 3FC4A 1RG6A 3ZDEA 2A4ZA 1N61C 4JN8A 3APDA 4J03A 1YJJA 2GRTA 2ASJA 5IKCM 3M3JA 4M9GA 3PNCA 1KLNA 4YTMB 3C0RB 1UH6A 2X8GA 3DK4A 2QKQA 1FEHA 2PSNA 1KF6B 2Y0SC 2R8DA 1SL0A 5HMMA 2F5ZA 1PZNA 4KLHA 3K9OB 3RO6A 3N7SC 4I2CA 4DEZA 5EE0A 3BYYB 2LUEA 3L16A 3FVDA 1BXTA 3PRZA 4HYRA 3VH4B 1MBTA 1V49A 3T3OA 5KNIA 5J0XA 3DOWA 4KLOA 4J56A 1KRPA 1ZXIA 3DBLB 2GR1A 3ZLHA 1YT3A 2WB1F 5J0YA 1RFAA 2HHWA 1FIQB 5FMHA 5J8YA 9ICGA 3ZD8A 3PR5B 1W1QA 2CFYA 3PM9A 4TSSA 3IBEA 1ZP0B 3GC2A 5KT4A 2V4QA 3EUB3 3H6NA 1KD0A 1FCLA 1X2IA 2HHXA 1ZPSA 4QIWF 2IY1B 1N62A 3DDCB 7ICIA 2AL2B 2AQ2B 4PWBA 4YMNA 3T5KA 3RB4A 2JYTA 1LXDA 4WIPA 3O0FA 2YEPF 3EKGA 4UBCA 3BS5B 2KTQA 2XGZA 5KFLA 2AQ4A 3WKCA 1SV0A 3AE2B 4G0NB 4EZJA 2GQTA 7ICLA 2KG5A 2V9HA 2BCQA 3DWMA 2P13A 1JX4A 8ICJA 1ECWA 3GOEA 3EF6A 4RGMA 1KW4A 3SFDB 1HSKA 2PJHA 3BQTA 4Z6EA 1DK2A 2D3CA 4KLMA 4XGAB 5AI4A 2N9KA 4HROA 2PXIA 4KKIA 1P48A 4JL9A 3W2DA 3VCNA 1RQNA 4O5EA 2AU0A 3BQ1A 5U25A 4IP5A 2WGSA 1R4NB 2IPKD 1TYTA 2Y3SA 2F44A 4DS5A 1WI0A 1KSPA 2OWOA 1RYJA 4PHEA 4NAWA 4L23A 4HPNA 3U9IA 2NV3A 1ECQA 2KJ9A 5EE9A 2WP9B 4R8UB 4RF0A 5L1MA 4K7WA 4FDCB 1MJDA 3WK8A 3RR7A 2O56A 4B6WA 3H0MB 3CXOA 2G5HB 3QX1A 5KAFU 2IGHA 2LGIA 3ECIA 5IAAC 5CTRC 4Z6FA 1U49A 2UUVA 4IKGA 1KTKA 5AICA 5KFXA 4NM2A 2L00B 1DIQA 1ESFA 1QQ6A 1KFSA 1V6EA 3GE3C 2VA3A 3BDPA 1PYWD 3Q69A 4GSWA 5DBCA 4XUSA 4DFDA 1UD7A 2BC0A 3IJQA 4C4SA 5DPWA 5AK6A 4ZYSA 2NCNA 3GIMA 2PTYA 2L05A 4OZBA 1XSLA 3TSHA 3H7SA 3SN1A 2BYEA 4G3IA 1V81A 4APNA 4J9NA 2UYZB 4RNAA 4YSYB 4MKSA 3RJAA 2YVJA 2XCPA 2MSNA 1K1QA 1TS5A 2JZPA 3BK2A 4A9AA 4EFOA 2ZADA 2XICA 4BAXA 3I76A 1WJNA 2DW6A 2NRXA 4JV0A 2HJ1A 4E74A 2PMQA 4RGNA 1ZK7A 4BDPA 1I35A 4R63A 5CHWA 4MFAA 1KL9A 3EZ5A 1ZETA 1EC9A 4Y2PA 2HOFA 4FHJA 1IGCA 2BYVE 4C00A 2QARA 3AMZA 3DEDA 4HYKA 2M0NA 1ZUD2 3DQ0A 1JCTA 1BQGA 4B9UA 4MM3A 2X8XX 4LNIA 4PS7A 4RT3A 2PPHA 3KWLA 1YN5A 5J2CA 2HE7A 3MZNA 1GERA 3NVYA 5KFWA 4FHKA 2GGEA 2Z59B 3S5SA 1X1MA 2W9NA 5FXEA 5FR3A 2BQQA 1J7BA 3RGTA 5FJTA 1NOMA 1F2RI 1SGGA 3HKZC 3RH4A 4PYUA 1TKEA 2A1AA 2PI5A 4F71A 2CHWA 5J2AA 4YXJA 1WGKA 4MDKE 3QXGA 4HXDA 4IHCA 1JROA 1GC6A 3C8YA 3PREA 2KZRA 2PP0A 2HHUA 2BR0A 3IJLA 1WXMA 3U26A 3H70A 3ZIMA 1ZD3A 1ZQDA 2NTTA 4KWSA 4HKZE 3UMGA 1SE4A 2WXJA 3H7PA 3RZFA 2GDQA 2DQNB 2Y08A 5C5JA 4W9CA 5AM0A 1X40A 1CZPA 5C0YA 3RN9C 4QIWC 3OLMD 4RQ7A 2WF8A 5ALRA 3UMBA 3NVVA 5KT6A 3VRBB 2FPKA 1DGJA 4CCHA 1YIWA 3QU4A 4TQ1A 3SDLC 1P7EA 4BWMA 4KSLC 1XDIA 1TK5A 4AJYB 1T0SC 3BS5A 5KG4A 2FCMA 2PE6B 1RYSA 1N5WC 3D2JA 5AI6A 1NEKB 4ZHOA 1S5LU 3RITA 4J9OA 1GNUA 1ZMCA 3C23A 4FXCA 1F0MA 3I5JC 3UXLA 3W9CB 4O1NA 2N9XA 3RNCC 3JSVB 5E6JA 4YR3A 2DZIA 2OPJA 4EMJA 5ALIA 5AKKA 4U7CA 3Q8LA 4XE0A 2KMDA 4TQSA 4EBDA 5E6OA 4M6WB 5JZEB 1HZ5A 3TTEA 4ECZA 2P66A 2NRVA 1MQ2A 1FXIA 2W54A 2KX3A 3MHSD 2VIXA 2W0HA 1H6VA 1E8GA 5KFQA 4CF3A 3RULA 2QAEA 1N60C 2J3NA 2PLPA 4DHZB 1RM6B 2O2VB 4C4TA 1JPMA 3VUYA 3TSJA 3ES7A 3WK6A 4H2HA 2O6KA 2K6QA 4HCNB 3SR6A 2P8BA 1LO5D 3UCDA 4PHDA 1QILA 2WDQB 1K51A 2VZKD 3NVZA 1XLQA 3KZXA 2CS4A 3PZDA 3ZTCA 5FR6A 3S1EA 4XX5A 5AM4A 5ALXA 7ICVA 1ZQXA 2WLBA 3CMMB 3PO5A 1D3ZA 3G6VA 4I2AA 2KV2A 2IJ0A 2YLMA 5J2GA 3A9KB 2AL1A 2NBUA 2EQ7A 3SAGA 4EQRA 1D8LA 1D9FA 4UD8A 1MOKA 3QC8B 4GGBA 3Q6BA 5HHIA 4RNOA 3CYJA 1NKBA 3ZJVA 2E8NA 2JEGA 3U4EG 1YOVB 4K3CA 2WF5A 5DCNA 5C2TB 1S9FA 2KK8A 1FXAA 3UI3A 2HCFA 1NHRA 3DG3A 4LIIA 5J2FA 2RMMA 5D94A 4KIKB 1QOGA 2I38A 4YQWA 4B0EA 1WR6E 4AUQC 2ISOA 3P4QB 3JZUA 1OUQA 3DVNV 5G5HA 4IL6U 4H4RA 3AE1B 3QTPA 1N2XA 2X38A 4EX6A 3GS2A 4EYHB 3ENEA 2VFRA 1N48A 1T0YA 3L4PA 2KDFB 5ALOA 3BIID 4O5KA 5AI8A 3UXPA 2E6XA 3D46A 1OEYA 1XD3B 2WAQC 3HW2A 4H4WA 3A33B 3T8QA 3GIIA 1ZQLA 3Q6JA 3BSMA 3FYYA 3F2DA 1K53A 5C23A 3CSFA 3QKEA 4H1ZA 2EMSA 3NFUA 2KDMA 4IM0A 4ITKA 3DHHC 2YQEA 1HUZA 2Z8LA 5KVIA 1RRBA 1ZQAA 2QQ6A 2DENB 1VZ7A 2V4LA 2V3SA 5ALYA 2A3VA 2WOWA 3OJ3A 4ZRJA 1U9LA 2H3ZA 2GBNA 1KJTA 4JWUC 1MBBA 2GGIA 5K8EA 5KG6A 5J29A 1K8RB 1P7FA 2MW5A 4NEWA 3LXFA 5T14A 2E8PA 5AKZA 4CE6A 2M17A 3PVXA 4L1BA 2CU3A 5DPTA 9ICAA 4F8RA 5JTIA 5HR6A 4XWTA 3DG6A 4K7ZA 2W8LA 1SGHA 2XY7A 3SQSA 4O3OA 1MNSA 2D2QA 1M94A 3NS1B 2ZUBA 2G06A 4RT2A 2R8HA 3ED5A 2A1JA 2H5XA 2AJQA 3FW9A 5AKIA 2DKZA 2DX5B 3JPQA 2BCRA 5FK9C 5KG3A 2BKEA 3UIPB 1HEKA 3GD4A 2ZUDA 2IYDB 3N6HA 5DG8A 1D5MC 7ICTA 3UGVA 3W5VB 1Z4OA 3KHGA 5CR0A 1XNSA 4MGYE 4B9MA 3T5LA 2YMLA 4ECYA 1N56A 4JV1A 2ZC8A 3NRWA 3EAOA 1GOZA 1ED1A 1TKDA 2PU1A 3QHTA 3AM9A 3SFEB 2ZIWA 2HDEA 1IBXB 2P0IA 2JH1A 1K52A 2PFQA 1EXNA 1H38A 3R66C 2MBQA 2WP6A 4IT1A 1S77D 3GSYA 1B4FA 4NM1A 1HQRD 4C7ZA 3AULA 4QWCA 4EZKA 1F0ZA 5IO9A 4KN4A 1KRHA 7ICEA 4JE3B 1WWUA 2QJMA 3C0PA 2QDFA 2IHNA 2VFTA 1QH9A 5CHVC 2PKOA 2L83A 1STEA 1SXTA 4KX5A 4GFIA 1M6YA 4J9SA 4IWOA 3K9PB 2UWQA 4NLKA 4IP4A 1SL1A 4RQ1A 1L5PA 1L8LA 1YD8U 4WWMA 3LB8A 2OAIA 3RUIB 4DBGA 1XS9D 2NPTA 5HP4A 2L52A 2DHZA 1WUEA 1BNPA 1KLVA 5AKLA 2WDRB 5JRBA 1TBEA 1UQVA 3GZNB 2BVGA 2L76A 1WR1A 2D11A 2QLTA 5J2DA 1F2RC 4NXZA 2X8HA 3N7RC 3ZD9A 2V3BA 3KQ4A 3JVAA 3U7DA 3GZNI 1D7YA 2BPFA 1JWUD 1X6JA 2QB0A 3Q3OC 3RT3B 3HRDD 1U4BA 1P3QU 5JU5A 2QB1A 2LD9A 2WP5A 4GYPA 2AGPA 4A8EA 2R8GA 5J04A 4DNAA 2PPGA 3LWLA 2C7HA 2J0JA 3LB8C 4RH6A 5HI1A 3IG3A 4KDLB 2YEPB 4J57A 1ISNA 3PW7A 4IM2A 2IBKA 3ZXVA 3VFCA 4EMWA 2CDUA 3QARA 3T9PA 3N1YC 3UPQA 4EOYA 3AL0B 2BWFA 5IN7A 2BTEA 4ZOHB 1C77A 2OCEA 2RPQA 4RPXA 3R2IA 2QARB 4HCLA 4DQPA 2BBCA 9ICSA 3Q8MA 1RDFA 3H8SA 2L3ZA 2ZEQA 3M1YA 2K5PA 2KZZA 4DLEA 1Y88A 2LYHA 2RGFA 2XNAC 4DF4A 4IDIA 5LXIB 5J2JA 3V6JA 2DW7A 2LYAA 3K1GA 2PTZA 4L2YA 3RH5A 1DIIA 3SENA 2YX8A 1D9DA 1MHXA 1RFKA 3E58A 3S1DA 2HNEA 4TV3A 3P1MA 2V3AA 3AU6A 3CSTA 3ZDAA 3PX0A 3RNAC 1VR9A 2KWDA 5GMVA 2GQWA 2CU1A 3I6TA 3RJHA 2PLIA 5IA7A 1E8YA 2M8SA 5KG1A 4F5PA 1SB3C 3SJNA 1L7YA 4QZHA 3CNHA 1NHPA 4QWAA 3T3FA 2J7QB 3V4BA 2C5LC 3UJSA 4F2SA 2CJOA 1N63C 1Q1RA 3I6EA 1XU4A 1IXRA 3LADA 1Q1WA 2AEHA 2YAUA 1I4QA 2BCVA 2XH7A 3DFYA 2L5YA 5IILA 4DDGD 5D4BA 4B6JA 5ALDA 2KMMA 3LVVA 3NUQA 1J7CA 3VHTC 3WAPA 4GXJA 4LNNA 2QDEA 4UBBA 1TFRA 3HILA 2R2QA 2OX4A 3C1ZA 5ALPA 3B9JB 3IJIA 4I2FA 3ZLGA 2JEFA 3AE3B 3T4WA 4CF4A 3M63B 1C7YA 2YB4A 1SKWA 2RK5A 1W1OA 1X6IA 1NJXA 1IM4A 3PV1A 4IUMB 4ZRKA 3S2AA 3JPRA 4ARIA 3U2SC 8ICVA 1Q0WB 1GRAA 3NOBA 1L8PA 2A19A 3RNFC 3QLDA 2AGQA 2UVUA 2F8KA 1E7UA 1XCTL 1GESA 8ICPA 2IZVB 4MH0E 3Q8SB 4IQUA 1N6ZA 3M9OB 2EKIA 2OJWA 1F9CA 2AKMA 2G07A 1IV8A 1L3VA 1L0VB 2QJJA 2C9WB 2KFKB 4F4ZA 1LFDA 4UB2A 2PMVA 2Q5WD 2JWUA 4B9KA 1VRAB 3PPAA 3T8MA 4ZA0A 2J6SA 3MQTA 3HM3A 5AIBA 5KFIA 4YVZA 1WMHB 2WXHA 3IT6B 2OO6A 4Y2TA 5IIJA 2ZZBA 3HSUA 1WUFA 4QZDA 2DZKA 2ESEA 4FP1A 1JWBD 1R4NI 1WJ4A 1PVRA 1TAUA 4MM3B 3T79A 4JB1A 1KEJA 1DXSA 2KQ4X 2MP2B 3ZVHB 3WIMA 3EPGA 4BFRA 3RNEC 3T3NA 3N20C 9ICJA 1SB3B 3MWCA 1BVSA 4C8NA 4NY0A 1NYQA 3VTVA 4A55A 5C1ZA 1QSSA 1BGXT 1D5ZC 2CHZA 4GN1A 3UMCA 3P2BA 4HPPA 1PK3A 2UVVA 4NQKE 1JMLA 2P4PA 3GE8C 3RMKC 3Q3FA 5HHZA 3FXGA 3PSIA 4KKJA 1AROP 4FJVB 3UCCA 2R8IA 3IP4B 8ICAA 2B0CA 1VD2A 1WGDA 3MJ5A 2BCSA 2EQ6A 4KMUA 2EAOA 2MLBA 4K8DA 2LWPA 1UWMA 3H7PB 1J97A 4RZRA 2NBVB 5IOIA 2K0PA 3I9V1 2ZZCA 1OFFA 7ICKA 2EMTA 2XH2A 4H4QA 3GY1A 2B3AA 2E3TA 2WAQF 4ED3A 2BS2B 4WQMA 2VAOA 4EZ9A 3C21A 4FFDA 3APFA 4I2GA 3SEBA 1WY8A 2QILA 1ZOYB 3AE8B 3IDWA 1J7AA 2QHOA 4MGIE 2WFAA 5HKHA 1ONFA 4ED2A 2KWVB 4TURA 2K4EA 1L2NA 4M01A 2V0GA 4JHMA 2XN9C 2ZNVC 1ZQPA 2FCNA 4HDQA 3ZJUA 3PO4A 2C7MB 4ELTA 5ALNA 1V1OA 4Y2YA 3NS1A 3SV3A 3B2GA 5F9NA 3MJWA 2FJ6A 1FEZA 3MR2A 4JWNA 1XQQA 4G7FA 2JSVX 3OTQA 4HAIA 4F4XA 3QK0A 3FYHA 2IMWP 4US8A 3A9KA 5BMGA 4YN4A 1GSNA 2KQ7A 1GB1A 2ZNVB 3ZGZA 1V59A 2BDUA 4GC7A 3STPA 4OVVA 2LM1A 1TYGB 2KTRA 2JGAA 5ALMA 5EOZA 1AARA 2PGEA 1W1MA 3W1SC 3A9JB 5HMRA 2I5HA 5KG7A 2LVPA 5AZHA 4TUPA 5ER0A 1SBBB 4EUTA 3BWUD 4Y2RA 4UARA 4FA6A 4H4VA 2KX0A 2K8CB 3SHQA 3FV9A 5AKGA 3HP6A 2N7JA 1XWLA 1V9PA 4OVZA 1V2YA 1J8CA 1NYRA 5AI9A 3GRTA 2EDUA 4BKTA 4TQ0A 2ONQA 4YR0A 2FYMA 3CF6E 2LGSA 4MH8A 2QDDA 1WF9A 3KUDB 1EC8A 4Z1YA 2Y5BB 2XVTA 5ALKA 3A7UA 4F4RA 4A3OA 4ANVA 4G3XB 5G5GB 5LLIA 4I2DA 3VDGA 1BPBA 2GLEA 3AV8A 4MT5A 1SJHD 5J0QA 2KTRB 1HA5A 1AHZA 2KKVA 1QKZA 2PMZF 5JRTA 2J0MA 2MBRA 2A5UA 4GDLA 2ODGA 5IINA 1ZY8A 3ZDBA 2MHJA 2EH9A 2VJ5A 1VAOA 2D07B 1VDVA 2YMMA 2WPEA 3N4EA 5ADZA 8ICWA 4H83A 4HG0A 4DSFA 5J2IA 1BUIC 3PLUA 2LGDA 2M19A 3UF8A 3BVMA 4YG2A 3A1QB 5EBKA 3NVWA 2FMQA 1ACCA 4R8UA 2I5QA 5AM2A 2AAQA 3R0KA 4EE2A 3ENLA 2KEYA 3OWEB 4M04A 2BVHA 4X57B 1EF5A 2XGPA 4IRKA 2MRLA 2HSZA 3QU5A 4TVYA 3AEEB 1BNOA 1FM0D 2KOXA 2MUTB 5J0PA 4RUCA 1WWTA 3OW1A 2K22A 3D2NA 4KGTA 4QJFB 1WGRA 2KN7A 2HW3A 4GRTA 3PRMB 3ZDCA 2PW9A 3NRZB 3OZMA 4IL2A 4F5RA 3ZRCA 2SEBD 8ICQA 2KIVA 1LV5A 5HFYA 3C5FA 3C28A 2F3NA 2N1WA 3GV7B 5L1LA 3L0WB 1B9RA 2FE9A 3VDZA 1ZQSA 1NVID 3CK5A 4RM9A 4F4KA 2XEWA 4NY8A 2DYBA 5JHBA 4KX3A 2C60A 3NZUA 2LASA 2ZZ0A 2JVCA 2KP7A 2PLSA 4XRHA 2WF6A 2IA6A 4DSKA 1MHHE 1Z1VA 2N9PC 2AHOB 2XBBC 2ONEA 7ENLA 4JUZA 4HCDA 3RNGC 2VFVA 2ZTCA 2J6UA 3TEYA 4C56C 1KKOA 4E0DA 1JPDX 4O3NA 9ICLA 2NYVA 3AXCA 5KT3A 4DHGA 1E0ZA 2AGOA 1FECA 3RPFC 3GV8B 3VUXA 4BBNF 2BHNA 5HNKA 4H4ZA 4KN7A 5GTIU 7ICNA 1WJUA 2PP1A 4IR9A 3VXWA 2M4NA 1L0YB 1WVFA 5AZFA 5AEKB 2F1JA 3EC8A 7ICOA 6ENLA 1TY2A 2K1FA 4NPNA 2OEDA 5ALSA 4X2PA 1TV9A 4BZAA 1TVAA 5FS7A 3I63C 1TGZB 5D6JB 3FILB 4FI4A 3PSEB 2KACA 3POPA 2LHDA 1VJ5A 2YVGA 2LKYA 1FNUA 1EM7A 1R4MB 3FAHA 4RCOA 1NHQA 2JUOA 2BS4B 1GRHA 2QJNA 1ZKHA 2KFZA 1IG6A 4KVGB 3IG5A 1C4AA 2KHWB 3MDCA 5KFJA
chains in the Genus database with same CATH topology
4XDDA 3A7RA 3VRBB 3R07C 1DGJA 1FFVA 2AQ3B 4TQ1A 3BW7A 1P7EA 1T5XD 2VZKB 1AHUA 3E56A 4ZRQA 2BB5A 1N5WC 3BK1A 1NEKB 4ZHOA 3D2JA 3AEGB 4RGOS 3E9SA 1VJKA 2NTSA 4FXCA 3LYYA 3W9CB 1WRIA 4O1NA 2LFIA 1UUPA 1X2GA 5E6JA 1E0YA 1OQRA 1WVEA 2DYMA 3W8XA 3ETRA 1FNWA 2QIEB 4RF1A 4XE0A 3NUHB 1JWSD 1HZ5A 5AE2A 1FXIA 2W54A 1E8GA 1UXYA 1SIJA 1N60C 2PLPA 1QLTA 1V8CA 1RM6B 3R8BA 4OALA 2Y3AA 4C7YA 3TSJA 1I4HA 1FIQA 3SR6A 1LO5D 2Y3RA 5FXPA 2WDQB 1QILA 2GI9A 4N58A 2I2YA 1K51A 1L4DB 2VZKD 3NVZA 1DYQA 1V1PB 1XLQA 1C9FA 3S1EA 1KLUD 2WLBA 4OW0A 2QSDA 3Q8AA 1FMAD 1SSNA 2IJ0A 3AE5B 1ZXIC 5I4DA 2Y5PA 5D79A 2BYTA 4JAYA 3IT4B 5JXVA 4UD8A 3LAEA 3W5UB 1I4XA 1TZOA 2RDHA 1X2HA 3ZJVA 3U4EG 2BB6A 1L6VA 3AEDB 1TS3A 3HRDC 5C2TB 3H8HA 4JWSC 4UDUC 1FXAA 1FD6A 2BT6A 3P4RB 3UI3A 4OHJA 2WXNA 2RMMA 3MHZA 1QOGA 2I38A 2WU2B 1T3QC 1R7SA 4B0EA 2JQRB 3P4PB 1M4VA 3P4QB 2BW2A 1XXGA 4DQOC 1I4RA 2Q85A 1ENFA 3S1FA 5G5HA 4CQNA 3AE1B 3N9YC 1SEBD 1TY0A 1YQ4B 2G9HD 3MFGA 5AE3A 2QMTA 1KH0A 1L6UA 2X38A 1F0XA 1D5XC 3GS2A 4TMAB 4M0WA 4NAMA 2VFRA 4BCAA 3L4PA 1E7PB 2IGDA 3BIID 5H8YE 1PUTA 1PGAA 2E6XA 3KLSX 3NVZB 2QPMA 4HKQA 1QLBB 4LTUA 4HRSA 1AHVA 3ABVB 1K53A 3P4SB 1VZ6A 4H2AA 1VLBA 2KDMA 1ZXHA 4IOIE 2I0KA 4ITKA 4EC3A 4NZLB 2Z8LA 3HUIA 5BYRA 1VZ7A 1ZR6A 2P3HA 2WXMA 1C76A 1DOXA 4JX1C 1TJEA 4JWUC 1MBBA 4P16A 3S1CA 2V3NA 3I57A 5K8EA 3U7ZA 1SJED 2GB1A 1P7FA 3LXFA 3WCQA 1QOAA 1TKYA 4L1BA 4US9A 2CU3A 3TSSA 3TEZA 4MACA 2JX5A 4PVJA 2KAJA 3EUB2 4XWTA 4WURA 1E8HA 4JPSA 4GDLB 2TSSA 2SAKA 3Q8BA 4YTPB 3BYTB 2J53A 3NS1B 1L4ZB 4Q2JA 3JS8A 3W8ZA 5AE1A 3FW9A 3P42A 1N60A 2MJEA 4NJCA 5FK9C 4AQ7A 2WU5B 1UNSA 2FE8A 4TVWA 2HTME 1VQZA 1D5MC 3P63A 3W5VB 3PO0A 3W8WA 4XLOA 2L1AA 4PT5A 2M0AA 4YWGG 1N62C 1GOZA 1OQQA 4LLGM 4PZFA 1QLUA 3ZJTA 3AM9A 3R2TA 1NI3A 3SFEB 5HG2A 4B0MA 2HDEA 1IBXB 2LEKA 3FW7A 1K52A 2N0SB 1W1LA 1CJEA 1PGBA 3AE6B 3GSYA 1HQRD 4C7ZA 1TS4A 4BBYA 3MP9A 1JALA 3KJMA 2MJ3A 1F0ZA 1C79A 4WAFA 1EU4A 1KRHA 1JW9D 1FRDA 4JE3B 3C0PA 5MPOA 2VFTA 4REZA 2PKOA 2L83A 1STEA 2AQ1B 1SXTA 2LJIA 2WS3B 4HJGE 3NVVB 5AWVA 2NQWA 5HHDG 1L5PA 2W3SA 1JCKB 4WWMA 2OAIA 1KFYB 1V1PA 2NMQA 3PQBA 4P6VF 2WXPA 1QQRA 2L52A 2MH7A 2WDRB 2WXOA 1FFUC 2BVGA 3VTEA 3PZ7A 1T6BX 1WSPA 1AWDA 1F2RC 1FFVC 1FFUA 1GAQB 3KQ4A 4J3OD 5FXFA 1JWUD 1W1RA 4ZRPA 2VFUA 1E10A 1RM6C 3HRDD 2INPE 1D6EC 1QOFA 4N6EB 5H92C 3VQIA 2ON8A 3BZDB 1IGDA 1HZ6A 3NVWB 3TX1A 3LB8C 1NENB 4RH6A 3AB5A 5HI1A 2YEPB 3AECB 2B76B 5GXGB 4PYTA 5BMIA 2WNMA 4ZHPA 2ZW0A 2BTEA 1D4BA 1C77A 1AYFA 2LHEA 3IAS1 4ZOHB 5I1VA 1XEEA 3R2IA 4DXFA 2BBCA 4ZOHC 5I1WA 1YN4A 4A8XC 1ZE3D 4N59A 1JRPA 2K5PA 2MEKA 2W55A 1BMLC 1EU3A 2XNAC 1N5XA 1IUEA 2L32A 4IDIA 4AS1A 3TEXA 2WDWA 4L2YA 1DIIA 3TUOA 3S1DA 1MHXA 1RFKA 3P1MA 2WXKA 2E5AA 1W1SA 2QEJC 1HEZE 3DWGC 3Q8FA 1VR9A 2KWDA 1C4PA 4R3DA 4ARCA 5L6FA 5D7GA 1CQVA 4PVEA 1SB3C 2CJNA 2PIAA 2Q4WA 1I4PA 1YNTE 4DNSA 2CJOA 1N63C 3GP7A 1QT9A 3Q8CA 1FO4A 1E8FA 2Y4GA 5FXDA 4OZAA 5BYQA 1I4QA 2WXLA 2DWQA 3NVYB 2ACZB 2KMMA 3NZ3A 1J7CA 1GPXA 1SE3A 4C80A 1VZ8A 3IXSA 5BYSA 5EE1A 1L0XB 3ZQ4A 3B9JB 3AN1A 3AE3B 1MI0A 3B2FA 1RWSA 1SF0A 4GLSC 1N5WA 5TSSA 2QKNA 2O3GA 2ICIA 2AX5A 1QF6A 2H88B 2RDGA 2RK5A 1W1OA 3B9JA 4ARIA 2PVOD 2K9XA 2WXRA 3U2SC 1ET9A 2PLIA 3IAM1 5D3IB 1YJIA 4LK0M 5FKAC 1XCTL 1V97A 4YSZB 2EKIA 4YSXB 1XLOA 1IBXA 2V3PA 1L0VB 4XWWA 5EE3A 5D3DA 2Q5WD 2PMVA 2JWUA 4O95A 4D2KA 2GQUA 1VRAB 1Q10A 2PTLA 2AXRA 5G5HB 3AEFB 3HSUA 2WXHA 4PVKA 3IT6B 4YXDB 1DZNA 4WH4A 2J52A 1JWBD 3FC4A 3AE7B 1N61C 3LLBA 3Q8EA 1JQ4A 1YJJA 4MM3B 3FWAA 4JB1A 2KQ4X 2DBYA 2GRIA 3J9CA 1C78A 4YTMB 3BVZA 3T3NA 1T3QA 4PVHA 1SB3B 2QJLA 1NYQA 1FEHA 1KF6B 2WXFA 4A55A 3RJ8A 1D5ZC 2R8DA 2RPVA 1WXQA 2FBWB 2EELA 1JMLA 2N9LA 2DLBA 2P4PA 3BYYB 5EE0A 5HHZA 1BXTA 4KKJA 2D5GA 1ZDXA 2FUG1 3AE4B 1MBTA 3PZ8A 3MJ5A 3T3OA 1EWCA 1FNVA 4USAA 2VFSA 1UWMA 1KLGD 1ZXIA 2LUMA 2K0PA 1TKGA 3I9V1 1OFFA 1FIQB 2WXQA 3SR6B 2WXGA 2E3TA 1I19A 2BS2B 4WQMA 1W1QA 5AUKA 4MLAA 1UGJA 2VAOA 3PM9A 3FW8A 4TSSA 1MVKA 2JYEA 2J4XA 1ZP0B 4RGTA 3SEBA 2QILA 1ZOYB 1SE2A 2K3UA 3AE8B 1J7AA 3EUB3 2IDYA 3AEAB 1N61A 1FCLA 1ZPSA 2V0GA 2XN9C 1N62A 1AW7A 3ZJUA 4OZCA 1V1OA 2AQ2B 3NS1A 2MJDA 3B2GA 3ETRB 4PWBA 3A7AA 2JYTA 4WIPA 2YEPF 2JSVX 2YVSA 3V05A 1C4CA 3AE2B 4US8A 2EXRA 5BMGA 1GB1A 3ZGZA 1I4GA 2DYOA 4HEA1 4YT0B 3DWMA 4BC7A 1PDXA 2P13A 1TYGB 3VR8B 1W1MA 5HMRA 1HXYD 1ET6A 1UWXA 4RGMA 3SFDB 1HSKA 1SBBB 1F77A 1ROEA 3BWUD 2N9KA 5T8IA 1XCQL 4HROA 2W3RA 2N7JA 1A70A 2G1EA 4KKIA 4YTNB 3TEWA 1JWAD 2OHFA 2INNE 4NAWB 3W2DA 4OVZA 1NYRA 4TQ0A 2ONQA 3FILA 3D2DA 4MH8A 5LNK1 2J42A 1W1KA 2IPKD 3I99A 4BC9A 2Y3SA 1RYJA 1QOBA 2LMCA 3MC0B 4L23A 3CIRB 3W1SA 1XLNA 2JU6X 1PGXA 2WP9B 5EE9A 5C3JB 3A7UA 4RF0A 5G5GB 1GB4A 3AV8A 4MT5A 4ML8A 1SJHD 2PVGC 3KWVA 3ZYYX 1HA5A 1AHZA 1QKZA 3HVZA 1XO3A 2MBRA 1DOYA 5L6GA 1N63A 1K50A 2IGHA 2LGIA 1VAOA 2UUVA 1VDVA 4IKGA 5ADZA 1KTKA 1DIQA 4HG0A 1E6EB 1ESFA 1BUIC 5AUIA 1FCCC 4A6QA 1FRRA 1DOIA 1YN3A 2KN4A 2M19A 3BVMA 2R2ZA 3EA6A 3EGRA 3RFZB 3NVWA 1ACCA 1JWMD 1PYWD 3Q69A 3URYA 4EE2A 3OWEB 1CK1A 1XF5L 1I7HA 2H89B 2BVHA 4ZYSA 3AE9B 3VR9B 5G5GA 4TVYA 3AEEB 1FM0D 4OZBA 3TSHA 1WWTA 2K22A 4KGTA 4RNAA 4YSYB 1WYGA 3RJAA 1E9MA 1TS5A 2JZPA 2PW9A 3BK2A 3HVDA 4A9AA 3NRZB 4A90A 3AH7A 2SEBD 5HFYA 2IPIA 4RFBA 4RGNA 1B9RA 2WXIA 1TS2A 3D2HA 1YQ3B 1NVID 2BS3B 2JXTA 3CWIA 1IGCA 3DQ0A 1YMHE 3AMZA 3DEDA 4PWCA 1ZUD2 2V4IB 4XDCA 2WDVB 3O13A 2R61A 4DXGA 2PLSA 2UUUA 1MHHE 3KWLA 1EWYC 1YN5A 1W1JA 3NVYA 2VFVA 3TEYA 1Y56A 4C56C 2W82A 4KGSA 4KGRA 5FXEA 5FR3A 1J7BA 1E0ZA 3RPFC 3V3XA 1PFDA 2ZW1A 3BVGA 1F2RI 4KX6B 1AN8A 2IGGA 3NRZA 2WQYB 1TKEA 1ZDVA 1L0YB 3AEBB 1WVFA 1WGKA 1JROA 5HQXA 2BVFA 1TY2A 1MPEA 3C8YA 3VRAB 2OEDA 3U52E 2M56B 4GDKB 1XLPA 3FILB 2KACA 3GB1A 3POPA 2LHDA 2NTTA 4HKZE 1FNUA 1EM7A 3FAHA 1SE4A 2WXJA 4RCOA 2BS4B 2Y08A 2Y5CA 2GQTA 1CZPA 1C4AA 5BMHA 1B1ZA 3NVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7R A;  3VRB B;  3R07 C;  1DGJ A;  1FFV A;  3BW7 A;  1AHU A;  1N5W C;  1NEK B;  4ZHO A;  3AEG B;  1VJK A;  4FXC A;  3W9C B;  1X2G A;  1WRI A;  1E0Y A;  1OQR A;  1WVE A;  3W8X A;  3ETR A;  2QIE B;  5AE2 A;  1FXI A;  2W54 A;  1E8G A;  1UXY A;  1SIJ A;  1N60 C;  1QLT A;  1V8C A;  1RM6 B;  4OAL A;  4C7Y A;  1FIQ A;  3SR6 A;  5FXP A;  2WDQ B;  4N58 A;  3NVZ A;  1XLQ A;  3S1E A;  2WLB A;  1FMA D;  3AE5 B;  1ZXI C;  4JAY A;  3LAE A;  3W5U B;  1X2H A;  1L6V A;  3AED B;  3HRD C;  5C2T B;  4JWS C;  1FXA A;  2BT6 A;  3P4R B;  1QOG A;  2WU2 B;  1T3Q C;  1R7S A;  2JQR B;  3P4P B;  3P4Q B;  2Q85 A;  3S1F A;  5G5H A;  3AE1 B;  1YQ4 B;  5AE3 A;  1L6U A;  1F0X A;  2VFR A;  4BCA A;  3L4P A;  1E7P B;  3BII D;  5H8Y E;  1PUT A;  3NVZ B;  2QPM A;  1QLB B;  4LTU A;  4HRS A;  1AHV A;  3ABV B;  3P4S B;  1VLB A;  2I0K A;  4ITK A;  3HUI A;  1ZR6 A;  2P3H A;  1DOX A;  4JX1 C;  1TJE A;  4JWU C;  1MBB A;  3S1C A;  3LXF A;  3WCQ A;  1QOA A;  1TKY A;  4US9 A;  2CU3 A;  2JX5 A;  2KAJ A;  3EUB 2;  1E8H A;  4YTP B;  3NS1 B;  3JS8 A;  3W8Z A;  5AE1 A;  1N60 A;  2MJE A;  2WU5 B;  4TVW A;  2HTM E;  1VQZ A;  3P63 A;  3W5V B;  3PO0 A;  3W8W A;  4XLO A;  1N62 C;  1OQQ A;  1QLU A;  3AM9 A;  1NI3 A;  3SFE B;  2LEK A;  2N0S B;  1W1L A;  1CJE A;  3AE6 B;  4C7Z A;  4BBY A;  1JAL A;  3KJM A;  2MJ3 A;  1F0Z A;  1KRH A;  1JW9 D;  1FRD A;  3C0P A;  5MPO A;  2VFT A;  2PKO A;  2L83 A;  2WS3 B;  3NVV B;  2NQW A;  1L5P A;  2W3S A;  4WWM A;  2OAI A;  1KFY B;  4P6V F;  2L52 A;  2MH7 A;  2WDR B;  2BVG A;  1FFU C;  1AWD A;  1FFV C;  1FFU A;  1GAQ B;  5FXF A;  1W1R A;  2VFU A;  1E10 A;  1RM6 C;  3HRD D;  4N6E B;  1QOF A;  5H92 C;  3NVW B;  3TX1 A;  3LB8 C;  1NEN B;  3AB5 A;  3AEC B;  2B76 B;  5GXG B;  4PYT A;  4ZHP A;  4ZOH B;  1AYF A;  4ZOH C;  4N59 A;  1JRP A;  2K5P A;  2W55 A;  1N5X A;  1IUE A;  4IDI A;  1DII A;  3S1D A;  1RFK A;  3P1M A;  2E5A A;  1W1S A;  3DWG C;  1SB3 C;  2CJN A;  2PIA A;  2Q4W A;  2CJO A;  1N63 C;  1QT9 A;  1FO4 A;  1E8F A;  5FXD A;  2DWQ A;  3NVY B;  2ACZ B;  2KMM A;  1J7C A;  1GPX A;  4C80 A;  5EE1 A;  3B9J B;  3AN1 A;  3AE3 B;  3B2F A;  1RWS A;  1SF0 A;  1N5W A;  2QKN A;  2O3G A;  2AX5 A;  1QF6 A;  2H88 B;  2RK5 A;  1W1O A;  3B9J A;  2PVO D;  2K9X A;  2PLI A;  1YJI A;  1V97 A;  4YSZ B;  2EKI A;  4YSX B;  1XLO A;  1L0V B;  5EE3 A;  2Q5W D;  4O95 A;  2GQU A;  2AXR A;  5G5H B;  3AEF B;  4YXD B;  1DZN A;  1JWB D;  3FC4 A;  3AE7 B;  1N61 C;  3LLB A;  1JQ4 A;  1YJJ A;  4JB1 A;  2DBY A;  4YTM B;  1T3Q A;  1SB3 B;  2QJL A;  1NYQ A;  1KF6 B;  2R8D A;  1WXQ A;  2FBW B;  2P4P A;  5EE0 A;  5HHZ A;  3AE4 B;  1MBT A;  2VFS A;  4USA A;  1UWM A;  1ZXI A;  1TKG A;  1OFF A;  1FIQ B;  3SR6 B;  2E3T A;  1I19 A;  2BS2 B;  4WQM A;  1W1Q A;  5AUK A;  4MLA A;  2VAO A;  3PM9 A;  1ZP0 B;  1ZOY B;  3AE8 B;  1J7A A;  3EUB 3;  3AEA B;  1N61 A;  1N62 A;  2MJD A;  3NS1 A;  3B2G A;  3ETR B;  3A7A A;  2YVS A;  3AE2 B;  4US8 A;  2EXR A;  4BC7 A;  4YT0 B;  3DWM A;  1PDX A;  2P13 A;  1TYG B;  3VR8 B;  1W1M A;  5HMR A;  3SFD B;  1HSK A;  1ROE A;  4HRO A;  2W3R A;  4YTN B;  1A70 A;  2G1E A;  1JWA D;  2OHF A;  1NYR A;  1W1K A;  3I99 A;  4BC9 A;  1RYJ A;  1QOB A;  3CIR B;  1XLN A;  5EE9 A;  2WP9 B;  5C3J B;  3A7U A;  5G5G B;  3AV8 A;  4ML8 A;  2PVG C;  3ZYY X;  1AHZ A;  3HVZ A;  1XO3 A;  2MBR A;  1DOY A;  1N63 A;  1VAO A;  1VDV A;  5ADZ A;  1DIQ A;  4HG0 A;  1E6E B;  5AUI A;  1FRR A;  1DOI A;  2M19 A;  2R2Z A;  3NVW A;  1I7H A;  2H89 B;  2BVH A;  3AE9 B;  3VR9 B;  5G5G A;  4TVY A;  3AEE B;  1FM0 D;  1WWT A;  2K22 A;  4YSY B;  1WYG A;  1E9M A;  4A9A A;  3NRZ B;  3AH7 A;  1B9R A;  1YQ3 B;  1NVI D;  2BS3 B;  3CWI A;  3DQ0 A;  3AMZ A;  3DED A;  1ZUD 2;  2WDV B;  2PLS A;  3KWL A;  1EWY C;  1W1J A;  3NVY A;  2VFV A;  5FXE A;  1J7B A;  1E0Z A;  3RPF C;  1PFD A;  4KX6 B;  3NRZ A;  2WQY B;  1TKE A;  3AEB B;  1WVF A;  1WGK A;  1JRO A;  5HQX A;  2BVF A;  3VRA B;  2M56 B;  1XLP A;  3FAH A;  2BS4 B;  2Y5C A;  2GQT A;  1CZP A;  3NVV A; 
#chains in the Genus database with same CATH topology
 3Q14 C;  3A7R A;  2KDE B;  3TCA A;  3R07 C;  4FBU A;  3BZK A;  4QWD A;  1XSN A;  4KIT B;  2Z0E B;  4MGG A;  1COO A;  2AQ3 B;  4BOS C;  1RXW A;  1C1Y B;  3VTW A;  3BW7 A;  1WCN A;  1L7O A;  1QCK A;  2GO7 A;  4RQ5 A;  7ICM A;  2VZK B;  4E3C A;  1WX7 A;  1AHU A;  3F5A A;  4RQ0 A;  1T0Q C;  4WQO B;  3L08 A;  3E9S A;  1VJK A;  4B9V A;  2JY6 A;  2NTS A;  3LYY A;  2HBJ A;  4G11 A;  2DYM A;  1L6N A;  1E7V A;  4GOC A;  2DUY A;  2P35 A;  1FNW A;  2QIE B;  4IG7 B;  4RF1 A;  3VUW A;  1JWS D;  1MO9 A;  2ZUC A;  5FP0 A;  4KTQ A;  3MFH A;  2KFN A;  4GIR A;  5GTH U;  3SEI A;  3QZ7 A;  8ICY A;  1QLT A;  5J2B A;  5KFD A;  2KVC A;  4YXM A;  5KFC A;  3DVN U;  1TE6 A;  2GOW A;  3MC8 A;  4IQT A;  2OG9 A;  4I2E A;  3NY5 A;  4ICU A;  2Y3R A;  2I2Y A;  5HHH A;  2GI9 A;  4N58 A;  4YD2 A;  3RJJ A;  1DYQ A;  4DL7 A;  3P0W A;  8ICF A;  3LVW A;  1C9F A;  3VC6 A;  2HZG A;  1KLU D;  4M0W B;  3DQV A;  5DDY A;  2YB1 A;  4DQI A;  1SSN A;  2OH2 A;  3NTU A;  4W9E A;  4C4R A;  3SYZ A;  2EQY A;  4CRX A;  2POZ A;  2E8O A;  2LBO A;  1TT5 B;  2Y5P A;  4DHZ E;  4CGZ A;  2BYT A;  2KNJ A;  5JXV A;  4DOB A;  3TIX A;  2W7O A;  2K8C A;  4WJN A;  9ICR A;  1I4X A;  3LAE A;  2KJ8 A;  2RDH A;  4W9I A;  3B97 A;  3GQC A;  2BB6 A;  3ONS A;  2HHS A;  2G4D B;  1T8E A;  2AL2 A;  4ROP A;  3AED B;  1TS3 A;  2KDB A;  2KD1 A;  3K75 D;  3PW0 A;  4JWS C;  3N4F A;  3P4R B;  4JV2 A;  3HK0 A;  4OHJ A;  1L7M A;  1U47 A;  1LGR A;  3ETL A;  3ZVH A;  3WU2 U;  1SXE A;  1E5W A;  1S0V A;  2JQR B;  2Y0S F;  1M4V A;  1XXG A;  4LNK A;  4XYC A;  4CHK A;  2Q85 A;  1ENF A;  1J19 A;  3DVG Y;  4CQN A;  2IHM A;  2OJR A;  4W9G A;  4MMW A;  1SEB D;  2VAN A;  4CF5 A;  1KH0 A;  1TIF A;  2PS2 A;  2IND C;  1D5X C;  2OVL A;  4LZD A;  2MNR A;  4FX9 A;  3RJF A;  2XSX A;  4BCA A;  2BZF A;  3DVG X;  4TKN A;  1E7P B;  1MUC A;  3NVZ B;  3KLS X;  4I2B A;  5DKW A;  4C4V A;  8ICZ A;  2PCE A;  4QNL A;  2QPM A;  3AQF A;  3THV A;  4B9T A;  4HKQ A;  1QLB B;  2MX2 A;  4RNM A;  4HRS A;  2XID A;  3F2C A;  1Q5W B;  5ALU A;  1GEU A;  5L1K A;  1VZ6 A;  1LPF A;  4NLN A;  4IOI E;  4PS8 A;  1WRD B;  4EC3 A;  1HIW A;  1ZQU A;  3HUI A;  9ICE A;  2GGG A;  3TKA A;  2KVS A;  2HXT A;  1ZD5 A;  2W7P A;  2FLP A;  7ICJ A;  3ML8 A;  2Z7J A;  3BS7 A;  1DOX A;  1NKE A;  2P3H A;  2ZIU B;  2JRI B;  2K60 A;  3GIK A;  1K4Q A;  4OJL A;  2OYY A;  4ED8 A;  1FPY A;  2EQ8 A;  5FJP A;  4BWJ A;  2E1F A;  2CPR A;  3N32 A;  4BBN C;  3NXL A;  3C2K A;  4US9 A;  4DFM A;  4B9S A;  4EZL A;  4PVJ A;  2RQ5 A;  2HVI A;  4WUR A;  2W9B A;  4GIB A;  2ZPY A;  4QZ8 A;  4O3R A;  9ICM A;  4F1S A;  3QEB Z;  2J6T A;  4DQR A;  2IBI B;  3JS8 A;  2ZTD A;  2IO3 B;  1SL2 A;  1B22 A;  5EWE A;  4UAY A;  4O9M A;  4W9L A;  3SD5 A;  4NJC A;  3RBE A;  4UB8 U;  3Q8R B;  4FJY A;  3RB0 A;  2DAF A;  1T94 A;  2JZ3 B;  3ZVV A;  3BJY A;  2YQU A;  3D47 A;  2BKR B;  2HTM E;  4NJ6 A;  3M8R A;  1VQZ A;  1NDD A;  2I1Q A;  3MTN B;  3PO0 A;  3W8W A;  2M0A A;  4K4I A;  1N62 C;  5AKE A;  4OJO A;  2TPR A;  4LLG M;  4GIS A;  4B9L A;  5HG2 A;  3KHL A;  1ZQM A;  3DES A;  2LEK A;  2ES6 A;  2PFP A;  1IYF A;  1W1L A;  1MC8 A;  3KHH A;  3C5G A;  1PGB A;  1T0R C;  2KLC A;  4HDO A;  1DXL A;  1UA1 A;  3QN3 A;  1TS4 A;  4JN7 A;  3T5H A;  3B0A A;  2MSE D;  3RB6 A;  1NU5 A;  3SAF A;  1CEZ A;  1EU4 A;  1NHS A;  5KVH A;  4YWS A;  1M6I A;  3TOY A;  5MPO A;  3CGE A;  3QIJ A;  3CGC A;  1HTQ A;  2LGY A;  4REZ A;  1KN5 A;  2GOL A;  2DKX A;  3L5K A;  5KFH A;  4PYZ A;  1GRG A;  4I27 A;  4I2I A;  3LJ3 A;  3PST A;  2JXX A;  1KDH A;  2W3S A;  4IQV A;  1V1P A;  3HKZ F;  8ICN A;  3M95 A;  4P6V F;  1FEA A;  2HDO A;  3RFA A;  2W9C B;  3RRH A;  3PZP A;  4M2Y A;  3RJG A;  2WXP A;  2ZZP B;  1T7P A;  2W43 A;  2W9A A;  2RD0 A;  3SMV A;  4ECX A;  1P7D A;  3VFK A;  2AXT U;  1MDL A;  1QQ7 A;  4DHJ B;  3LDA A;  4BOZ B;  2EAM A;  1FFU A;  4EEN A;  4J3O D;  3CB3 A;  1EUV B;  2ZCB A;  3TAQ A;  2VFU A;  4IQW A;  4XC2 A;  2HHQ A;  5FXF A;  1RM6 C;  5D49 A;  2INP E;  2CRX A;  1D6E C;  3H0R B;  4II2 B;  4N6E B;  1ZD2 P;  2ON8 A;  3B0X A;  5AI0 A;  4F4W A;  5H92 C;  3VQI A;  4AJW A;  3EFU A;  3L10 B;  5L95 C;  4WJO A;  3M6K A;  1NK7 A;  1IIP A;  4URK A;  3WKE A;  5TZV A;  4M9N A;  4NL9 C;  1L3U A;  1QLN A;  2I1J A;  4ELU A;  4GXK A;  3RBD A;  2L0T A;  2WNM A;  4ZHP A;  2KZM A;  1D4B A;  2E8M A;  2K4I A;  3CGD A;  1Q3V A;  1S1Q B;  2HHV A;  2GGJ A;  3WKD A;  5FJO A;  2YN4 A;  3TW9 A;  2XC9 A;  3I28 A;  2Y9U A;  1NKC A;  1JRP A;  7ICS A;  2W55 A;  2BKF A;  1N5X A;  3RTV A;  1IUE A;  2KFJ A;  4AS1 A;  2UVW A;  3S47 A;  2ZIV A;  4K8G A;  4EEY A;  5ALQ A;  4QWB A;  3AUO A;  4KLE A;  5KFP A;  3QPE A;  3Q8K A;  3CT2 A;  3SN0 A;  1KTQ A;  3ONN A;  1V80 A;  3V5C A;  4AP4 C;  5KFG A;  4WAA A;  2QEJ C;  3MKC A;  3Q8F A;  4ARC A;  4O3P A;  5D7G A;  4PVE A;  3PX4 A;  4HPL B;  4RPY A;  2A1J B;  2EAP A;  2PIA A;  1T3N A;  2Q4W A;  4DNS A;  3KUC B;  3N1Z C;  3WAL A;  1V5T A;  2HJ8 A;  3GP7 A;  9ICF A;  3L5O A;  4P0P B;  3NZS A;  5ALG A;  3A1Q A;  5FXD A;  4K81 A;  2R2O A;  9ICV A;  4OZA A;  5BYQ A;  3R7R A;  3FCP A;  3OHB A;  3KYD D;  3NVY B;  2LVQ A;  3NZ3 A;  1DTN A;  1GPX A;  5IIK A;  2VA2 A;  5JCI A;  1CUK A;  1P43 A;  4C80 A;  5BYS A;  2RDJ A;  1L0X B;  4ECU A;  4J9M A;  3ZQ4 A;  2REX A;  4Y2Q A;  5JCN A;  1MI0 A;  3QQ8 B;  1NZB A;  3B2F A;  1C3T A;  3LXD A;  2KKC A;  3DBH B;  1SF0 A;  9ICO A;  4GLS C;  3U30 A;  1C20 A;  3KHR A;  4GXB A;  2HD5 B;  3JPT A;  2AX5 A;  2FIF A;  4FE3 A;  2H88 B;  3QUT A;  3I3T B;  1EBD A;  3B9J A;  1Q3U A;  5L1J A;  5J2R A;  2LI6 A;  2WXR A;  3GIL A;  4UAT A;  3IAM 1;  4H19 A;  3DEQ A;  4P0Q B;  3SAH A;  4RNN A;  1YJI A;  2JPH A;  4NQL B;  4YSZ B;  2RHF A;  4WWN A;  1ZQR A;  4YSX B;  1XLO A;  2HOI A;  3MGI A;  4GME A;  1D8B A;  5KFA A;  1IBX A;  1MQ3 A;  3AU5 A;  4MSQ B;  5EE3 A;  4KLQ A;  1P98 A;  3ZDT A;  1KFT A;  2NRT A;  4I6P A;  1ZQF A;  3SD7 A;  4O95 A;  3H8W A;  3DJG X;  1Q10 A;  3PMN A;  5DBA A;  2JV3 A;  5G5H B;  4PJ0 U;  3D9X A;  2O3G A;  7ICP A;  4BVU C;  4DHJ D;  2LRW A;  4BKS A;  5J0R A;  4PVK A;  1DZN A;  1FEB A;  4DOC A;  2OXO A;  2J52 A;  3AE7 B;  3JW7 A;  2OFJ A;  4E4F A;  3LLB A;  5ALV A;  3I1Y A;  1GJZ A;  4UAZ A;  3OSN A;  4YMO A;  2ALZ A;  4KLG A;  3VH3 B;  1JQ4 A;  5L83 A;  1Q46 A;  4QZB A;  5KG2 A;  5KT5 A;  2KWC A;  3J9C A;  1TAM A;  4O5C A;  4BV6 A;  2W11 A;  3BVZ A;  1T3Q A;  2H3F A;  2EAN A;  3NG0 A;  4PVH A;  2E5S A;  1MDR A;  3KUZ A;  5AIA A;  1ZQH A;  2IO1 B;  2WXF A;  3RJ8 A;  3OTR A;  3M9M B;  3EFC A;  1OJT A;  4GFJ A;  1ZOL A;  1WXQ A;  2EEL A;  2FBW B;  3GD6 A;  2N9L A;  2WYQ A;  2FUG 1;  1ZDX A;  3AE4 B;  4DSE A;  1JRU A;  4AYB C;  4K4H A;  1WX9 A;  2WTF A;  1OXJ A;  2V9W A;  1EWC A;  4RQN A;  1PK1 B;  4USA A;  1FNV A;  3QNM A;  4F50 A;  1WGY A;  1GRT A;  1KLG D;  2ZG6 A;  5KFF A;  1YX6 B;  2GWS A;  3ZKJ C;  3ZO5 B;  3SR6 B;  3TI0 A;  1H4R A;  2NRW A;  3DIP A;  2ZIX B;  3MFI A;  3J81 j;  3RH6 A;  2WXG A;  1I19 A;  2MAX A;  2XY5 A;  1GC7 A;  3H8A A;  5AUK A;  3CW2 C;  3TQ1 A;  1BPY A;  5CRX A;  2INC C;  4KDI C;  1MVK A;  5KFO A;  1X9S A;  3H7I A;  2JYE A;  3FM9 A;  3KOO A;  5J8Y C;  5L1I A;  2ZVO A;  3RAQ A;  1EF1 A;  1FHV A;  1Z4N A;  2E1E A;  3AEA B;  1OW5 A;  4PL1 A;  1AW7 A;  3JVZ X;  4BXO B;  4OZC A;  3H9D A;  5AHX A;  2MJD A;  3DHG C;  5J17 A;  3IG8 A;  4BUG A;  2PU0 A;  1C4C A;  1MG8 A;  4IM3 A;  1ZMD A;  3TL5 A;  2EXR A;  5TR5 A;  3QE9 Y;  2XK5 A;  3N30 A;  2UU7 A;  2DL0 A;  4PGQ A;  9ICU A;  1I4G A;  2DYO A;  2JRH A;  4HEA 1;  5GRT A;  1PDX A;  2ZVN A;  3VR8 B;  2ZXI A;  1SWV A;  1ZQZ A;  4ICA A;  3DV9 A;  4M0A A;  2CR5 A;  1HXY D;  2ZIX A;  2L0F A;  3N28 A;  1ROE A;  4JDR A;  2KFK A;  3CXB A;  4R66 A;  7ICR A;  5T8I A;  4DYE A;  1G6J A;  1NK0 A;  4QW8 A;  2W3R A;  3UQ2 A;  3ALR A;  1A70 A;  4YTN B;  3TEW A;  4UB4 A;  1RLF A;  3QFA A;  2INN E;  3Q3J A;  3OGU A;  4NAW B;  3PV8 A;  1SJD A;  4UQG A;  4FZN A;  2NO5 A;  5AM3 A;  4DDI D;  3V6K A;  5LNK 1;  5DB8 A;  1NK6 A;  1WM2 A;  2XGQ A;  3KFU F;  2NPX A;  5JUM A;  1ZQ1 C;  1QOB A;  3W1S A;  3CIR B;  3HM6 X;  2IO2 B;  2HMX A;  1XLN A;  2KJH B;  4ECR A;  3QAQ A;  1E8W A;  4KLU A;  1GB4 A;  4R64 A;  4DL2 A;  3WK7 A;  2PVG C;  3IC9 A;  3M8S A;  3HVZ A;  3DH9 A;  1Q1O A;  5AKH A;  2WPF A;  1N63 A;  4FO6 A;  1K50 A;  3L13 A;  2KAN A;  1MG4 A;  2RR9 A;  1A76 A;  1SV4 A;  1DRG A;  5G55 A;  8ICH A;  5K4L A;  2IY0 B;  1E6E B;  2BWE S;  3ZRF A;  4EMI A;  4A6Q A;  1XPY A;  3KBB A;  1DOI A;  2ISP A;  1FRR A;  5E79 U;  4FUL A;  5EWG A;  2KNB A;  3RFZ B;  9ICK A;  2OM6 A;  1RYU A;  1GG3 A;  1JWM D;  2LGX A;  2HVH A;  3URY A;  1CK1 A;  2H89 B;  4JB3 A;  3TJ4 A;  4WWO A;  5G5G A;  4C8L A;  3AEV A;  2DAJ A;  4LNF A;  3KKA A;  4CNQ A;  4M47 A;  1EC7 A;  2I6X A;  1KFD A;  4UAS A;  4F3O A;  1WYG A;  5KG0 A;  4K3B A;  3IFW B;  4A90 A;  3RR8 A;  4RFB A;  2C3D A;  4RUA A;  3D2Q A;  2WXI A;  1IPG A;  2BYF A;  2PP3 A;  4QZF A;  3D2H A;  5CHF A;  1U45 A;  1WGG A;  2BS3 B;  2JXT A;  3H4B A;  3DK9 A;  1J2N A;  4HWI B;  4PWC A;  2HXU A;  1NDA A;  3Q8Q B;  4DXG A;  4RPZ A;  1ZX9 A;  3PW5 A;  1WFY A;  1JIH A;  1W1J A;  1EWY C;  5DBB A;  1P1A A;  4DK5 A;  2KXJ A;  3IN5 A;  3DJJ A;  1FXT B;  4W9J A;  1Y56 A;  3NGD A;  3P3B A;  1PQS A;  2RDX A;  2WX0 A;  4KGS A;  4KGR A;  3OZY A;  3VA8 A;  1P9D U;  4ECT A;  3HIZ A;  4BKG A;  1RXV A;  2F77 X;  3SZ2 A;  1PFD A;  2ZW1 A;  2H3Q A;  3MR5 A;  4FS2 A;  2KOB A;  4PGX A;  5IIO A;  2N1V A;  3BVG A;  4M0X A;  3NRZ A;  1ZDV A;  2JHD A;  3AEB B;  3OHA A;  4M00 A;  3WAM A;  2X8C A;  3N6J A;  1NZP A;  5TR3 A;  2Z0D B;  2BVF A;  2KT7 A;  1O03 A;  2PE9 A;  3VRA B;  1GXF A;  2HBL A;  3ZNH B;  3U52 E;  2KC1 A;  1GRE A;  2BPC A;  2FDR A;  3GB1 A;  3OP2 A;  1WIA A;  1ZD4 A;  5KFR A;  3L3F X;  4IR1 A;  4BX9 C;  2FLL A;  2MBH A;  2Y5C A;  3ZLZ A;  3ZNG C;  5KHQ A;  4J9K A;  1KKX A;  2D10 A;  2OZT A;  3ISD A;  3H7V A;  4DX3 A;  4XDD A;  3K4G A;  4HVB A;  2KIC A;  9ICN A;  1FFV A;  4EQX A;  4W9F A;  4DL3 A;  8ICC A;  3RRG A;  1T5X D;  3IHP C;  4G8T A;  1ZQO A;  3Q4D A;  2BB5 A;  3WA0 A;  2GR0 A;  4MHV A;  1WWV A;  4FJZ A;  2HHT A;  4M6W A;  4HNC A;  2D6F C;  2WOV A;  2GH5 A;  1L8O A;  2LFI A;  3RNM A;  1S76 D;  3MDA A;  3QU7 A;  1YX5 B;  1WVE A;  1ZQY A;  2ZPN A;  3H40 A;  3QYP A;  2PTX A;  4F2R A;  1L7P A;  3EW9 A;  3NUH B;  2JWZ A;  3VAW A;  1CI4 A;  4J9Q A;  3OAW A;  1I42 A;  1GET A;  2RAB A;  5AE2 A;  3GO2 A;  4OO1 J;  2MP2 A;  1UXY A;  2KZ3 A;  2F1H A;  1V85 A;  1SIJ A;  3IM1 A;  3RAX A;  3BQ0 A;  1NK8 A;  4O3M A;  4OAL A;  1LKY B;  2GBM A;  3QWZ B;  2FNJ B;  4C7Y A;  4P1B C;  3CYM A;  4ED0 A;  3MR6 A;  1I4H A;  4IRD A;  3HHM A;  2LI5 A;  1FIQ A;  1UBI A;  1UGM A;  5FXP A;  4YL8 A;  2EZY A;  1ZQB A;  2DPI A;  4LVS A;  3O0H A;  1P0R A;  1V1P B;  4JIO U;  5DB7 A;  2BPG A;  5J2H A;  4ICV A;  3RCY A;  1SIF A;  2BF8 B;  4OW0 A;  3Q8A A;  2R18 A;  3V7J A;  1FMA D;  1S0N A;  3AE5 B;  3WKA A;  4EX7 A;  3OG5 A;  3PY8 A;  3EAN A;  2QC8 A;  1GRF A;  1XS2 A;  3PW4 A;  2NR2 A;  4PPX A;  3V72 A;  4KLL A;  4JAY A;  3UJE A;  2MRP A;  5BMH A;  1TZO A;  4F72 A;  5AM1 A;  4UB6 U;  4DO9 A;  3SQI A;  2MA1 A;  4PGY A;  4M9J A;  4ANW A;  5CP2 A;  4Y2U A;  1L6V A;  2D8C A;  3ISC A;  3HRD C;  4RQ4 A;  1PUZ A;  4J9L A;  1ZQV A;  4R65 A;  4K4G A;  2BT6 A;  2NQL A;  3RF9 A;  3TAC B;  3UGB B;  4DWF A;  5B66 U;  4QZI A;  2K6D B;  3PGE A;  4KPR A;  4P4M A;  3RD2 A;  3MHZ A;  1E8Z A;  4DSI A;  3EHV A;  9ICI A;  2R8J A;  3R9K A;  3QUB A;  2BW2 A;  2CHR A;  9ICQ A;  3OSP A;  3S1F A;  5CX3 A;  3N9Y C;  1F44 A;  1TY0 A;  3MFG A;  2G9H D;  4ED1 A;  2QMT A;  4MF8 A;  1LB2 B;  1XC9 A;  1L6U A;  1F0X A;  1NNL A;  2FPM A;  4B95 A;  2VA8 A;  5CHG A;  4YR2 A;  2ZXH A;  1GUA B;  4M0W A;  2LZ6 A;  4S17 A;  3N1X C;  4KZ0 A;  2WB1 C;  3BQ7 A;  2IGD A;  1PUT A;  2LXC A;  4ECS A;  4Z6D A;  1L3S A;  3Q2A C;  3K1R B;  4QZC A;  3QA8 A;  4FAD A;  1LVL A;  2BCP A;  1K1S A;  3RRA A;  4LTU A;  5AZG A;  1EO6 A;  1ZQK A;  2HOQ A;  4F5Q A;  1VLB A;  4P4P A;  3JPP A;  4UAU A;  1ZXH A;  2EZX A;  1NPX A;  3ZVI A;  2I0K A;  4WJ3 B;  3HW8 A;  4FZL A;  4IC9 A;  5BYR A;  3DER A;  4PHA A;  2OKT A;  1ZR6 A;  4QW9 A;  3WK9 A;  3T5J A;  4F93 B;  2L7R A;  2WXM A;  4H50 A;  3BQ2 A;  2AL6 A;  4JX1 C;  4Y2S A;  1RPL A;  8ICR A;  4DSL A;  1TJE A;  1OEP A;  3ZXR A;  4P16 A;  3UQ0 A;  3ZNI D;  1SJE D;  2GB1 A;  3ALB A;  1DGS A;  2CHX A;  3SI8 A;  2C22 A;  4TUS A;  3WCQ A;  1QOA A;  8ICT A;  4C8M A;  3SN4 A;  2FUH B;  3TSS A;  1BPD A;  3TEZ A;  1SJC A;  3EUB 2;  3GU3 A;  1WGH A;  4RU9 A;  2JZZ A;  1MSW D;  4HCH A;  5AI5 A;  2Y1J A;  4JPS A;  3HJE A;  3H1U A;  5KT2 A;  4GXI A;  2TSS A;  2P3Z A;  2C7N B;  2SAK A;  3DPD A;  3Q8B A;  3BYT B;  2J53 A;  4QZE A;  1L4Z B;  4Q2J A;  3HWT A;  5AE1 A;  3WK5 A;  1J2M A;  3P42 A;  1N60 A;  4PH5 A;  4HJK A;  1NJY A;  4AQ7 A;  2R8K A;  1UNS A;  3VC5 A;  2CKH B;  5HML A;  3PRP B;  3R7Q A;  4F8C B;  3P63 A;  2G08 A;  1XHC A;  4XA5 A;  5CA7 A;  4GDK A;  5ALJ A;  4XLO A;  2L1A A;  4YWG G;  2KMA A;  3PS6 A;  1OQQ A;  5DPS A;  1SWW A;  4Q45 A;  1Z2M A;  4PZF A;  4JK1 A;  3F2B A;  1YQB A;  1NI3 A;  3PVL A;  2ATL A;  3R2T A;  4A20 A;  4B0M A;  3FW7 A;  3M62 B;  2HBK A;  3QUQ A;  4P4O A;  3OJ4 B;  1WZ0 A;  4J9P A;  2N0S B;  3ZNZ B;  4K1W A;  2ZTE A;  4IZG A;  7ICG A;  5B5E U;  4KLI A;  2H3V A;  5BOM A;  2W9B B;  3AE6 B;  2BGF A;  4BBY A;  1Q8K A;  2PMZ C;  5ALL A;  2MJ3 A;  4Y2X A;  3C2L A;  1MN8 A;  2AWT A;  3PFR A;  2M1M A;  1YZ7 A;  2G0A A;  2IOH A;  4K7S A;  3HPF A;  4C8O A;  5J0O A;  4M6U A;  3RCZ A;  4HJG E;  3NVV B;  3QEA Z;  1CMX B;  1Z5S B;  2C2E A;  3L54 A;  4O3S A;  3JYU A;  5FJR A;  3C1Y A;  2OZ3 A;  1JCK B;  3PQB A;  4ZYN A;  1SXD A;  1KFY B;  3RI7 C;  4AWJ A;  1GV4 A;  2GMI C;  3OPS A;  1QQR A;  4ED6 A;  2MH7 A;  3VTE A;  1SZH A;  4Z17 A;  5BOF A;  1WSP A;  1WXV A;  3KLJ A;  1FFV C;  5KG5 A;  5FS6 A;  2MBE A;  2POD A;  4I6N B;  4ZRP A;  2AXR A;  2I1K A;  1XSP A;  4DLG A;  2KHQ A;  1IGD A;  3NVW B;  1QQ5 A;  5ALT A;  3ICX A;  4RQ8 A;  3B08 A;  4KEM A;  1NEN B;  1R4M I;  3BJS A;  2YMP A;  4YCX A;  1J0G A;  4JLC A;  2B76 B;  4MEL A;  1HE8 A;  3BZC A;  5BMI A;  3AQE A;  1BPX A;  3W1Y A;  2W04 A;  2G4S A;  2ZW0 A;  2JT4 B;  3Q8P B;  3CP8 A;  2LHE A;  2OQH A;  2WPC A;  5I1V A;  5DQH A;  2MBB B;  4DXF A;  4UB3 A;  4HLE A;  5I1W A;  4ACO A;  2F76 X;  4A8X C;  1AQ6 A;  5ALH A;  1BPZ A;  1YJ1 A;  1ZE3 D;  4EBE A;  4YFK A;  4OJP A;  2MEK A;  3KKA C;  4H4S A;  1BML C;  1KKR A;  3BY4 B;  4G50 A;  2L32 A;  1OGW A;  4ELV A;  4M02 A;  5KFU A;  4IC7 B;  3TUO A;  4NLB A;  1OEY J;  5KFB A;  3WAN A;  1A77 A;  4Y2V A;  2N1R A;  1RZT A;  2WXK A;  2K4P A;  1ZYQ A;  4JGH B;  1BZL A;  2MA9 B;  2CN1 A;  5JH5 C;  3VVW B;  3DWG C;  3V7K A;  3CGB A;  4F5O A;  2KVZ A;  3EEZ A;  1CQV A;  5DPR A;  2JRZ A;  4Q8F A;  2WOI A;  2JH7 A;  2CJN A;  2YMQ A;  4NLZ A;  1YNT E;  2F1I A;  1GO3 F;  4AP9 A;  4DWI A;  1GRB A;  2GR2 A;  3IRU A;  3ISB A;  5IIM A;  1FO4 A;  1WX8 A;  3T9L A;  2BVC A;  2DWQ A;  4KLJ A;  1WJ6 A;  1SE3 A;  3KZI U;  4E4U A;  2YY6 A;  3N7P D;  1VZ8 A;  2L8J A;  3FJ4 A;  4M52 A;  4J3Z A;  4BUR A;  3DBR I;  4IWP A;  4KMO B;  2ZJ8 A;  2EQ9 A;  4KT2 A;  5CEH A;  1WE6 A;  4EEW A;  1RWS A;  1WE7 A;  3EWA A;  4YMM A;  1N5W A;  1X9M A;  4I6L B;  2ICI A;  2RDG A;  3PW2 A;  1S8O A;  2PTW A;  2LMR A;  1UHU A;  3T6C A;  2K9X A;  1UCV A;  3G6Y A;  1ET9 A;  3R0U A;  3TQP A;  3DG7 A;  3R10 A;  4DF8 A;  5D3I B;  3MGV A;  1BKH A;  9ICX A;  3TAR A;  9ICB A;  1JUD A;  1RQL A;  2KSO B;  5ALZ A;  4LNO A;  4P1C C;  3RB3 A;  2C2D A;  1A0P A;  4LDT B;  5DLG A;  1WUD A;  3KW5 B;  3V6E B;  1S0O A;  2V3P A;  3EEC A;  4CDG A;  4C4V B;  5EWF A;  1ZGU B;  4D2K A;  3B1L X;  1JEH A;  3NS8 A;  2O2V A;  2WDT B;  3V6C B;  1VCB A;  2BDP A;  4PK1 A;  4ZDV A;  4GB9 A;  1R0M A;  2W9M A;  4OJ5 A;  4DQQ A;  5KFV A;  4I29 A;  4YXD B;  4EYI B;  5KHO A;  3PK7 A;  3KD3 A;  3ORY A;  4C8K A;  1URJ A;  3KUM A;  4ZH4 A;  3Q8E A;  2ZIV B;  9ICP A;  3PML A;  4LJO B;  2Y9T A;  3RZW C;  3FWA A;  2FMS A;  3IK4 A;  2DBY A;  4RQM A;  5CB1 A;  1ZW7 A;  2GRI A;  4E6M A;  1C78 A;  2RSU A;  1V9J A;  3TWA A;  5AKJ A;  1WCL A;  2HI0 A;  2QJL A;  3MC9 A;  1TKK A;  3UJ2 A;  2WF7 A;  1H2I A;  2DPJ A;  3JSV A;  3NAS A;  4JMU A;  2KJR A;  1YEY A;  2RPV A;  3QUC A;  3QZ8 A;  2H3I A;  3SV4 A;  3V6H A;  2DLB A;  4B9N A;  3NO1 A;  5EDS A;  2D5G A;  3X23 A;  3DGZ A;  1WM3 A;  3PZ8 A;  2PEA A;  3OC4 A;  2LUM A;  4JQ9 A;  1TKG A;  3UJR A;  2WXQ A;  7ICF A;  1E9I A;  4DXA B;  1OQY A;  1F3P A;  1B43 A;  4MLA A;  1UGJ A;  2FMP A;  3FW8 A;  1BPE A;  1DK3 A;  2J4X A;  4HCP B;  2V6O A;  4RGT A;  1SE2 A;  5DGA A;  2K3U A;  4KIK A;  2QVH A;  3PSP A;  2EZZ A;  3MSY A;  2BQ3 A;  1RYR A;  1L5U A;  3KTQ A;  1R6W A;  5KFT A;  5CJ7 A;  2IDY A;  2NVK X;  1N61 A;  1TK0 A;  3VCC A;  1E90 A;  3PT2 B;  5HR7 A;  4KLT A;  4A3P A;  4LA1 A;  5H2F U;  2FKP A;  4P7I A;  4BGD A;  1KN0 A;  1HJP A;  3ETR B;  4PL2 A;  4ACF A;  3A7A A;  3IVF A;  4QWE A;  2YVS A;  3KYC D;  3V05 A;  3SBF A;  1HUO A;  3JW0 X;  3X0W A;  4DFP A;  2K8B B;  4QZA A;  2JMG A;  3UQA A;  4DOA A;  2LPE A;  5J0T A;  1S3S G;  4NJ7 A;  4YT0 B;  7ICQ A;  4BC7 A;  4M8N A;  1PDZ A;  1RVK A;  4M9L A;  3QCA A;  4BJQ A;  4AOF A;  3UQB A;  1NI2 A;  2YVF A;  3V3W A;  2G09 A;  1UWX A;  1ET6 A;  1WXS A;  1F77 A;  1JXL A;  4KPL A;  1XCQ L;  3V61 A;  2G1E A;  2G5I B;  5F3X B;  3QFB A;  1JWA D;  3LWM A;  4IRC A;  2AH5 A;  2OHF A;  1WXA A;  2MWS B;  3DHI C;  3TAD A;  3R25 A;  1UZX B;  4UB1 A;  3CRX A;  2KLG A;  1F9J A;  2LXA A;  1ZRM A;  4TUQ A;  3FIL A;  3D2D A;  5AKY A;  1W1K A;  2J42 A;  1ZJM A;  3I99 A;  3DBS A;  4BC9 A;  2XK5 B;  1V86 A;  5ENL A;  3JPS A;  2LMC A;  2KDI A;  3MC0 B;  1JDF A;  2D3D A;  3TFS A;  2JU6 X;  4RM8 A;  1PGX A;  5C3J B;  3A9J A;  3NZG A;  3E0F A;  4ML8 A;  3QU2 A;  4QZG A;  4WWP A;  1H8C A;  3KWV A;  3ZYY X;  3H4K A;  2WF9 A;  5KFZ A;  3MY9 A;  1SV0 C;  1XO3 A;  4IW0 A;  3H4D A;  1F1H A;  3G6X A;  2KVR A;  1ZQW A;  3IV6 A;  1DOY A;  5L6G A;  3DBH I;  4NNJ B;  1S7M A;  5ALF A;  3OJS A;  2F2A B;  4FZM A;  5KFM A;  4DQS A;  3UIN B;  3PHX B;  3FKY A;  2OQY A;  2KC2 A;  3DDM A;  3ZI4 A;  3MBY A;  2K8B A;  5J0W A;  5JCM A;  3Q3M C;  5AUI A;  1FCC C;  5JCK A;  2LM4 A;  2N9E B;  1YN3 A;  2KN4 A;  2D3A A;  4EZ6 A;  2R2Z A;  5KTQ A;  2KHV A;  3EA6 A;  3MR3 A;  1XT9 B;  3EGR A;  4A35 A;  3V7L A;  4IWQ A;  3RJK A;  2ZJ5 A;  1EBG A;  3WK4 A;  4P2H A;  2VJ4 A;  2ZIU A;  3LYS A;  1MA7 A;  3UXN A;  2BQR A;  1I7H A;  1XF5 L;  2GH1 A;  3ZDD A;  3AE9 B;  3VR9 B;  3TMP B;  4A6G A;  4LDT D;  2GSH A;  1L3T A;  2PA6 A;  1TZ1 A;  1TYP A;  1JN3 A;  2GL5 A;  2V4R A;  1E9M A;  2N7E A;  4YD1 A;  4G9B A;  3HVD A;  2OZ8 A;  3A0B U;  3AH7 A;  4KSK C;  2IPI A;  2PFO A;  5J18 A;  1NEL A;  1TS2 A;  1YQ3 B;  2FCS A;  4GLX A;  3PLV A;  3H0L B;  4F92 B;  4ENL A;  1TTN A;  2NBW B;  5D46 A;  3V62 A;  4LZG A;  3CWI A;  2D3B A;  4MFF A;  1YMH E;  5KL8 B;  2V4I B;  2HTH A;  4XDC A;  3SU8 X;  2WDV B;  1WH3 A;  2JEI A;  2R61 A;  3O13 A;  3I4K A;  2UUU A;  2J0K A;  2RDI A;  2W03 A;  2KE7 A;  4I2J A;  2N7D A;  3KVF B;  4QAY A;  2W82 A;  3QX7 A;  2LRU A;  5KT7 A;  4MGK E;  1NK9 A;  2XY6 A;  5KFN A;  3V3X A;  4GC6 A;  2M9N A;  4KX6 B;  1AN8 A;  2IGG A;  1Z19 A;  2WQY B;  4RQ3 A;  3Q45 A;  2M0X A;  4DFK A;  3PSF A;  1SKR A;  1F52 A;  3GV5 B;  4FLH A;  5HQX A;  4O0I A;  1MPE A;  2K4H A;  1QSY A;  5KAI U;  8ICE A;  2QKN A;  2M56 B;  4ZCW A;  4GDK B;  4GGQ A;  1XLP A;  2KK0 A;  5KFS A;  5DB9 A;  2JK6 A;  3BOX A;  4DL5 A;  3II4 A;  4NEV A;  4TQR A;  2Q0Z X;  1RAX A;  4H4Y A;  3PWI A;  4MEY A;  3GDX A;  5ALW A;  1S10 A;  1OTR B;  1B1Z A;  2C2R A;  4GR1 A;  4MF2 A;  2JF5 A;  2X50 A;  2DFL A;  4IL0 A;  1ZKQ A;  2GBK A;  2MCN B;  3DFH A;  2KSO A;  4WJP A;  8ICS A;  3E56 A;  9ICH A;  4ZRQ A;  4MEM A;  4DL6 A;  4K2S A;  9ICT A;  3BK1 A;  3LDZ E;  3AEG B;  4RGO S;  4A3R A;  2P88 A;  5JHA A;  1COK A;  5G2N A;  1X2G A;  1WRI A;  4J1O A;  1UUP A;  5AK3 A;  1E0Y A;  1OQR A;  3NJT A;  5JCL A;  3W8X A;  5D2M B;  3ETR A;  3GFK B;  9ICC A;  2GLS A;  3TWB A;  3C29 A;  5DG7 A;  3EPI A;  2KN5 A;  4C0Z A;  3MAB A;  8ICX A;  2PFN A;  4H4P A;  3L17 A;  5KFK A;  1ZQT A;  1LQB A;  1MRA A;  2LVO A;  1V8C A;  5BOL A;  4JWM A;  4GGH A;  3R8B A;  3TBL D;  2Y3A A;  5AK5 A;  3AU2 A;  4DWD A;  5FS8 A;  1WYW B;  2WX1 A;  4TUU A;  3RJI A;  4K7U A;  5J2E A;  1L4D B;  3E2E A;  2KKP A;  4DXK A;  4UAV A;  1KM7 A;  3RJE A;  5E6N A;  1UEL A;  2FPL A;  8ICI A;  1U4A A;  4UAW A;  4DL4 A;  4RQ6 A;  4RQ2 A;  1UA0 A;  2QSD A;  4IS7 A;  5F9L A;  2DGZ A;  1ZXI C;  2DNF A;  4MJS A;  5I4D A;  5FJU A;  2Y1I A;  2WHI A;  3ZW3 A;  2MBO A;  3D6J A;  4OD0 A;  4F4Y A;  2KWU B;  5D79 A;  2AQ0 A;  4HK2 A;  3IT4 B;  4ANU A;  3C19 A;  3W5U B;  1NBF C;  1X2H A;  3VC8 A;  4X5V A;  1ONE A;  3H12 A;  1PK1 A;  3N4M B;  3VTU A;  2W8K A;  3AU4 A;  4BXO A;  2ZCC A;  1X9X A;  4NJ8 A;  2BCU A;  4W9D A;  4OCZ A;  3VCB A;  3H8H A;  4UDU C;  4XQ8 A;  5DQG A;  1FD6 A;  8ICK A;  2JZB B;  4PZO A;  4JQW C;  1TAQ A;  2KJ6 A;  3HT3 A;  2N4F A;  2WXN A;  2ZJA A;  2MQJ A;  2WU2 B;  1KOT A;  1T3Q C;  4ADW A;  3DGH A;  1R7S A;  3P4P B;  4DQO C;  1L7N A;  2KMC A;  2MU2 A;  1I4R A;  3A4S C;  2IOF A;  3FG2 P;  1Z1B A;  4I28 A;  4U6P A;  2FID A;  3TJP A;  1YQ4 B;  2MUC A;  3UJF A;  5AE3 A;  3TAD C;  1V38 A;  1STZ A;  1WMH A;  1UT8 A;  8ICL A;  4TMA B;  4NAM A;  2W9C A;  2HQM A;  3D32 A;  3UXK A;  4AYB F;  2VRR B;  5H8Y E;  1PGA A;  2B21 A;  1Y8R C;  1T4G A;  4FBT A;  4HN8 A;  4J6I A;  4KLS A;  3JPN A;  1YZ6 A;  3URH A;  2FLN A;  4PS3 A;  1AHV A;  4HNL A;  3ABV B;  1Z00 B;  3P4S B;  4W9K A;  2KO3 A;  2PKE A;  4H2A A;  1SE9 A;  2WWZ A;  4WJQ A;  2X99 A;  4EQS A;  1IYX A;  4YP3 A;  3P93 A;  2MUT A;  4NZL B;  4EEK A;  3GZF A;  1D8Y A;  2XO7 A;  2NPT B;  1C76 A;  2JZB A;  3QU9 A;  3U4F A;  1QTM A;  3S1C A;  2V3N A;  3I57 A;  2C28 A;  3DEE A;  2NRZ A;  3U7Z A;  5LXH A;  4ASW C;  4Q8E A;  2G3Q B;  2OEH A;  3ES8 A;  3DGB A;  1LVH A;  4P0Q A;  3EYZ A;  1KBU A;  1ZQJ A;  1TKY A;  2K8A A;  3APC A;  4GIV A;  4RMA A;  4MAC A;  2JX5 A;  2KAJ A;  2JXJ A;  3TAN A;  1E8H A;  2VFS A;  3MC1 A;  4FN2 A;  2LJ5 A;  4GDL B;  2VH1 A;  3PWG A;  2IO0 B;  4LJX A;  2D3G A;  3M9N B;  1ZJN A;  4YTP B;  5FS9 A;  2P8C A;  5AM5 A;  4EKU A;  1BWC A;  2P6R A;  3W8Z A;  2ZIW B;  1LM8 B;  4PHP A;  2MJE A;  2EKE C;  1NK5 A;  3FDS A;  4MGZ E;  1JOA A;  8ICG A;  4NLC A;  2WU5 B;  1SJB A;  2FE8 A;  4TVW A;  4CO7 A;  3UIO B;  3F5E A;  1KCZ A;  3R11 A;  2ASD A;  3B0Y A;  1S97 A;  4PT5 A;  2DZM A;  3L8K A;  1NK4 A;  4EQW A;  3N3K B;  2FCQ A;  3F53 A;  2PGW A;  1QLU A;  3ZJT A;  4DCC A;  3ZDM C;  3HPO A;  4EBC A;  3H8J A;  4NV0 A;  5KL1 B;  4ZRI A;  3M6Z A;  4KV2 A;  2AL3 A;  2OOB B;  1ZRN A;  3IHQ B;  1NJZ A;  1CJE A;  2HBM A;  2DZJ A;  4E8G A;  4MSM B;  3OJU A;  2YVC A;  4Y2J A;  1SJA A;  4KLF A;  3MP9 A;  1JAL A;  4Z6C A;  1ZQE A;  3KJM A;  1MFW A;  2VH2 A;  1C79 A;  4WAF A;  1F5S A;  1JW9 D;  1FRD A;  2BPS A;  3DCG A;  1ZQI A;  2YTU A;  1U48 A;  4UB5 A;  8ICB A;  3A4R A;  3R1Z A;  4ECV A;  3V5F A;  4P0P A;  4EM3 A;  4NL9 A;  1X42 A;  1X9W A;  1NJW A;  2AQ1 B;  2LJI A;  2F8L A;  1BT0 A;  2WS3 B;  3DBL I;  2QB0 B;  1PVP A;  5AWV A;  2NQW A;  8ICO A;  1V5O A;  5HHD G;  3H8M A;  3S6J A;  8ICU A;  8ICM A;  2GBR A;  5KFY A;  2NMQ A;  1TE2 A;  5BPC A;  5IDZ A;  4ECW A;  2WXO A;  1FFU C;  2BQU A;  1W6T A;  5BO4 B;  2DF4 B;  3PR4 A;  4NLG A;  7ICH A;  1T6B X;  2NVU I;  3PZ7 A;  4MJS B;  4EM4 A;  2Q4T A;  2QGY A;  1AWD A;  3RNB C;  4EEL A;  2QCZ A;  2O6V B;  1GAQ B;  3NHE B;  4N9F 4;  4OVU A;  1W1R A;  1E10 A;  3GIJ A;  4HPM B;  2FI1 A;  4NWI A;  3DBR B;  1QOF A;  3BZD B;  1PVQ A;  4DSJ A;  1HZ6 A;  3TX1 A;  2KTF A;  4ED7 A;  1F8W A;  4W9H A;  3U8Z A;  1ZQQ A;  3TAP A;  2G45 B;  3RYT A;  1ZQG A;  3AB5 A;  1EBH A;  1ELS A;  3RR1 A;  3AEC B;  1HTO A;  1E8X A;  5GXG B;  4PYT A;  2R9Z A;  2NO4 A;  4Q44 A;  5CWR A;  5E6P A;  1UBQ A;  5BOE A;  3TCS A;  3IAS 1;  3M7D A;  1AYF A;  1JMS A;  3GRS A;  1XEE A;  4F7Z A;  2KIW A;  4ZOH C;  1TZZ A;  3UM9 A;  4LJP B;  2XH0 A;  3HX0 A;  5DDM A;  4DFJ A;  1A6S A;  1YN4 A;  2KQS A;  2ZJD A;  4UW9 A;  9ICW A;  3D2S A;  4N59 A;  5TIS U;  4M8M A;  4BKS D;  2GR3 A;  5KFE A;  2JEJ A;  1EU3 A;  2KYW A;  2AKZ A;  3ZLF A;  2O6V A;  1ZQN A;  4K1R B;  3TEX A;  4E71 A;  4OJ6 A;  3PG6 A;  3PTF C;  4E5T A;  2WDW A;  2BGW A;  1XO0 A;  1WZ3 A;  4LCD E;  2WHE A;  3CAW A;  2K39 A;  1B0X A;  1SKS A;  1JXE A;  2IOF K;  5J0S A;  4MFC A;  2E5A A;  3A0H U;  4FS1 A;  3PHW B;  2C3C A;  1W1S A;  4MEX A;  3OPX A;  4ANX A;  5DG9 A;  1HEZ E;  1ZDL A;  3V60 A;  4EWJ A;  2RP5 A;  1C4P A;  4R3D A;  4H4U A;  5L6F A;  3N97 B;  2ASQ A;  4FBJ B;  3TFR A;  4KLD A;  2RRD A;  3QJZ A;  5J0U A;  1I4P A;  2K89 A;  1YQZ A;  2JR5 A;  2CXY A;  3DDH A;  3C2M A;  2XH4 A;  1CRX A;  1QT9 A;  3Q8C A;  1LKY A;  5DQI A;  4F5N A;  1S0M A;  3R3M A;  1E8F A;  5DB6 A;  4YWO A;  4I2H A;  4H4T A;  5ALE A;  2Y4G A;  1Z3E B;  4KZC A;  1XO1 A;  2RLT A;  1UT5 A;  2ASL A;  1FHU A;  2WXL A;  2BC1 A;  2ACZ B;  2GGH A;  5DGB A;  1QSL A;  4GU2 A;  5AKX A;  2XCA A;  3IXS A;  3DK8 A;  2LHT A;  3UXO A;  4J9R A;  5EE1 A;  3THU A;  2B6G A;  2LYB A;  3TJI A;  3AN1 A;  1O08 A;  4PZN A;  4ECQ A;  1QZE A;  5TSS A;  4F91 B;  3BIN A;  3MGH A;  1ZQC A;  3O65 B;  4GYP C;  5DLF A;  1SZP A;  4QZ9 A;  1QF6 A;  3GD3 A;  3SQP A;  4Q43 A;  3MUC A;  2K8H A;  2FAZ A;  2K25 A;  2OLA A;  3Q3N C;  2PVO D;  2RDB C;  2P6U A;  5AK4 A;  3WAO A;  2VKQ A;  1KQQ A;  5A0L A;  4GMV A;  1DNC A;  1AOG A;  3K1Z A;  1JI7 A;  1DOQ A;  1WG8 A;  2WBA A;  5EU9 A;  3ZUN A;  4LK0 M;  5FKA C;  1IP9 A;  2I9G A;  3JPO A;  1V97 A;  3WKB A;  3SSZ A;  2UVR A;  2V1Y A;  7ICU A;  4H4X A;  5IP4 D;  3KH0 A;  1UPH A;  2GBJ A;  4II3 B;  2KJ5 A;  5J2K A;  2KD0 A;  4XWW A;  1X66 A;  5L9X A;  5D3D A;  4DN1 A;  2PI4 A;  1UF0 A;  1K5O A;  1XAN A;  2GQU A;  2AYO B;  2XI9 A;  3ML9 A;  2A8X A;  4O3Q A;  2NS5 A;  2O6V D;  2PTL A;  3AI5 A;  5U1O A;  4DS4 A;  1PDY A;  1TK8 A;  1Z00 A;  3AEF B;  4XZ4 A;  4CYE A;  4WH4 A;  3ZTD A;  1A5R A;  5III A;  3LK9 A;  3PX6 A;  4S0R A;  4M9H A;  3FC4 A;  1RG6 A;  3ZDE A;  2A4Z A;  1N61 C;  4JN8 A;  3APD A;  4J03 A;  1YJJ A;  2GRT A;  2ASJ A;  5IKC M;  3M3J A;  4M9G A;  3PNC A;  1KLN A;  4YTM B;  3C0R B;  1UH6 A;  2X8G A;  3DK4 A;  2QKQ A;  1FEH A;  2PSN A;  1KF6 B;  2Y0S C;  2R8D A;  1SL0 A;  5HMM A;  2F5Z A;  1PZN A;  4KLH A;  3K9O B;  3RO6 A;  3N7S C;  4I2C A;  4DEZ A;  5EE0 A;  3BYY B;  2LUE A;  3L16 A;  3FVD A;  1BXT A;  3PRZ A;  4HYR A;  3VH4 B;  1MBT A;  1V49 A;  3T3O A;  5KNI A;  5J0X A;  3DOW A;  4KLO A;  4J56 A;  1KRP A;  1ZXI A;  3DBL B;  2GR1 A;  3ZLH A;  1YT3 A;  2WB1 F;  5J0Y A;  1RFA A;  2HHW A;  1FIQ B;  5FMH A;  5J8Y A;  9ICG A;  3ZD8 A;  3PR5 B;  1W1Q A;  2CFY A;  3PM9 A;  4TSS A;  3IBE A;  1ZP0 B;  3GC2 A;  5KT4 A;  2V4Q A;  3EUB 3;  3H6N A;  1KD0 A;  1FCL A;  1X2I A;  2HHX A;  1ZPS A;  4QIW F;  2IY1 B;  1N62 A;  3DDC B;  7ICI A;  2AL2 B;  2AQ2 B;  4PWB A;  4YMN A;  3T5K A;  3RB4 A;  2JYT A;  1LXD A;  4WIP A;  3O0F A;  2YEP F;  3EKG A;  4UBC A;  3BS5 B;  2KTQ A;  2XGZ A;  5KFL A;  2AQ4 A;  3WKC A;  1SV0 A;  3AE2 B;  4G0N B;  4EZJ A;  2GQT A;  7ICL A;  2KG5 A;  2V9H A;  2BCQ A;  3DWM A;  2P13 A;  1JX4 A;  8ICJ A;  1ECW A;  3GOE A;  3EF6 A;  4RGM A;  1KW4 A;  3SFD B;  1HSK A;  2PJH A;  3BQT A;  4Z6E A;  1DK2 A;  2D3C A;  4KLM A;  4XGA B;  5AI4 A;  2N9K A;  4HRO A;  2PXI A;  4KKI A;  1P48 A;  4JL9 A;  3W2D A;  3VCN A;  1RQN A;  4O5E A;  2AU0 A;  3BQ1 A;  5U25 A;  4IP5 A;  2WGS A;  1R4N B;  2IPK D;  1TYT A;  2Y3S A;  2F44 A;  4DS5 A;  1WI0 A;  1KSP A;  2OWO A;  1RYJ A;  4PHE A;  4NAW A;  4L23 A;  4HPN A;  3U9I A;  2NV3 A;  1ECQ A;  2KJ9 A;  5EE9 A;  2WP9 B;  4R8U B;  4RF0 A;  5L1M A;  4K7W A;  4FDC B;  1MJD A;  3WK8 A;  3RR7 A;  2O56 A;  4B6W A;  3H0M B;  3CXO A;  2G5H B;  3QX1 A;  5KAF U;  2IGH A;  2LGI A;  3ECI A;  5IAA C;  5CTR C;  4Z6F A;  1U49 A;  2UUV A;  4IKG A;  1KTK A;  5AIC A;  5KFX A;  4NM2 A;  2L00 B;  1DIQ A;  1ESF A;  1QQ6 A;  1KFS A;  1V6E A;  3GE3 C;  2VA3 A;  3BDP A;  1PYW D;  3Q69 A;  4GSW A;  5DBC A;  4XUS A;  4DFD A;  1UD7 A;  2BC0 A;  3IJQ A;  4C4S A;  5DPW A;  5AK6 A;  4ZYS A;  2NCN A;  3GIM A;  2PTY A;  2L05 A;  4OZB A;  1XSL A;  3TSH A;  3H7S A;  3SN1 A;  2BYE A;  4G3I A;  1V81 A;  4APN A;  4J9N A;  2UYZ B;  4RNA A;  4YSY B;  4MKS A;  3RJA A;  2YVJ A;  2XCP A;  2MSN A;  1K1Q A;  1TS5 A;  2JZP A;  3BK2 A;  4A9A A;  4EFO A;  2ZAD A;  2XIC A;  4BAX A;  3I76 A;  1WJN A;  2DW6 A;  2NRX A;  4JV0 A;  2HJ1 A;  4E74 A;  2PMQ A;  4RGN A;  1ZK7 A;  4BDP A;  1I35 A;  4R63 A;  5CHW A;  4MFA A;  1KL9 A;  3EZ5 A;  1ZET A;  1EC9 A;  4Y2P A;  2HOF A;  4FHJ A;  1IGC A;  2BYV E;  4C00 A;  2QAR A;  3AMZ A;  3DED A;  4HYK A;  2M0N A;  1ZUD 2;  3DQ0 A;  1JCT A;  1BQG A;  4B9U A;  4MM3 A;  2X8X X;  4LNI A;  4PS7 A;  4RT3 A;  2PPH A;  3KWL A;  1YN5 A;  5J2C A;  2HE7 A;  3MZN A;  1GER A;  3NVY A;  5KFW A;  4FHK A;  2GGE A;  2Z59 B;  3S5S A;  1X1M A;  2W9N A;  5FXE A;  5FR3 A;  2BQQ A;  1J7B A;  3RGT A;  5FJT A;  1NOM A;  1F2R I;  1SGG A;  3HKZ C;  3RH4 A;  4PYU A;  1TKE A;  2A1A A;  2PI5 A;  4F71 A;  2CHW A;  5J2A A;  4YXJ A;  1WGK A;  4MDK E;  3QXG A;  4HXD A;  4IHC A;  1JRO A;  1GC6 A;  3C8Y A;  3PRE A;  2KZR A;  2PP0 A;  2HHU A;  2BR0 A;  3IJL A;  1WXM A;  3U26 A;  3H70 A;  3ZIM A;  1ZD3 A;  1ZQD A;  2NTT A;  4KWS A;  4HKZ E;  3UMG A;  1SE4 A;  2WXJ A;  3H7P A;  3RZF A;  2GDQ A;  2DQN B;  2Y08 A;  5C5J A;  4W9C A;  5AM0 A;  1X40 A;  1CZP A;  5C0Y A;  3RN9 C;  4QIW C;  3OLM D;  4RQ7 A;  2WF8 A;  5ALR A;  3UMB A;  3NVV A;  5KT6 A;  3VRB B;  2FPK A;  1DGJ A;  4CCH A;  1YIW A;  3QU4 A;  4TQ1 A;  3SDL C;  1P7E A;  4BWM A;  4KSL C;  1XDI A;  1TK5 A;  4AJY B;  1T0S C;  3BS5 A;  5KG4 A;  2FCM A;  2PE6 B;  1RYS A;  1N5W C;  3D2J A;  5AI6 A;  1NEK B;  4ZHO A;  1S5L U;  3RIT A;  4J9O A;  1GNU A;  1ZMC A;  3C23 A;  4FXC A;  1F0M A;  3I5J C;  3UXL A;  3W9C B;  4O1N A;  2N9X A;  3RNC C;  3JSV B;  5E6J A;  4YR3 A;  2DZI A;  2OPJ A;  4EMJ A;  5ALI A;  5AKK A;  4U7C A;  3Q8L A;  4XE0 A;  2KMD A;  4TQS A;  4EBD A;  5E6O A;  4M6W B;  5JZE B;  1HZ5 A;  3TTE A;  4ECZ A;  2P66 A;  2NRV A;  1MQ2 A;  1FXI A;  2W54 A;  2KX3 A;  3MHS D;  2VIX A;  2W0H A;  1H6V A;  1E8G A;  5KFQ A;  4CF3 A;  3RUL A;  2QAE A;  1N60 C;  2J3N A;  2PLP A;  4DHZ B;  1RM6 B;  2O2V B;  4C4T A;  1JPM A;  3VUY A;  3TSJ A;  3ES7 A;  3WK6 A;  4H2H A;  2O6K A;  2K6Q A;  4HCN B;  3SR6 A;  2P8B A;  1LO5 D;  3UCD A;  4PHD A;  1QIL A;  2WDQ B;  1K51 A;  2VZK D;  3NVZ A;  1XLQ A;  3KZX A;  2CS4 A;  3PZD A;  3ZTC A;  5FR6 A;  3S1E A;  4XX5 A;  5AM4 A;  5ALX A;  7ICV A;  1ZQX A;  2WLB A;  3CMM B;  3PO5 A;  1D3Z A;  3G6V A;  4I2A A;  2KV2 A;  2IJ0 A;  2YLM A;  5J2G A;  3A9K B;  2AL1 A;  2NBU A;  2EQ7 A;  3SAG A;  4EQR A;  1D8L A;  1D9F A;  4UD8 A;  1MOK A;  3QC8 B;  4GGB A;  3Q6B A;  5HHI A;  4RNO A;  3CYJ A;  1NKB A;  3ZJV A;  2E8N A;  2JEG A;  3U4E G;  1YOV B;  4K3C A;  2WF5 A;  5DCN A;  5C2T B;  1S9F A;  2KK8 A;  1FXA A;  3UI3 A;  2HCF A;  1NHR A;  3DG3 A;  4LII A;  5J2F A;  2RMM A;  5D94 A;  4KIK B;  1QOG A;  2I38 A;  4YQW A;  4B0E A;  1WR6 E;  4AUQ C;  2ISO A;  3P4Q B;  3JZU A;  1OUQ A;  3DVN V;  5G5H A;  4IL6 U;  4H4R A;  3AE1 B;  3QTP A;  1N2X A;  2X38 A;  4EX6 A;  3GS2 A;  4EYH B;  3ENE A;  2VFR A;  1N48 A;  1T0Y A;  3L4P A;  2KDF B;  5ALO A;  3BII D;  4O5K A;  5AI8 A;  3UXP A;  2E6X A;  3D46 A;  1OEY A;  1XD3 B;  2WAQ C;  3HW2 A;  4H4W A;  3A33 B;  3T8Q A;  3GII A;  1ZQL A;  3Q6J A;  3BSM A;  3FYY A;  3F2D A;  1K53 A;  5C23 A;  3CSF A;  3QKE A;  4H1Z A;  2EMS A;  3NFU A;  2KDM A;  4IM0 A;  4ITK A;  3DHH C;  2YQE A;  1HUZ A;  2Z8L A;  5KVI A;  1RRB A;  1ZQA A;  2QQ6 A;  2DEN B;  1VZ7 A;  2V4L A;  2V3S A;  5ALY A;  2A3V A;  2WOW A;  3OJ3 A;  4ZRJ A;  1U9L A;  2H3Z A;  2GBN A;  1KJT A;  4JWU C;  1MBB A;  2GGI A;  5K8E A;  5KG6 A;  5J29 A;  1K8R B;  1P7F A;  2MW5 A;  4NEW A;  3LXF A;  5T14 A;  2E8P A;  5AKZ A;  4CE6 A;  2M17 A;  3PVX A;  4L1B A;  2CU3 A;  5DPT A;  9ICA A;  4F8R A;  5JTI A;  5HR6 A;  4XWT A;  3DG6 A;  4K7Z A;  2W8L A;  1SGH A;  2XY7 A;  3SQS A;  4O3O A;  1MNS A;  2D2Q A;  1M94 A;  3NS1 B;  2ZUB A;  2G06 A;  4RT2 A;  2R8H A;  3ED5 A;  2A1J A;  2H5X A;  2AJQ A;  3FW9 A;  5AKI A;  2DKZ A;  2DX5 B;  3JPQ A;  2BCR A;  5FK9 C;  5KG3 A;  2BKE A;  3UIP B;  1HEK A;  3GD4 A;  2ZUD A;  2IYD B;  3N6H A;  5DG8 A;  1D5M C;  7ICT A;  3UGV A;  3W5V B;  1Z4O A;  3KHG A;  5CR0 A;  1XNS A;  4MGY E;  4B9M A;  3T5L A;  2YML A;  4ECY A;  1N56 A;  4JV1 A;  2ZC8 A;  3NRW A;  3EAO A;  1GOZ A;  1ED1 A;  1TKD A;  2PU1 A;  3QHT A;  3AM9 A;  3SFE B;  2ZIW A;  2HDE A;  1IBX B;  2P0I A;  2JH1 A;  1K52 A;  2PFQ A;  1EXN A;  1H38 A;  3R66 C;  2MBQ A;  2WP6 A;  4IT1 A;  1S77 D;  3GSY A;  1B4F A;  4NM1 A;  1HQR D;  4C7Z A;  3AUL A;  4QWC A;  4EZK A;  1F0Z A;  5IO9 A;  4KN4 A;  1KRH A;  7ICE A;  4JE3 B;  1WWU A;  2QJM A;  3C0P A;  2QDF A;  2IHN A;  2VFT A;  1QH9 A;  5CHV C;  2PKO A;  2L83 A;  1STE A;  1SXT A;  4KX5 A;  4GFI A;  1M6Y A;  4J9S A;  4IWO A;  3K9P B;  2UWQ A;  4NLK A;  4IP4 A;  1SL1 A;  4RQ1 A;  1L5P A;  1L8L A;  1YD8 U;  4WWM A;  3LB8 A;  2OAI A;  3RUI B;  4DBG A;  1XS9 D;  2NPT A;  5HP4 A;  2L52 A;  2DHZ A;  1WUE A;  1BNP A;  1KLV A;  5AKL A;  2WDR B;  5JRB A;  1TBE A;  1UQV A;  3GZN B;  2BVG A;  2L76 A;  1WR1 A;  2D11 A;  2QLT A;  5J2D A;  1F2R C;  4NXZ A;  2X8H A;  3N7R C;  3ZD9 A;  2V3B A;  3KQ4 A;  3JVA A;  3U7D A;  3GZN I;  1D7Y A;  2BPF A;  1JWU D;  1X6J A;  2QB0 A;  3Q3O C;  3RT3 B;  3HRD D;  1U4B A;  1P3Q U;  5JU5 A;  2QB1 A;  2LD9 A;  2WP5 A;  4GYP A;  2AGP A;  4A8E A;  2R8G A;  5J04 A;  4DNA A;  2PPG A;  3LWL A;  2C7H A;  2J0J A;  3LB8 C;  4RH6 A;  5HI1 A;  3IG3 A;  4KDL B;  2YEP B;  4J57 A;  1ISN A;  3PW7 A;  4IM2 A;  2IBK A;  3ZXV A;  3VFC A;  4EMW A;  2CDU A;  3QAR A;  3T9P A;  3N1Y C;  3UPQ A;  4EOY A;  3AL0 B;  2BWF A;  5IN7 A;  2BTE A;  4ZOH B;  1C77 A;  2OCE A;  2RPQ A;  4RPX A;  3R2I A;  2QAR B;  4HCL A;  4DQP A;  2BBC A;  9ICS A;  3Q8M A;  1RDF A;  3H8S A;  2L3Z A;  2ZEQ A;  3M1Y A;  2K5P A;  2KZZ A;  4DLE A;  1Y88 A;  2LYH A;  2RGF A;  2XNA C;  4DF4 A;  4IDI A;  5LXI B;  5J2J A;  3V6J A;  2DW7 A;  2LYA A;  3K1G A;  2PTZ A;  4L2Y A;  3RH5 A;  1DII A;  3SEN A;  2YX8 A;  1D9D A;  1MHX A;  1RFK A;  3E58 A;  3S1D A;  2HNE A;  4TV3 A;  3P1M A;  2V3A A;  3AU6 A;  3CST A;  3ZDA A;  3PX0 A;  3RNA C;  1VR9 A;  2KWD A;  5GMV A;  2GQW A;  2CU1 A;  3I6T A;  3RJH A;  2PLI A;  5IA7 A;  1E8Y A;  2M8S A;  5KG1 A;  4F5P A;  1SB3 C;  3SJN A;  1L7Y A;  4QZH A;  3CNH A;  1NHP A;  4QWA A;  3T3F A;  2J7Q B;  3V4B A;  2C5L C;  3UJS A;  4F2S A;  2CJO A;  1N63 C;  1Q1R A;  3I6E A;  1XU4 A;  1IXR A;  3LAD A;  1Q1W A;  2AEH A;  2YAU A;  1I4Q A;  2BCV A;  2XH7 A;  3DFY A;  2L5Y A;  5IIL A;  4DDG D;  5D4B A;  4B6J A;  5ALD A;  2KMM A;  3LVV A;  3NUQ A;  1J7C A;  3VHT C;  3WAP A;  4GXJ A;  4LNN A;  2QDE A;  4UBB A;  1TFR A;  3HIL A;  2R2Q A;  2OX4 A;  3C1Z A;  5ALP A;  3B9J B;  3IJI A;  4I2F A;  3ZLG A;  2JEF A;  3AE3 B;  3T4W A;  4CF4 A;  3M63 B;  1C7Y A;  2YB4 A;  1SKW A;  2RK5 A;  1W1O A;  1X6I A;  1NJX A;  1IM4 A;  3PV1 A;  4IUM B;  4ZRK A;  3S2A A;  3JPR A;  4ARI A;  3U2S C;  8ICV A;  1Q0W B;  1GRA A;  3NOB A;  1L8P A;  2A19 A;  3RNF C;  3QLD A;  2AGQ A;  2UVU A;  2F8K A;  1E7U A;  1XCT L;  1GES A;  8ICP A;  2IZV B;  4MH0 E;  3Q8S B;  4IQU A;  1N6Z A;  3M9O B;  2EKI A;  2OJW A;  1F9C A;  2AKM A;  2G07 A;  1IV8 A;  1L3V A;  1L0V B;  2QJJ A;  2C9W B;  2KFK B;  4F4Z A;  1LFD A;  4UB2 A;  2PMV A;  2Q5W D;  2JWU A;  4B9K A;  1VRA B;  3PPA A;  3T8M A;  4ZA0 A;  2J6S A;  3MQT A;  3HM3 A;  5AIB A;  5KFI A;  4YVZ A;  1WMH B;  2WXH A;  3IT6 B;  2OO6 A;  4Y2T A;  5IIJ A;  2ZZB A;  3HSU A;  1WUF A;  4QZD A;  2DZK A;  2ESE A;  4FP1 A;  1JWB D;  1R4N I;  1WJ4 A;  1PVR A;  1TAU A;  4MM3 B;  3T79 A;  4JB1 A;  1KEJ A;  1DXS A;  2KQ4 X;  2MP2 B;  3ZVH B;  3WIM A;  3EPG A;  4BFR A;  3RNE C;  3T3N A;  3N20 C;  9ICJ A;  1SB3 B;  3MWC A;  1BVS A;  4C8N A;  4NY0 A;  1NYQ A;  3VTV A;  4A55 A;  5C1Z A;  1QSS A;  1BGX T;  1D5Z C;  2CHZ A;  4GN1 A;  3UMC A;  3P2B A;  4HPP A;  1PK3 A;  2UVV A;  4NQK E;  1JML A;  2P4P A;  3GE8 C;  3RMK C;  3Q3F A;  5HHZ A;  3FXG A;  3PSI A;  4KKJ A;  1ARO P;  4FJV B;  3UCC A;  2R8I A;  3IP4 B;  8ICA A;  2B0C A;  1VD2 A;  1WGD A;  3MJ5 A;  2BCS A;  2EQ6 A;  4KMU A;  2EAO A;  2MLB A;  4K8D A;  2LWP A;  1UWM A;  3H7P B;  1J97 A;  4RZR A;  2NBV B;  5IOI A;  2K0P A;  3I9V 1;  2ZZC A;  1OFF A;  7ICK A;  2EMT A;  2XH2 A;  4H4Q A;  3GY1 A;  2B3A A;  2E3T A;  2WAQ F;  4ED3 A;  2BS2 B;  4WQM A;  2VAO A;  4EZ9 A;  3C21 A;  4FFD A;  3APF A;  4I2G A;  3SEB A;  1WY8 A;  2QIL A;  1ZOY B;  3AE8 B;  3IDW A;  1J7A A;  2QHO A;  4MGI E;  2WFA A;  5HKH A;  1ONF A;  4ED2 A;  2KWV B;  4TUR A;  2K4E A;  1L2N A;  4M01 A;  2V0G A;  4JHM A;  2XN9 C;  2ZNV C;  1ZQP A;  2FCN A;  4HDQ A;  3ZJU A;  3PO4 A;  2C7M B;  4ELT A;  5ALN A;  1V1O A;  4Y2Y A;  3NS1 A;  3SV3 A;  3B2G A;  5F9N A;  3MJW A;  2FJ6 A;  1FEZ A;  3MR2 A;  4JWN A;  1XQQ A;  4G7F A;  2JSV X;  3OTQ A;  4HAI A;  4F4X A;  3QK0 A;  3FYH A;  2IMW P;  4US8 A;  3A9K A;  5BMG A;  4YN4 A;  1GSN A;  2KQ7 A;  1GB1 A;  2ZNV B;  3ZGZ A;  1V59 A;  2BDU A;  4GC7 A;  3STP A;  4OVV A;  2LM1 A;  1TYG B;  2KTR A;  2JGA A;  5ALM A;  5EOZ A;  1AAR A;  2PGE A;  1W1M A;  3W1S C;  3A9J B;  5HMR A;  2I5H A;  5KG7 A;  2LVP A;  5AZH A;  4TUP A;  5ER0 A;  1SBB B;  4EUT A;  3BWU D;  4Y2R A;  4UAR A;  4FA6 A;  4H4V A;  2KX0 A;  2K8C B;  3SHQ A;  3FV9 A;  5AKG A;  3HP6 A;  2N7J A;  1XWL A;  1V9P A;  4OVZ A;  1V2Y A;  1J8C A;  1NYR A;  5AI9 A;  3GRT A;  2EDU A;  4BKT A;  4TQ0 A;  2ONQ A;  4YR0 A;  2FYM A;  3CF6 E;  2LGS A;  4MH8 A;  2QDD A;  1WF9 A;  3KUD B;  1EC8 A;  4Z1Y A;  2Y5B B;  2XVT A;  5ALK A;  3A7U A;  4F4R A;  4A3O A;  4ANV A;  4G3X B;  5G5G B;  5LLI A;  4I2D A;  3VDG A;  1BPB A;  2GLE A;  3AV8 A;  4MT5 A;  1SJH D;  5J0Q A;  2KTR B;  1HA5 A;  1AHZ A;  2KKV A;  1QKZ A;  2PMZ F;  5JRT A;  2J0M A;  2MBR A;  2A5U A;  4GDL A;  2ODG A;  5IIN A;  1ZY8 A;  3ZDB A;  2MHJ A;  2EH9 A;  2VJ5 A;  1VAO A;  2D07 B;  1VDV A;  2YMM A;  2WPE A;  3N4E A;  5ADZ A;  8ICW A;  4H83 A;  4HG0 A;  4DSF A;  5J2I A;  1BUI C;  3PLU A;  2LGD A;  2M19 A;  3UF8 A;  3BVM A;  4YG2 A;  3A1Q B;  5EBK A;  3NVW A;  2FMQ A;  1ACC A;  4R8U A;  2I5Q A;  5AM2 A;  2AAQ A;  3R0K A;  4EE2 A;  3ENL A;  2KEY A;  3OWE B;  4M04 A;  2BVH A;  4X57 B;  1EF5 A;  2XGP A;  4IRK A;  2MRL A;  2HSZ A;  3QU5 A;  4TVY A;  3AEE B;  1BNO A;  1FM0 D;  2KOX A;  2MUT B;  5J0P A;  4RUC A;  1WWT A;  3OW1 A;  2K22 A;  3D2N A;  4KGT A;  4QJF B;  1WGR A;  2KN7 A;  2HW3 A;  4GRT A;  3PRM B;  3ZDC A;  2PW9 A;  3NRZ B;  3OZM A;  4IL2 A;  4F5R A;  3ZRC A;  2SEB D;  8ICQ A;  2KIV A;  1LV5 A;  5HFY A;  3C5F A;  3C28 A;  2F3N A;  2N1W A;  3GV7 B;  5L1L A;  3L0W B;  1B9R A;  2FE9 A;  3VDZ A;  1ZQS A;  1NVI D;  3CK5 A;  4RM9 A;  4F4K A;  2XEW A;  4NY8 A;  2DYB A;  5JHB A;  4KX3 A;  2C60 A;  3NZU A;  2LAS A;  2ZZ0 A;  2JVC A;  2KP7 A;  2PLS A;  4XRH A;  2WF6 A;  2IA6 A;  4DSK A;  1MHH E;  1Z1V A;  2N9P C;  2AHO B;  2XBB C;  2ONE A;  7ENL A;  4JUZ A;  4HCD A;  3RNG C;  2VFV A;  2ZTC A;  2J6U A;  3TEY A;  4C56 C;  1KKO A;  4E0D A;  1JPD X;  4O3N A;  9ICL A;  2NYV A;  3AXC A;  5KT3 A;  4DHG A;  1E0Z A;  2AGO A;  1FEC A;  3RPF C;  3GV8 B;  3VUX A;  4BBN F;  2BHN A;  5HNK A;  4H4Z A;  4KN7 A;  5GTI U;  7ICN A;  1WJU A;  2PP1 A;  4IR9 A;  3VXW A;  2M4N A;  1L0Y B;  1WVF A;  5AZF A;  5AEK B;  2F1J A;  3EC8 A;  7ICO A;  6ENL A;  1TY2 A;  2K1F A;  4NPN A;  2OED A;  5ALS A;  4X2P A;  1TV9 A;  4BZA A;  1TVA A;  5FS7 A;  3I63 C;  1TGZ B;  5D6J B;  3FIL B;  4FI4 A;  3PSE B;  2KAC A;  3POP A;  2LHD A;  1VJ5 A;  2YVG A;  2LKY A;  1FNU A;  1EM7 A;  1R4M B;  3FAH A;  4RCO A;  1NHQ A;  2JUO A;  2BS4 B;  1GRH A;  2QJN A;  1ZKH A;  2KFZ A;  1IG6 A;  4KVG B;  3IG5 A;  1C4A A;  2KHW B;  3MDC A;  5KFJ A; 
#chains in the Genus database with same CATH homology
 4XDD A;  3A7R A;  3VRB B;  3R07 C;  1DGJ A;  1FFV A;  2AQ3 B;  4TQ1 A;  3BW7 A;  1P7E A;  1T5X D;  2VZK B;  1AHU A;  3E56 A;  4ZRQ A;  2BB5 A;  1N5W C;  3BK1 A;  1NEK B;  4ZHO A;  3D2J A;  3AEG B;  4RGO S;  3E9S A;  1VJK A;  2NTS A;  4FXC A;  3LYY A;  3W9C B;  1WRI A;  4O1N A;  2LFI A;  1UUP A;  1X2G A;  5E6J A;  1E0Y A;  1OQR A;  1WVE A;  2DYM A;  3W8X A;  3ETR A;  1FNW A;  2QIE B;  4RF1 A;  4XE0 A;  3NUH B;  1JWS D;  1HZ5 A;  5AE2 A;  1FXI A;  2W54 A;  1E8G A;  1UXY A;  1SIJ A;  1N60 C;  2PLP A;  1QLT A;  1V8C A;  1RM6 B;  3R8B A;  4OAL A;  2Y3A A;  4C7Y A;  3TSJ A;  1I4H A;  1FIQ A;  3SR6 A;  1LO5 D;  2Y3R A;  5FXP A;  2WDQ B;  1QIL A;  2GI9 A;  4N58 A;  2I2Y A;  1K51 A;  1L4D B;  2VZK D;  3NVZ A;  1DYQ A;  1V1P B;  1XLQ A;  1C9F A;  3S1E A;  1KLU D;  2WLB A;  4OW0 A;  2QSD A;  3Q8A A;  1FMA D;  1SSN A;  2IJ0 A;  3AE5 B;  1ZXI C;  5I4D A;  2Y5P A;  5D79 A;  2BYT A;  4JAY A;  3IT4 B;  5JXV A;  4UD8 A;  3LAE A;  3W5U B;  1I4X A;  1TZO A;  2RDH A;  1X2H A;  3ZJV A;  3U4E G;  2BB6 A;  1L6V A;  3AED B;  1TS3 A;  3HRD C;  5C2T B;  3H8H A;  4JWS C;  4UDU C;  1FXA A;  1FD6 A;  2BT6 A;  3P4R B;  3UI3 A;  4OHJ A;  2WXN A;  2RMM A;  3MHZ A;  1QOG A;  2I38 A;  2WU2 B;  1T3Q C;  1R7S A;  4B0E A;  2JQR B;  3P4P B;  1M4V A;  3P4Q B;  2BW2 A;  1XXG A;  4DQO C;  1I4R A;  2Q85 A;  1ENF A;  3S1F A;  5G5H A;  4CQN A;  3AE1 B;  3N9Y C;  1SEB D;  1TY0 A;  1YQ4 B;  2G9H D;  3MFG A;  5AE3 A;  2QMT A;  1KH0 A;  1L6U A;  2X38 A;  1F0X A;  1D5X C;  3GS2 A;  4TMA B;  4M0W A;  4NAM A;  2VFR A;  4BCA A;  3L4P A;  1E7P B;  2IGD A;  3BII D;  5H8Y E;  1PUT A;  1PGA A;  2E6X A;  3KLS X;  3NVZ B;  2QPM A;  4HKQ A;  1QLB B;  4LTU A;  4HRS A;  1AHV A;  3ABV B;  1K53 A;  3P4S B;  1VZ6 A;  4H2A A;  1VLB A;  2KDM A;  1ZXH A;  4IOI E;  2I0K A;  4ITK A;  4EC3 A;  4NZL B;  2Z8L A;  3HUI A;  5BYR A;  1VZ7 A;  1ZR6 A;  2P3H A;  2WXM A;  1C76 A;  1DOX A;  4JX1 C;  1TJE A;  4JWU C;  1MBB A;  4P16 A;  3S1C A;  2V3N A;  3I57 A;  5K8E A;  3U7Z A;  1SJE D;  2GB1 A;  1P7F A;  3LXF A;  3WCQ A;  1QOA A;  1TKY A;  4L1B A;  4US9 A;  2CU3 A;  3TSS A;  3TEZ A;  4MAC A;  2JX5 A;  4PVJ A;  2KAJ A;  3EUB 2;  4XWT A;  4WUR A;  1E8H A;  4JPS A;  4GDL B;  2TSS A;  2SAK A;  3Q8B A;  4YTP B;  3BYT B;  2J53 A;  3NS1 B;  1L4Z B;  4Q2J A;  3JS8 A;  3W8Z A;  5AE1 A;  3FW9 A;  3P42 A;  1N60 A;  2MJE A;  4NJC A;  5FK9 C;  4AQ7 A;  2WU5 B;  1UNS A;  2FE8 A;  4TVW A;  2HTM E;  1VQZ A;  1D5M C;  3P63 A;  3W5V B;  3PO0 A;  3W8W A;  4XLO A;  2L1A A;  4PT5 A;  2M0A A;  4YWG G;  1N62 C;  1GOZ A;  1OQQ A;  4LLG M;  4PZF A;  1QLU A;  3ZJT A;  3AM9 A;  3R2T A;  1NI3 A;  3SFE B;  5HG2 A;  4B0M A;  2HDE A;  1IBX B;  2LEK A;  3FW7 A;  1K52 A;  2N0S B;  1W1L A;  1CJE A;  1PGB A;  3AE6 B;  3GSY A;  1HQR D;  4C7Z A;  1TS4 A;  4BBY A;  3MP9 A;  1JAL A;  3KJM A;  2MJ3 A;  1F0Z A;  1C79 A;  4WAF A;  1EU4 A;  1KRH A;  1JW9 D;  1FRD A;  4JE3 B;  3C0P A;  5MPO A;  2VFT A;  4REZ A;  2PKO A;  2L83 A;  1STE A;  2AQ1 B;  1SXT A;  2LJI A;  2WS3 B;  4HJG E;  3NVV B;  5AWV A;  2NQW A;  5HHD G;  1L5P A;  2W3S A;  1JCK B;  4WWM A;  2OAI A;  1KFY B;  1V1P A;  2NMQ A;  3PQB A;  4P6V F;  2WXP A;  1QQR A;  2L52 A;  2MH7 A;  2WDR B;  2WXO A;  1FFU C;  2BVG A;  3VTE A;  3PZ7 A;  1T6B X;  1WSP A;  1AWD A;  1F2R C;  1FFV C;  1FFU A;  1GAQ B;  3KQ4 A;  4J3O D;  5FXF A;  1JWU D;  1W1R A;  4ZRP A;  2VFU A;  1E10 A;  1RM6 C;  3HRD D;  2INP E;  1D6E C;  1QOF A;  4N6E B;  5H92 C;  3VQI A;  2ON8 A;  3BZD B;  1IGD A;  1HZ6 A;  3NVW B;  3TX1 A;  3LB8 C;  1NEN B;  4RH6 A;  3AB5 A;  5HI1 A;  2YEP B;  3AEC B;  2B76 B;  5GXG B;  4PYT A;  5BMI A;  2WNM A;  4ZHP A;  2ZW0 A;  2BTE A;  1D4B A;  1C77 A;  1AYF A;  2LHE A;  3IAS 1;  4ZOH B;  5I1V A;  1XEE A;  3R2I A;  4DXF A;  2BBC A;  4ZOH C;  5I1W A;  1YN4 A;  4A8X C;  1ZE3 D;  4N59 A;  1JRP A;  2K5P A;  2MEK A;  2W55 A;  1BML C;  1EU3 A;  2XNA C;  1N5X A;  1IUE A;  2L32 A;  4IDI A;  4AS1 A;  3TEX A;  2WDW A;  4L2Y A;  1DII A;  3TUO A;  3S1D A;  1MHX A;  1RFK A;  3P1M A;  2WXK A;  2E5A A;  1W1S A;  2QEJ C;  1HEZ E;  3DWG C;  3Q8F A;  1VR9 A;  2KWD A;  1C4P A;  4R3D A;  4ARC A;  5L6F A;  5D7G A;  1CQV A;  4PVE A;  1SB3 C;  2CJN A;  2PIA A;  2Q4W A;  1I4P A;  1YNT E;  4DNS A;  2CJO A;  1N63 C;  3GP7 A;  1QT9 A;  3Q8C A;  1FO4 A;  1E8F A;  2Y4G A;  5FXD A;  4OZA A;  5BYQ A;  1I4Q A;  2WXL A;  2DWQ A;  3NVY B;  2ACZ B;  2KMM A;  3NZ3 A;  1J7C A;  1GPX A;  1SE3 A;  4C80 A;  1VZ8 A;  3IXS A;  5BYS A;  5EE1 A;  1L0X B;  3ZQ4 A;  3B9J B;  3AN1 A;  3AE3 B;  1MI0 A;  3B2F A;  1RWS A;  1SF0 A;  4GLS C;  1N5W A;  5TSS A;  2QKN A;  2O3G A;  2ICI A;  2AX5 A;  1QF6 A;  2H88 B;  2RDG A;  2RK5 A;  1W1O A;  3B9J A;  4ARI A;  2PVO D;  2K9X A;  2WXR A;  3U2S C;  1ET9 A;  2PLI A;  3IAM 1;  5D3I B;  1YJI A;  4LK0 M;  5FKA C;  1XCT L;  1V97 A;  4YSZ B;  2EKI A;  4YSX B;  1XLO A;  1IBX A;  2V3P A;  1L0V B;  4XWW A;  5EE3 A;  5D3D A;  2Q5W D;  2PMV A;  2JWU A;  4O95 A;  4D2K A;  2GQU A;  1VRA B;  1Q10 A;  2PTL A;  2AXR A;  5G5H B;  3AEF B;  3HSU A;  2WXH A;  4PVK A;  3IT6 B;  4YXD B;  1DZN A;  4WH4 A;  2J52 A;  1JWB D;  3FC4 A;  3AE7 B;  1N61 C;  3LLB A;  3Q8E A;  1JQ4 A;  1YJJ A;  4MM3 B;  3FWA A;  4JB1 A;  2KQ4 X;  2DBY A;  2GRI A;  3J9C A;  1C78 A;  4YTM B;  3BVZ A;  3T3N A;  1T3Q A;  4PVH A;  1SB3 B;  2QJL A;  1NYQ A;  1FEH A;  1KF6 B;  2WXF A;  4A55 A;  3RJ8 A;  1D5Z C;  2R8D A;  2RPV A;  1WXQ A;  2FBW B;  2EEL A;  1JML A;  2N9L A;  2DLB A;  2P4P A;  3BYY B;  5EE0 A;  5HHZ A;  1BXT A;  4KKJ A;  2D5G A;  1ZDX A;  2FUG 1;  3AE4 B;  1MBT A;  3PZ8 A;  3MJ5 A;  3T3O A;  1EWC A;  1FNV A;  4USA A;  2VFS A;  1UWM A;  1KLG D;  1ZXI A;  2LUM A;  2K0P A;  1TKG A;  3I9V 1;  1OFF A;  1FIQ B;  2WXQ A;  3SR6 B;  2WXG A;  2E3T A;  1I19 A;  2BS2 B;  4WQM A;  1W1Q A;  5AUK A;  4MLA A;  1UGJ A;  2VAO A;  3PM9 A;  3FW8 A;  4TSS A;  1MVK A;  2JYE A;  2J4X A;  1ZP0 B;  4RGT A;  3SEB A;  2QIL A;  1ZOY B;  1SE2 A;  2K3U A;  3AE8 B;  1J7A A;  3EUB 3;  2IDY A;  3AEA B;  1N61 A;  1FCL A;  1ZPS A;  2V0G A;  2XN9 C;  1N62 A;  1AW7 A;  3ZJU A;  4OZC A;  1V1O A;  2AQ2 B;  3NS1 A;  2MJD A;  3B2G A;  3ETR B;  4PWB A;  3A7A A;  2JYT A;  4WIP A;  2YEP F;  2JSV X;  2YVS A;  3V05 A;  1C4C A;  3AE2 B;  4US8 A;  2EXR A;  5BMG A;  1GB1 A;  3ZGZ A;  1I4G A;  2DYO A;  4HEA 1;  4YT0 B;  3DWM A;  4BC7 A;  1PDX A;  2P13 A;  1TYG B;  3VR8 B;  1W1M A;  5HMR A;  1HXY D;  1ET6 A;  1UWX A;  4RGM A;  3SFD B;  1HSK A;  1SBB B;  1F77 A;  1ROE A;  3BWU D;  2N9K A;  5T8I A;  1XCQ L;  4HRO A;  2W3R A;  2N7J A;  1A70 A;  2G1E A;  4KKI A;  4YTN B;  3TEW A;  1JWA D;  2OHF A;  2INN E;  4NAW B;  3W2D A;  4OVZ A;  1NYR A;  4TQ0 A;  2ONQ A;  3FIL A;  3D2D A;  4MH8 A;  5LNK 1;  2J42 A;  1W1K A;  2IPK D;  3I99 A;  4BC9 A;  2Y3S A;  1RYJ A;  1QOB A;  2LMC A;  3MC0 B;  4L23 A;  3CIR B;  3W1S A;  1XLN A;  2JU6 X;  1PGX A;  2WP9 B;  5EE9 A;  5C3J B;  3A7U A;  4RF0 A;  5G5G B;  1GB4 A;  3AV8 A;  4MT5 A;  4ML8 A;  1SJH D;  2PVG C;  3KWV A;  3ZYY X;  1HA5 A;  1AHZ A;  1QKZ A;  3HVZ A;  1XO3 A;  2MBR A;  1DOY A;  5L6G A;  1N63 A;  1K50 A;  2IGH A;  2LGI A;  1VAO A;  2UUV A;  1VDV A;  4IKG A;  5ADZ A;  1KTK A;  1DIQ A;  4HG0 A;  1E6E B;  1ESF A;  1BUI C;  5AUI A;  1FCC C;  4A6Q A;  1FRR A;  1DOI A;  1YN3 A;  2KN4 A;  2M19 A;  3BVM A;  2R2Z A;  3EA6 A;  3EGR A;  3RFZ B;  3NVW A;  1ACC A;  1JWM D;  1PYW D;  3Q69 A;  3URY A;  4EE2 A;  3OWE B;  1CK1 A;  1XF5 L;  1I7H A;  2H89 B;  2BVH A;  4ZYS A;  3AE9 B;  3VR9 B;  5G5G A;  4TVY A;  3AEE B;  1FM0 D;  4OZB A;  3TSH A;  1WWT A;  2K22 A;  4KGT A;  4RNA A;  4YSY B;  1WYG A;  3RJA A;  1E9M A;  1TS5 A;  2JZP A;  2PW9 A;  3BK2 A;  3HVD A;  4A9A A;  3NRZ B;  4A90 A;  3AH7 A;  2SEB D;  5HFY A;  2IPI A;  4RFB A;  4RGN A;  1B9R A;  2WXI A;  1TS2 A;  3D2H A;  1YQ3 B;  1NVI D;  2BS3 B;  2JXT A;  3CWI A;  1IGC A;  3DQ0 A;  1YMH E;  3AMZ A;  3DED A;  4PWC A;  1ZUD 2;  2V4I B;  4XDC A;  2WDV B;  3O13 A;  2R61 A;  4DXG A;  2PLS A;  2UUU A;  1MHH E;  3KWL A;  1EWY C;  1YN5 A;  1W1J A;  3NVY A;  2VFV A;  3TEY A;  1Y56 A;  4C56 C;  2W82 A;  4KGS A;  4KGR A;  5FXE A;  5FR3 A;  1J7B A;  1E0Z A;  3RPF C;  3V3X A;  1PFD A;  2ZW1 A;  3BVG A;  1F2R I;  4KX6 B;  1AN8 A;  2IGG A;  3NRZ A;  2WQY B;  1TKE A;  1ZDV A;  1L0Y B;  3AEB B;  1WVF A;  1WGK A;  1JRO A;  5HQX A;  2BVF A;  1TY2 A;  1MPE A;  3C8Y A;  3VRA B;  2OED A;  3U52 E;  2M56 B;  4GDK B;  1XLP A;  3FIL B;  2KAC A;  3GB1 A;  3POP A;  2LHD A;  2NTT A;  4HKZ E;  1FNU A;  1EM7 A;  3FAH A;  1SE4 A;  2WXJ A;  4RCO A;  2BS4 B;  2Y08 A;  2Y5C A;  2GQT A;  1CZP A;  1C4A A;  5BMH A;  1B1Z A;  3NVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...