1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
2WLBA 2R8DA 3B9JB 2OAIA 1QOBA 3PO0A 1FIQB 3W8WA 2VFSA 1VDVA 1KFYB 5FXDA 2N0SB 1WGKA 3EUB2 3TX1A 4P6VF 3AEGB 2H88B 5C2TB 4ZOHB 2R2ZA 2Q4WA 2L52A 1IUEA 5ADZA 1DGJA 1N62C 3VRAB 2W55A 4N58A 3NVWB 1XLNA 1VJKA 2BVHA 1J7BA 2WS3B 3KWLA 1VLBA 2WDRB 1FXAA 5H8YE 1YQ3B 3P1MA 4KX6B 4JX1C 5H92C 1TKGA 3NVVB 1L5PA 3AE8B 5AE1A 1L6VA 4C80A 4HG0A 1AHUA 4ZOHC 2K9XA 3LXFA 4BC7A 1FO4A 3AEDB 4JWSC 1ZUD2 4PYTA 1TKEA 3VR8B 1JQ4A 3HUIA 2BS4B 4LTUA 1FM0D 3AE1B 3W9CB 1SB3B 2LEKA 3NS1B 1FFUA 1OFFA 1RM6B 1I7HA 3AE6B 1YQ4B 1AHZA 4YTPB 1QOGA 2EXRA 2E5AA 3AEAB 2Q5WD 1R7SA 5G5HB 2Q85A 3S1DA 4YTMB 2H89B 3FC4A 4YT0B 2QPMA 3SR6B 4ZHOA 3P4SB 1N63C 4JB1A 3EUB3 3AE5B 5MPOA 1SB3C 2VFRA 1W1MA 1E7PB 5G5GB 1W1RA 1FFVC 2VFTA 1JRPA 4IDIA 3NVYB 4BC9A 1RM6C 2OHFA 2FBWB 1A70A 4US9A 2QKNA 3AE2B 3AE4B 1T3QA 1WVFA 2AXRA 1E0YA 2VAOA 1N62A 2HTME 4YSXB 2BS3B 2M19A 3ZYYX 1NEKB 1V8CA 1ZR6A 2I0KA 1JWAD 2QIEB 1TYGB 3VRBB 3AM9A 1GAQB 5AE2A 1FIQA 1EWYC 4YSYB 2L83A 1MBBA 1QT9A 1RYJA 3BW7A 1QLBB 1L6UA 1V97A 4HRSA 1XLQA 2CJNA 3NRZA 3I99A 5FXEA 2WU5B 1SF0A 2MJEA 5EE9A 5HMRA 1GPXA 1W1LA 5EE3A 1ZXIA 2MH7A 1E8GA 4TVYA 1KRHA 3CWIA 4YXDB 3BIID 1JW9D 4N59A 3S1CA 1DOXA 2DWQA 1F0XA 2P4PA 2E3TA 2ACZB 3AEEB 4C7ZA 3DQ0A 3JS8A 5EE0A 3W8XA 2VFUA 4WQMA 1QF6A 4N6EB 1RWSA 4A9AA 3LB8C 2RK5A 1E8FA 3LAEA 1N63A 1XO3A 3RPFC 3WCQA 1NI3A 1FXIA 3HRDC 1FFVA 1N61C 3AH7A 4YSZB 2MJ3A 1QLTA 2NQWA 1W1KA 3S1FA 2PVOD 1VAOA 4HROA 4JWUC 3W5UB 5C3JB 1WWTA 5EE1A 1E6EB 3A7AA 5G5HA 2PLIA 2P13A 1KF6B 1NYQA 1QOAA 3SR6A 1ROEA 1XLPA 3FAHA 3AV8A 4TVWA 1WRIA 4ZHPA 4C7YA 5G5GA 2WP9B 3PM9A 1W1SA 3A7UA 1ZP0B 3NVYA 1YJJA 4BBYA 3ETRA 3HVZA 1QOFA 1YJIA 1I19A 3AECB 4JAYA 3NVZB 1HSKA 2M56B 3P4QB 2PLSA 5AUIA 3S1EA 1FRRA 5FXPA 3HRDD 2G1EA 1NYRA 3P4RB 3B9JA 5AUKA 1E9MA 2W3SA 1W1QA 2EKIA 2BS2B 1DOIA 2K22A 1NVID 3AN1A 1DIQA 2KAJA 2BT6A 2W3RA 1E8HA 3KJMA 3AMZA 1CZPA 4YTNB 1QLUA 3C0PA 2PIAA 4OALA 1PDXA 3A7RA 3NVWA 1N60C 5FXFA 5GXGB 1N5XA 1UWMA 1WVEA 1T3QC 1RFKA 1WXQA 1N5WC 2GQTA 1J7CA 1TJEA 3NRZB 2Y5CA 3CIRB 2DBYA 2WDVB 3AE7B 3NVVA 1N61A 2WDQB 4WWMA 4ML8A 1AHVA 1XLOA 1AYFA 3AEBB 5AE3A 4FXCA 4BCAA 3VR9B 1DIIA 4USAA 2K5PA 1SIJA 1B9RA 4ITKA 3LLBA 1JROA 3DEDA 2JX5A 1E0ZA 2PKOA 3P63A 2KMMA 2AX5A 1X2GA 2JQRB 2MBRA 3NS1A 1ZOYB 1VQZA 3W8ZA 5HQXA 1E10A 2B76B 1FRDA 3AEFB 3ABVB 2PVGC 3B2FA 3L4PA 1ZXIC 4US8A 2W54A 2P3HA 3AB5A 1J7AA 1MBTA 2BVFA 3DWGC 1WYGA 4XLOA 5HHZA 1L0VB 2VFVA 2YVSA 1JALA 3SFDB 2CU3A 1CJEA 4O95A 3R07C 3DWMA 2O3GA 2BVGA 1FMAD 1PFDA 3AE9B 1FFUC 2WU2B 2QJLA 1AWDA 1DZNA 1TKYA 1JWBD 1W1JA 1OQQA 1UXYA 3P4PB 2CJOA 1PUTA 1F0ZA 2GQUA 3AE3B 1X2HA 1DOYA 3ETRB 3NVZA 3B2GA 1N60A 1OQRA 3W5VB 1NENB 2MJDA 1N5WA 1W1OA 3SFEB 4MLAA 2WQYB
chains in the Genus database with same CATH superfamily
2D07B 1ECWA 5KT4A 3EECA 2Z0EB 1SL1A 1C1YB 2OAIA 2INCC 4JV1A 1EU3A 3MHSD 2HOFA 2PMZC 5DG8A 1PZNA 3NZSA 4ED8A 1HQRD 2BHNA 2KFZA 3DBLB 2KTQA 2J7QB 3AEGB 3UCCA 3NZUA 5KT3A 4P0QA 4DQIA 2EZZA 4QWBA 4NAWB 2QARA 1UBIA 3R0KA 2XEWA 3P3BA 5EWGA 5C2TB 5J8YA 4QZCA 2R2ZA 2KJRA 2KYWA 3S2AA 3EGRA 1OEPA 5ADZA 5HMLA 2YVCA 1JI7A 1BPXA 1D8BA 4MGKE 1WUEA 1N62C 3VRAB 2W55A 1F9JA 2ZCCA 1BWCA 5DLGA 3IFWB 3TWBA 2ZJAA 1IP9A 2UUUA 1VJKA 4M2YA 2WB1F 1P0RA 4M0XA 3RFZB 3PLUA 4GB9A 1X2IA 3Q8PB 2K39A 8ICHA 4YN4A 2JZBB 4F92B 1WE7A 1GEUA 1STZA 3WKDA 4K3CA 2JZPA 2LVPA 3O13A 1X9XA 2R18A 2WXKA 3A1QA 3ZRFA 4JX1C 3Q4DA 3I5JC 4W9HA 3R1ZA 5AE1A 3UQ2A 3S6JA 4DSJA 4R63A 9ICNA 2ISPA 4K1RB 4IC7B 4PZFA 2KIVA 1TFRA 2K9XA 3VTVA 1COKA 2NRTA 5U25A 2YQEA 3ORYA 4RT2A 4Z6DA 3MQTA 4PYTA 5IIJA 5KFUA 4O3QA 5DDYA 5AM1A 4I27A 4F5QA 1GC7A 1A5RA 3PWIA 2XK5B 2CHXA 2HQMA 2OX4A 2ZIVA 5J2JA 1JQ4A 1BPYA 4C4RA 1ZQPA 2AWTA 1PGXA 2KVSA 2V4IB 2C28A 5CHVC 3AE1B 5KFKA 5KFSA 5KFWA 3ZVHA 2KKPA 3UQ0A 3FYHA 2OOBB 3JPPA 3IN5A 2JV3A 4O3RA 4ECWA 3DIPA 4FN2A 5CJ7A 2FYMA 2I5HA 2IMWP 4ECUA 2CHRA 5EU9A 2GWSA 5LXIB 2EMSA 3KHLA 5ALDA 3BZCA 1F1HA 4ZCWA 1SBBB 4QZEA 2VRRB 3AE6B 4EBEA 2E5SA 3VDGA 2EXRA 4P0PA 3KHGA 2UVUA 2M0NA 2A1JB 2KOXA 3ZVVA 2JH7A 2BKFA 4YXJA 3WAMA 4BWMA 4CGZA 1ZMDA 3II4A 5FJUA 4DNSA 1STEA 4J1OA 2FPMA 2HJ1A 2V3SA 1Q10A 1SE3A 2ASQA 1X6IA 4TQ1A 2PTXA 2NBUA 3RR1A 3SHQA 5EOZA 3Q3MC 1N63C 3BDPA 5ALYA 2KNBA 3AE5B 2J6UA 1DOQA 1Q8KA 4B0EA 4XWTA 1YX6B 2AL3A 4TKNA 3RJ8A 2W9BB 5AKEA 2C2EA 2BQQA 1UCVA 4FBJB 4DQPA 4TUUA 2GRIA 1JWMD 2PMZF 2F1IA 2XC9A 2XO7A 3MDAA 5IINA 3UIPB 1X9SA 4IL2A 4BC9A 3L54A 5ALVA 1GOZA 2KV2A 3MGIA 2QKNA 5EWFA 2FLLA 3VH3B 2O2VB 3RNEC 5AM0A 4P1BC 1UH6A 2XN9C 3AE4B 1TTNA 4Z6CA 2AL2A 4DF8A 2FIFA 4PS3A 4ED3A 4E71A 2QB1A 5AK6A 2Y4GA 5D79A 4RQMA 5J2RA 1T3QA 5LLIA 1C76A 2FUHB 2K8BA 2KJHB 2MBHA 1S9FA 3Q8AA 2AXRA 1NHPA 1N62A 2HTME 4YSXB 2B0CA 1PVQA 2DNFA 1EC9A 4B0MA 3ML9A 8ICAA 3P2BA 3OAWA 3QU4A 3UXPA 2L1AA 1WJNA 2F5ZA 1NU5A 3QFBA 2FI1A 4DLEA 3SN4A 3JPNA 1YX5B 3LYYA 1ZR6A 4HDQA 1ZQTA 5FS9A 3QU2A 3AU5A 2DZIA 2LRWA 3VCBA 3AU4A 4KN7A 4ELVA 2R8GA 4F5PA 2KZ3A 4DXGA 1A76A 2J42A 2UWQA 3B1LX 5KAFU 2C5LC 2L83A 1MBBA 4BKSA 2YB1A 1NOMA 3BW7A 4UBCA 3AEVA 1H4RA 2WXGA 4HCPB 2W9MA 1V6EA 4HRSA 4NAWA 3PSPA 1BGXT 4LNKA 4YMOA 3RZWC 3D2NA 4W9JA 1B43A 2EQYA 2PE6B 1M94A 1L0XB 3FKYA 2LFIA 2Z8LA 7ICUA 3APCA 2I2YA 3NRZA 2VANA 4J9SA 2PFPA 2E8MA 4EBCA 4F3OA 4RPXA 2PLPA 1ZQNA 2MJEA 2J0KA 3DJJA 1GESA 3PRPB 1NK6A 1EF5A 1KJTA 1YD8U 4LNOA 4RF0A 2HHUA 4F7ZA 1GPXA 2E1EA 4EFOA 2PP0A 2KXJA 2D2QA 1GRBA 2J3NA 3E2EA 4J9PA 3BYTB 2GLEA 2XBBC 5DG7A 1W1LA 2H3FA 1DXLA 2MH7A 1GETA 3Q3JA 1FHVA 3ZVIA 1JXEA 4TVYA 1LQBA 4M9HA 1KRHA 4E8GA 3BIID 2QKQA 1PQSA 1KKOA 3L8KA 3AQEA 1VCBA 4TUQA 1DNCA 5KFNA 1DOXA 2PMVA 4JPSA 3QFAA 1F0XA 2INPE 3PVLA 1JPDX 4Z17A 2RDBC 5KHQA 1P48A 5DCNA 1TZ1A 2PPHA 4IQWA 2KFJA 1KFDA 2LHTA 2MSED 1XSLA 3FDSA 5FR3A 4M6WA 3M3JA 1IV8A 4ECSA 4W9IA 2N1VA 2WP5A 4HYRA 3AL0B 4YR2A 2IBKA 3TJPA 2VFUA 1EWCA 1TS5A 5AK5A 3IG5A 3LB8C 5D46A 2XK5A 1E8FA 1ZJMA 2F77X 8ICIA 3LAEA 1N63A 3G6VA 3VUYA 2F1JA 3MFGA 2P6UA 4J9MA 1C9FA 1SKWA 1WFYA 1XC9A 5BO4B 7ICVA 4R3DA 2PFNA 4PHPA 4JN8A 3QQ8B 3ZO5B 4HLEA 2VA3A 2HMXA 1KSPA 2BCQA 5G2NA 3PHWB 2RDGA 4NEWA 4DCCA 3C2LA 4UB3A 1I4QA 4YSZB 2MJ3A 3IJQA 2AYOB 2NQWA 4HK2A 1BZLA 1W1KA 3S1FA 4GLXA 4B6JA 1JEHA 1UGMA 1FEAA 4JWUC 1PYWD 1MA7A 3C1YA 2KWCA 3KKAA 1HUZA 7ICEA 3A4SC 1UF0A 1WWTA 2BDPA 4H4ZA 4DBGA 5KFFA 3JZUA 4UB8U 2I1JA 2MA1A 5DQGA 3QX1A 2GRTA 2A1JA 1S97A 4HJKA 2OFJA 5CEHA 9ICMA 3P42A 2HJ8A 3N7RC 4NZLB 4PK1A 4YP3A 4AYBF 4RPYA 3PT2B 2Y5PA 2P13A 1X9WA 3RAXA 2BVCA 3V6CB 1ROEA 4QAYA 9ICTA 5AKKA 2BYFA 3B0YA 4YG2A 3ZUNA 1ENFA 2RPQA 2QLTA 4QZDA 1OXJA 2E1FA 1RVKA 3AV8A 4TVWA 2IOFK 2YX8A 2L32A 4CDGA 2ZIXB 3IT6B 2BPCA 8ICUA 2ZUCA 2W9BA 1GG3A 2IOFA 4EWJA 2LYAA 2HTHA 5DG9A 3HM3A 3NY5A 4LNNA 2LJ5A 3QYPA 2LM4A 3VA8A 4IQTA 1I4GA 3TFSA 1YJJA 2KDEB 3QAQA 2Y1IA 4BBYA 3R0UA 3R25A 2EDUA 4RQ8A 2LWPA 1VRAB 2MEKA 1ZQRA 4H4RA 1WH3A 4BOSC 1QOFA 2G5HB 4JV0A 2O2VA 2JRZA 3GO2A 1HJPA 2DQNB 4DWIA 1U4BA 1C4AA 4J3OD 2HHWA 4C4VA 2ONEA 2M9NA 3GIKA 4AOFA 3RJGA 4OW0A 4RH6A 1GRGA 4EYHB 3CMMB 2DPJA 2JEGA 4BXOB 1TS4A 1LB2B 4DFPA 2ZZ0A 5E6NA 2ES6A 3ZD9A 4FI4A 8ICZA 1IIPA 3P4QB 2Z59B 5AUIA 4QZ8A 3SDLC 2FPLA 4HNLA 1GUAB 3HRDD 1L8PA 3BQTA 4E4UA 1HTQA 1L7MA 3VUXA 1URJA 1EBHA 1KTKA 1WF9A 2ZIWB 2W3SA 2N9LA 4KLOA 1SZHA 1MQ3A 2LYBA 3H8MA 2LJIA 2Z7JA 3V4BA 3BQ2A 4MACA 1DIQA 4AUQC 4EKUA 3NASA 4IHCA 4NQLB 1K50A 3HW8A 1E90A 4IQUA 3A9KB 4M01A 2AU0A 3DG3A 2H3QA 2KLCA 1SKRA 2A1AA 2KJ5A 1CZPA 1NK9A 1KM7A 2OEHA 1RRBA 3R8BA 2IBIB 3C0PA 2N7DA 4OALA 1V1PB 2G4DB 2KC2A 5GTHU 1IBXA 2GL5A 4JV2A 3VC8A 3TBLD 3OJUA 1HEZE 3DEEA 1MPEA 5KFDA 1L3TA 4OHJA 4GYPC 1WX7A 3ONSA 4C0ZA 1N5XA 1UWMA 2MSNA 3LB8A 3CSFA 4GDLB 1RFKA 3HX0A 4ICVA 3RZFA 2IO0B 2NQLA 2DKXA 4DFMA 2ICIA 2QEJC 2F3NA 4GU2A 2Y5CA 3RN9C 3IV6A 2AAQA 4DN1A 5JCMA 3CIRB 3APDA 3I3TB 2EANA 1NNLA 1P7EA 3CB3A 4B9SA 5BYRA 3CGBA 3QIJA 2KVCA 5DPTA 3RNGC 3AE7B 3NVVA 2WDQB 3MGHA 3H6NA 3A0BU 1LV5A 5HHDG 3PG6A 4H19A 1O03A 4NJ7A 1XWLA 4I2GA 3MKCA 4A6QA 1KFSA 3Q3OC 3ZXRA 2P0IA 2MAXA 1RFAA 5HR7A 3T9PA 1DIIA 1TAMA 4PT5A 4NY8A 3SBFA 3WU2U 4P4OA 5KFYA 4YCXA 1SWVA 2ZZCA 5L83A 5KNIA 1Z2MA 4JE3B 2KN7A 3R7QA 5KL8B 1U48A 4BZAA 2EH9A 2KKVA 2D11A 3KOOA 3ISCA 4KMUA 1NJYA 2MU2A 3MR2A 2JX5A 4MH0E 5ALZA 4B9TA 2JMGA 3LWMA 1BXTA 1Z5SB 3OSPA 2KMMA 1X2GA 2JQRB 2MBRA 4C8NA 2NS5A 4KLGA 5J2BA 9ICEA 2KFNA 3NS1A 3Q3NC 3PPAA 1VQZA 3W8ZA 1E8YA 1TAUA 2ASLA 1AQ6A 4IT1A 3M9OB 1ZQAA 3ISBA 4NLKA 3T3OA 3WKBA 2GBJA 3V5CA 2J53A 2BTEA 3EAOA 3WIMA 4G0NB 1MRAA 4PWCA 3ABVB 3KUCB 4EMJA 2V3AA 2NPTB 4DQRA 4RQ7A 4QJFB 4I2BA 2C7HA 3ZNHB 4JB3A 2X99A 3CRXA 2P3HA 4NWIA 4I2JA 3JPRA 5KFRA 3TSHA 3L3FX 3V6EB 3V3XA 3RRHA 1MBTA 2LGYA 9ICHA 1ZOLA 1EC7A 3DWGC 4UB6U 3NUHB 3WKAA 2V4QA 3SZ2A 3QKEA 4YXMA 4KPRA 4EMWA 2D8CA 2XSXA 3WAOA 1PK1A 2X8CA 1L0VB 2WF8A 2YVSA 1XT9B 3BYYB 3C5GA 3SD7A 3BQ1A 1YIWA 1S10A 3DBSA 1XO1A 1QZEA 1BPDA 4M0WA 9ICPA 2O3GA 1HA5A 1TYPA 1FMAD 8ICGA 1L0YB 3ZLGA 1WWVA 2L7RA 2GBNA 2ZIXA 2V3PA 3RF9A 3BQ0A 5ALGA 2DZKA 3OSNA 2LM1A 2MBBB 2QJLA 4HXDA 3BVMA 3QUTA 3JW7A 4M9NA 1DK3A 2WNMA 3EKGA 5AKLA 1OQQA 4DHJD 4LJPB 2D3CA 1RYSA 2XH7A 8ICVA 4H2HA 2E8NA 4PL1A 4M9JA 3M8RA 5BPCA 2K4HA 4DSIA 2KACA 2LGIA 4MJSB 2JEIA 4PGXA 3AE3B 2GGJA 2OYYA 2OLAA 3HPFA 2ZIUB 2DYOA 1DOYA 4F8RA 3UGBB 1X2HA 3EPGA 3GC2A 2JWZA 4EQSA 3RH6A 2RGFA 3SSZA 4OJ5A 4UB2A 2RMMA 4JL9A 5C23A 5ALQA 4BXOA 4EEWA 4GYPA 4UAVA 2GBKA 3GZFA 1FEBA 4MGIE 2WHEA 1YOVB 5DPSA 3ZJUA 4NJ6A 2PP1A 3WK5A 3N4MB 2JVCA 2BR0A 4H4VA 1V49A 4JN7A 5BOMA 1K8RB 3C23A 2ZIWA 4FZNA 3DHHC 3Q45A 2KJ9A 4XQ8A 5D49A 3I57A 4K3BA 3SD5A 2FLNA 1IYXA 3B9JB 1D4BA 1WZ3A 4RQ2A 4G11A 5LNK1 3I28A 4KLEA 3N4EA 3ZLFA 3W8WA 3F2DA 1KFYB 3L13A 2FAZA 4E0DA 5A0LA 9ICWA 2N0SB 3VCNA 1UA0A 1NKBA 4P6VF 4YL8A 2YVJA 4EBDA 2H88B 2D3BA 3QU5A 3RNCC 2P6RA 2NR2A 2W82A 1SJBA 3KUDB 3KZXA 4ZRJA 1UD7A 4BVUC 5KFGA 5ALFA 1VZ6A 2BGFA 3NRWA 2HOIA 3NXLA 4M00A 4XRHA 4GDLA 3NVWB 3OTQA 1XLNA 3D2JA 1JCKB 2Y3AA 4FADA 3TSSA 5J0RA 4D2KA 1E8WA 3U30A 1Q1RA 5AKHA 1L7NA 3U4EG 1OJTA 3CGDA 2TSSA 1ZQJA 3X0WA 5KL1B 1VLBA 1R4NI 3RNAC 4PH5A 4NLCA 4NM2A 2PA6A 2WDRB 4H4XA 1LKYB 2IHMA 3TKAA 3BJSA 1YQ3B 2EMTA 1YNTE 1L7PA 5JRTA 3RJKA 1SIFA 3GOEA 5JU5A 2RDHA 2E6XA 5HHHA 3PV1A 3ENLA 2MBOA 2BGWA 2FMSA 2YVFA 3I76A 2GSHA 2DZMA 3AE8B 3UJ2A 2GBMA 5KFMA 3BK2A 4YR3A 2RDJA 2RHFA 4QWDA 3I63C 1FO4A 3RJFA 1VZ7A 4F8CB 2PU0A 3MP9A 2QAEA 3MC1A 4DEZA 4O3NA 2VIXA 1RXVA 1TKEA 4K4HA 1QCKA 1E8XA 5J0TA 4ARCA 2B21A 3T4WA 3ONNA 4UD8A 5FR6A 2WB1C 1RQLA 2V4RA 5DBAA 1ZY8A 5AZGA 1T8EA 1HE8A 4LTUA 1FM0D 2O6VA 4HWIB 3GQCA 4YMMA 1CUKA 2AH5A 2QB0B 2XVTA 5J2EA 1RZTA 4KLQA 3Q8FA 1QLNA 4C00A 5IDZA 2G5IB 4BV6A 6ENLA 2EQ7A 4RQ5A 1ZMCA 4MFCA 2K1FA 1NK5A 2PPGA 2G0AA 1GV4A 4W9GA 1ZQXA 1L8OA 5J18A 4C56C 1RM6B 3HWTA 2NTTA 4NNJB 4KN4A 2LI6A 1J2NA 3APFA 1LVHA 9ICOA 3AULA 4ZA0A 1ZDXA 2FUG1 3QWZB 4L23A 4O3MA 3PS6A 4M8MA 2KHVA 3IJLA 3DEQA 2GOLA 3LADA 4OJ6A 2AHOB 2WXJA 2Q5WD 4Q8FA 4RM9A 2OZTA 1L3VA 1R7SA 4YWGG 2G07A 5T8IA 3PW5A 1JXLA 3QX7A 2P35A 1SXEA 5CB1A 3E58A 8ICMA 2AQ2B 1U47A 2H89B 3FC4A 4HAIA 1R4NB 4B6WA 1WRDB 4H50A 1CMXB 3P4SB 3MTNB 4JLCA 3MHZA 2FMPA 2WPCA 2QSDA 2KTRB 1V2YA 3IHPC 1NHRA 2FE8A 4R8UB 1PVRA 2OWOA 3SAFA 2FCNA 1Z3EB 2INNE 4OZAA 3NZGA 1W1MA 3PQBA 4OZCA 3NO1A 3RCZA 1W1RA 1FFVC 2K8HA 3VH4B 4NV0A 2FNJB 3D47A 3OHAA 4IDIA 4DL2A 4QZIA 4UATA 3MC0B 3NVYB 1QH9A 1RM6C 2CDUA 2IGGA 3N7SC 3L10B 1D7YA 5KT2A 4US9A 1GJZA 1SWWA 3DPDA 1ZQBA 4HCLA 4MJSA 4C8OA 4PYUA 2C3DA 2KSOA 1P3QU 4KSKC 5AHXA 3RJIA 1WGGA 2ZIUA 4JHMA 1D9FA 3NS8A 3DK4A 4K4GA 3MDCA 3AU6A 3M9NB 3NUQA 1E0YA 1UA1A 2XICA 2W9CB 2KLGA 3BS7A 2DENB 2XH2A 2KVRA 9ICRA 4J56A 5L6FA 1FEHA 1E5WA 4FJZA 3N9YC 4Q44A 4YWSA 4BURA 4PWBA 3H7VA 3PNCA 2WF7A 4ZRIA 3KTQA 1L5UA 4ICAA 3QZ8A 3RBEA 2KO3A 3PTFC 1JWAD 3URHA 3N28A 3MWCA 4KWSA 4QWEA 1TYGB 3GZNB 5J2HA 1MC8A 5KFHA 4WAAA 3ZKJC 3BS5A 3I6EA 2YMQA 2GH1A 5DQHA 3J9CA 1ECQA 1F3PA 1GERA 2EAMA 4YSYB 2WAQC 1HTOA 1RYJA 1MHHE 4E4FA 3K9OB 7ICGA 3EHVA 5ALPA 3RH5A 4KVGB 1K5OA 2F2AB 3CSTA 1V97A 2LYHA 1F77A 2N9KA 1BUIC 1TK0A 5AICA 3QU9A 4FS2A 2QDFA 1KQQA 1XLQA 1WUDA 5E6OA 3C5FA 3VCCA 2LUEA 5F9LA 2D10A 3G6YA 3WANA 4RQNA 1I4PA 5JCNA 3JSVB 2PW9A 4F5OA 2HBJA 5HHIA 5JCLA 5FXEA 4CF3A 2DAFA 2BKEA 2I6XA 5EE9A 2MW5A 1YN5A 3Q8QB 3DCGA 4QWAA 5AEKB 1E9IA 4LIIA 1JRUA 3RNMA 5HMRA 3WA0A 5J17A 5AZFA 4W9LA 4FHJA 3OHBA 1WR1A 2L00B 1T0RC 4A8EA 1ZX9A 1MFWA 3H9DA 1ZXIA 3ZJTA 1LKYA 1ZD5A 3GIIA 4J9NA 3W1SC 3KUMA 5K4LA 3NGDA 4TMAB 2W7OA 2KQ7A 3N4FA 2BQ3A 2AL6A 4ECQA 2KDFB 3E56A 5JTIA 4N59A 2HSZA 3TCAA 3IDWA 3OTRA 4GFIA 3B97A 4O9MA 1SGHA 2BPSA 4O3SA 3KD3A 3D46A 4H2AA 3L5KA 1DYQA 2W7PA 2PU1A 3IVFA 1E7VA 4DYEA 1J97A 3T3FA 3W8XA 4FZLA 2LMCA 4O5KA 2R8HA 5CHFA 4ECYA 3RTVA 2KKCA 1RWSA 4P7IA 3H7PB 4A3PA 2AKMA 2XH4A 3TEWA 3DGZA 3CF6E 4WJQA 5IP4D 3M8SA 1K52A 2ZUBA 2DUYA 4L1BA 4ECTA 3RPFC 2PTWA 2WOVA 4EEKA 4DOAA 2QB0A 2ZVOA 4P4MA 4BAXA 1NI3A 3PZDA 1FXIA 3R66C 1NELA 3HRDC 1FFVA 3UIOB 2MBQA 2ALZA 4EZ9A 4QWCA 3OJ3A 4TV3A 5KFTA 4WIPA 4IM0A 1D3ZA 3MR3A 1YEYA 1OGWA 1KLVA 3F2CA 4MEYA 1ZKHA 4A6GA 1RG6A 3N7PD 4BKTA 1XS9D 5D3DA 1V59A 3TADA 1QQ6A 3M9MB 5CTRC 3ZDAA 1SE9A 3DJGX 1TZZA 1S7MA 1UHUA 4XGAB 2HXUA 4NJCA 1T94A 3IT4B 3FILB 5FJRA 3F5AA 1QTMA 4O0IA 2N7EA 2C2RA 9ICJA 4G8TA 2JXTA 3C21A 1K4QA 3ZLHA 2Y3SA 2DYBA 2IO2B 1V85A 1BPZA 9ICIA 1KN5A 1VZ8A 4LJOB 4K4IA 1KKRA 2KTRA 4RUCA 2OKTA 2J0MA 1TYTA 1K53A 3UJFA 4R8UA 3PX6A 1FCCC 1ZQZA 3DG6A 3KVFB 8ICTA 3HW2A 2PGEA 1S1QB 1BVSA 3NVYA 4KLUA 2WAQF 7ICNA 4YWOA 1MOKA 1TE2A 4I6LB 2UYZB 2VZKD 3ETRA 4KKJA 4DSLA 4MFAA 5AKJA 2N4FA 2LPEA 2MUTB 2ZC8A 1TY2A 1C20A 4HKZE 1Q1OA 2WPFA 3QUBA 3ZDCA 1ET9A 4O1NA 2MP2B 1YJIA 4AYBC 4IRDA 2LRUA 4IM3A 3MSYA 4LDTD 4Q8EA 3F5EA 9ICAA 2M56B 3N20C 4IG7B 3GRTA 1M4VA 2LD9A 1FRRA 4UASA 1T3NA 4AJWA 2KIWA 1JIHA 3HJEA 4XX5A 1NYRA 1JUDA 4W9EA 2OQHA 3O0HA 4BKGA 4H4QA 4HNCA 4XC2A 1GXFA 4KLMA 1E9MA 4G3IA 4K8DA 1KOTA 2KN5A 5HI1A 3ZDMC 2UUVA 1WG8A 1Z4OA 1DOIA 2BS2B 2K22A 3DK8A 3U7ZA 4LZDA 3EA6A 3ZQ4A 3W1SA 4DL6A 1ET6A 4KMOB 1WCLA 4LJXA 3TAPA 4QZFA 1U49A 4GN1A 2PI4A 2KFKB 3AI5A 1BQGA 4HPNA 4GOCA 2DLBA 3UXNA 3RT3B 2NYVA 3IG3A 4IR1A 4XUSA 4Z6FA 1I4XA 1Z19A 3AMZA 1IGDA 1ZQFA 4X57B 1T7PA 4DHJB 5JCKA 1WMHB 4KGSA 3FW9A 4F4ZA 1NJZA 3BK1A 1OW5A 2W9AA 4IR9A 1WXMA 2PIAA 3BVGA 4MSQB 4EE2A 3H70A 3PW0A 3A7RA 2RABA 4LK0M 5JZEB 1MSWD 3JSVA 4ED7A 4HCDA 1BNOA 2DF4B 3ZDBA 1SL0A 5C0YA 1SXTA 3LDZE 2KICA 3VXWA 3BINA 3QU7A 1WVEA 4KPLA 2KJ6A 1ESFA 2X8GA 1D5MC 3FYYA 2JZBA 3TQ1A 1TV9A 5ALUA 4BBNC 3QLDA 3PSFA 1OEYJ 3TMPB 1NDAA 3A9JB 9ICQA 1BKHA 2KWVB 2N9PC 1LM8B 1Y8RC 2R8JA 1S8OA 4WURA 3GY1A 4NPNA 5DBBA 1ZQDA 4GMVA 5CHWA 4DF4A 2RP5A 5TR3A 2YVGA 1TZOA 3H4BA 3V05A 1KLGD 1AHVA 4HKQA 1ONEA 3ZGZA 5J0OA 1RLFA 4Y2UA 1XLOA 1J0GA 5KFPA 3D2HA 1RQNA 2PSNA 4JUZA 3RB3A 4O5EA 1ZQHA 4BCAA 5AE3A 2I1QA 4USAA 4RU9A 4ED1A 1YJ1A 3UXKA 2RDIA 3LDAA 1TK5A 2K5PA 4F5RA 1SIJA 2IHNA 4NXZA 4ZDVA 2JZ3B 4PVHA 4W9KA 4DDID 3RITA 3S47A 2BC1A 3LLBA 3GU3A 3RR7A 1E0ZA 2FPKA 2Y0SC 2PKOA 5AWVA 3H7PA 3P63A 2GR0A 8ICYA 2AX5A 4U6PA 2X8XX 4F72A 4LCDE 5I4DA 2WDTB 3RAQA 1U4AA 3MFIA 1KN0A 2JGAA 1P7FA 3CXBA 4KLFA 1W6TA 2AXTU 7ICLA 1WXVA 2G45B 3ISDA 2QQ6A 3QEBZ 2B76B 5AM5A 2M1MA 4JIOU 4MEXA 4DS4A 2BCUA 2ZJ5A 2NVKX 4P4PA 3L4PA 3KWVA 1XO0A 1LGRA 4KLIA 3E0FA 4US8A 4MM3B 5DPRA 4DXKA 3AXCA 3NG0A 2WQYB 1ZE3D 2BKRB 1SE4A 5FS8A 4GGBA 1KLNA 4FBUA 2BVFA 2L76A 2R2OA 3DG7A 3VTEA 3URYA 2NO5A 2WYQA 4PZNA 4F91B 5J2KA 3EANA 5C1ZA 3DV9A 3AQFA 4J9OA 4I2CA 1AARA 1C4CA 2VFVA 1JALA 2LXCA 3SFDB 4RQ0A 3RJHA 3TACB 4HPLB 2OQYA 2OCEA 5B66U 1VR9A 4ANXA 3UJSA 2IO3B 3DWMA 5ALNA 5HG2A 1Z1VA 1S0MA 2ZNVB 5HFYA 2UVRA 4EUTA 2MBEA 1UUPA 3X23A 3AE9B 1WXSA 3V6JA 2P3ZA 3SI8A 1LXDA 4HDOA 5J29A 2N1WA 4IKGA 2NRXA 2LXAA 3DK9A 4BDPA 4GXKA 3MC8A 3U52E 1F52A 3T3NA 2FKPA 2HDOA 1D9DA 1XXGA 2WXPA 3P4PB 4IW0A 4NLZA 4AJYB 2ZJ8A 1Q3UA 2NPXA 1F0ZA 2Y9UA 5FS7A 4E5TA 4M9LA 4RNMA 4I2HA 4QW9A 5J2FA 5KT6A 2ASDA 2VJ4A 2W8LA 1PUZA 4Y2YA 2MP2A 1NJWA 4NJ8A 2LVOA 2V1YA 8ICBA 1P1AA 3PX0A 3B2GA 2KHWB 1O08A 4NQKE 2V0GA 2ZW0A 3GE8C 3WK7A 4DWDA 2A5UA 3PZPA 1ZQEA 4MF2A 1NENB 2WXLA 1WXAA 2G09A 2MWSB 4RM8A 4BBNF 2WXIA 3PW2A 3PR4A 1KKXA 2ZNVC 3MFHA 4MLAA 3UMCA 2FJ6A 4UW9A 9ICSA 3H4KA 3TWAA 4O5CA 5KFAA 2WLBA 1MDRA 4J9RA 1XSPA 1I4HA 1UPHA 2NTSA 5J0XA 4RZRA 4RNOA 3EF6A 4PVJA 1V38A 3V6KA 3ZNID 3MR5A 1QOBA 3PO0A 5HKHA 1FNUA 1FIQB 3CAWA 3V3WA 5FKAC 4IRKA 3KZIU 3C8YA 5FXDA 1X1MA 3EUB2 2KFKA 3TX1A 4GDKB 3N6JA 4NLBA 2D6FC 5FS6A 4EOYA 1XDIA 2IA6A 2K4EA 1YN4A 3QK0A 8ICSA 2K4IA 2L52A 2SEBD 3JW0X 4G7FA 2MRPA 2Y0SF 1T5XD 2AQ3B 1DGJA 2PFQA 2R8IA 1E8ZA 2JZZA 3T9LA 2G06A 5AKGA 1I4RA 4N58A 4ZYSA 4JWMA 2DHZA 1ACCA 3GRSA 3H7IA 3JPSA 4ECXA 4FLHA 3UXLA 2BVHA 4CE6A 4J9QA 2CXYA 3RFAA 3PMNA 3A9JA 3TEXA 1GSNA 2WGSA 1L6NA 4FA6A 4Y2RA 4EZ6A 1P9DU 3KWLA 3QXGA 3Q8LA 3KUZA 4NY0A 2RLTA 4I6NB 1BNPA 3UF8A 4E74A 4JDRA 3VTUA 1FXAA 2LKYA 1ZQCA 3MJWA 3M62B 4KX6B 4DL7A 1LFDA 4KLHA 4KZCA 3FXGA 3FW7A 2QCZA 5KG7A 5JH5C 2VFTA 2UVVA 3ALRA 2KN4A 5IN7A 4IC9A 3ZDDA 2VJ5A 1TKGA 1MNSA 1XANA 4KZ0A 4MH8A 4HG0A 3OGUA 4HN8A 4ROPA 3Q6JA 2AJQA 3Q8RB 4G9BA 2LGXA 4F93B 3V72A 3LXFA 4EZKA 2WP6A 4BC7A 2C3CA 1NZPA 2IDYA 4IS7A 4ZH4A 1DXSA 2NRWA 3WALA 2HZGA 4S17A 3BZDB 2YY6A 2YQUA 1N6ZA 2WX1A 3SU8X 5D2MB 2JYEA 2KE7A 3R10A 2H3VA 4BGDA 2N9XA 4BFRA 2AL1A 3ZDEA 4F5NA 2ZW1A 2QJNA 2OZ8A 3HUIA 2NO4A 5B5EU 2C7NB 2KX3A 3DOWA 5GTIU 3DVNU 1KBUA 5KFZA 4EQWA 1XNSA 3M6KA 3TTEA 4EQRA 3W9CB 1L7OA 2PEAA 1JDFA 4J9KA 4UAZA 1SJCA 2ZCBA 5AI5A 5F9NA 3VAWA 4NL9C 3OLMD 1SKSA 5IA7A 1OFFA 3DGHA 1F44A 3G6XA 5L1KA 1WUFA 2BC0A 4DQSA 5AI0A 3O0FA 3M95A 1TVAA 7ICRA 4APNA 4M8NA 2BCRA 4UBBA 3V7KA 4AWJA 8ICXA 1QOGA 3OG5A 1AW7A 1X42A 5CWRA 9ICGA 5C5JA 1ZQGA 2E5AA 4TQ0A 1Q46A 5E6JA 5DDMA 4JQ9A 1PK3A 1WJUA 2Q85A 1X6JA 3SAGA 1DRGA 3S1DA 1JWUD 4CF4A 1QQRA 1KRPA 2HOQA 4CRXA 5U1OA 4ZHOA 4JB1A 1NKEA 4A3OA 1U45A 1QSYA 2KC1A 3PZ8A 3QC8B 3I9V1 2Y08A 2DZJA 3KBBA 2D3AA 5MPOA 3DFYA 4RMAA 3ECIA 4B9KA 2VFRA 2GB1A 1E7PB 3PLVA 5G5GB 2BB5A 3HM6X 4HPPA 2WFAA 2A3VA 2G9HD 3DDCB 3UXOA 3C28A 2CRXA 1TS3A 3VC6A 1S0OA 3DBHI 4K7WA 4TUPA 3L0WB 2D5GA 2KEYA 2AQ0A 1ZPSA 2IYDB 4NLNA 2OHFA 4IWQA 4TSSA 5HMMA 4QZ9A 2FBWB 2LI5A 1R0MA 4EC3A 4RFBA 4MDKE 4MSMB 2ZZBA 2OG9A 1FPYA 4QIWC 2W04A 3CYMA 2NVUI 3AE2B 3KLJA 3RO6A 4A90A 4J9LA 3EWAA 3C29A 1UZXB 1WVFA 4MT5A 4XDCA 4KLJA 5TISU 1H2IA 4I6PA 2JYTA 3BQ7A 5BOEA 4ZYNA 2R2QA 2W8KA 1F2RI 2BS3B 2C7MB 4GR1A 1A6SA 2M19A 3CNHA 3ZYYX 2VA8A 4RQ6A 2ZTEA 2HE7A 3ZIMA 4FS1A 1NEKB 4R65A 4QZHA 2BYEA 5KG1A 2J4XA 3H1UA 1NPXA 7ENLA 2IZVB 1NK0A 2J6TA 2JF5A 4MEMA 4WQOB 2Q0ZX 2Y5BB 2QIEB 3RB4A 1XF5L 3A9KA 4RUAA 3VRBB 2GGGA 3SQPA 2AQ1B 3LVWA 2W43A 3MY9A 1FIQA 1EWYC 2M0XA 3RJEA 3SQSA 4LLGM 1AOGA 2NRZA 3PY8A 3T5JA 3UJRA 1V1PA 1QKZA 1Z1BA 1QLBB 4GXIA 4GDKA 2CHZA 1BMLC 4WJPA 1QQ7A 5J2IA 4PYZA 3FM9A 5KT5A 2OPJA 3EEZA 3TARA 4IL0A 2VZKB 3N1ZC 3ED5A 3HHMA 4KIKB 4X5VA 4IP4A 2CJNA 4AP4C 5J04A 3SEBA 5AK4A 4F50A 5D7GA 5BOLA 1M6IA 4A20A 1QSLA 2X50A 4YQWA 4LDTB 2K6DB 4FO6A 3DBHB 2V3BA 2XH0A 5ALWA 3MZNA 3NJTA 3J81j 2XNAC 4OJOA 8ICKA 3IK4A 3RGTA 4KX5A 3FWAA 2MQJA 2GQWA 2DAJA 1GB4A 3WAPA 2WXFA 4P1CC 4IL6U 3K1ZA 4BOZB 2DW7A 3IC9A 5KG2A 3QE9Y 2FIDA 2JHDA 3AU2A 4NL9A 2KDMA 1E8GA 2BYVE 3CWIA 2WHIA 4YXDB 3BZKA 2HW3A 1MUCA 1ONFA 1JW9D 3S1CA 2GLSA 3GIJA 4KGTA 2YAUA 2EQ6A 2OEDA 2P4PA 5KG3A 2ACZB 2YMPA 3SYZA 3A1QB 4C4SA 2L0TA 3Q8KA 1A77A 4YVZA 3D2QA 4W9CA 3SV3A 4XDDA 3DQ0A 5HP4A 5EE0A 2XIDA 4GC6A 4WQMA 1NBFC 5D6JB 3TEZA 2RPVA 1QF6A 2DW6A 4N6EB 1UGJA 1WGDA 4A9AA 4EM3A 5J8YC 1ZQWA 2KX0A 3NFUA 3TSJA 4MHVA 3CGEA 2KJ8A 1V5OA 1XO3A 1PDYA 2VH1A 4EELA 2POZA 3KH0A 3GE3C 1C7YA 4O3OA 3WCQA 1WY8A 2IY1B 2NPTA 5IKCM 4UARA 5J0YA 2QDEA 4F4XA 5AK3A 4KDIC 1ZQKA 3VFKA 3AH7A 1NHQA 3DERA 3TEYA 2IO1B 1Y88A 1QLTA 3UJEA 3MBYA 1NK7A 2WXHA 1GRTA 2PVOD 3IM1A 4ARIA 2HCFA 9ICCA 4QIWF 4M47A 3W5UB 3CP8A 2Z0DB 2GR2A 2W0HA 2XCAA 5JUMA 1L7YA 3TL5A 4ECVA 3H8JA 1UWXA 3JPOA 5IIMA 2YEPB 2KDIA 4H4SA 3A7AA 2XI9A 2YLMA 5KFJA 3BSMA 2JT4B 3QA8A 2HBMA 3GD3A 3RJJA 3M1YA 1KF6B 1NYQA 1SJAA 4GFJA 2W11A 3AUOA 7ICFA 2WDWA 1OUQA 4WJ3B 4KSLC 9ICUA 4PVEA 3R2TA 1V80A 4IUMB 2DGZA 5J2AA 4FFDA 2JPHA 2LUMA 1XLPA 3DBLI 3ES8A 4Y2XA 4G50A 5J2CA 3ZJVA 1WRIA 4ZHPA 4C7YA 3UMGA 1KFTA 3ZTCA 5G5GA 3RRGA 2WP9B 2M17A 1XU4A 5BMHA 3PM9A 1W1SA 3C2MA 3A7UA 4GGHA 4KLTA 3QHTA 2FDRA 5CHGA 5JHAA 2HHXA 2KP7A 3R2IA 1K1SA 3EPIA 1N56A 1GRAA 2GO7A 4PHEA 2I5QA 2V6OA 3TOYA 5J0QA 5ALEA 5L1IA 2FE9A 2H5XA 3DFHA 4M52A 3U4FA 1ZQIA 1KEJA 2K4PA 4REZA 2OZ3A 1IPGA 4DNAA 3SENA 3SN1A 2KMDA 5KFXA 5KG5A 3O65B 2HVHA 4DL3A 4BWJA 3NOBA 4B95A 4S0RA 3NVZB 4GRTA 4DL5A 4URKA 4ACOA 5DB8A 3SEIA 3MUCA 4CNQA 1J19A 2KWDA 3RMKC 4HEA1 3S1EA 3OJ4B 5FK9C 2PMQA 2PS2A 4J03A 1FECA 3HPOA 1NZBA 3P4RB 3B9JA 2L05A 1RDFA 1ELSA 2LZ6A 4A35A 3P93A 5DBCA 4DQQA 4HJGE 1P43A 2N9EB 5BOFA 3JVAA 5L6GA 2EELA 1NKCA 5KFQA 2N1RA 3LVVA 4MF8A 2PE9A 1SV4A 1AN8A 1NVID 3AN1A 3D6JA 5L1MA 4KGRA 1XEEA 4C8KA 4PJ0U 3MR6A 3SMVA 1B0XA 4B9MA 3S5SA 2W3RA 4EM4A 2Y3RA 1WM3A 2RDXA 3RCYA 4F2SA 4JWNA 3KJMA 3SV4A 4YTNB 2DL0A 7ICJA 2MUCA 4RT3A 3QEAZ 5BMIA 1ZQSA 4CF5A 2K0PA 1PDXA 4KIKA 1Z4NA 3NVWA 1Q1WA 2ZEQA 4TURA 3OZMA 3EC8A 2K8CB 2LGDA 2HHSA 4YMNA 2KG5A 2KMCA 5JCIA 2F8LA 1SZPA 9ICXA 2LHDA 2HBKA 1T3QC 1EF1A 4ZRPA 1ZQOA 1WZ0A 1WXQA 2A19A 2O6VD 3PRZA 1TJEA 4KT2A 2OM6A 3NRZB 3MGVA 2GR1A 2CN1A 3DDMA 5T14A 5ALKA 2DBYA 3GB1A 2WDVB 5KVHA 3KHRA 2L8JA 3PSIA 2QJMA 3FVDA 4UB4A 3GILA 3V6HA 1RYRA 3PV8A 4GGQA 1SGGA 3UGVA 4LNFA 2RQ5A 3AEBB 2HHQA 3QTPA 1TY0A 3ZLZA 3NZ3A 4M0AA 1FCLA 2RRDA 4OO1J 2NBWB 3ZRCA 2RD0A 5CRXA 4OVZA 3KHHA 3TANA 1J8CA 5IIKA 5EBKA 1B4FA 4ITKA 3RNFC 1JROA 4XWWA 3HKZC 3D2SA 4K1WA 3DEDA 5FJTA 1YN3A 3PFRA 3ZNGC 2BCVA 2RSUA 4N9F4 4M6WB 5AI4A 3B0AA 2LHEA 4B9NA 2DX5B 2EZXA 1Z00B 1KDHA 3DHIC 3JYUA 2L5YA 5CX3A 1JN3A 2ZXHA 3V5FA 3ETLA 3IP4B 1YQZA 3PW7A 2BWES 2JRHA 2K60A 2FMQA 5HQXA 4JQWC 2KDBA 2K8AA 3ML8A 3QPEA 2PVGC 3B2FA 1Q0WB 4I29A 4MGZE 2ZUDA 3VHTC 4OZBA 5KTQA 1MJDA 4M6UA 1ZD3A 4EENA 5AM2A 2W54A 3GD6A 4DFKA 3L5OA 3D2DA 4H4WA 2PFOA 1FHUA 1WSPA 1JPMA 1X66A 1H38A 3V61A 1MG4A 4RF1A 3W1YA 2OXOA 1E7UA 2QDDA 2WBAA 4RQ3A 2VA2A 5CR0A 2YEPF 1WYGA 2CU1A 3N32A 2EQ8A 3OW1A 3VQIA 4H4UA 1P7DA 4XLOA 3B0XA 5KFVA 1EBDA 4DFDA 1ED1A 3RR8A 1ZQQA 5FP0A 3TI0A 3QZ7A 3R07C 2ZTCA 5J0PA 3PR5B 3KQ4A 1I35A 4X2PA 4DS5A 1PFDA 2WXQA 3D9XA 4GIRA 3H40A 2HBLA 4PHDA 4R64A 3ZXVA 2KD0A 3T5LA 1FFUC 2WU2B 3D32A 3SJNA 5E6PA 3ICXA 2ZG6A 3NTUA 4BX9C 5JHBA 3EFUA 1JWBD 4FJVB 4UAUA 4DOCA 3PX4A 1LPFA 3Q8EA 4I28A 2HDEA 1VJ5A 1WM2A 4KV2A 2PTYA 2GQUA 2IJ0A 3UINB 4XZ4A 4M9GA 1BPEA 2P88A 7ICMA 1EU4A 2OVLA 1ZYQA 5LXHA 1HSKA 2W9CA 2DPIA 4KTQA 1S77D 1Q5WB 1ZKQA 2P8CA 3M6ZA 4GISA 3T6CA 2JWUA 1T6BX 1V81A 1J2MA 1WX8A 3KKAC 3Q8BA 3NVZA 5FJPA 3FV9A 4DL4A 1HZ6A 2BBCA 3N6HA 2INDC 4C4VB 4PZOA 3W5VB 2NMQA 4FX9A 1FD6A 2FCMA 8ICNA 1UNSA 1WWUA 5EWEA 1GO3F 3DESA 1TIFA 3GV7B 4ANUA 2CHWA 2JXJA 3VUWA 1W1OA 1ISNA 3T79A 2KD1A 4Y2SA 5AIBA 5IAAC 5FMHA 4I2EA 1AROP 4RQ1A 2ZPYA 7ICIA 1QLUA 2CFYA 3GD4A 3Q2AC 4RNNA 4RCOA 3OZYA 2R8DA 2LASA 3DQVA 4QZBA 1ZQMA 4RGTA 1EC8A 1F5SA 4EZJA 3H8WA 3ALBA 4YFKA 2ZTDA 1D6EC 5DKWA 2KQ4X 1COOA 4II3B 4ANWA 1VDVA 2BCSA 2VFSA 4FHKA 1WGKA 2N7JA 4F4YA 2CR5A 5KFEA 3BWUD 3UI3A 3QUCA 4YD1A 1X9MA 2KZMA 4H1ZA 3H8AA 2H3ZA 3F53A 5AKZA 3IBEA 4ZOHB 3UPQA 3HKZF 1NK8A 2IPIA 4TQRA 5ALRA 2Q4WA 1IUEA 5L1LA 3JVZX 2BPFA 1IXRA 2K8CA 3V7LA 1CQVA 4NEVA 3DDHA 3POPA 2F1HA 1S0NA 4GIVA 4WWOA 1IBXB 4DLGA 3ZD8A 2C22A 5I1WA 2XGQA 2P8BA 1SJHD 2SAKA 2JEJA 2CS4A 4YR0A 2G08A 1J7BA 2HD5B 2WS3B 2R61A 4ENLA 3TFRA 3QUQA 1P98A 4RGOS 3T5KA 1F8WA 3R9KA 3WK4A 4LZGA 3RBDA 3KFUF 4KDLB 3PO5A 2PCEA 4PHAA 3P1MA 5H8YE 5AI8A 1CEZA 4Z1YA 1XCTL 4GSWA 5KG0A 3LWLA 2OJRA 4OD0A 3IRUA 1XS2A 4JK1A 3MJ5A 4WJNA 5H92C 3NVVB 2NV3A 5L1JA 2UU7A 7ICQA 1L5PA 4B9LA 4IP5A 7ICOA 4TQSA 3PWGA 1L6VA 4C80A 3RULA 3Q8SB 1L2NA 1AHUA 2LMRA 2JR5A 4IWOA 2EKEC 3PSTA 4ZOHC 3PSEB 4DXAB 3LJ3A 3AEDB 1I42A 2AGQA 4EZLA 4JWSC 5ALJA 1ZUD2 1D8YA 2MNRA 1WGHA 3GDXA 2Y9TA 3M7DA 1V1OA 3RB6A 4HCNB 4KLLA 4M02A 4LNIA 3VR8B 3CGCA 4LA1A 3GSYA 5F3XB 5DGBA 9ICFA 1Z00A 3OPXA 2BS4B 2GGIA 1ZD2P 2ZJDA 2V9HA 4ICUA 1SB3B 2GDQA 3THUA 3KLSX 3PK7A 2LEKA 2AGPA 1FFUA 3NS1B 1L3SA 1H6VA 3RRAA 1WYWB 2AQ4A 3VVWB 8ICEA 4F2RA 3OWEB 3RD2A 2MRLA 4C8LA 4U7CA 4MFFA 4B9UA 3CT2A 3IAM1 4DHGA 1I7HA 4IQVA 3FILA 1XQQA 1KW4A 1DGSA 1YQ4B 2ESEA 1AHZA 2B3AA 4YTPB 2JSVX 1PVPA 2C9WB 5DQIA 1U9LA 3U26A 4NLGA 2PXIA 4WWPA 3AEAB 2AGOA 4NM1A 2BB6A 4P16A 2F76X 3WK9A 1OQYA 4ACFA 2V4LA 5G5HB 4DSEA 2AEHA 4F4RA 2QVHA 3C19A 2PTZA 4ED2A 4K81A 4YTMB 2UVWA 4YT0B 4EMIA 2QPMA 3SR6B 3Q6BA 1T0YA 5AI6A 5KT7A 3DVGY 3H12A 3EUB3 8ICPA 1PK1B 2Q4TA 4Y2TA 2LGSA 1RYUA 3STPA 2YMMA 2BQRA 4E6MA 2PKEA 3RB0A 2WTFA 1C79A 2ZPNA 3TW9A 1SB3C 1LO5D 2GGEA 1K1QA 2XGPA 3N1YC 2YB4A 4M0WB 5JRBA 3DH9A 4BKSD 2I9GA 2QGYA 1KD0A 1JRPA 1S76D 2QILA 2MUTA 1H8CA 2EZYA 2LBOA 1KH0A 1G6JA 3TIXA 1A70A 4KKIA 2PODA 4FULA 3B08A 4A55A 1SSNA 1TS2A 2IOHA 1OTRB 2YMLA 8ICJA 3HT3A 3Q8CA 3TQPA 5L95C 2WPEA 2P66A 5KVIA 3ZI4A 3RI7C 2Y1JA 4HCHA 3TUOA 4DX3A 4R66A 3A33B 4WWNA 4ED6A 2MX2A 4ASWC 3DBRI 2V3NA 3L16A 1JX4A 2VAOA 1JCTA 1EBGA 1ZD4A 3CW2C 1SL2A 1ZQ1C 2WOIA 3HIZA 3ZDTA 2O56A 2O6KA 1C78A 3K4GA 1V8CA 3QCAA 5IO9A 2QJJA 4KLDA 4PGYA 3JPTA 2J52A 1F0MA 4IRCA 5FJOA 4OVVA 2KTFA 4ELTA 1NDDA 3TJ4A 1WGYA 1IGCA 4DHZE 2I0KA 3RJAA 4HVBA 2HI0A 3UMBA 3GIMA 4DWFA 3PO4A 1ZETA 2FCSA 5DB6A 2BQUA 3R3MA 3AM9A 4L2YA 3EZ5A 1IM4A 3U2SC 4AS1A 2V9WA 1GAQB 1UT8A 2E8PA 5AKXA 4PS7A 3H8SA 3H0LB 4Y2PA 4W9FA 5L9XA 4WAFA 3I6TA 5AE2A 1QT9A 1WMHA 3K1RB 5E79U 3N1XC 2GOWA 3H7SA 2VKQA 1FEZA 2NBVB 2TPRA 1L6UA 3UQBA 1RPLA 2CPRA 3KYDD 4IWPA 4MGYE 5IIIA 3HVDA 2EAPA 4RGNA 2ZXIA 2MCNB 2EQ9A 1KTQA 4EEYA 2BPGA 4I2FA 3LK9A 3N97B 4II2B 3UM9A 5DB9A 2PP3A 4MGGA 3I99A 3PHXB 5ALOA 1SEBD 2WU5B 1SF0A 3Q14C 2BCPA 1KLUD 3I4KA 1RAXA 2GR3A 4DQOC 3IJIA 1ZQLA 3CK5A 2G3QB 4DK5A 5J0WA 1N48A 5EE3A 1HZ5A 5BYSA 4F4KA 1QQ5A 1Y56A 3TJIA 1UT5A 3HP6A 3MABA 1BT0A 1V5TA 2QHOA 5AM3A 9ICKA 3PREA 4G3XB 5KFCA 5ALHA 2B6GA 4DOBA 2WF6A 1S0VA 1WIAA 4RGMA 3CYJA 2PTLA 1T4GA 3FJ4A 5IIOA 1L4DB 2DWQA 1TKKA 1ZRMA 4H4YA 2E3TA 3DBRB 5KG6A 2JK6A 3AEEB 1L4ZB 2BDUA 4C7ZA 2HXTA 4F71A 1JOAA 3RH4A 3CXOA 2ATLA 3DHGC 4EQXA 1R4MI 3JS8A 3KYCD 5J2DA 1HXYD 2G4SA 4J6IA 4FDCB 2KQSA 3C0RB 4OCZA 4J3ZA 2K89A 1NI2A 3ZTDA 4GIBA 4Q45A 5AKIA 2KZZA 4PGQA 3IG8A 2LVQA 4AP9A 2BF8B 4XE0A 3V62A 4CYEA 2RK5A 5AIAA 1XSNA 4PL2A 4CCHA 4FZMA 2IGDA 3SQIA 4ED0A 2IGHA 4PVKA 4FP1A 3BVZA 4A3RA 7ICTA 1QSSA 1K51A 3SN0A 5KFBA 3TCSA 1EM7A 1GNUA 4LVSA 3A0HU 2WXNA 3DGBA 1JMSA 5HNKA 4MM3A 4KX3A 4XA5A 2O6VB 1N61C 5DPWA 2WXOA 3W2DA 4XYCA 2K3UA 1MI0A 1S3SG 1UQVA 2MA9B 4IZGA 1FNWA 3U7DA 1MHXA 3WK6A 5IOIA 1LVLA 2M8SA 3F2BA 3HILA 1DTNA 4GXBA 4QZAA 5KG4A 4DSFA 8ICRA 9ICVA 1XD3B 1VAOA 3THVA 4HROA 2I1KA 7ICHA 5C3JB 2XGZA 1MVKA 1SV0C 5D94A 5EE1A 1EO6A 4F4WA 2ZVNA 4EX7A 2BWFA 3BOXA 2YTUA 1E6EB 8ICCA 4OJPA 4B9VA 1YQBA 5I1VA 2WWZA 1ZW7A 1M6YA 3NHEB 5G5HA 4QW8A 1L8LA 4OJLA 5H2FU 2PLIA 5TZVA 4DHZB 1QOAA 2I38A 1PGAA 2OJWA 2WX0A 3SR6A 4Q43A 4MMWA 4UQGA 4P2HA 2BYTA 8ICFA 3FAHA 3V60A 4BUGA 1HEKA 1TBEA 4MELA 5IILA 1RXWA 1WGRA 3DVNV 2A8XA 1D5XC 5KFIA 5J0SA 2JU6X 4DSKA 3DVGX 4NAMA 1ZGUB 2HNEA 4KEMA 1ZP0B 3PGEA 3VTWA 1D8LA 3V7JA 3GS2A 2ON8A 1SXDA 2DFLA 1KCZA 2VH2A 2L3ZA 3EYZA 8ICOA 3GV8B 3L17A 2OO6A 1R4MB 4HYKA 4QZGA 5J2GA 5AKYA 1CRXA 2PGWA 3HVZA 2K6QA 5AM4A 5KHOA 1ZDVA 3BY4B 1X40A 1ZQVA 4YD2A 5CP2A 3E9SA 1I19A 2ASJA 1TK8A 1CI4A 4KLSA 5TR5A 1WI0A 3AECB 3FW8A 4JAYA 3U9IA 2KSOB 3GV5B 3K9PB 4C4TA 3L08A 2RR9A 2X38A 3IHQB 2CKHB 3FCPA 2PLSA 4C8MA 5FXPA 2JXXA 4I2AA 1V86A 2G1EA 1SJDA 1MO9A 2JY6A 4K7ZA 3R7RA 1T0QC 4EYIB 5AUKA 2OH2A 4ZRQA 2W03A 5ER0A 1W1QA 3OJSA 8ICLA 3C2KA 2PI5A 2EKIA 2MLBA 1TGZB 4CQNA 3HK0A 3I1YA 3C1ZA 2BW2A 5AZHA 2HHVA 5ENLA 3VC5A 2KAJA 2BT6A 1XHCA 4E3CA 2QC8A 4FJYA 1TKDA 3VFCA 1B1ZA 1V9JA 1WE6A 1ZK7A 1IG6A 3BS5B 3PRMB 4K8GA 1YMHE 1E8HA 1SE2A 3WK8A 3PW4A 2R8KA 1YZ6A 4P0QB 2M4NA 3RUIB 3Q8MA 2XY6A 1ZXHA 3ENEA 2QARB 3ZW3A 2C60A 1S5LU 4EX6A 3SAHA 9ICLA 2REXA 4MKSA 2KOBA 2KT7A 9ICBA 2KZRA 3VDZA 4ADWA 1N60C 2ISOA 3LYSA 1B22A 5FXFA 5GMVA 4CO7A 1CK1A 5KFOA 1NK4A 2GMIC 4IOIE 5GXGB 5BMGA 3K75D 4UAYA 2KVZA 3H8HA 3OPSA 1HUOA 2J6SA 5D4BA 4RNAA 4UAWA 1N5WC 1UELA 4ECRA 2GQTA 1NHSA 1J7CA 3MC9A 4WH4A 5ALTA 1R6WA 3A4RA 4ECZA 4Y2QA 4IM2A 1IYFA 5ALMA 2KNJA 4GXJA 2KANA 4HPMB 1WJ4A 1ZQYA 1N61A 3T5HA 5KAIU 2JRIB 1OEYA 4WWMA 4DDGD 2WOWA 5GRTA 3QARA 4ML8A 1MQ2A 2E8OA 3M63B 3R11A 3H0RB 4KITB 1MG8A 1AYFA 3UQAA 4GC7A 4PPXA 1KL9A 1SJED 2QMTA 1TT5B 4BJQA 4FXCA 1WR6E 3VR9B 2ONQA 3N30A 2XCPA 1FXTB 3GP7A 4M04A 2ODGA 1SV0A 5BYQA 2JUOA 4J57A 1YT3A 4A8XC 3HSUA 2DKZA 3ZNZB 3RYTA 1B9RA 1MDLA 3LXDA 1ZJNA 2J0JA 4Z6EA 4Y2VA 1ZDLA 1D5ZC 5DB7A 4K2SA 3TAQA 1PGBA 2R9ZA 2MHJA 2ZIVB 2JEFA 5DGAA 5AI9A 1Q3VA 1QILA 2FCQA 5K8EA 4UDUC 4DFJA 2F8KA 1ZOYB 4ANVA 2ZZPB 4CHKA 2X8HA 4JGHB 4OVUA 2NCNA 3ZVHB 3Q3FA 1XCQL 1E10A 4GMEA 1DK2A 2WF9A 4I2DA 3WKCA 1C4PA 2KK8A 1FRDA 3IAS1 3AEFB 5EDSA 3GFKB 1WX9A 1VD2A 5JXVA 4I2IA 3WKEA 3KW5B 1GRHA 4Y2JA 2JH1A 1F2RC 5ALSA 1WCNA 1ZXIC 1EUVB 3T8QA 2K25A 2KK0A 3AB5A 1J7AA 4UB5A 1T0SC 2IY0B 1HIWA 5DLFA 4P0PB 4H4PA 3H4DA 1GB1A 1JMLA 2FLPA 2GI9A 4PS8A 2D3GA 2H3IA 3ES7A 4K7SA 2ZADA 3GZNI 5ALLA 4GLSC 2KMAA 2WXRA 2AKZA 5HHZA 8ICQA 5D3IB 4FE3A 5KFLA 4RQ4A 1GC6A 1JWSD 2GBRA 1NJXA 5ALIA 2CU3A 1CJEA 1GREA 5HR6A 4O95A 2D3DA 1WJ6A 1EXNA 5J0UA 3N3KB 2EAOA 2W9NA 3EFCA 1ZRNA 2YN4A 2BVGA 2F44A 2KWUB 2HVIA 4Q2JA 1GRFA 1PDZA 3PVXA 3P0WA 3QNMA 2C2DA 2PJHA 1A0PA 2WXMA 2HHTA 2M0AA 1DZNA 1AWDA 1TAQA 1L3UA 1TKYA 3K1GA 2GH5A 4QNLA 5TSSA 1W1JA 1C3TA 3FG2P 5CA7A 4K7UA 2GGHA 3IXSA 2CJOA 1UXYA 7ICPA 3JPQA 1N2XA 4WJOA 3EW9A 7ICKA 4UB1A 1PUTA 3UCDA 1V9PA 3OP2A 1FNVA 3BJYA 1C77A 2DYMA 3PMLA 3ETRB 5G55A 2AL2B 3TADC 2L0FA 1BPBA 1TE6A 1MN8A 7ICSA 3H0MB 4H4TA 2K8BB 4RPZA 1YZ7A 3Q69A 1N60A 4DO9A 1OQRA 1UBQA 4DXFA 4AQ7A 5ALXA 3PZ7A 2BZFA 4TUSA 4F1SA 3U8ZA 1XPYA 2A4ZA 4ELUA 3QJZA 4W9DA 2NRVA 3QN3A 2MJDA 2KHQA 2XY5A 4ZRKA 8ICWA 1F9CA 1N5WA 3RNBC 2XY7A 1ZQUA 3SFEB 3OC4A 4H83A 2IPKD 2WF5A 4FBTA 4JMUA 3T8MA 4O3PA
chains in the Genus database with same CATH topology
2WLBA 4RCOA 2R8DA 3I57A 1I4HA 3B9JB 2NTSA 1D4BA 2OAIA 4RGTA 4PVJA 1EU3A 5LNK1 1QOBA 3PO0A 1FIQB 1D6EC 1FNUA 2KQ4X 3W8WA 5FKAC 2VFSA 1VDVA 1HQRD 1KFYB 3C8YA 5FXDA 2N0SB 1WGKA 3EUB2 2N7JA 3TX1A 3BWUD 4P6VF 3AEGB 4GDKB 3UI3A 2H88B 2W82A 4NAWB 5C2TB 4ZOHB 1YN4A 2R2ZA 2IPIA 2L52A 2SEBD 2Q4WA 1IUEA 1VZ6A 5ADZA 3EGRA 1T5XD 2AQ3B 1DGJA 1CQVA 1N62C 3VRAB 3POPA 1IBXB 2W55A 1I4RA 4N58A 4ZYSA 3NVWB 1XLNA 3D2JA 5I1WA 1ACCA 1JCKB 2Y3AA 2UUUA 1VJKA 3TSSA 2BVHA 1SJHD 2SAKA 4D2KA 1J7BA 3TEXA 2WS3B 2R61A 3RFZB 3U4EG 4RGOS 2TSSA 3KWLA 1VLBA 2WDRB 1FXAA 2JZPA 1YQ3B 3P1MA 1YNTE 4KX6B 5H8YE 3FW7A 1XCTL 3O13A 2RDHA 2E6XA 2WXKA 4JX1C 2KN4A 3MJ5A 5H92C 1TKGA 3NVVB 1L5PA 3AE8B 5AE1A 4MH8A 1L6VA 4C80A 4HG0A 3BK2A 1AHUA 4PZFA 4ZOHC 2K9XA 3LXFA 4BC7A 1FO4A 3AEDB 2IDYA 1VZ7A 4JWSC 3MP9A 3BZDB 1ZUD2 4PYTA 1TKEA 2JYEA 1V1OA 3VR8B 4ARCA 4UD8A 3GSYA 2ZW1A 1JQ4A 3HUIA 1PGXA 2BS4B 4LTUA 1FM0D 2V4IB 3Q8FA 3AE1B 3W9CB 1SB3B 3KLSX 2LEKA 3NS1B 1FFUA 1OFFA 4C56C 1RM6B 3OWEB 2NTTA 3IAM1 1ZDXA 2FUG1 1I7HA 3FILA 4L23A 1SBBB 3AE6B 1YQ4B 1AHZA 4YTPB 1QOGA 2JSVX 2EXRA 1AW7A 2E5AA 4TQ0A 3AEAB 2WXJA 2BB6A 4P16A 5E6JA 2Q5WD 1R7SA 4YWGG 5G5HB 2Q85A 1STEA 3S1DA 4DNSA 5T8IA 4TQ1A 1JWUD 1Q10A 1SE3A 1QQRA 4YTMB 2AQ2B 2H89B 3FC4A 4YT0B 2QPMA 3SR6B 4ZHOA 3P4SB 1N63C 3MHZA 4JB1A 3EUB3 3AE5B 2QSDA 3PZ8A 3I9V1 2Y08A 4B0EA 5MPOA 4XWTA 2FE8A 1C79A 3RJ8A 2INNE 1LO5D 1SB3C 4OZAA 2GB1A 1E7PB 5G5GB 1W1MA 4OZCA 2VFRA 3PQBA 2BB5A 1W1RA 1FFVC 2G9HD 2GRIA 2VFTA 1JRPA 1TS3A 1JWMD 4IDIA 3MC0B 2D5GA 3NVYB 4BC9A 2QILA 1RM6C 1KH0A 1ZPSA 2IGGA 2OHFA 1GOZA 4TSSA 2FBWB 1A70A 4KKIA 4EC3A 4US9A 4RFBA 2QKNA 4A55A 1SSNA 1TS2A 3AE2B 2XN9C 3AE4B 3Q8CA 4A90A 2Y4GA 5D79A 1T3QA 4MT5A 1WVFA 1C76A 4XDCA 3TUOA 2AXRA 1E0YA 3Q8AA 2JYTA 5L6FA 2V3NA 2VAOA 1N62A 1FEHA 2HTME 1F2RI 4YSXB 2BS3B 2M19A 4B0MA 3N9YC 3ZYYX 4PWBA 2L1AA 1C78A 1NEKB 1V8CA 2J52A 3LYYA 1ZR6A 2J4XA 2I0KA 3RJAA 1IGCA 1JWAD 2QIEB 1TYGB 1XF5L 3VRBB 4L2YA 3AM9A 4AS1A 2AQ1B 3U2SC 4DXGA 1GAQB 3J9CA 4WAFA 5AE2A 1FIQA 1EWYC 2J42A 4YSYB 2L83A 1MBBA 1QT9A 1RYJA 1MHHE 4LLGM 1V1PA 3BW7A 1QKZA 2WXGA 1QLBB 1BMLC 1L6UA 1V97A 4HRSA 1F77A 2N9KA 1BUIC 4RGNA 3HVDA 2VZKB 1XLQA 2CJNA 1I4PA 3SEBA 1L0XB 5D7GA 2LFIA 2Z8LA 2PW9A 2I2YA 3NRZA 3I99A 5FXEA 1SEBD 2WU5B 1SF0A 2MJEA 2PLPA 5EE9A 1YN5A 1KLUD 4RF0A 5HMRA 1GPXA 4DQOC 2XNAC 3FWAA 3BYTB 1GB4A 1W1LA 2WXFA 5EE3A 1ZXIA 1HZ5A 3ZJTA 2MH7A 5BYSA 1E8GA 1Y56A 2KDMA 4TVYA 4TMAB 1KRHA 3CWIA 4YXDB 3BIID 4RGMA 2PTLA 1JW9D 3E56A 4N59A 3S1CA 4KGTA 1L4DB 1DOXA 2DWQA 2PMVA 4JPSA 2OEDA 1F0XA 2INPE 2P4PA 2ACZB 2E3TA 3AEEB 4H2AA 1L4ZB 4C7ZA 1DYQA 4XDDA 3DQ0A 5FR3A 3JS8A 5EE0A 3W8XA 1HXYD 2VFUA 4WQMA 3TEZA 1QF6A 2LMCA 2RPVA 1EWCA 1RWSA 1TS5A 1UGJA 4N6EB 4XE0A 4A9AA 3TEWA 3TSJA 3LB8C 2RK5A 1E8FA 1K52A 2IGDA 3LAEA 1N63A 1XO3A 2IGHA 4PVKA 3MFGA 3BVZA 4L1BA 3RPFC 3WCQA 1C9FA 1K51A 1EM7A 1NI3A 1FXIA 2WXNA 3HRDC 4R3DA 1FFVA 1N61C 2WXOA 3W2DA 2K3UA 1MI0A 2RDGA 3AH7A 1FNWA 4WIPA 1MHXA 1I4QA 4YSZB 3TEYA 2MJ3A 1QLTA 2NQWA 2WXHA 5D3DA 1W1KA 3S1FA 2PVOD 4ARIA 1VAOA 4HROA 4JWUC 3W5UB 1PYWD 5C3JB 1WWTA 1MVKA 5EE1A 1UWXA 4NJCA 3IT4B 1E6EB 3FILB 2YEPB 3P42A 3A7AA 5I1VA 4NZLB 5G5HA 2PLIA 2Y5PA 2P13A 1KF6B 1NYQA 1QOAA 1PGAA 2I38A 2JXTA 2Y3SA 2WDWA 4PVEA 3SR6A 1ROEA 3R2TA 2BYTA 2LUMA 1ENFA 1VZ8A 1XLPA 3FAHA 3AV8A 3ZJVA 4TVWA 1WRIA 1K53A 2L32A 3IT6B 4ZHPA 4C7YA 5G5GA 1FCCC 2WP9B 3PM9A 5BMHA 1D5XC 1W1SA 2JU6X 3A7UA 4NAMA 1ZP0B 3GS2A 3NVYA 2ON8A 3R2IA 1I4GA 1YJJA 4BBYA 2VZKD 3ETRA 4KKJA 1VRAB 2MEKA 3HVZA 1QOFA 1TY2A 4REZA 1ZDVA 4HKZE 1ET9A 4O1NA 1C4AA 1YJIA 4J3OD 3E9SA 1I19A 4OW0A 4RH6A 3AECB 3FW8A 4JAYA 3NVZB 1TS4A 1HSKA 2M56B 2KWDA 2X38A 3P4QB 2PLSA 5AUIA 1M4VA 4HEA1 1FRRA 3S1EA 5FXPA 5FK9C 3HRDD 2G1EA 1NYRA 3P4RB 3B9JA 5AUKA 1E9MA 4ZRQA 1KTKA 4HJGE 2W3SA 2N9LA 1W1QA 5L6GA 2EELA 5HI1A 2EKIA 2BS2B 2LJIA 1DOIA 2K22A 4CQNA 2UUVA 1AN8A 1NVID 3EA6A 3U7ZA 3AN1A 4MACA 3W1SA 3ZQ4A 2BW2A 4KGRA 1DIQA 1XEEA 1ET6A 2BT6A 2KAJA 1K50A 2W3RA 1B1ZA 2Y3RA 1YMHE 2DLBA 1E8HA 1SE2A 3KJMA 1I4XA 1IGDA 3AMZA 1CZPA 4YTNB 1QLUA 1ZXHA 5BMIA 4KGSA 3FW9A 3BK1A 3BVGA 3R8BA 4EE2A 3C0PA 2K0PA 2PIAA 4OALA 1PDXA 1V1PB 1IBXA 3A7RA 3NVWA 4LK0M 1HEZE 1N60C 1MPEA 4OHJA 5FXFA 1CK1A 5GXGB 4IOIE 1SXTA 5BMGA 1N5XA 1UWMA 3H8HA 2LHDA 4GDLB 1WVEA 4RNAA 1T3QC 1ESFA 1RFKA 4ZRPA 1D5MC 1WXQA 1N5WC 2GQTA 1J7CA 1TJEA 4WH4A 2ICIA 2QEJC 3NRZB 2Y5CA 3CIRB 2DBYA 3GB1A 2WDVB 4WURA 1P7EA 5BYRA 3AE7B 3NVVA 1N61A 2WDQB 5HHDG 1TZOA 4WWMA 4ML8A 3V05A 1KLGD 1AHVA 4HKQA 3ZGZA 1XLOA 4A6QA 1AYFA 3D2HA 1SJED 2QMTA 3AEBB 5AE3A 1TY0A 4FXCA 4BCAA 3NZ3A 3VR9B 1DIIA 1FCLA 4USAA 4PT5A 2ONQA 3GP7A 2K5PA 1SIJA 4OVZA 5BYQA 4A8XC 3HSUA 4JE3B 4PVHA 1B9RA 4ITKA 4XWWA 3LLBA 1JROA 3DEDA 2JX5A 1E0ZA 1YN3A 1D5ZC 2PKOA 5AWVA 1PGBA 1BXTA 3P63A 2KMMA 2AX5A 1X2GA 2JQRB 2MBRA 5I4DA 2LHEA 1QILA 5K8EA 4UDUC 3NS1A 1ZOYB 1VQZA 3W8ZA 1P7FA 1XCQL 3T3OA 1E10A 5HQXA 2B76B 2J53A 2BTEA 1C4PA 1FRDA 4PWCA 3IAS1 3AEFB 3ABVB 2PVGC 3B2FA 5JXVA 3KWVA 3L4PA 4OZBA 1F2RC 4MM3B 4US8A 1ZXIC 2W54A 3D2DA 2P3HA 1ZE3D 1SE4A 3AB5A 1J7AA 3TSHA 1WSPA 3V3XA 1MBTA 4RF1A 2BVFA 3VTEA 3DWGC 3URYA 2YEPF 1WYGA 3NUHB 1JMLA 1GB1A 2GI9A 3VQIA 4XLOA 4GLSC 2WXRA 5HHZA 1C4CA 5D3IB 1L0VB 2VFVA 1JWSD 2YVSA 1JALA 3SFDB 2CU3A 3BYYB 1CJEA 4O95A 1VR9A 3R07C 3DWMA 4M0WA 5HG2A 2O3GA 1HA5A 2BVGA 3KQ4A 1FMAD 1PFDA 1L0YB 2WXQA 4Q2JA 5HFYA 1UUPA 2V3PA 3AE9B 1FFUC 2WXMA 2WU2B 2M0AA 2QJLA 1AWDA 1DZNA 4IKGA 3BVMA 1TKYA 3T3NA 3U52E 2WNMA 1XXGA 1JWBD 5TSSA 1OQQA 1W1JA 2WXPA 1UXYA 3IXSA 2CJOA 3P4PB 3Q8EA 2HDEA 1PUTA 1F0ZA 2GQUA 2IJ0A 2KACA 2LGIA 1EU4A 1FNVA 3AE3B 1C77A 2DYMA 2DYOA 1X2HA 1DOYA 3ETRB 2JWUA 1T6BX 2RMMA 3Q8BA 3NVZA 3Q69A 3B2GA 1N60A 1OQRA 4AQ7A 4DXFA 2V0GA 2ZW0A 1HZ6A 3PZ7A 2BBCA 3W5VB 2NMQA 1FD6A 1UNSA 3ZJUA 1NENB 2MJDA 2WXLA 2WXIA 1N5WA 1W1OA 3SFEB 4MLAA 2IPKD 2WQYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLB A;  2R8D A;  3B9J B;  2OAI A;  1QOB A;  3PO0 A;  1FIQ B;  3W8W A;  2VFS A;  1VDV A;  1KFY B;  5FXD A;  2N0S B;  1WGK A;  3EUB 2;  3TX1 A;  4P6V F;  3AEG B;  2H88 B;  5C2T B;  4ZOH B;  2R2Z A;  2Q4W A;  2L52 A;  1IUE A;  5ADZ A;  1DGJ A;  1N62 C;  3VRA B;  2W55 A;  4N58 A;  3NVW B;  1XLN A;  1VJK A;  2BVH A;  1J7B A;  2WS3 B;  3KWL A;  1VLB A;  2WDR B;  1FXA A;  5H8Y E;  1YQ3 B;  3P1M A;  4KX6 B;  4JX1 C;  5H92 C;  1TKG A;  3NVV B;  1L5P A;  3AE8 B;  5AE1 A;  1L6V A;  4C80 A;  4HG0 A;  1AHU A;  4ZOH C;  2K9X A;  3LXF A;  4BC7 A;  1FO4 A;  3AED B;  4JWS C;  1ZUD 2;  4PYT A;  1TKE A;  3VR8 B;  1JQ4 A;  3HUI A;  2BS4 B;  4LTU A;  1FM0 D;  3AE1 B;  3W9C B;  1SB3 B;  2LEK A;  3NS1 B;  1FFU A;  1OFF A;  1RM6 B;  1I7H A;  3AE6 B;  1YQ4 B;  1AHZ A;  4YTP B;  1QOG A;  2EXR A;  2E5A A;  3AEA B;  2Q5W D;  1R7S A;  5G5H B;  2Q85 A;  3S1D A;  4YTM B;  2H89 B;  3FC4 A;  4YT0 B;  2QPM A;  3SR6 B;  4ZHO A;  3P4S B;  1N63 C;  4JB1 A;  3EUB 3;  3AE5 B;  5MPO A;  1SB3 C;  2VFR A;  1W1M A;  1E7P B;  5G5G B;  1W1R A;  1FFV C;  2VFT A;  1JRP A;  4IDI A;  3NVY B;  4BC9 A;  1RM6 C;  2OHF A;  2FBW B;  1A70 A;  4US9 A;  2QKN A;  3AE2 B;  3AE4 B;  1T3Q A;  1WVF A;  2AXR A;  1E0Y A;  2VAO A;  1N62 A;  2HTM E;  4YSX B;  2BS3 B;  2M19 A;  3ZYY X;  1NEK B;  1V8C A;  1ZR6 A;  2I0K A;  1JWA D;  2QIE B;  1TYG B;  3VRB B;  3AM9 A;  1GAQ B;  5AE2 A;  1FIQ A;  1EWY C;  4YSY B;  2L83 A;  1MBB A;  1QT9 A;  1RYJ A;  3BW7 A;  1QLB B;  1L6U A;  1V97 A;  4HRS A;  1XLQ A;  2CJN A;  3NRZ A;  3I99 A;  5FXE A;  2WU5 B;  1SF0 A;  2MJE A;  5EE9 A;  5HMR A;  1GPX A;  1W1L A;  5EE3 A;  1ZXI A;  2MH7 A;  1E8G A;  4TVY A;  1KRH A;  3CWI A;  4YXD B;  3BII D;  1JW9 D;  4N59 A;  3S1C A;  1DOX A;  2DWQ A;  1F0X A;  2P4P A;  2E3T A;  2ACZ B;  3AEE B;  4C7Z A;  3DQ0 A;  3JS8 A;  5EE0 A;  3W8X A;  2VFU A;  4WQM A;  1QF6 A;  4N6E B;  1RWS A;  4A9A A;  3LB8 C;  2RK5 A;  1E8F A;  3LAE A;  1N63 A;  1XO3 A;  3RPF C;  3WCQ A;  1NI3 A;  1FXI A;  3HRD C;  1FFV A;  1N61 C;  3AH7 A;  4YSZ B;  2MJ3 A;  1QLT A;  2NQW A;  1W1K A;  3S1F A;  2PVO D;  1VAO A;  4HRO A;  4JWU C;  3W5U B;  5C3J B;  1WWT A;  5EE1 A;  1E6E B;  3A7A A;  5G5H A;  2PLI A;  2P13 A;  1KF6 B;  1NYQ A;  1QOA A;  3SR6 A;  1ROE A;  1XLP A;  3FAH A;  3AV8 A;  4TVW A;  1WRI A;  4ZHP A;  4C7Y A;  5G5G A;  2WP9 B;  3PM9 A;  1W1S A;  3A7U A;  1ZP0 B;  3NVY A;  1YJJ A;  4BBY A;  3ETR A;  3HVZ A;  1QOF A;  1YJI A;  1I19 A;  3AEC B;  4JAY A;  3NVZ B;  1HSK A;  2M56 B;  3P4Q B;  2PLS A;  5AUI A;  3S1E A;  1FRR A;  5FXP A;  3HRD D;  2G1E A;  1NYR A;  3P4R B;  3B9J A;  5AUK A;  1E9M A;  2W3S A;  1W1Q A;  2EKI A;  2BS2 B;  1DOI A;  2K22 A;  1NVI D;  3AN1 A;  1DIQ A;  2KAJ A;  2BT6 A;  2W3R A;  1E8H A;  3KJM A;  3AMZ A;  1CZP A;  4YTN B;  1QLU A;  3C0P A;  2PIA A;  4OAL A;  1PDX A;  3A7R A;  3NVW A;  1N60 C;  5FXF A;  5GXG B;  1N5X A;  1UWM A;  1WVE A;  1T3Q C;  1RFK A;  1WXQ A;  1N5W C;  2GQT A;  1J7C A;  1TJE A;  3NRZ B;  2Y5C A;  3CIR B;  2DBY A;  2WDV B;  3AE7 B;  3NVV A;  1N61 A;  2WDQ B;  4WWM A;  4ML8 A;  1AHV A;  1XLO A;  1AYF A;  3AEB B;  5AE3 A;  4FXC A;  4BCA A;  3VR9 B;  1DII A;  4USA A;  2K5P A;  1SIJ A;  1B9R A;  4ITK A;  3LLB A;  1JRO A;  3DED A;  2JX5 A;  1E0Z A;  2PKO A;  3P63 A;  2KMM A;  2AX5 A;  1X2G A;  2JQR B;  2MBR A;  3NS1 A;  1ZOY B;  1VQZ A;  3W8Z A;  5HQX A;  1E10 A;  2B76 B;  1FRD A;  3AEF B;  3ABV B;  2PVG C;  3B2F A;  3L4P A;  1ZXI C;  4US8 A;  2W54 A;  2P3H A;  3AB5 A;  1J7A A;  1MBT A;  2BVF A;  3DWG C;  1WYG A;  4XLO A;  5HHZ A;  1L0V B;  2VFV A;  2YVS A;  1JAL A;  3SFD B;  2CU3 A;  1CJE A;  4O95 A;  3R07 C;  3DWM A;  2O3G A;  2BVG A;  1FMA D;  1PFD A;  3AE9 B;  1FFU C;  2WU2 B;  2QJL A;  1AWD A;  1DZN A;  1TKY A;  1JWB D;  1W1J A;  1OQQ A;  1UXY A;  3P4P B;  2CJO A;  1PUT A;  1F0Z A;  2GQU A;  3AE3 B;  1X2H A;  1DOY A;  3ETR B;  3NVZ A;  3B2G A;  1N60 A;  1OQR A;  3W5V B;  1NEN B;  2MJD A;  1N5W A;  1W1O A;  3SFE B;  4MLA A;  2WQY B; 
#chains in the Genus database with same CATH topology
 2D07 B;  1ECW A;  5KT4 A;  3EEC A;  2Z0E B;  1SL1 A;  1C1Y B;  2OAI A;  2INC C;  4JV1 A;  1EU3 A;  3MHS D;  2HOF A;  2PMZ C;  5DG8 A;  1PZN A;  3NZS A;  4ED8 A;  1HQR D;  2BHN A;  2KFZ A;  3DBL B;  2KTQ A;  2J7Q B;  3AEG B;  3UCC A;  3NZU A;  5KT3 A;  4P0Q A;  4DQI A;  2EZZ A;  4QWB A;  4NAW B;  2QAR A;  1UBI A;  3R0K A;  2XEW A;  3P3B A;  5EWG A;  5C2T B;  5J8Y A;  4QZC A;  2R2Z A;  2KJR A;  2KYW A;  3S2A A;  3EGR A;  1OEP A;  5ADZ A;  5HML A;  2YVC A;  1JI7 A;  1BPX A;  1D8B A;  4MGK E;  1WUE A;  1N62 C;  3VRA B;  2W55 A;  1F9J A;  2ZCC A;  1BWC A;  5DLG A;  3IFW B;  3TWB A;  2ZJA A;  1IP9 A;  2UUU A;  1VJK A;  4M2Y A;  2WB1 F;  1P0R A;  4M0X A;  3RFZ B;  3PLU A;  4GB9 A;  1X2I A;  3Q8P B;  2K39 A;  8ICH A;  4YN4 A;  2JZB B;  4F92 B;  1WE7 A;  1GEU A;  1STZ A;  3WKD A;  4K3C A;  2JZP A;  2LVP A;  3O13 A;  1X9X A;  2R18 A;  2WXK A;  3A1Q A;  3ZRF A;  4JX1 C;  3Q4D A;  3I5J C;  4W9H A;  3R1Z A;  5AE1 A;  3UQ2 A;  3S6J A;  4DSJ A;  4R63 A;  9ICN A;  2ISP A;  4K1R B;  4IC7 B;  4PZF A;  2KIV A;  1TFR A;  2K9X A;  3VTV A;  1COK A;  2NRT A;  5U25 A;  2YQE A;  3ORY A;  4RT2 A;  4Z6D A;  3MQT A;  4PYT A;  5IIJ A;  5KFU A;  4O3Q A;  5DDY A;  5AM1 A;  4I27 A;  4F5Q A;  1GC7 A;  1A5R A;  3PWI A;  2XK5 B;  2CHX A;  2HQM A;  2OX4 A;  2ZIV A;  5J2J A;  1JQ4 A;  1BPY A;  4C4R A;  1ZQP A;  2AWT A;  1PGX A;  2KVS A;  2V4I B;  2C28 A;  5CHV C;  3AE1 B;  5KFK A;  5KFS A;  5KFW A;  3ZVH A;  2KKP A;  3UQ0 A;  3FYH A;  2OOB B;  3JPP A;  3IN5 A;  2JV3 A;  4O3R A;  4ECW A;  3DIP A;  4FN2 A;  5CJ7 A;  2FYM A;  2I5H A;  2IMW P;  4ECU A;  2CHR A;  5EU9 A;  2GWS A;  5LXI B;  2EMS A;  3KHL A;  5ALD A;  3BZC A;  1F1H A;  4ZCW A;  1SBB B;  4QZE A;  2VRR B;  3AE6 B;  4EBE A;  2E5S A;  3VDG A;  2EXR A;  4P0P A;  3KHG A;  2UVU A;  2M0N A;  2A1J B;  2KOX A;  3ZVV A;  2JH7 A;  2BKF A;  4YXJ A;  3WAM A;  4BWM A;  4CGZ A;  1ZMD A;  3II4 A;  5FJU A;  4DNS A;  1STE A;  4J1O A;  2FPM A;  2HJ1 A;  2V3S A;  1Q10 A;  1SE3 A;  2ASQ A;  1X6I A;  4TQ1 A;  2PTX A;  2NBU A;  3RR1 A;  3SHQ A;  5EOZ A;  3Q3M C;  1N63 C;  3BDP A;  5ALY A;  2KNB A;  3AE5 B;  2J6U A;  1DOQ A;  1Q8K A;  4B0E A;  4XWT A;  1YX6 B;  2AL3 A;  4TKN A;  3RJ8 A;  2W9B B;  5AKE A;  2C2E A;  2BQQ A;  1UCV A;  4FBJ B;  4DQP A;  4TUU A;  2GRI A;  1JWM D;  2PMZ F;  2F1I A;  2XC9 A;  2XO7 A;  3MDA A;  5IIN A;  3UIP B;  1X9S A;  4IL2 A;  4BC9 A;  3L54 A;  5ALV A;  1GOZ A;  2KV2 A;  3MGI A;  2QKN A;  5EWF A;  2FLL A;  3VH3 B;  2O2V B;  3RNE C;  5AM0 A;  4P1B C;  1UH6 A;  2XN9 C;  3AE4 B;  1TTN A;  4Z6C A;  2AL2 A;  4DF8 A;  2FIF A;  4PS3 A;  4ED3 A;  4E71 A;  2QB1 A;  5AK6 A;  2Y4G A;  5D79 A;  4RQM A;  5J2R A;  1T3Q A;  5LLI A;  1C76 A;  2FUH B;  2K8B A;  2KJH B;  2MBH A;  1S9F A;  3Q8A A;  2AXR A;  1NHP A;  1N62 A;  2HTM E;  4YSX B;  2B0C A;  1PVQ A;  2DNF A;  1EC9 A;  4B0M A;  3ML9 A;  8ICA A;  3P2B A;  3OAW A;  3QU4 A;  3UXP A;  2L1A A;  1WJN A;  2F5Z A;  1NU5 A;  3QFB A;  2FI1 A;  4DLE A;  3SN4 A;  3JPN A;  1YX5 B;  3LYY A;  1ZR6 A;  4HDQ A;  1ZQT A;  5FS9 A;  3QU2 A;  3AU5 A;  2DZI A;  2LRW A;  3VCB A;  3AU4 A;  4KN7 A;  4ELV A;  2R8G A;  4F5P A;  2KZ3 A;  4DXG A;  1A76 A;  2J42 A;  2UWQ A;  3B1L X;  5KAF U;  2C5L C;  2L83 A;  1MBB A;  4BKS A;  2YB1 A;  1NOM A;  3BW7 A;  4UBC A;  3AEV A;  1H4R A;  2WXG A;  4HCP B;  2W9M A;  1V6E A;  4HRS A;  4NAW A;  3PSP A;  1BGX T;  4LNK A;  4YMO A;  3RZW C;  3D2N A;  4W9J A;  1B43 A;  2EQY A;  2PE6 B;  1M94 A;  1L0X B;  3FKY A;  2LFI A;  2Z8L A;  7ICU A;  3APC A;  2I2Y A;  3NRZ A;  2VAN A;  4J9S A;  2PFP A;  2E8M A;  4EBC A;  4F3O A;  4RPX A;  2PLP A;  1ZQN A;  2MJE A;  2J0K A;  3DJJ A;  1GES A;  3PRP B;  1NK6 A;  1EF5 A;  1KJT A;  1YD8 U;  4LNO A;  4RF0 A;  2HHU A;  4F7Z A;  1GPX A;  2E1E A;  4EFO A;  2PP0 A;  2KXJ A;  2D2Q A;  1GRB A;  2J3N A;  3E2E A;  4J9P A;  3BYT B;  2GLE A;  2XBB C;  5DG7 A;  1W1L A;  2H3F A;  1DXL A;  2MH7 A;  1GET A;  3Q3J A;  1FHV A;  3ZVI A;  1JXE A;  4TVY A;  1LQB A;  4M9H A;  1KRH A;  4E8G A;  3BII D;  2QKQ A;  1PQS A;  1KKO A;  3L8K A;  3AQE A;  1VCB A;  4TUQ A;  1DNC A;  5KFN A;  1DOX A;  2PMV A;  4JPS A;  3QFA A;  1F0X A;  2INP E;  3PVL A;  1JPD X;  4Z17 A;  2RDB C;  5KHQ A;  1P48 A;  5DCN A;  1TZ1 A;  2PPH A;  4IQW A;  2KFJ A;  1KFD A;  2LHT A;  2MSE D;  1XSL A;  3FDS A;  5FR3 A;  4M6W A;  3M3J A;  1IV8 A;  4ECS A;  4W9I A;  2N1V A;  2WP5 A;  4HYR A;  3AL0 B;  4YR2 A;  2IBK A;  3TJP A;  2VFU A;  1EWC A;  1TS5 A;  5AK5 A;  3IG5 A;  3LB8 C;  5D46 A;  2XK5 A;  1E8F A;  1ZJM A;  2F77 X;  8ICI A;  3LAE A;  1N63 A;  3G6V A;  3VUY A;  2F1J A;  3MFG A;  2P6U A;  4J9M A;  1C9F A;  1SKW A;  1WFY A;  1XC9 A;  5BO4 B;  7ICV A;  4R3D A;  2PFN A;  4PHP A;  4JN8 A;  3QQ8 B;  3ZO5 B;  4HLE A;  2VA3 A;  2HMX A;  1KSP A;  2BCQ A;  5G2N A;  3PHW B;  2RDG A;  4NEW A;  4DCC A;  3C2L A;  4UB3 A;  1I4Q A;  4YSZ B;  2MJ3 A;  3IJQ A;  2AYO B;  2NQW A;  4HK2 A;  1BZL A;  1W1K A;  3S1F A;  4GLX A;  4B6J A;  1JEH A;  1UGM A;  1FEA A;  4JWU C;  1PYW D;  1MA7 A;  3C1Y A;  2KWC A;  3KKA A;  1HUZ A;  7ICE A;  3A4S C;  1UF0 A;  1WWT A;  2BDP A;  4H4Z A;  4DBG A;  5KFF A;  3JZU A;  4UB8 U;  2I1J A;  2MA1 A;  5DQG A;  3QX1 A;  2GRT A;  2A1J A;  1S97 A;  4HJK A;  2OFJ A;  5CEH A;  9ICM A;  3P42 A;  2HJ8 A;  3N7R C;  4NZL B;  4PK1 A;  4YP3 A;  4AYB F;  4RPY A;  3PT2 B;  2Y5P A;  2P13 A;  1X9W A;  3RAX A;  2BVC A;  3V6C B;  1ROE A;  4QAY A;  9ICT A;  5AKK A;  2BYF A;  3B0Y A;  4YG2 A;  3ZUN A;  1ENF A;  2RPQ A;  2QLT A;  4QZD A;  1OXJ A;  2E1F A;  1RVK A;  3AV8 A;  4TVW A;  2IOF K;  2YX8 A;  2L32 A;  4CDG A;  2ZIX B;  3IT6 B;  2BPC A;  8ICU A;  2ZUC A;  2W9B A;  1GG3 A;  2IOF A;  4EWJ A;  2LYA A;  2HTH A;  5DG9 A;  3HM3 A;  3NY5 A;  4LNN A;  2LJ5 A;  3QYP A;  2LM4 A;  3VA8 A;  4IQT A;  1I4G A;  3TFS A;  1YJJ A;  2KDE B;  3QAQ A;  2Y1I A;  4BBY A;  3R0U A;  3R25 A;  2EDU A;  4RQ8 A;  2LWP A;  1VRA B;  2MEK A;  1ZQR A;  4H4R A;  1WH3 A;  4BOS C;  1QOF A;  2G5H B;  4JV0 A;  2O2V A;  2JRZ A;  3GO2 A;  1HJP A;  2DQN B;  4DWI A;  1U4B A;  1C4A A;  4J3O D;  2HHW A;  4C4V A;  2ONE A;  2M9N A;  3GIK A;  4AOF A;  3RJG A;  4OW0 A;  4RH6 A;  1GRG A;  4EYH B;  3CMM B;  2DPJ A;  2JEG A;  4BXO B;  1TS4 A;  1LB2 B;  4DFP A;  2ZZ0 A;  5E6N A;  2ES6 A;  3ZD9 A;  4FI4 A;  8ICZ A;  1IIP A;  3P4Q B;  2Z59 B;  5AUI A;  4QZ8 A;  3SDL C;  2FPL A;  4HNL A;  1GUA B;  3HRD D;  1L8P A;  3BQT A;  4E4U A;  1HTQ A;  1L7M A;  3VUX A;  1URJ A;  1EBH A;  1KTK A;  1WF9 A;  2ZIW B;  2W3S A;  2N9L A;  4KLO A;  1SZH A;  1MQ3 A;  2LYB A;  3H8M A;  2LJI A;  2Z7J A;  3V4B A;  3BQ2 A;  4MAC A;  1DIQ A;  4AUQ C;  4EKU A;  3NAS A;  4IHC A;  4NQL B;  1K50 A;  3HW8 A;  1E90 A;  4IQU A;  3A9K B;  4M01 A;  2AU0 A;  3DG3 A;  2H3Q A;  2KLC A;  1SKR A;  2A1A A;  2KJ5 A;  1CZP A;  1NK9 A;  1KM7 A;  2OEH A;  1RRB A;  3R8B A;  2IBI B;  3C0P A;  2N7D A;  4OAL A;  1V1P B;  2G4D B;  2KC2 A;  5GTH U;  1IBX A;  2GL5 A;  4JV2 A;  3VC8 A;  3TBL D;  3OJU A;  1HEZ E;  3DEE A;  1MPE A;  5KFD A;  1L3T A;  4OHJ A;  4GYP C;  1WX7 A;  3ONS A;  4C0Z A;  1N5X A;  1UWM A;  2MSN A;  3LB8 A;  3CSF A;  4GDL B;  1RFK A;  3HX0 A;  4ICV A;  3RZF A;  2IO0 B;  2NQL A;  2DKX A;  4DFM A;  2ICI A;  2QEJ C;  2F3N A;  4GU2 A;  2Y5C A;  3RN9 C;  3IV6 A;  2AAQ A;  4DN1 A;  5JCM A;  3CIR B;  3APD A;  3I3T B;  2EAN A;  1NNL A;  1P7E A;  3CB3 A;  4B9S A;  5BYR A;  3CGB A;  3QIJ A;  2KVC A;  5DPT A;  3RNG C;  3AE7 B;  3NVV A;  2WDQ B;  3MGH A;  3H6N A;  3A0B U;  1LV5 A;  5HHD G;  3PG6 A;  4H19 A;  1O03 A;  4NJ7 A;  1XWL A;  4I2G A;  3MKC A;  4A6Q A;  1KFS A;  3Q3O C;  3ZXR A;  2P0I A;  2MAX A;  1RFA A;  5HR7 A;  3T9P A;  1DII A;  1TAM A;  4PT5 A;  4NY8 A;  3SBF A;  3WU2 U;  4P4O A;  5KFY A;  4YCX A;  1SWV A;  2ZZC A;  5L83 A;  5KNI A;  1Z2M A;  4JE3 B;  2KN7 A;  3R7Q A;  5KL8 B;  1U48 A;  4BZA A;  2EH9 A;  2KKV A;  2D11 A;  3KOO A;  3ISC A;  4KMU A;  1NJY A;  2MU2 A;  3MR2 A;  2JX5 A;  4MH0 E;  5ALZ A;  4B9T A;  2JMG A;  3LWM A;  1BXT A;  1Z5S B;  3OSP A;  2KMM A;  1X2G A;  2JQR B;  2MBR A;  4C8N A;  2NS5 A;  4KLG A;  5J2B A;  9ICE A;  2KFN A;  3NS1 A;  3Q3N C;  3PPA A;  1VQZ A;  3W8Z A;  1E8Y A;  1TAU A;  2ASL A;  1AQ6 A;  4IT1 A;  3M9O B;  1ZQA A;  3ISB A;  4NLK A;  3T3O A;  3WKB A;  2GBJ A;  3V5C A;  2J53 A;  2BTE A;  3EAO A;  3WIM A;  4G0N B;  1MRA A;  4PWC A;  3ABV B;  3KUC B;  4EMJ A;  2V3A A;  2NPT B;  4DQR A;  4RQ7 A;  4QJF B;  4I2B A;  2C7H A;  3ZNH B;  4JB3 A;  2X99 A;  3CRX A;  2P3H A;  4NWI A;  4I2J A;  3JPR A;  5KFR A;  3TSH A;  3L3F X;  3V6E B;  3V3X A;  3RRH A;  1MBT A;  2LGY A;  9ICH A;  1ZOL A;  1EC7 A;  3DWG C;  4UB6 U;  3NUH B;  3WKA A;  2V4Q A;  3SZ2 A;  3QKE A;  4YXM A;  4KPR A;  4EMW A;  2D8C A;  2XSX A;  3WAO A;  1PK1 A;  2X8C A;  1L0V B;  2WF8 A;  2YVS A;  1XT9 B;  3BYY B;  3C5G A;  3SD7 A;  3BQ1 A;  1YIW A;  1S10 A;  3DBS A;  1XO1 A;  1QZE A;  1BPD A;  4M0W A;  9ICP A;  2O3G A;  1HA5 A;  1TYP A;  1FMA D;  8ICG A;  1L0Y B;  3ZLG A;  1WWV A;  2L7R A;  2GBN A;  2ZIX A;  2V3P A;  3RF9 A;  3BQ0 A;  5ALG A;  2DZK A;  3OSN A;  2LM1 A;  2MBB B;  2QJL A;  4HXD A;  3BVM A;  3QUT A;  3JW7 A;  4M9N A;  1DK3 A;  2WNM A;  3EKG A;  5AKL A;  1OQQ A;  4DHJ D;  4LJP B;  2D3C A;  1RYS A;  2XH7 A;  8ICV A;  4H2H A;  2E8N A;  4PL1 A;  4M9J A;  3M8R A;  5BPC A;  2K4H A;  4DSI A;  2KAC A;  2LGI A;  4MJS B;  2JEI A;  4PGX A;  3AE3 B;  2GGJ A;  2OYY A;  2OLA A;  3HPF A;  2ZIU B;  2DYO A;  1DOY A;  4F8R A;  3UGB B;  1X2H A;  3EPG A;  3GC2 A;  2JWZ A;  4EQS A;  3RH6 A;  2RGF A;  3SSZ A;  4OJ5 A;  4UB2 A;  2RMM A;  4JL9 A;  5C23 A;  5ALQ A;  4BXO A;  4EEW A;  4GYP A;  4UAV A;  2GBK A;  3GZF A;  1FEB A;  4MGI E;  2WHE A;  1YOV B;  5DPS A;  3ZJU A;  4NJ6 A;  2PP1 A;  3WK5 A;  3N4M B;  2JVC A;  2BR0 A;  4H4V A;  1V49 A;  4JN7 A;  5BOM A;  1K8R B;  3C23 A;  2ZIW A;  4FZN A;  3DHH C;  3Q45 A;  2KJ9 A;  4XQ8 A;  5D49 A;  3I57 A;  4K3B A;  3SD5 A;  2FLN A;  1IYX A;  3B9J B;  1D4B A;  1WZ3 A;  4RQ2 A;  4G11 A;  5LNK 1;  3I28 A;  4KLE A;  3N4E A;  3ZLF A;  3W8W A;  3F2D A;  1KFY B;  3L13 A;  2FAZ A;  4E0D A;  5A0L A;  9ICW A;  2N0S B;  3VCN A;  1UA0 A;  1NKB A;  4P6V F;  4YL8 A;  2YVJ A;  4EBD A;  2H88 B;  2D3B A;  3QU5 A;  3RNC C;  2P6R A;  2NR2 A;  2W82 A;  1SJB A;  3KUD B;  3KZX A;  4ZRJ A;  1UD7 A;  4BVU C;  5KFG A;  5ALF A;  1VZ6 A;  2BGF A;  3NRW A;  2HOI A;  3NXL A;  4M00 A;  4XRH A;  4GDL A;  3NVW B;  3OTQ A;  1XLN A;  3D2J A;  1JCK B;  2Y3A A;  4FAD A;  3TSS A;  5J0R A;  4D2K A;  1E8W A;  3U30 A;  1Q1R A;  5AKH A;  1L7N A;  3U4E G;  1OJT A;  3CGD A;  2TSS A;  1ZQJ A;  3X0W A;  5KL1 B;  1VLB A;  1R4N I;  3RNA C;  4PH5 A;  4NLC A;  4NM2 A;  2PA6 A;  2WDR B;  4H4X A;  1LKY B;  2IHM A;  3TKA A;  3BJS A;  1YQ3 B;  2EMT A;  1YNT E;  1L7P A;  5JRT A;  3RJK A;  1SIF A;  3GOE A;  5JU5 A;  2RDH A;  2E6X A;  5HHH A;  3PV1 A;  3ENL A;  2MBO A;  2BGW A;  2FMS A;  2YVF A;  3I76 A;  2GSH A;  2DZM A;  3AE8 B;  3UJ2 A;  2GBM A;  5KFM A;  3BK2 A;  4YR3 A;  2RDJ A;  2RHF A;  4QWD A;  3I63 C;  1FO4 A;  3RJF A;  1VZ7 A;  4F8C B;  2PU0 A;  3MP9 A;  2QAE A;  3MC1 A;  4DEZ A;  4O3N A;  2VIX A;  1RXV A;  1TKE A;  4K4H A;  1QCK A;  1E8X A;  5J0T A;  4ARC A;  2B21 A;  3T4W A;  3ONN A;  4UD8 A;  5FR6 A;  2WB1 C;  1RQL A;  2V4R A;  5DBA A;  1ZY8 A;  5AZG A;  1T8E A;  1HE8 A;  4LTU A;  1FM0 D;  2O6V A;  4HWI B;  3GQC A;  4YMM A;  1CUK A;  2AH5 A;  2QB0 B;  2XVT A;  5J2E A;  1RZT A;  4KLQ A;  3Q8F A;  1QLN A;  4C00 A;  5IDZ A;  2G5I B;  4BV6 A;  6ENL A;  2EQ7 A;  4RQ5 A;  1ZMC A;  4MFC A;  2K1F A;  1NK5 A;  2PPG A;  2G0A A;  1GV4 A;  4W9G A;  1ZQX A;  1L8O A;  5J18 A;  4C56 C;  1RM6 B;  3HWT A;  2NTT A;  4NNJ B;  4KN4 A;  2LI6 A;  1J2N A;  3APF A;  1LVH A;  9ICO A;  3AUL A;  4ZA0 A;  1ZDX A;  2FUG 1;  3QWZ B;  4L23 A;  4O3M A;  3PS6 A;  4M8M A;  2KHV A;  3IJL A;  3DEQ A;  2GOL A;  3LAD A;  4OJ6 A;  2AHO B;  2WXJ A;  2Q5W D;  4Q8F A;  4RM9 A;  2OZT A;  1L3V A;  1R7S A;  4YWG G;  2G07 A;  5T8I A;  3PW5 A;  1JXL A;  3QX7 A;  2P35 A;  1SXE A;  5CB1 A;  3E58 A;  8ICM A;  2AQ2 B;  1U47 A;  2H89 B;  3FC4 A;  4HAI A;  1R4N B;  4B6W A;  1WRD B;  4H50 A;  1CMX B;  3P4S B;  3MTN B;  4JLC A;  3MHZ A;  2FMP A;  2WPC A;  2QSD A;  2KTR B;  1V2Y A;  3IHP C;  1NHR A;  2FE8 A;  4R8U B;  1PVR A;  2OWO A;  3SAF A;  2FCN A;  1Z3E B;  2INN E;  4OZA A;  3NZG A;  1W1M A;  3PQB A;  4OZC A;  3NO1 A;  3RCZ A;  1W1R A;  1FFV C;  2K8H A;  3VH4 B;  4NV0 A;  2FNJ B;  3D47 A;  3OHA A;  4IDI A;  4DL2 A;  4QZI A;  4UAT A;  3MC0 B;  3NVY B;  1QH9 A;  1RM6 C;  2CDU A;  2IGG A;  3N7S C;  3L10 B;  1D7Y A;  5KT2 A;  4US9 A;  1GJZ A;  1SWW A;  3DPD A;  1ZQB A;  4HCL A;  4MJS A;  4C8O A;  4PYU A;  2C3D A;  2KSO A;  1P3Q U;  4KSK C;  5AHX A;  3RJI A;  1WGG A;  2ZIU A;  4JHM A;  1D9F A;  3NS8 A;  3DK4 A;  4K4G A;  3MDC A;  3AU6 A;  3M9N B;  3NUQ A;  1E0Y A;  1UA1 A;  2XIC A;  2W9C B;  2KLG A;  3BS7 A;  2DEN B;  2XH2 A;  2KVR A;  9ICR A;  4J56 A;  5L6F A;  1FEH A;  1E5W A;  4FJZ A;  3N9Y C;  4Q44 A;  4YWS A;  4BUR A;  4PWB A;  3H7V A;  3PNC A;  2WF7 A;  4ZRI A;  3KTQ A;  1L5U A;  4ICA A;  3QZ8 A;  3RBE A;  2KO3 A;  3PTF C;  1JWA D;  3URH A;  3N28 A;  3MWC A;  4KWS A;  4QWE A;  1TYG B;  3GZN B;  5J2H A;  1MC8 A;  5KFH A;  4WAA A;  3ZKJ C;  3BS5 A;  3I6E A;  2YMQ A;  2GH1 A;  5DQH A;  3J9C A;  1ECQ A;  1F3P A;  1GER A;  2EAM A;  4YSY B;  2WAQ C;  1HTO A;  1RYJ A;  1MHH E;  4E4F A;  3K9O B;  7ICG A;  3EHV A;  5ALP A;  3RH5 A;  4KVG B;  1K5O A;  2F2A B;  3CST A;  1V97 A;  2LYH A;  1F77 A;  2N9K A;  1BUI C;  1TK0 A;  5AIC A;  3QU9 A;  4FS2 A;  2QDF A;  1KQQ A;  1XLQ A;  1WUD A;  5E6O A;  3C5F A;  3VCC A;  2LUE A;  5F9L A;  2D10 A;  3G6Y A;  3WAN A;  4RQN A;  1I4P A;  5JCN A;  3JSV B;  2PW9 A;  4F5O A;  2HBJ A;  5HHI A;  5JCL A;  5FXE A;  4CF3 A;  2DAF A;  2BKE A;  2I6X A;  5EE9 A;  2MW5 A;  1YN5 A;  3Q8Q B;  3DCG A;  4QWA A;  5AEK B;  1E9I A;  4LII A;  1JRU A;  3RNM A;  5HMR A;  3WA0 A;  5J17 A;  5AZF A;  4W9L A;  4FHJ A;  3OHB A;  1WR1 A;  2L00 B;  1T0R C;  4A8E A;  1ZX9 A;  1MFW A;  3H9D A;  1ZXI A;  3ZJT A;  1LKY A;  1ZD5 A;  3GII A;  4J9N A;  3W1S C;  3KUM A;  5K4L A;  3NGD A;  4TMA B;  2W7O A;  2KQ7 A;  3N4F A;  2BQ3 A;  2AL6 A;  4ECQ A;  2KDF B;  3E56 A;  5JTI A;  4N59 A;  2HSZ A;  3TCA A;  3IDW A;  3OTR A;  4GFI A;  3B97 A;  4O9M A;  1SGH A;  2BPS A;  4O3S A;  3KD3 A;  3D46 A;  4H2A A;  3L5K A;  1DYQ A;  2W7P A;  2PU1 A;  3IVF A;  1E7V A;  4DYE A;  1J97 A;  3T3F A;  3W8X A;  4FZL A;  2LMC A;  4O5K A;  2R8H A;  5CHF A;  4ECY A;  3RTV A;  2KKC A;  1RWS A;  4P7I A;  3H7P B;  4A3P A;  2AKM A;  2XH4 A;  3TEW A;  3DGZ A;  3CF6 E;  4WJQ A;  5IP4 D;  3M8S A;  1K52 A;  2ZUB A;  2DUY A;  4L1B A;  4ECT A;  3RPF C;  2PTW A;  2WOV A;  4EEK A;  4DOA A;  2QB0 A;  2ZVO A;  4P4M A;  4BAX A;  1NI3 A;  3PZD A;  1FXI A;  3R66 C;  1NEL A;  3HRD C;  1FFV A;  3UIO B;  2MBQ A;  2ALZ A;  4EZ9 A;  4QWC A;  3OJ3 A;  4TV3 A;  5KFT A;  4WIP A;  4IM0 A;  1D3Z A;  3MR3 A;  1YEY A;  1OGW A;  1KLV A;  3F2C A;  4MEY A;  1ZKH A;  4A6G A;  1RG6 A;  3N7P D;  4BKT A;  1XS9 D;  5D3D A;  1V59 A;  3TAD A;  1QQ6 A;  3M9M B;  5CTR C;  3ZDA A;  1SE9 A;  3DJG X;  1TZZ A;  1S7M A;  1UHU A;  4XGA B;  2HXU A;  4NJC A;  1T94 A;  3IT4 B;  3FIL B;  5FJR A;  3F5A A;  1QTM A;  4O0I A;  2N7E A;  2C2R A;  9ICJ A;  4G8T A;  2JXT A;  3C21 A;  1K4Q A;  3ZLH A;  2Y3S A;  2DYB A;  2IO2 B;  1V85 A;  1BPZ A;  9ICI A;  1KN5 A;  1VZ8 A;  4LJO B;  4K4I A;  1KKR A;  2KTR A;  4RUC A;  2OKT A;  2J0M A;  1TYT A;  1K53 A;  3UJF A;  4R8U A;  3PX6 A;  1FCC C;  1ZQZ A;  3DG6 A;  3KVF B;  8ICT A;  3HW2 A;  2PGE A;  1S1Q B;  1BVS A;  3NVY A;  4KLU A;  2WAQ F;  7ICN A;  4YWO A;  1MOK A;  1TE2 A;  4I6L B;  2UYZ B;  2VZK D;  3ETR A;  4KKJ A;  4DSL A;  4MFA A;  5AKJ A;  2N4F A;  2LPE A;  2MUT B;  2ZC8 A;  1TY2 A;  1C20 A;  4HKZ E;  1Q1O A;  2WPF A;  3QUB A;  3ZDC A;  1ET9 A;  4O1N A;  2MP2 B;  1YJI A;  4AYB C;  4IRD A;  2LRU A;  4IM3 A;  3MSY A;  4LDT D;  4Q8E A;  3F5E A;  9ICA A;  2M56 B;  3N20 C;  4IG7 B;  3GRT A;  1M4V A;  2LD9 A;  1FRR A;  4UAS A;  1T3N A;  4AJW A;  2KIW A;  1JIH A;  3HJE A;  4XX5 A;  1NYR A;  1JUD A;  4W9E A;  2OQH A;  3O0H A;  4BKG A;  4H4Q A;  4HNC A;  4XC2 A;  1GXF A;  4KLM A;  1E9M A;  4G3I A;  4K8D A;  1KOT A;  2KN5 A;  5HI1 A;  3ZDM C;  2UUV A;  1WG8 A;  1Z4O A;  1DOI A;  2BS2 B;  2K22 A;  3DK8 A;  3U7Z A;  4LZD A;  3EA6 A;  3ZQ4 A;  3W1S A;  4DL6 A;  1ET6 A;  4KMO B;  1WCL A;  4LJX A;  3TAP A;  4QZF A;  1U49 A;  4GN1 A;  2PI4 A;  2KFK B;  3AI5 A;  1BQG A;  4HPN A;  4GOC A;  2DLB A;  3UXN A;  3RT3 B;  2NYV A;  3IG3 A;  4IR1 A;  4XUS A;  4Z6F A;  1I4X A;  1Z19 A;  3AMZ A;  1IGD A;  1ZQF A;  4X57 B;  1T7P A;  4DHJ B;  5JCK A;  1WMH B;  4KGS A;  3FW9 A;  4F4Z A;  1NJZ A;  3BK1 A;  1OW5 A;  2W9A A;  4IR9 A;  1WXM A;  2PIA A;  3BVG A;  4MSQ B;  4EE2 A;  3H70 A;  3PW0 A;  3A7R A;  2RAB A;  4LK0 M;  5JZE B;  1MSW D;  3JSV A;  4ED7 A;  4HCD A;  1BNO A;  2DF4 B;  3ZDB A;  1SL0 A;  5C0Y A;  1SXT A;  3LDZ E;  2KIC A;  3VXW A;  3BIN A;  3QU7 A;  1WVE A;  4KPL A;  2KJ6 A;  1ESF A;  2X8G A;  1D5M C;  3FYY A;  2JZB A;  3TQ1 A;  1TV9 A;  5ALU A;  4BBN C;  3QLD A;  3PSF A;  1OEY J;  3TMP B;  1NDA A;  3A9J B;  9ICQ A;  1BKH A;  2KWV B;  2N9P C;  1LM8 B;  1Y8R C;  2R8J A;  1S8O A;  4WUR A;  3GY1 A;  4NPN A;  5DBB A;  1ZQD A;  4GMV A;  5CHW A;  4DF4 A;  2RP5 A;  5TR3 A;  2YVG A;  1TZO A;  3H4B A;  3V05 A;  1KLG D;  1AHV A;  4HKQ A;  1ONE A;  3ZGZ A;  5J0O A;  1RLF A;  4Y2U A;  1XLO A;  1J0G A;  5KFP A;  3D2H A;  1RQN A;  2PSN A;  4JUZ A;  3RB3 A;  4O5E A;  1ZQH A;  4BCA A;  5AE3 A;  2I1Q A;  4USA A;  4RU9 A;  4ED1 A;  1YJ1 A;  3UXK A;  2RDI A;  3LDA A;  1TK5 A;  2K5P A;  4F5R A;  1SIJ A;  2IHN A;  4NXZ A;  4ZDV A;  2JZ3 B;  4PVH A;  4W9K A;  4DDI D;  3RIT A;  3S47 A;  2BC1 A;  3LLB A;  3GU3 A;  3RR7 A;  1E0Z A;  2FPK A;  2Y0S C;  2PKO A;  5AWV A;  3H7P A;  3P63 A;  2GR0 A;  8ICY A;  2AX5 A;  4U6P A;  2X8X X;  4F72 A;  4LCD E;  5I4D A;  2WDT B;  3RAQ A;  1U4A A;  3MFI A;  1KN0 A;  2JGA A;  1P7F A;  3CXB A;  4KLF A;  1W6T A;  2AXT U;  7ICL A;  1WXV A;  2G45 B;  3ISD A;  2QQ6 A;  3QEB Z;  2B76 B;  5AM5 A;  2M1M A;  4JIO U;  4MEX A;  4DS4 A;  2BCU A;  2ZJ5 A;  2NVK X;  4P4P A;  3L4P A;  3KWV A;  1XO0 A;  1LGR A;  4KLI A;  3E0F A;  4US8 A;  4MM3 B;  5DPR A;  4DXK A;  3AXC A;  3NG0 A;  2WQY B;  1ZE3 D;  2BKR B;  1SE4 A;  5FS8 A;  4GGB A;  1KLN A;  4FBU A;  2BVF A;  2L76 A;  2R2O A;  3DG7 A;  3VTE A;  3URY A;  2NO5 A;  2WYQ A;  4PZN A;  4F91 B;  5J2K A;  3EAN A;  5C1Z A;  3DV9 A;  3AQF A;  4J9O A;  4I2C A;  1AAR A;  1C4C A;  2VFV A;  1JAL A;  2LXC A;  3SFD B;  4RQ0 A;  3RJH A;  3TAC B;  4HPL B;  2OQY A;  2OCE A;  5B66 U;  1VR9 A;  4ANX A;  3UJS A;  2IO3 B;  3DWM A;  5ALN A;  5HG2 A;  1Z1V A;  1S0M A;  2ZNV B;  5HFY A;  2UVR A;  4EUT A;  2MBE A;  1UUP A;  3X23 A;  3AE9 B;  1WXS A;  3V6J A;  2P3Z A;  3SI8 A;  1LXD A;  4HDO A;  5J29 A;  2N1W A;  4IKG A;  2NRX A;  2LXA A;  3DK9 A;  4BDP A;  4GXK A;  3MC8 A;  3U52 E;  1F52 A;  3T3N A;  2FKP A;  2HDO A;  1D9D A;  1XXG A;  2WXP A;  3P4P B;  4IW0 A;  4NLZ A;  4AJY B;  2ZJ8 A;  1Q3U A;  2NPX A;  1F0Z A;  2Y9U A;  5FS7 A;  4E5T A;  4M9L A;  4RNM A;  4I2H A;  4QW9 A;  5J2F A;  5KT6 A;  2ASD A;  2VJ4 A;  2W8L A;  1PUZ A;  4Y2Y A;  2MP2 A;  1NJW A;  4NJ8 A;  2LVO A;  2V1Y A;  8ICB A;  1P1A A;  3PX0 A;  3B2G A;  2KHW B;  1O08 A;  4NQK E;  2V0G A;  2ZW0 A;  3GE8 C;  3WK7 A;  4DWD A;  2A5U A;  3PZP A;  1ZQE A;  4MF2 A;  1NEN B;  2WXL A;  1WXA A;  2G09 A;  2MWS B;  4RM8 A;  4BBN F;  2WXI A;  3PW2 A;  3PR4 A;  1KKX A;  2ZNV C;  3MFH A;  4MLA A;  3UMC A;  2FJ6 A;  4UW9 A;  9ICS A;  3H4K A;  3TWA A;  4O5C A;  5KFA A;  2WLB A;  1MDR A;  4J9R A;  1XSP A;  1I4H A;  1UPH A;  2NTS A;  5J0X A;  4RZR A;  4RNO A;  3EF6 A;  4PVJ A;  1V38 A;  3V6K A;  3ZNI D;  3MR5 A;  1QOB A;  3PO0 A;  5HKH A;  1FNU A;  1FIQ B;  3CAW A;  3V3W A;  5FKA C;  4IRK A;  3KZI U;  3C8Y A;  5FXD A;  1X1M A;  3EUB 2;  2KFK A;  3TX1 A;  4GDK B;  3N6J A;  4NLB A;  2D6F C;  5FS6 A;  4EOY A;  1XDI A;  2IA6 A;  2K4E A;  1YN4 A;  3QK0 A;  8ICS A;  2K4I A;  2L52 A;  2SEB D;  3JW0 X;  4G7F A;  2MRP A;  2Y0S F;  1T5X D;  2AQ3 B;  1DGJ A;  2PFQ A;  2R8I A;  1E8Z A;  2JZZ A;  3T9L A;  2G06 A;  5AKG A;  1I4R A;  4N58 A;  4ZYS A;  4JWM A;  2DHZ A;  1ACC A;  3GRS A;  3H7I A;  3JPS A;  4ECX A;  4FLH A;  3UXL A;  2BVH A;  4CE6 A;  4J9Q A;  2CXY A;  3RFA A;  3PMN A;  3A9J A;  3TEX A;  1GSN A;  2WGS A;  1L6N A;  4FA6 A;  4Y2R A;  4EZ6 A;  1P9D U;  3KWL A;  3QXG A;  3Q8L A;  3KUZ A;  4NY0 A;  2RLT A;  4I6N B;  1BNP A;  3UF8 A;  4E74 A;  4JDR A;  3VTU A;  1FXA A;  2LKY A;  1ZQC A;  3MJW A;  3M62 B;  4KX6 B;  4DL7 A;  1LFD A;  4KLH A;  4KZC A;  3FXG A;  3FW7 A;  2QCZ A;  5KG7 A;  5JH5 C;  2VFT A;  2UVV A;  3ALR A;  2KN4 A;  5IN7 A;  4IC9 A;  3ZDD A;  2VJ5 A;  1TKG A;  1MNS A;  1XAN A;  4KZ0 A;  4MH8 A;  4HG0 A;  3OGU A;  4HN8 A;  4ROP A;  3Q6J A;  2AJQ A;  3Q8R B;  4G9B A;  2LGX A;  4F93 B;  3V72 A;  3LXF A;  4EZK A;  2WP6 A;  4BC7 A;  2C3C A;  1NZP A;  2IDY A;  4IS7 A;  4ZH4 A;  1DXS A;  2NRW A;  3WAL A;  2HZG A;  4S17 A;  3BZD B;  2YY6 A;  2YQU A;  1N6Z A;  2WX1 A;  3SU8 X;  5D2M B;  2JYE A;  2KE7 A;  3R10 A;  2H3V A;  4BGD A;  2N9X A;  4BFR A;  2AL1 A;  3ZDE A;  4F5N A;  2ZW1 A;  2QJN A;  2OZ8 A;  3HUI A;  2NO4 A;  5B5E U;  2C7N B;  2KX3 A;  3DOW A;  5GTI U;  3DVN U;  1KBU A;  5KFZ A;  4EQW A;  1XNS A;  3M6K A;  3TTE A;  4EQR A;  3W9C B;  1L7O A;  2PEA A;  1JDF A;  4J9K A;  4UAZ A;  1SJC A;  2ZCB A;  5AI5 A;  5F9N A;  3VAW A;  4NL9 C;  3OLM D;  1SKS A;  5IA7 A;  1OFF A;  3DGH A;  1F44 A;  3G6X A;  5L1K A;  1WUF A;  2BC0 A;  4DQS A;  5AI0 A;  3O0F A;  3M95 A;  1TVA A;  7ICR A;  4APN A;  4M8N A;  2BCR A;  4UBB A;  3V7K A;  4AWJ A;  8ICX A;  1QOG A;  3OG5 A;  1AW7 A;  1X42 A;  5CWR A;  9ICG A;  5C5J A;  1ZQG A;  2E5A A;  4TQ0 A;  1Q46 A;  5E6J A;  5DDM A;  4JQ9 A;  1PK3 A;  1WJU A;  2Q85 A;  1X6J A;  3SAG A;  1DRG A;  3S1D A;  1JWU D;  4CF4 A;  1QQR A;  1KRP A;  2HOQ A;  4CRX A;  5U1O A;  4ZHO A;  4JB1 A;  1NKE A;  4A3O A;  1U45 A;  1QSY A;  2KC1 A;  3PZ8 A;  3QC8 B;  3I9V 1;  2Y08 A;  2DZJ A;  3KBB A;  2D3A A;  5MPO A;  3DFY A;  4RMA A;  3ECI A;  4B9K A;  2VFR A;  2GB1 A;  1E7P B;  3PLV A;  5G5G B;  2BB5 A;  3HM6 X;  4HPP A;  2WFA A;  2A3V A;  2G9H D;  3DDC B;  3UXO A;  3C28 A;  2CRX A;  1TS3 A;  3VC6 A;  1S0O A;  3DBH I;  4K7W A;  4TUP A;  3L0W B;  2D5G A;  2KEY A;  2AQ0 A;  1ZPS A;  2IYD B;  4NLN A;  2OHF A;  4IWQ A;  4TSS A;  5HMM A;  4QZ9 A;  2FBW B;  2LI5 A;  1R0M A;  4EC3 A;  4RFB A;  4MDK E;  4MSM B;  2ZZB A;  2OG9 A;  1FPY A;  4QIW C;  2W04 A;  3CYM A;  2NVU I;  3AE2 B;  3KLJ A;  3RO6 A;  4A90 A;  4J9L A;  3EWA A;  3C29 A;  1UZX B;  1WVF A;  4MT5 A;  4XDC A;  4KLJ A;  5TIS U;  1H2I A;  4I6P A;  2JYT A;  3BQ7 A;  5BOE A;  4ZYN A;  2R2Q A;  2W8K A;  1F2R I;  2BS3 B;  2C7M B;  4GR1 A;  1A6S A;  2M19 A;  3CNH A;  3ZYY X;  2VA8 A;  4RQ6 A;  2ZTE A;  2HE7 A;  3ZIM A;  4FS1 A;  1NEK B;  4R65 A;  4QZH A;  2BYE A;  5KG1 A;  2J4X A;  3H1U A;  1NPX A;  7ENL A;  2IZV B;  1NK0 A;  2J6T A;  2JF5 A;  4MEM A;  4WQO B;  2Q0Z X;  2Y5B B;  2QIE B;  3RB4 A;  1XF5 L;  3A9K A;  4RUA A;  3VRB B;  2GGG A;  3SQP A;  2AQ1 B;  3LVW A;  2W43 A;  3MY9 A;  1FIQ A;  1EWY C;  2M0X A;  3RJE A;  3SQS A;  4LLG M;  1AOG A;  2NRZ A;  3PY8 A;  3T5J A;  3UJR A;  1V1P A;  1QKZ A;  1Z1B A;  1QLB B;  4GXI A;  4GDK A;  2CHZ A;  1BML C;  4WJP A;  1QQ7 A;  5J2I A;  4PYZ A;  3FM9 A;  5KT5 A;  2OPJ A;  3EEZ A;  3TAR A;  4IL0 A;  2VZK B;  3N1Z C;  3ED5 A;  3HHM A;  4KIK B;  4X5V A;  4IP4 A;  2CJN A;  4AP4 C;  5J04 A;  3SEB A;  5AK4 A;  4F50 A;  5D7G A;  5BOL A;  1M6I A;  4A20 A;  1QSL A;  2X50 A;  4YQW A;  4LDT B;  2K6D B;  4FO6 A;  3DBH B;  2V3B A;  2XH0 A;  5ALW A;  3MZN A;  3NJT A;  3J81 j;  2XNA C;  4OJO A;  8ICK A;  3IK4 A;  3RGT A;  4KX5 A;  3FWA A;  2MQJ A;  2GQW A;  2DAJ A;  1GB4 A;  3WAP A;  2WXF A;  4P1C C;  4IL6 U;  3K1Z A;  4BOZ B;  2DW7 A;  3IC9 A;  5KG2 A;  3QE9 Y;  2FID A;  2JHD A;  3AU2 A;  4NL9 A;  2KDM A;  1E8G A;  2BYV E;  3CWI A;  2WHI A;  4YXD B;  3BZK A;  2HW3 A;  1MUC A;  1ONF A;  1JW9 D;  3S1C A;  2GLS A;  3GIJ A;  4KGT A;  2YAU A;  2EQ6 A;  2OED A;  2P4P A;  5KG3 A;  2ACZ B;  2YMP A;  3SYZ A;  3A1Q B;  4C4S A;  2L0T A;  3Q8K A;  1A77 A;  4YVZ A;  3D2Q A;  4W9C A;  3SV3 A;  4XDD A;  3DQ0 A;  5HP4 A;  5EE0 A;  2XID A;  4GC6 A;  4WQM A;  1NBF C;  5D6J B;  3TEZ A;  2RPV A;  1QF6 A;  2DW6 A;  4N6E B;  1UGJ A;  1WGD A;  4A9A A;  4EM3 A;  5J8Y C;  1ZQW A;  2KX0 A;  3NFU A;  3TSJ A;  4MHV A;  3CGE A;  2KJ8 A;  1V5O A;  1XO3 A;  1PDY A;  2VH1 A;  4EEL A;  2POZ A;  3KH0 A;  3GE3 C;  1C7Y A;  4O3O A;  3WCQ A;  1WY8 A;  2IY1 B;  2NPT A;  5IKC M;  4UAR A;  5J0Y A;  2QDE A;  4F4X A;  5AK3 A;  4KDI C;  1ZQK A;  3VFK A;  3AH7 A;  1NHQ A;  3DER A;  3TEY A;  2IO1 B;  1Y88 A;  1QLT A;  3UJE A;  3MBY A;  1NK7 A;  2WXH A;  1GRT A;  2PVO D;  3IM1 A;  4ARI A;  2HCF A;  9ICC A;  4QIW F;  4M47 A;  3W5U B;  3CP8 A;  2Z0D B;  2GR2 A;  2W0H A;  2XCA A;  5JUM A;  1L7Y A;  3TL5 A;  4ECV A;  3H8J A;  1UWX A;  3JPO A;  5IIM A;  2YEP B;  2KDI A;  4H4S A;  3A7A A;  2XI9 A;  2YLM A;  5KFJ A;  3BSM A;  2JT4 B;  3QA8 A;  2HBM A;  3GD3 A;  3RJJ A;  3M1Y A;  1KF6 B;  1NYQ A;  1SJA A;  4GFJ A;  2W11 A;  3AUO A;  7ICF A;  2WDW A;  1OUQ A;  4WJ3 B;  4KSL C;  9ICU A;  4PVE A;  3R2T A;  1V80 A;  4IUM B;  2DGZ A;  5J2A A;  4FFD A;  2JPH A;  2LUM A;  1XLP A;  3DBL I;  3ES8 A;  4Y2X A;  4G50 A;  5J2C A;  3ZJV A;  1WRI A;  4ZHP A;  4C7Y A;  3UMG A;  1KFT A;  3ZTC A;  5G5G A;  3RRG A;  2WP9 B;  2M17 A;  1XU4 A;  5BMH A;  3PM9 A;  1W1S A;  3C2M A;  3A7U A;  4GGH A;  4KLT A;  3QHT A;  2FDR A;  5CHG A;  5JHA A;  2HHX A;  2KP7 A;  3R2I A;  1K1S A;  3EPI A;  1N56 A;  1GRA A;  2GO7 A;  4PHE A;  2I5Q A;  2V6O A;  3TOY A;  5J0Q A;  5ALE A;  5L1I A;  2FE9 A;  2H5X A;  3DFH A;  4M52 A;  3U4F A;  1ZQI A;  1KEJ A;  2K4P A;  4REZ A;  2OZ3 A;  1IPG A;  4DNA A;  3SEN A;  3SN1 A;  2KMD A;  5KFX A;  5KG5 A;  3O65 B;  2HVH A;  4DL3 A;  4BWJ A;  3NOB A;  4B95 A;  4S0R A;  3NVZ B;  4GRT A;  4DL5 A;  4URK A;  4ACO A;  5DB8 A;  3SEI A;  3MUC A;  4CNQ A;  1J19 A;  2KWD A;  3RMK C;  4HEA 1;  3S1E A;  3OJ4 B;  5FK9 C;  2PMQ A;  2PS2 A;  4J03 A;  1FEC A;  3HPO A;  1NZB A;  3P4R B;  3B9J A;  2L05 A;  1RDF A;  1ELS A;  2LZ6 A;  4A35 A;  3P93 A;  5DBC A;  4DQQ A;  4HJG E;  1P43 A;  2N9E B;  5BOF A;  3JVA A;  5L6G A;  2EEL A;  1NKC A;  5KFQ A;  2N1R A;  3LVV A;  4MF8 A;  2PE9 A;  1SV4 A;  1AN8 A;  1NVI D;  3AN1 A;  3D6J A;  5L1M A;  4KGR A;  1XEE A;  4C8K A;  4PJ0 U;  3MR6 A;  3SMV A;  1B0X A;  4B9M A;  3S5S A;  2W3R A;  4EM4 A;  2Y3R A;  1WM3 A;  2RDX A;  3RCY A;  4F2S A;  4JWN A;  3KJM A;  3SV4 A;  4YTN B;  2DL0 A;  7ICJ A;  2MUC A;  4RT3 A;  3QEA Z;  5BMI A;  1ZQS A;  4CF5 A;  2K0P A;  1PDX A;  4KIK A;  1Z4N A;  3NVW A;  1Q1W A;  2ZEQ A;  4TUR A;  3OZM A;  3EC8 A;  2K8C B;  2LGD A;  2HHS A;  4YMN A;  2KG5 A;  2KMC A;  5JCI A;  2F8L A;  1SZP A;  9ICX A;  2LHD A;  2HBK A;  1T3Q C;  1EF1 A;  4ZRP A;  1ZQO A;  1WZ0 A;  1WXQ A;  2A19 A;  2O6V D;  3PRZ A;  1TJE A;  4KT2 A;  2OM6 A;  3NRZ B;  3MGV A;  2GR1 A;  2CN1 A;  3DDM A;  5T14 A;  5ALK A;  2DBY A;  3GB1 A;  2WDV B;  5KVH A;  3KHR A;  2L8J A;  3PSI A;  2QJM A;  3FVD A;  4UB4 A;  3GIL A;  3V6H A;  1RYR A;  3PV8 A;  4GGQ A;  1SGG A;  3UGV A;  4LNF A;  2RQ5 A;  3AEB B;  2HHQ A;  3QTP A;  1TY0 A;  3ZLZ A;  3NZ3 A;  4M0A A;  1FCL A;  2RRD A;  4OO1 J;  2NBW B;  3ZRC A;  2RD0 A;  5CRX A;  4OVZ A;  3KHH A;  3TAN A;  1J8C A;  5IIK A;  5EBK A;  1B4F A;  4ITK A;  3RNF C;  1JRO A;  4XWW A;  3HKZ C;  3D2S A;  4K1W A;  3DED A;  5FJT A;  1YN3 A;  3PFR A;  3ZNG C;  2BCV A;  2RSU A;  4N9F 4;  4M6W B;  5AI4 A;  3B0A A;  2LHE A;  4B9N A;  2DX5 B;  2EZX A;  1Z00 B;  1KDH A;  3DHI C;  3JYU A;  2L5Y A;  5CX3 A;  1JN3 A;  2ZXH A;  3V5F A;  3ETL A;  3IP4 B;  1YQZ A;  3PW7 A;  2BWE S;  2JRH A;  2K60 A;  2FMQ A;  5HQX A;  4JQW C;  2KDB A;  2K8A A;  3ML8 A;  3QPE A;  2PVG C;  3B2F A;  1Q0W B;  4I29 A;  4MGZ E;  2ZUD A;  3VHT C;  4OZB A;  5KTQ A;  1MJD A;  4M6U A;  1ZD3 A;  4EEN A;  5AM2 A;  2W54 A;  3GD6 A;  4DFK A;  3L5O A;  3D2D A;  4H4W A;  2PFO A;  1FHU A;  1WSP A;  1JPM A;  1X66 A;  1H38 A;  3V61 A;  1MG4 A;  4RF1 A;  3W1Y A;  2OXO A;  1E7U A;  2QDD A;  2WBA A;  4RQ3 A;  2VA2 A;  5CR0 A;  2YEP F;  1WYG A;  2CU1 A;  3N32 A;  2EQ8 A;  3OW1 A;  3VQI A;  4H4U A;  1P7D A;  4XLO A;  3B0X A;  5KFV A;  1EBD A;  4DFD A;  1ED1 A;  3RR8 A;  1ZQQ A;  5FP0 A;  3TI0 A;  3QZ7 A;  3R07 C;  2ZTC A;  5J0P A;  3PR5 B;  3KQ4 A;  1I35 A;  4X2P A;  4DS5 A;  1PFD A;  2WXQ A;  3D9X A;  4GIR A;  3H40 A;  2HBL A;  4PHD A;  4R64 A;  3ZXV A;  2KD0 A;  3T5L A;  1FFU C;  2WU2 B;  3D32 A;  3SJN A;  5E6P A;  3ICX A;  2ZG6 A;  3NTU A;  4BX9 C;  5JHB A;  3EFU A;  1JWB D;  4FJV B;  4UAU A;  4DOC A;  3PX4 A;  1LPF A;  3Q8E A;  4I28 A;  2HDE A;  1VJ5 A;  1WM2 A;  4KV2 A;  2PTY A;  2GQU A;  2IJ0 A;  3UIN B;  4XZ4 A;  4M9G A;  1BPE A;  2P88 A;  7ICM A;  1EU4 A;  2OVL A;  1ZYQ A;  5LXH A;  1HSK A;  2W9C A;  2DPI A;  4KTQ A;  1S77 D;  1Q5W B;  1ZKQ A;  2P8C A;  3M6Z A;  4GIS A;  3T6C A;  2JWU A;  1T6B X;  1V81 A;  1J2M A;  1WX8 A;  3KKA C;  3Q8B A;  3NVZ A;  5FJP A;  3FV9 A;  4DL4 A;  1HZ6 A;  2BBC A;  3N6H A;  2IND C;  4C4V B;  4PZO A;  3W5V B;  2NMQ A;  4FX9 A;  1FD6 A;  2FCM A;  8ICN A;  1UNS A;  1WWU A;  5EWE A;  1GO3 F;  3DES A;  1TIF A;  3GV7 B;  4ANU A;  2CHW A;  2JXJ A;  3VUW A;  1W1O A;  1ISN A;  3T79 A;  2KD1 A;  4Y2S A;  5AIB A;  5IAA C;  5FMH A;  4I2E A;  1ARO P;  4RQ1 A;  2ZPY A;  7ICI A;  1QLU A;  2CFY A;  3GD4 A;  3Q2A C;  4RNN A;  4RCO A;  3OZY A;  2R8D A;  2LAS A;  3DQV A;  4QZB A;  1ZQM A;  4RGT A;  1EC8 A;  1F5S A;  4EZJ A;  3H8W A;  3ALB A;  4YFK A;  2ZTD A;  1D6E C;  5DKW A;  2KQ4 X;  1COO A;  4II3 B;  4ANW A;  1VDV A;  2BCS A;  2VFS A;  4FHK A;  1WGK A;  2N7J A;  4F4Y A;  2CR5 A;  5KFE A;  3BWU D;  3UI3 A;  3QUC A;  4YD1 A;  1X9M A;  2KZM A;  4H1Z A;  3H8A A;  2H3Z A;  3F53 A;  5AKZ A;  3IBE A;  4ZOH B;  3UPQ A;  3HKZ F;  1NK8 A;  2IPI A;  4TQR A;  5ALR A;  2Q4W A;  1IUE A;  5L1L A;  3JVZ X;  2BPF A;  1IXR A;  2K8C A;  3V7L A;  1CQV A;  4NEV A;  3DDH A;  3POP A;  2F1H A;  1S0N A;  4GIV A;  4WWO A;  1IBX B;  4DLG A;  3ZD8 A;  2C22 A;  5I1W A;  2XGQ A;  2P8B A;  1SJH D;  2SAK A;  2JEJ A;  2CS4 A;  4YR0 A;  2G08 A;  1J7B A;  2HD5 B;  2WS3 B;  2R61 A;  4ENL A;  3TFR A;  3QUQ A;  1P98 A;  4RGO S;  3T5K A;  1F8W A;  3R9K A;  3WK4 A;  4LZG A;  3RBD A;  3KFU F;  4KDL B;  3PO5 A;  2PCE A;  4PHA A;  3P1M A;  5H8Y E;  5AI8 A;  1CEZ A;  4Z1Y A;  1XCT L;  4GSW A;  5KG0 A;  3LWL A;  2OJR A;  4OD0 A;  3IRU A;  1XS2 A;  4JK1 A;  3MJ5 A;  4WJN A;  5H92 C;  3NVV B;  2NV3 A;  5L1J A;  2UU7 A;  7ICQ A;  1L5P A;  4B9L A;  4IP5 A;  7ICO A;  4TQS A;  3PWG A;  1L6V A;  4C80 A;  3RUL A;  3Q8S B;  1L2N A;  1AHU A;  2LMR A;  2JR5 A;  4IWO A;  2EKE C;  3PST A;  4ZOH C;  3PSE B;  4DXA B;  3LJ3 A;  3AED B;  1I42 A;  2AGQ A;  4EZL A;  4JWS C;  5ALJ A;  1ZUD 2;  1D8Y A;  2MNR A;  1WGH A;  3GDX A;  2Y9T A;  3M7D A;  1V1O A;  3RB6 A;  4HCN B;  4KLL A;  4M02 A;  4LNI A;  3VR8 B;  3CGC A;  4LA1 A;  3GSY A;  5F3X B;  5DGB A;  9ICF A;  1Z00 A;  3OPX A;  2BS4 B;  2GGI A;  1ZD2 P;  2ZJD A;  2V9H A;  4ICU A;  1SB3 B;  2GDQ A;  3THU A;  3KLS X;  3PK7 A;  2LEK A;  2AGP A;  1FFU A;  3NS1 B;  1L3S A;  1H6V A;  3RRA A;  1WYW B;  2AQ4 A;  3VVW B;  8ICE A;  4F2R A;  3OWE B;  3RD2 A;  2MRL A;  4C8L A;  4U7C A;  4MFF A;  4B9U A;  3CT2 A;  3IAM 1;  4DHG A;  1I7H A;  4IQV A;  3FIL A;  1XQQ A;  1KW4 A;  1DGS A;  1YQ4 B;  2ESE A;  1AHZ A;  2B3A A;  4YTP B;  2JSV X;  1PVP A;  2C9W B;  5DQI A;  1U9L A;  3U26 A;  4NLG A;  2PXI A;  4WWP A;  3AEA B;  2AGO A;  4NM1 A;  2BB6 A;  4P16 A;  2F76 X;  3WK9 A;  1OQY A;  4ACF A;  2V4L A;  5G5H B;  4DSE A;  2AEH A;  4F4R A;  2QVH A;  3C19 A;  2PTZ A;  4ED2 A;  4K81 A;  4YTM B;  2UVW A;  4YT0 B;  4EMI A;  2QPM A;  3SR6 B;  3Q6B A;  1T0Y A;  5AI6 A;  5KT7 A;  3DVG Y;  3H12 A;  3EUB 3;  8ICP A;  1PK1 B;  2Q4T A;  4Y2T A;  2LGS A;  1RYU A;  3STP A;  2YMM A;  2BQR A;  4E6M A;  2PKE A;  3RB0 A;  2WTF A;  1C79 A;  2ZPN A;  3TW9 A;  1SB3 C;  1LO5 D;  2GGE A;  1K1Q A;  2XGP A;  3N1Y C;  2YB4 A;  4M0W B;  5JRB A;  3DH9 A;  4BKS D;  2I9G A;  2QGY A;  1KD0 A;  1JRP A;  1S76 D;  2QIL A;  2MUT A;  1H8C A;  2EZY A;  2LBO A;  1KH0 A;  1G6J A;  3TIX A;  1A70 A;  4KKI A;  2POD A;  4FUL A;  3B08 A;  4A55 A;  1SSN A;  1TS2 A;  2IOH A;  1OTR B;  2YML A;  8ICJ A;  3HT3 A;  3Q8C A;  3TQP A;  5L95 C;  2WPE A;  2P66 A;  5KVI A;  3ZI4 A;  3RI7 C;  2Y1J A;  4HCH A;  3TUO A;  4DX3 A;  4R66 A;  3A33 B;  4WWN A;  4ED6 A;  2MX2 A;  4ASW C;  3DBR I;  2V3N A;  3L16 A;  1JX4 A;  2VAO A;  1JCT A;  1EBG A;  1ZD4 A;  3CW2 C;  1SL2 A;  1ZQ1 C;  2WOI A;  3HIZ A;  3ZDT A;  2O56 A;  2O6K A;  1C78 A;  3K4G A;  1V8C A;  3QCA A;  5IO9 A;  2QJJ A;  4KLD A;  4PGY A;  3JPT A;  2J52 A;  1F0M A;  4IRC A;  5FJO A;  4OVV A;  2KTF A;  4ELT A;  1NDD A;  3TJ4 A;  1WGY A;  1IGC A;  4DHZ E;  2I0K A;  3RJA A;  4HVB A;  2HI0 A;  3UMB A;  3GIM A;  4DWF A;  3PO4 A;  1ZET A;  2FCS A;  5DB6 A;  2BQU A;  3R3M A;  3AM9 A;  4L2Y A;  3EZ5 A;  1IM4 A;  3U2S C;  4AS1 A;  2V9W A;  1GAQ B;  1UT8 A;  2E8P A;  5AKX A;  4PS7 A;  3H8S A;  3H0L B;  4Y2P A;  4W9F A;  5L9X A;  4WAF A;  3I6T A;  5AE2 A;  1QT9 A;  1WMH A;  3K1R B;  5E79 U;  3N1X C;  2GOW A;  3H7S A;  2VKQ A;  1FEZ A;  2NBV B;  2TPR A;  1L6U A;  3UQB A;  1RPL A;  2CPR A;  3KYD D;  4IWP A;  4MGY E;  5III A;  3HVD A;  2EAP A;  4RGN A;  2ZXI A;  2MCN B;  2EQ9 A;  1KTQ A;  4EEY A;  2BPG A;  4I2F A;  3LK9 A;  3N97 B;  4II2 B;  3UM9 A;  5DB9 A;  2PP3 A;  4MGG A;  3I99 A;  3PHX B;  5ALO A;  1SEB D;  2WU5 B;  1SF0 A;  3Q14 C;  2BCP A;  1KLU D;  3I4K A;  1RAX A;  2GR3 A;  4DQO C;  3IJI A;  1ZQL A;  3CK5 A;  2G3Q B;  4DK5 A;  5J0W A;  1N48 A;  5EE3 A;  1HZ5 A;  5BYS A;  4F4K A;  1QQ5 A;  1Y56 A;  3TJI A;  1UT5 A;  3HP6 A;  3MAB A;  1BT0 A;  1V5T A;  2QHO A;  5AM3 A;  9ICK A;  3PRE A;  4G3X B;  5KFC A;  5ALH A;  2B6G A;  4DOB A;  2WF6 A;  1S0V A;  1WIA A;  4RGM A;  3CYJ A;  2PTL A;  1T4G A;  3FJ4 A;  5IIO A;  1L4D B;  2DWQ A;  1TKK A;  1ZRM A;  4H4Y A;  2E3T A;  3DBR B;  5KG6 A;  2JK6 A;  3AEE B;  1L4Z B;  2BDU A;  4C7Z A;  2HXT A;  4F71 A;  1JOA A;  3RH4 A;  3CXO A;  2ATL A;  3DHG C;  4EQX A;  1R4M I;  3JS8 A;  3KYC D;  5J2D A;  1HXY D;  2G4S A;  4J6I A;  4FDC B;  2KQS A;  3C0R B;  4OCZ A;  4J3Z A;  2K89 A;  1NI2 A;  3ZTD A;  4GIB A;  4Q45 A;  5AKI A;  2KZZ A;  4PGQ A;  3IG8 A;  2LVQ A;  4AP9 A;  2BF8 B;  4XE0 A;  3V62 A;  4CYE A;  2RK5 A;  5AIA A;  1XSN A;  4PL2 A;  4CCH A;  4FZM A;  2IGD A;  3SQI A;  4ED0 A;  2IGH A;  4PVK A;  4FP1 A;  3BVZ A;  4A3R A;  7ICT A;  1QSS A;  1K51 A;  3SN0 A;  5KFB A;  3TCS A;  1EM7 A;  1GNU A;  4LVS A;  3A0H U;  2WXN A;  3DGB A;  1JMS A;  5HNK A;  4MM3 A;  4KX3 A;  4XA5 A;  2O6V B;  1N61 C;  5DPW A;  2WXO A;  3W2D A;  4XYC A;  2K3U A;  1MI0 A;  1S3S G;  1UQV A;  2MA9 B;  4IZG A;  1FNW A;  3U7D A;  1MHX A;  3WK6 A;  5IOI A;  1LVL A;  2M8S A;  3F2B A;  3HIL A;  1DTN A;  4GXB A;  4QZA A;  5KG4 A;  4DSF A;  8ICR A;  9ICV A;  1XD3 B;  1VAO A;  3THV A;  4HRO A;  2I1K A;  7ICH A;  5C3J B;  2XGZ A;  1MVK A;  1SV0 C;  5D94 A;  5EE1 A;  1EO6 A;  4F4W A;  2ZVN A;  4EX7 A;  2BWF A;  3BOX A;  2YTU A;  1E6E B;  8ICC A;  4OJP A;  4B9V A;  1YQB A;  5I1V A;  2WWZ A;  1ZW7 A;  1M6Y A;  3NHE B;  5G5H A;  4QW8 A;  1L8L A;  4OJL A;  5H2F U;  2PLI A;  5TZV A;  4DHZ B;  1QOA A;  2I38 A;  1PGA A;  2OJW A;  2WX0 A;  3SR6 A;  4Q43 A;  4MMW A;  4UQG A;  4P2H A;  2BYT A;  8ICF A;  3FAH A;  3V60 A;  4BUG A;  1HEK A;  1TBE A;  4MEL A;  5IIL A;  1RXW A;  1WGR A;  3DVN V;  2A8X A;  1D5X C;  5KFI A;  5J0S A;  2JU6 X;  4DSK A;  3DVG X;  4NAM A;  1ZGU B;  2HNE A;  4KEM A;  1ZP0 B;  3PGE A;  3VTW A;  1D8L A;  3V7J A;  3GS2 A;  2ON8 A;  1SXD A;  2DFL A;  1KCZ A;  2VH2 A;  2L3Z A;  3EYZ A;  8ICO A;  3GV8 B;  3L17 A;  2OO6 A;  1R4M B;  4HYK A;  4QZG A;  5J2G A;  5AKY A;  1CRX A;  2PGW A;  3HVZ A;  2K6Q A;  5AM4 A;  5KHO A;  1ZDV A;  3BY4 B;  1X40 A;  1ZQV A;  4YD2 A;  5CP2 A;  3E9S A;  1I19 A;  2ASJ A;  1TK8 A;  1CI4 A;  4KLS A;  5TR5 A;  1WI0 A;  3AEC B;  3FW8 A;  4JAY A;  3U9I A;  2KSO B;  3GV5 B;  3K9P B;  4C4T A;  3L08 A;  2RR9 A;  2X38 A;  3IHQ B;  2CKH B;  3FCP A;  2PLS A;  4C8M A;  5FXP A;  2JXX A;  4I2A A;  1V86 A;  2G1E A;  1SJD A;  1MO9 A;  2JY6 A;  4K7Z A;  3R7R A;  1T0Q C;  4EYI B;  5AUK A;  2OH2 A;  4ZRQ A;  2W03 A;  5ER0 A;  1W1Q A;  3OJS A;  8ICL A;  3C2K A;  2PI5 A;  2EKI A;  2MLB A;  1TGZ B;  4CQN A;  3HK0 A;  3I1Y A;  3C1Z A;  2BW2 A;  5AZH A;  2HHV A;  5ENL A;  3VC5 A;  2KAJ A;  2BT6 A;  1XHC A;  4E3C A;  2QC8 A;  4FJY A;  1TKD A;  3VFC A;  1B1Z A;  1V9J A;  1WE6 A;  1ZK7 A;  1IG6 A;  3BS5 B;  3PRM B;  4K8G A;  1YMH E;  1E8H A;  1SE2 A;  3WK8 A;  3PW4 A;  2R8K A;  1YZ6 A;  4P0Q B;  2M4N A;  3RUI B;  3Q8M A;  2XY6 A;  1ZXH A;  3ENE A;  2QAR B;  3ZW3 A;  2C60 A;  1S5L U;  4EX6 A;  3SAH A;  9ICL A;  2REX A;  4MKS A;  2KOB A;  2KT7 A;  9ICB A;  2KZR A;  3VDZ A;  4ADW A;  1N60 C;  2ISO A;  3LYS A;  1B22 A;  5FXF A;  5GMV A;  4CO7 A;  1CK1 A;  5KFO A;  1NK4 A;  2GMI C;  4IOI E;  5GXG B;  5BMG A;  3K75 D;  4UAY A;  2KVZ A;  3H8H A;  3OPS A;  1HUO A;  2J6S A;  5D4B A;  4RNA A;  4UAW A;  1N5W C;  1UEL A;  4ECR A;  2GQT A;  1NHS A;  1J7C A;  3MC9 A;  4WH4 A;  5ALT A;  1R6W A;  3A4R A;  4ECZ A;  4Y2Q A;  4IM2 A;  1IYF A;  5ALM A;  2KNJ A;  4GXJ A;  2KAN A;  4HPM B;  1WJ4 A;  1ZQY A;  1N61 A;  3T5H A;  5KAI U;  2JRI B;  1OEY A;  4WWM A;  4DDG D;  2WOW A;  5GRT A;  3QAR A;  4ML8 A;  1MQ2 A;  2E8O A;  3M63 B;  3R11 A;  3H0R B;  4KIT B;  1MG8 A;  1AYF A;  3UQA A;  4GC7 A;  4PPX A;  1KL9 A;  1SJE D;  2QMT A;  1TT5 B;  4BJQ A;  4FXC A;  1WR6 E;  3VR9 B;  2ONQ A;  3N30 A;  2XCP A;  1FXT B;  3GP7 A;  4M04 A;  2ODG A;  1SV0 A;  5BYQ A;  2JUO A;  4J57 A;  1YT3 A;  4A8X C;  3HSU A;  2DKZ A;  3ZNZ B;  3RYT A;  1B9R A;  1MDL A;  3LXD A;  1ZJN A;  2J0J A;  4Z6E A;  4Y2V A;  1ZDL A;  1D5Z C;  5DB7 A;  4K2S A;  3TAQ A;  1PGB A;  2R9Z A;  2MHJ A;  2ZIV B;  2JEF A;  5DGA A;  5AI9 A;  1Q3V A;  1QIL A;  2FCQ A;  5K8E A;  4UDU C;  4DFJ A;  2F8K A;  1ZOY B;  4ANV A;  2ZZP B;  4CHK A;  2X8H A;  4JGH B;  4OVU A;  2NCN A;  3ZVH B;  3Q3F A;  1XCQ L;  1E10 A;  4GME A;  1DK2 A;  2WF9 A;  4I2D A;  3WKC A;  1C4P A;  2KK8 A;  1FRD A;  3IAS 1;  3AEF B;  5EDS A;  3GFK B;  1WX9 A;  1VD2 A;  5JXV A;  4I2I A;  3WKE A;  3KW5 B;  1GRH A;  4Y2J A;  2JH1 A;  1F2R C;  5ALS A;  1WCN A;  1ZXI C;  1EUV B;  3T8Q A;  2K25 A;  2KK0 A;  3AB5 A;  1J7A A;  4UB5 A;  1T0S C;  2IY0 B;  1HIW A;  5DLF A;  4P0P B;  4H4P A;  3H4D A;  1GB1 A;  1JML A;  2FLP A;  2GI9 A;  4PS8 A;  2D3G A;  2H3I A;  3ES7 A;  4K7S A;  2ZAD A;  3GZN I;  5ALL A;  4GLS C;  2KMA A;  2WXR A;  2AKZ A;  5HHZ A;  8ICQ A;  5D3I B;  4FE3 A;  5KFL A;  4RQ4 A;  1GC6 A;  1JWS D;  2GBR A;  1NJX A;  5ALI A;  2CU3 A;  1CJE A;  1GRE A;  5HR6 A;  4O95 A;  2D3D A;  1WJ6 A;  1EXN A;  5J0U A;  3N3K B;  2EAO A;  2W9N A;  3EFC A;  1ZRN A;  2YN4 A;  2BVG A;  2F44 A;  2KWU B;  2HVI A;  4Q2J A;  1GRF A;  1PDZ A;  3PVX A;  3P0W A;  3QNM A;  2C2D A;  2PJH A;  1A0P A;  2WXM A;  2HHT A;  2M0A A;  1DZN A;  1AWD A;  1TAQ A;  1L3U A;  1TKY A;  3K1G A;  2GH5 A;  4QNL A;  5TSS A;  1W1J A;  1C3T A;  3FG2 P;  5CA7 A;  4K7U A;  2GGH A;  3IXS A;  2CJO A;  1UXY A;  7ICP A;  3JPQ A;  1N2X A;  4WJO A;  3EW9 A;  7ICK A;  4UB1 A;  1PUT A;  3UCD A;  1V9P A;  3OP2 A;  1FNV A;  3BJY A;  1C77 A;  2DYM A;  3PML A;  3ETR B;  5G55 A;  2AL2 B;  3TAD C;  2L0F A;  1BPB A;  1TE6 A;  1MN8 A;  7ICS A;  3H0M B;  4H4T A;  2K8B B;  4RPZ A;  1YZ7 A;  3Q69 A;  1N60 A;  4DO9 A;  1OQR A;  1UBQ A;  4DXF A;  4AQ7 A;  5ALX A;  3PZ7 A;  2BZF A;  4TUS A;  4F1S A;  3U8Z A;  1XPY A;  2A4Z A;  4ELU A;  3QJZ A;  4W9D A;  2NRV A;  3QN3 A;  2MJD A;  2KHQ A;  2XY5 A;  4ZRK A;  8ICW A;  1F9C A;  1N5W A;  3RNB C;  2XY7 A;  1ZQU A;  3SFE B;  3OC4 A;  4H83 A;  2IPK D;  2WF5 A;  4FBT A;  4JMU A;  3T8M A;  4O3P A; 
#chains in the Genus database with same CATH homology
 2WLB A;  4RCO A;  2R8D A;  3I57 A;  1I4H A;  3B9J B;  2NTS A;  1D4B A;  2OAI A;  4RGT A;  4PVJ A;  1EU3 A;  5LNK 1;  1QOB A;  3PO0 A;  1FIQ B;  1D6E C;  1FNU A;  2KQ4 X;  3W8W A;  5FKA C;  2VFS A;  1VDV A;  1HQR D;  1KFY B;  3C8Y A;  5FXD A;  2N0S B;  1WGK A;  3EUB 2;  2N7J A;  3TX1 A;  3BWU D;  4P6V F;  3AEG B;  4GDK B;  3UI3 A;  2H88 B;  2W82 A;  4NAW B;  5C2T B;  4ZOH B;  1YN4 A;  2R2Z A;  2IPI A;  2L52 A;  2SEB D;  2Q4W A;  1IUE A;  1VZ6 A;  5ADZ A;  3EGR A;  1T5X D;  2AQ3 B;  1DGJ A;  1CQV A;  1N62 C;  3VRA B;  3POP A;  1IBX B;  2W55 A;  1I4R A;  4N58 A;  4ZYS A;  3NVW B;  1XLN A;  3D2J A;  5I1W A;  1ACC A;  1JCK B;  2Y3A A;  2UUU A;  1VJK A;  3TSS A;  2BVH A;  1SJH D;  2SAK A;  4D2K A;  1J7B A;  3TEX A;  2WS3 B;  2R61 A;  3RFZ B;  3U4E G;  4RGO S;  2TSS A;  3KWL A;  1VLB A;  2WDR B;  1FXA A;  2JZP A;  1YQ3 B;  3P1M A;  1YNT E;  4KX6 B;  5H8Y E;  3FW7 A;  1XCT L;  3O13 A;  2RDH A;  2E6X A;  2WXK A;  4JX1 C;  2KN4 A;  3MJ5 A;  5H92 C;  1TKG A;  3NVV B;  1L5P A;  3AE8 B;  5AE1 A;  4MH8 A;  1L6V A;  4C80 A;  4HG0 A;  3BK2 A;  1AHU A;  4PZF A;  4ZOH C;  2K9X A;  3LXF A;  4BC7 A;  1FO4 A;  3AED B;  2IDY A;  1VZ7 A;  4JWS C;  3MP9 A;  3BZD B;  1ZUD 2;  4PYT A;  1TKE A;  2JYE A;  1V1O A;  3VR8 B;  4ARC A;  4UD8 A;  3GSY A;  2ZW1 A;  1JQ4 A;  3HUI A;  1PGX A;  2BS4 B;  4LTU A;  1FM0 D;  2V4I B;  3Q8F A;  3AE1 B;  3W9C B;  1SB3 B;  3KLS X;  2LEK A;  3NS1 B;  1FFU A;  1OFF A;  4C56 C;  1RM6 B;  3OWE B;  2NTT A;  3IAM 1;  1ZDX A;  2FUG 1;  1I7H A;  3FIL A;  4L23 A;  1SBB B;  3AE6 B;  1YQ4 B;  1AHZ A;  4YTP B;  1QOG A;  2JSV X;  2EXR A;  1AW7 A;  2E5A A;  4TQ0 A;  3AEA B;  2WXJ A;  2BB6 A;  4P16 A;  5E6J A;  2Q5W D;  1R7S A;  4YWG G;  5G5H B;  2Q85 A;  1STE A;  3S1D A;  4DNS A;  5T8I A;  4TQ1 A;  1JWU D;  1Q10 A;  1SE3 A;  1QQR A;  4YTM B;  2AQ2 B;  2H89 B;  3FC4 A;  4YT0 B;  2QPM A;  3SR6 B;  4ZHO A;  3P4S B;  1N63 C;  3MHZ A;  4JB1 A;  3EUB 3;  3AE5 B;  2QSD A;  3PZ8 A;  3I9V 1;  2Y08 A;  4B0E A;  5MPO A;  4XWT A;  2FE8 A;  1C79 A;  3RJ8 A;  2INN E;  1LO5 D;  1SB3 C;  4OZA A;  2GB1 A;  1E7P B;  5G5G B;  1W1M A;  4OZC A;  2VFR A;  3PQB A;  2BB5 A;  1W1R A;  1FFV C;  2G9H D;  2GRI A;  2VFT A;  1JRP A;  1TS3 A;  1JWM D;  4IDI A;  3MC0 B;  2D5G A;  3NVY B;  4BC9 A;  2QIL A;  1RM6 C;  1KH0 A;  1ZPS A;  2IGG A;  2OHF A;  1GOZ A;  4TSS A;  2FBW B;  1A70 A;  4KKI A;  4EC3 A;  4US9 A;  4RFB A;  2QKN A;  4A55 A;  1SSN A;  1TS2 A;  3AE2 B;  2XN9 C;  3AE4 B;  3Q8C A;  4A90 A;  2Y4G A;  5D79 A;  1T3Q A;  4MT5 A;  1WVF A;  1C76 A;  4XDC A;  3TUO A;  2AXR A;  1E0Y A;  3Q8A A;  2JYT A;  5L6F A;  2V3N A;  2VAO A;  1N62 A;  1FEH A;  2HTM E;  1F2R I;  4YSX B;  2BS3 B;  2M19 A;  4B0M A;  3N9Y C;  3ZYY X;  4PWB A;  2L1A A;  1C78 A;  1NEK B;  1V8C A;  2J52 A;  3LYY A;  1ZR6 A;  2J4X A;  2I0K A;  3RJA A;  1IGC A;  1JWA D;  2QIE B;  1TYG B;  1XF5 L;  3VRB B;  4L2Y A;  3AM9 A;  4AS1 A;  2AQ1 B;  3U2S C;  4DXG A;  1GAQ B;  3J9C A;  4WAF A;  5AE2 A;  1FIQ A;  1EWY C;  2J42 A;  4YSY B;  2L83 A;  1MBB A;  1QT9 A;  1RYJ A;  1MHH E;  4LLG M;  1V1P A;  3BW7 A;  1QKZ A;  2WXG A;  1QLB B;  1BML C;  1L6U A;  1V97 A;  4HRS A;  1F77 A;  2N9K A;  1BUI C;  4RGN A;  3HVD A;  2VZK B;  1XLQ A;  2CJN A;  1I4P A;  3SEB A;  1L0X B;  5D7G A;  2LFI A;  2Z8L A;  2PW9 A;  2I2Y A;  3NRZ A;  3I99 A;  5FXE A;  1SEB D;  2WU5 B;  1SF0 A;  2MJE A;  2PLP A;  5EE9 A;  1YN5 A;  1KLU D;  4RF0 A;  5HMR A;  1GPX A;  4DQO C;  2XNA C;  3FWA A;  3BYT B;  1GB4 A;  1W1L A;  2WXF A;  5EE3 A;  1ZXI A;  1HZ5 A;  3ZJT A;  2MH7 A;  5BYS A;  1E8G A;  1Y56 A;  2KDM A;  4TVY A;  4TMA B;  1KRH A;  3CWI A;  4YXD B;  3BII D;  4RGM A;  2PTL A;  1JW9 D;  3E56 A;  4N59 A;  3S1C A;  4KGT A;  1L4D B;  1DOX A;  2DWQ A;  2PMV A;  4JPS A;  2OED A;  1F0X A;  2INP E;  2P4P A;  2ACZ B;  2E3T A;  3AEE B;  4H2A A;  1L4Z B;  4C7Z A;  1DYQ A;  4XDD A;  3DQ0 A;  5FR3 A;  3JS8 A;  5EE0 A;  3W8X A;  1HXY D;  2VFU A;  4WQM A;  3TEZ A;  1QF6 A;  2LMC A;  2RPV A;  1EWC A;  1RWS A;  1TS5 A;  1UGJ A;  4N6E B;  4XE0 A;  4A9A A;  3TEW A;  3TSJ A;  3LB8 C;  2RK5 A;  1E8F A;  1K52 A;  2IGD A;  3LAE A;  1N63 A;  1XO3 A;  2IGH A;  4PVK A;  3MFG A;  3BVZ A;  4L1B A;  3RPF C;  3WCQ A;  1C9F A;  1K51 A;  1EM7 A;  1NI3 A;  1FXI A;  2WXN A;  3HRD C;  4R3D A;  1FFV A;  1N61 C;  2WXO A;  3W2D A;  2K3U A;  1MI0 A;  2RDG A;  3AH7 A;  1FNW A;  4WIP A;  1MHX A;  1I4Q A;  4YSZ B;  3TEY A;  2MJ3 A;  1QLT A;  2NQW A;  2WXH A;  5D3D A;  1W1K A;  3S1F A;  2PVO D;  4ARI A;  1VAO A;  4HRO A;  4JWU C;  3W5U B;  1PYW D;  5C3J B;  1WWT A;  1MVK A;  5EE1 A;  1UWX A;  4NJC A;  3IT4 B;  1E6E B;  3FIL B;  2YEP B;  3P42 A;  3A7A A;  5I1V A;  4NZL B;  5G5H A;  2PLI A;  2Y5P A;  2P13 A;  1KF6 B;  1NYQ A;  1QOA A;  1PGA A;  2I38 A;  2JXT A;  2Y3S A;  2WDW A;  4PVE A;  3SR6 A;  1ROE A;  3R2T A;  2BYT A;  2LUM A;  1ENF A;  1VZ8 A;  1XLP A;  3FAH A;  3AV8 A;  3ZJV A;  4TVW A;  1WRI A;  1K53 A;  2L32 A;  3IT6 B;  4ZHP A;  4C7Y A;  5G5G A;  1FCC C;  2WP9 B;  3PM9 A;  5BMH A;  1D5X C;  1W1S A;  2JU6 X;  3A7U A;  4NAM A;  1ZP0 B;  3GS2 A;  3NVY A;  2ON8 A;  3R2I A;  1I4G A;  1YJJ A;  4BBY A;  2VZK D;  3ETR A;  4KKJ A;  1VRA B;  2MEK A;  3HVZ A;  1QOF A;  1TY2 A;  4REZ A;  1ZDV A;  4HKZ E;  1ET9 A;  4O1N A;  1C4A A;  1YJI A;  4J3O D;  3E9S A;  1I19 A;  4OW0 A;  4RH6 A;  3AEC B;  3FW8 A;  4JAY A;  3NVZ B;  1TS4 A;  1HSK A;  2M56 B;  2KWD A;  2X38 A;  3P4Q B;  2PLS A;  5AUI A;  1M4V A;  4HEA 1;  1FRR A;  3S1E A;  5FXP A;  5FK9 C;  3HRD D;  2G1E A;  1NYR A;  3P4R B;  3B9J A;  5AUK A;  1E9M A;  4ZRQ A;  1KTK A;  4HJG E;  2W3S A;  2N9L A;  1W1Q A;  5L6G A;  2EEL A;  5HI1 A;  2EKI A;  2BS2 B;  2LJI A;  1DOI A;  2K22 A;  4CQN A;  2UUV A;  1AN8 A;  1NVI D;  3EA6 A;  3U7Z A;  3AN1 A;  4MAC A;  3W1S A;  3ZQ4 A;  2BW2 A;  4KGR A;  1DIQ A;  1XEE A;  1ET6 A;  2BT6 A;  2KAJ A;  1K50 A;  2W3R A;  1B1Z A;  2Y3R A;  1YMH E;  2DLB A;  1E8H A;  1SE2 A;  3KJM A;  1I4X A;  1IGD A;  3AMZ A;  1CZP A;  4YTN B;  1QLU A;  1ZXH A;  5BMI A;  4KGS A;  3FW9 A;  3BK1 A;  3BVG A;  3R8B A;  4EE2 A;  3C0P A;  2K0P A;  2PIA A;  4OAL A;  1PDX A;  1V1P B;  1IBX A;  3A7R A;  3NVW A;  4LK0 M;  1HEZ E;  1N60 C;  1MPE A;  4OHJ A;  5FXF A;  1CK1 A;  5GXG B;  4IOI E;  1SXT A;  5BMG A;  1N5X A;  1UWM A;  3H8H A;  2LHD A;  4GDL B;  1WVE A;  4RNA A;  1T3Q C;  1ESF A;  1RFK A;  4ZRP A;  1D5M C;  1WXQ A;  1N5W C;  2GQT A;  1J7C A;  1TJE A;  4WH4 A;  2ICI A;  2QEJ C;  3NRZ B;  2Y5C A;  3CIR B;  2DBY A;  3GB1 A;  2WDV B;  4WUR A;  1P7E A;  5BYR A;  3AE7 B;  3NVV A;  1N61 A;  2WDQ B;  5HHD G;  1TZO A;  4WWM A;  4ML8 A;  3V05 A;  1KLG D;  1AHV A;  4HKQ A;  3ZGZ A;  1XLO A;  4A6Q A;  1AYF A;  3D2H A;  1SJE D;  2QMT A;  3AEB B;  5AE3 A;  1TY0 A;  4FXC A;  4BCA A;  3NZ3 A;  3VR9 B;  1DII A;  1FCL A;  4USA A;  4PT5 A;  2ONQ A;  3GP7 A;  2K5P A;  1SIJ A;  4OVZ A;  5BYQ A;  4A8X C;  3HSU A;  4JE3 B;  4PVH A;  1B9R A;  4ITK A;  4XWW A;  3LLB A;  1JRO A;  3DED A;  2JX5 A;  1E0Z A;  1YN3 A;  1D5Z C;  2PKO A;  5AWV A;  1PGB A;  1BXT A;  3P63 A;  2KMM A;  2AX5 A;  1X2G A;  2JQR B;  2MBR A;  5I4D A;  2LHE A;  1QIL A;  5K8E A;  4UDU C;  3NS1 A;  1ZOY B;  1VQZ A;  3W8Z A;  1P7F A;  1XCQ L;  3T3O A;  1E10 A;  5HQX A;  2B76 B;  2J53 A;  2BTE A;  1C4P A;  1FRD A;  4PWC A;  3IAS 1;  3AEF B;  3ABV B;  2PVG C;  3B2F A;  5JXV A;  3KWV A;  3L4P A;  4OZB A;  1F2R C;  4MM3 B;  4US8 A;  1ZXI C;  2W54 A;  3D2D A;  2P3H A;  1ZE3 D;  1SE4 A;  3AB5 A;  1J7A A;  3TSH A;  1WSP A;  3V3X A;  1MBT A;  4RF1 A;  2BVF A;  3VTE A;  3DWG C;  3URY A;  2YEP F;  1WYG A;  3NUH B;  1JML A;  1GB1 A;  2GI9 A;  3VQI A;  4XLO A;  4GLS C;  2WXR A;  5HHZ A;  1C4C A;  5D3I B;  1L0V B;  2VFV A;  1JWS D;  2YVS A;  1JAL A;  3SFD B;  2CU3 A;  3BYY B;  1CJE A;  4O95 A;  1VR9 A;  3R07 C;  3DWM A;  4M0W A;  5HG2 A;  2O3G A;  1HA5 A;  2BVG A;  3KQ4 A;  1FMA D;  1PFD A;  1L0Y B;  2WXQ A;  4Q2J A;  5HFY A;  1UUP A;  2V3P A;  3AE9 B;  1FFU C;  2WXM A;  2WU2 B;  2M0A A;  2QJL A;  1AWD A;  1DZN A;  4IKG A;  3BVM A;  1TKY A;  3T3N A;  3U52 E;  2WNM A;  1XXG A;  1JWB D;  5TSS A;  1OQQ A;  1W1J A;  2WXP A;  1UXY A;  3IXS A;  2CJO A;  3P4P B;  3Q8E A;  2HDE A;  1PUT A;  1F0Z A;  2GQU A;  2IJ0 A;  2KAC A;  2LGI A;  1EU4 A;  1FNV A;  3AE3 B;  1C77 A;  2DYM A;  2DYO A;  1X2H A;  1DOY A;  3ETR B;  2JWU A;  1T6B X;  2RMM A;  3Q8B A;  3NVZ A;  3Q69 A;  3B2G A;  1N60 A;  1OQR A;  4AQ7 A;  4DXF A;  2V0G A;  2ZW0 A;  1HZ6 A;  3PZ7 A;  2BBC A;  3W5V B;  2NMQ A;  1FD6 A;  1UNS A;  3ZJU A;  1NEN B;  2MJD A;  2WXL A;  2WXI A;  1N5W A;  1W1O A;  3SFE B;  4MLA A;  2IPK D;  2WQY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...