1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
1QF6A 1W1JA 2WDRB 3LAEA 2NQWA 1ZUD2 3NVWA 5ADZA 3P4SB 4LTUA 3C0PA 1GPXA 3PO0A 2BT6A 2VFRA 1TKYA 5HQXA 3W8XA 1T3QA 1W1MA 2P3HA 1E0YA 1WGKA 3NS1B 1X2GA 1YQ3B 1XLOA 3HUIA 1WXQA 4PYTA 5GXGB 3AEGB 1WVEA 2CJNA 3WCQA 1DIIA 1FM0D 5EE9A 1SIJA 1VDVA 2P4PA 2G1EA 2WS3B 1JROA 1W1QA 2WU5B 4BCAA 3RPFC 1L6UA 4A9AA 2LEKA 1YJJA 3KWLA 1E8FA 3AE2B 3SFEB 4ZOHC 4HRSA 1JWBD 4OALA 1E7PB 1OQQA 2R2ZA 1OFFA 2QKNA 1W1SA 1A70A 3HRDD 5G5HA 4HG0A 1OQRA 4ZHPA 1FFUA 1B9RA 3PM9A 1V8CA 1PDXA 3AEDB 2JQRB 2W54A 5MPOA 2WDQB 3ETRB 1RWSA 3VRAB 2YVSA 3AEAB 3P4QB 1HSKA 2H88B 3NVYB 1WRIA 2VAOA 4HROA 1QOGA 4USAA 3CWIA 2M19A 1XO3A 1FXAA 1AYFA 4TVYA 1JRPA 1E8GA 2ACZB 5AUIA 1W1KA 1N60A 5C3JB 2PLIA 1UWMA 3BW7A 2BVHA 3NVZA 3P4RB 4JB1A 1N62A 5FXDA 2BS3B 2MJ3A 1CJEA 2M56B 5AE2A 3EUB3 4JAYA 1QOAA 3NRZA 3W5UB 2GQUA 1FRDA 3AE6B 1AHUA 3NVWB 2AXRA 2WP9B 1NEKB 2VFSA 5AE3A 2PVOD 5H92C 2W3SA 3KJMA 4KX6B 1JQ4A 1R7SA 3BIID 2QPMA 1WVFA 1GAQB 1F0XA 2PKOA 4JWSC 4P6VF 5EE3A 3B9JB 1VJKA 4YTPB 3W8WA 1IUEA 2WLBA 4N58A 3S1FA 1SB3B 4C7ZA 3TX1A 1TKEA 3CIRB 5EE1A 1KFYB 3AEEB 3AN1A 1AWDA 1NYRA 2CU3A 3B9JA 5FXFA 1ROEA 3P63A 4US9A 1N63A 1N5WA 2KMMA 4FXCA 2EXRA 5G5HB 5FXPA 1W1OA 1E6EB 1KRHA 1ZXIC 4YTNB 2WQYB 1NVID 1QLUA 3I99A 4WWMA 3AMZA 3SR6A 3R07C 1QLTA 1N61A 4TVWA 1DOYA 1MBTA 2BS2B 2K9XA 1XLQA 2JX5A 1JW9D 3LB8C 1WYGA 3FC4A 1J7CA 2PLSA 2VFVA 3FAHA 3AECB 1MBBA 1J7BA 1AHVA 2FBWB 4YSYB 1FXIA 4WQMA 1XLPA 1YQ4B 2GQTA 1FFVA 3NVZB 2W3RA 3P4PB 3ZYYX 3NRZB 1QOFA 2MH7A 1F0ZA 1N5XA 2PIAA 1T3QC 1X2HA 1ZR6A 5AE1A 4YSXB 4JX1C 5FXEA 4O95A 1ZP0B 1RM6B 1PUTA 3NVVA 4US8A 3ABVB 1DOIA 4BC9A 1TYGB 1E10A 3DWMA 1CZPA 1SB3C 2AX5A 1N5WC 1RFKA 1TKGA 1WWTA 2DWQA 5EE0A 5G5GB 1DIQA 1FIQA 1XLNA 1PFDA 3VR8B 2H89B 2MJEA 3AE1B 2DBYA 4JWUC 2BS4B 1SF0A 3AE8B 3VR9B 3AEFB 4ML8A 2MBRA 1QOBA 3AE3B 5H8YE 5G5GA 1FFUC 4ZHOA 1L6VA 4C7YA 1VLBA 3AV8A 2O3GA 3W5VB 2CJOA 1AHZA 1FFVC 1QT9A 2BVFA 3HVZA 1EWYC 1JALA 1QLBB 3A7AA 4ITKA 1DZNA 3SR6B 3SFDB 3S1DA 4YSZB 4BC7A 4MLAA 1L5PA 1FMAD 1TJEA 2QIEB 3AE4B 3AE5B 5HMRA 3AEBB 3HRDC 1N60C 3W9CB 5AUKA 2OAIA 1N62C 2WU2B 3S1EA 4BBYA 2E5AA 1DOXA 3L4PA 1FO4A 3A7UA 4YXDB 1L0VB 2VFTA 4XLOA 4N6EB 4N59A 3NS1A 2RK5A 2PVGC 1E0ZA 1I19A 2W55A 2N0SB 2VFUA 2K5PA 5HHZA 1RM6C 3AH7A 2OHFA 3AB5A 5C2TB 1ZOYB 2EKIA 3A7RA 1DGJA 1NI3A 3B2GA 1E8HA 1VAOA 3NVVB 1VQZA 3W8ZA 2Y5CA 1I7HA 1JWAD 4C80A 3DQ0A 4YTMB 1J7AA 1RYJA 2HTME 2Q85A 1W1LA 4YT0B 4ZOHB 2K22A 2L83A 2L52A 1FIQB 3AE9B 2E3TA 2R8DA 2BVGA 3ETRA 1ZXIA 3DWGC 2B76B 1N63C 4IDIA 3NVYA 1W1RA 1V97A 3JS8A 1FRRA 3AM9A 2Q4WA 3LXFA 3DEDA 2QJLA 3AE7B 1KF6B 1NENB 2I0KA 2P13A 2KAJA 2MJDA 1N61C 3LLBA 2WDVB 1UXYA 3P1MA 3S1CA 1E9MA 3EUB2 3VRBB 1YJIA 1NYQA 3B2FA 2Q5WD
chains in the Genus database with same CATH superfamily
4NQKE 1OEYJ 5JCIA 4IWQA 2WDRB 1XSPA 5BMGA 4O3MA 1ZUD2 3NVWA 1TZZA 1KSPA 4E0DA 1LB2B 4KGSA 1DTNA 3EPGA 1A5RA 3PSTA 4KITB 2EQ9A 3C0PA 3HKZC 2JF5A 3JW0X 2ZUDA 2BW2A 3EEZA 1GPXA 1NOMA 5KFDA 3T6CA 1M94A 2HE7A 5FR6A 5HQXA 4YMOA 5T14A 3ISBA 3GD4A 2I2YA 2F1IA 1T3QA 3RH5A 1C1YB 1QZEA 1V86A 1H8CA 4QZDA 2OQHA 1RG6A 1E0YA 2P88A 5ALFA 5C1ZA 3OSPA 2OG9A 2WDWA 1ZQJA 1H2IA 1PVPA 2Z0EB 2BQQA 2GLEA 4C4TA 3ZDTA 4JIOU 4AOFA 2GR2A 4ECXA 4C8NA 2X8HA 5KFXA 1TAMA 2G3QB 2JPHA 2H3IA 2NTSA 3HHMA 3T8MA 4MMWA 1OXJA 4PYTA 4AJYB 1GREA 4DF8A 3A33B 1C20A 5GXGB 4M6WB 3EHVA 2M0NA 1FM0D 2WPFA 1V85A 1SIJA 2C28A 2KJRA 2LUMA 1GB1A 2PJHA 3VCCA 1V5TA 4Y2VA 3RB6A 3PLUA 5CA7A 2GR1A 5AICA 2YTUA 4K3CA 5IOIA 5J0SA 4DQPA 3H7SA 4O1NA 1W1QA 2WWZA 2RDHA 2KD0A 2C5LC 4BCAA 2JY6A 1RLFA 5HKHA 1S0VA 4KLJA 1L6UA 4F4ZA 3KWLA 1E8FA 3AE2B 3SFEB 4FULA 2ZJAA 5H2FU 1WG8A 4M47A 1F52A 1VRAB 3T9PA 3TQ1A 2V1YA 3VXWA 2IBKA 4OALA 3AU4A 4PZFA 4LNFA 4QZIA 1R4MI 2GWSA 2NRXA 3ED5A 2D3GA 2I5HA 1ZQRA 4IG7B 4RQ6A 5G5HA 3KVFB 2IPIA 2WB1F 3FYHA 2R8IA 2E8OA 1T0RC 2RDGA 1PGAA 4LJXA 1WZ3A 3K9OB 2BTEA 4J56A 1WJ6A 5KT6A 4K1WA 4BXOA 3AU6A 1WMHB 3WU2U 3RAXA 4ANWA 3OJ3A 3THVA 4ICUA 4C8OA 4KX5A 9ICNA 1U48A 1MVKA 1RWSA 1K8RB 1WRDB 3CF6E 1GRGA 2WXIA 4UAYA 3AEVA 3QQ8B 4HKZE 3T3OA 3MTNB 4IQTA 5C23A 2ZZ0A 3P4QB 3THUA 3NVYB 2HBKA 5J2RA 1LM8B 4F8CB 1ONEA 2MBQA 3II4A 2Y9TA 3UGBB 1NK6A 2F8KA 4GGQA 3M3JA 4RUCA 4TUSA 1NK9A 2BPFA 2EDUA 1TBEA 2BVCA 2X8XX 1NKCA 3O0HA 2LI6A 1SXTA 4CNQA 4EZ9A 5IP4D 3QX7A 1UD7A 2CFYA 3NFUA 4YXMA 5C0YA 9ICGA 1EXNA 1E8GA 1C79A 3EA6A 3PTFC 9ICTA 1DGSA 1MUCA 3N6JA 4PJ0U 4J1OA 4Y2YA 1WY8A 3NVZA 2VKQA 4M9LA 4F4KA 1KKXA 3A9KA 4HPMB 1KKOA 3QFAA 1X42A 2J52A 2WGSA 3Q8EA 2V9HA 5FXDA 3SAGA 3BJYA 1Q3VA 3SQPA 1RQLA 2MJ3A 1ZQNA 4F2RA 5U1OA 2WDTB 1HA5A 4XWWA 1QOAA 4A3RA 2WPCA 1YEYA 2H3FA 4ENLA 3APCA 2RDJA 4GOCA 4H4RA 1NJYA 1L7PA 3Q8SB 3GIMA 5J04A 1Z2MA 5AI8A 1FRDA 3AE6B 4CF5A 1S97A 4KLDA 4W9LA 5KHQA 4HCHA 5L6GA 2W9AA 3TKAA 2W8KA 3NVWB 3GOEA 5AKKA 2AXRA 3KUZA 4IM2A 1F2RC 1NEKB 2VFSA 1MOKA 4QIWC 3SN0A 4Z6CA 2R2QA 2W3SA 1L7NA 5L1MA 3PZPA 2NRZA 4KLIA 3KJMA 1JQ4A 1TK8A 4HAIA 2NMQA 3RULA 2KN4A 2GL5A 4RQ5A 4KDIC 2RRDA 2PE6B 1WVFA 2A5UA 1GAQB 2DZMA 3V5CA 1ED1A 2DGZA 3KUDB 4JUZA 2IO0B 4Z6FA 1NI2A 3DGHA 3OZYA 5J2IA 1P1AA 4P1CC 4R64A 3PVLA 2JWUA 5AKYA 9ICRA 1I4PA 3R2TA 4RFBA 4XE0A 2KG5A 2EAPA 3B9JB 1V9PA 9ICEA 2AKZA 3L10B 1R6WA 3QZ7A 1UCVA 4N58A 4AP4C 1SV0A 4ZRIA 2HCFA 3T3NA 4O3SA 1ZQPA 2EZYA 3T79A 3DDMA 7ICVA 3H7PA 2E8PA 4EQWA 1GJZA 1SL2A 5TISU 4TV3A 5LXHA 1GB4A 1TKEA 4ZRQA 4YMNA 5LLIA 1ZGUB 4JWNA 3V60A 2PKEA 1T0SC 1FHVA 3PW2A 3C29A 4S17A 3HILA 2CU3A 3MGHA 2PFPA 2LYHA 1V1PA 3ETLA 1ROEA 2N1WA 2LGSA 4GFJA 4JQ9A 5J2DA 3ZNID 1KDHA 3PX4A 1GNUA 3Q6JA 3G6XA 3DPDA 3RI7C 5DB9A 4IUMB 4FXCA 3UIOB 5G5HB 2GGGA 8ICVA 2BWES 5FXPA 5BYRA 1W1OA 4LJPB 2XH0A 1XNSA 3RT3B 4IZGA 4JN7A 1FXTB 1TYTA 3TADA 2FNJB 1NPXA 2WQYB 4FDCB 3N7RC 3H7IA 4F50A 4BXOB 1NVID 4GISA 3DJJA 4KPLA 4HEA1 5D94A 1QLUA 3I99A 9ICXA 3GV5B 1O03A 4KLQA 1S7MA 4ED0A 3ZD8A 3MFIA 4PGXA 1IGDA 4R65A 1N61A 9ICFA 5HHDG 2FCNA 2VA3A 3DBRB 3DOWA 3RN9C 1DOYA 4TVWA 4EMJA 1MBTA 4DS4A 4PHAA 8ICHA 2BS2B 4RGMA 2K9XA 4HCDA 4KLTA 4QZGA 2IYDB 2W8LA 1SKRA 8ICAA 4JGHB 4A20A 4YWOA 3QUQA 1YZ6A 5J18A 1J7CA 1HJPA 3IP4B 4CHKA 1JWMD 1AW7A 3NZUA 2PLSA 3DG3A 4EUTA 2NO4A 5DBBA 2AGQA 3AL0B 3LADA 1MBBA 1H38A 4MEXA 4M04A 2J6TA 1V5OA 2YB4A 2K8HA 2HVHA 1ET6A 3AULA 4DXKA 1FXIA 2JXJA 3V4BA 1T0QC 1XWLA 4H4UA 4GLXA 4JWMA 3GV7B 1YQ4B 2GQTA 3WKAA 4DSIA 4MGIE 1Z1VA 3DEEA 1FCCC 4DQSA 2DYBA 3A9KB 4MM3A 5DPTA 3MQTA 3NVZB 2ESEA 4G0NB 2HJ1A 4O5KA 2W3RA 2XGZA 3H40A 2FUHB 4UB3A 1MG4A 2GGHA 1D8YA 2BHNA 1ZQEA 2QKQA 5TZVA 4RMAA 1KLVA 2W7PA 1PYWD 2XH7A 1FCLA 1VZ7A 3P93A 2Y9UA 2KLGA 2A3VA 4XRHA 1C76A 2AQ3B 1F0ZA 4DFDA 1J8CA 4F5NA 2KDBA 2QILA 2I5QA 3KLSX 1X2HA 1ZR6A 4WJ3B 2ZW0A 1PK1A 4KLOA 3RNFC 4MDKE 5J0YA 3BQTA 3H9DA 3V3XA 1WWVA 1BGXT 1RQNA 3R11A 5J0RA 3ONSA 2G09A 4JX1C 2BKFA 3SV4A 2DYOA 2WXKA 4O95A 4KEMA 3CAWA 2LXCA 4MGZE 3QNMA 4US8A 3L5KA 4PWCA 3N97B 4WH4A 4ED3A 3UXOA 5EWGA 4JMUA 2V4QA 2PFNA 4II2B 4Q2JA 3TW9A 3PT2B 5KG4A 1IYXA 2LASA 3RJ8A 4BURA 2LRWA 4JB3A 1CZPA 2PPGA 3DK4A 1SB3C 2AX5A 4IQWA 1VJ5A 1ZQBA 3TJIA 3U26A 3OHAA 2AJQA 1WM2A 1WWTA 2M1MA 2LRUA 2ONQA 2RDIA 2DWQA 3RD2A 1X6IA 2MRPA 3ZO5B 1YX6B 4W9HA 2WF6A 5AKJA 2F77X 4FBJB 1IBXA 9ICBA 2RDXA 2V3PA 4QZ9A 4B0EA 1ZMDA 4MGGA 5FJUA 4MFCA 1B1ZA 1EF5A 2KN7A 4A6GA 5TR3A 3AE8B 2W9CA 1U4BA 2K6DB 3VR9B 2XO7A 3CGDA 1XC9A 3DG6A 3DG7A 3PWIA 1V1PB 4ML8A 1FEBA 3ZLGA 3Q3JA 4KKJA 2W9BA 1L6NA 2CXYA 3AE3B 2VRRB 3R7RA 3ZDDA 1HE8A 2XGPA 5CHGA 3F2CA 1BPZA 2ZIWB 4Y2SA 3M9MB 1L6VA 4JE3B 5GMVA 5HHIA 3ZW3A 1BUIC 1L0YB 3KW5B 3W5VB 2LD9A 4DSLA 3RJEA 1ONFA 1ZQDA 2RABA 5I4DA 2V3BA 3FWAA 1L3VA 5G55A 7ICNA 3R1ZA 2JRZA 3HVZA 3PW4A 3SQIA 3V6EB 1F8WA 1MQ2A 4ZRKA 2DF4B 3CNHA 1RYRA 4NY8A 8ICZA 4ITKA 4QAYA 1CEZA 3POPA 3D2HA 2AL1A 1I4RA 3CW2C 2ZNVC 1FMAD 5JUMA 4DL6A 2HVIA 1TJEA 2QIEB 3GRSA 3T8QA 5KT4A 3M9NB 2KHWB 3AE4B 2BQUA 1B43A 4QZCA 4W9KA 1LO5D 1J2MA 1U47A 1UA1A 2ZXIA 1S1QB 1N60C 2GDQA 1S5LU 4BOSC 1MDRA 5J2KA 2FCQA 4Y2PA 2INDC 3V5FA 5IIKA 1N62C 1LKYA 4MGKE 2WAQC 2F3NA 2EZZA 4QW8A 1L3UA 5D49A 2E5AA 4J9MA 3L4PA 1V2YA 2HXTA 1ISNA 1YT3A 1SE3A 4DNSA 2VFTA 2L1AA 5D3DA 3CGBA 3H8SA 1TV9A 2KX3A 3CXOA 4N6EB 2K8BA 4M9NA 3QJZA 2FLPA 2QDDA 4EYHB 4DHJB 5A0LA 4CRXA 1DYQA 5AKIA 2MCNB 3BQ2A 4Q43A 4MH8A 1Q5WB 1TKKA 3BW7A 1JCTA 3N28A 4BUGA 5L1JA 1ZJNA 1CI4A 4MSMB 2KIVA 3RAQA 5D46A 7ICRA 2WOIA 4E5TA 1ZKHA 2I9GA 1NHRA 2LHTA 3FDSA 4IL0A 2OHFA 1PK1B 3HKZF 5ALEA 5K4LA 5IIOA 3EANA 2AQ4A 3IVFA 3GSYA 5BOMA 2EKIA 2GMIC 2BDUA 3DBLB 1DGJA 4DSJA 4L1BA 3EPIA 3GY1A 4EMWA 3PNCA 2QARA 1WJUA 2GOWA 2K39A 1VAOA 5J0OA 2O2VB 2MUTB 3RTVA 3JSVA 4BKGA 4EZKA 2GBNA 3ZDCA 3MY9A 8ICXA 2ZUBA 2I1KA 3UINB 2GBJA 4OCZA 4M0WA 2J0KA 5T8IA 2K6QA 2JEJA 5HMLA 3C5GA 4BAXA 2PP3A 4F2SA 4KWSA 4YT0B 4UATA 5IN7A 8ICPA 3GC2A 4J9NA 3UJEA 3VC8A 2KJ9A 3TQPA 2KVCA 4C0ZA 2WPEA 3RJGA 3R2IA 2RHFA 1IBXB 3BVGA 1KFTA 2AYOB 2E3TA 3KHHA 2OZ3A 4I28A 3PMLA 8ICBA 3DFYA 9ICWA 4HCPB 2AGOA 1F44A 3I57A 3URHA 8ICLA 5FKAC 3DWGC 4H4VA 3R10A 4JV1A 4CGZA 4G3IA 3D32A 2B76B 1N63C 2YY6A 3V6JA 3RH4A 3MUCA 3BQ7A 2W9CB 2ZJ5A 5D6JB 3ES7A 4PS3A 2W9BB 3QUTA 7ICQA 2A1AA 2FI1A 4NWIA 2KTQA 3EAOA 2I1QA 1W1RA 3DVGX 1FRRA 5G2NA 3AM9A 2UYZB 2Q4WA 2KNJA 3KZIU 3PVXA 4NLBA 1NELA 1ZQCA 5ALKA 8ICWA 5KFLA 4IM3A 1F5SA 2KMDA 1FEZA 2JR5A 1R4NI 3D2DA 2ZCCA 8ICRA 2I0KA 2UVUA 3DJGX 2KAJA 2MJDA 4I6PA 5KFWA 2QCZA 3LLBA 2WDVB 2FDRA 3BINA 2KLCA 4RU9A 2LGDA 4ED7A 3LDZE 4IWOA 1WGRA 4NLCA 1DOQA 4J03A 4GB9A 3BVMA 2A4ZA 2NPXA 5AI6A 2MP2A 3PRMB 1ZQZA 1XEEA 3NZ3A 2IO1B 4OD0A 2KV2A 3T5HA 2KWUB 1GC7A 1MI0A 5FK9C 3LAEA 2NQWA 4IC7B 2M9NA 3SN4A 2UVWA 4U7CA 3LJ3A 5KFPA 2MSED 4YCXA 2ZTDA 3P4SB 2Y0SC 3MP9A 4KLHA 4K7ZA 1P7EA 5AM1A 2KNBA 3PO0A 2BT6A 3L13A 4A3OA 4IM0A 4G7FA 2VFRA 2MBOA 4H2AA 3OZMA 4YP3A 2DX5B 4LNOA 2AL3A 3QEBZ 2L5YA 5AZHA 3BY4B 3WAMA 1ENFA 2K8BB 4PHPA 1WUFA 3EW9A 1WGKA 2Z7JA 1WXMA 2KYWA 9ICCA 1YOVB 1L7OA 5DB8A 1JWUD 2E8MA 4B9KA 2QJMA 2WXMA 2LVQA 5KG7A 2N9PC 1L3TA 1JXEA 3IHQB 2Q0ZX 1WXQA 5IO9A 2MSNA 4FZMA 4O9MA 4LK0M 1ZMCA 3BSMA 4HN8A 3ZNZB 1WVEA 2UVVA 1C4PA 1XD3B 3RJKA 4OVUA 2D3BA 5IIIA 4KZCA 2HI0A 4OHJA 4DL7A 2ATLA 2GRIA 1KN0A 1FNUA 4BJQA 4DEZA 4QIWF 5J0PA 3HM6X 4XDCA 4B95A 3UJRA 4I27A 1E8YA 3PLVA 4PYZA 1P7DA 1UT8A 3KKAC 2OEHA 1I35A 2ZTCA 2ZPYA 5HFYA 2WXGA 2QARB 1ZK7A 3S47A 4P7IA 1SL1A 3ZJUA 4IR1A 4JK1A 5GTIU 1TK5A 3RPFC 4P4OA 4A9AA 1GRHA 1Q1WA 4QWBA 3HX0A 4QWCA 4KPRA 2K4PA 3DVNU 3DIPA 4PZOA 1YMHE 4HRSA 1JMLA 4ZHPA 4M0WB 2PMZC 1E7PB 1OQQA 1PQSA 4A3PA 1SWVA 3H8MA 1UUPA 5KFEA 3PG6A 2IO2B 2H3ZA 5AKZA 2QKNA 1W1SA 1XU4A 5KFCA 3OPSA 1WX8A 2LKYA 9ICVA 5ALYA 2G45B 2JEGA 4I6NB 4O3PA 1OQRA 4DFPA 2HTHA 2CKHB 2QLTA 4R3DA 2AU0A 3WK8A 5KG5A 2EMSA 1I42A 1MN8A 2KOBA 1V8CA 1HEZE 3F2DA 1PDXA 5BMIA 5ALIA 3PSIA 1TKDA 2RPVA 5MPOA 2HXUA 1MRAA 3ONNA 4LZDA 3UCCA 3KD3A 5KFRA 5KAFU 4KX3A 4NJ7A 5AIAA 1ECQA 3UCDA 5J2AA 2AXTU 4HLEA 4UW9A 3KH0A 1V49A 1HSKA 3OJUA 1WUEA 1D9FA 4PK1A 1E8XA 2KT7A 4XWTA 1WRIA 2DFLA 3T5KA 4MEYA 1QCKA 1ZQMA 4B9TA 5CP2A 2KZRA 2M0AA 2AL2A 1E5WA 4HROA 3UJ2A 2MBEA 4FP1A 5J2HA 1QOGA 4BWMA 3JZUA 4UAUA 1RFAA 3NZGA 1RAXA 3BOXA 4DDGD 4LDTD 3Q3FA 4LLGM 5CHWA 1WMHA 2DZKA 5KFMA 4AQ7A 3B0YA 3AXCA 4HJKA 5J2GA 3TCSA 1T3NA 2FCMA 4B9UA 2ACZB 2Y1JA 5AUIA 1N60A 1W1KA 5KT7A 2IHMA 7ICJA 2BGFA 2HHSA 2HDEA 2IO3B 2PTWA 4MGYE 2BVHA 2JYEA 4DDID 3TI0A 1EO6A 2QJJA 1XO0A 4NJ8A 1N62A 4Q8FA 2MA9B 5BOEA 2OQYA 1VR9A 3MR5A 3LDAA 1CJEA 1VCBA 5ALLA 3NRWA 2M56B 3DBHB 5JHBA 3U7ZA 3UI3A 2MP2B 3CK5A 4HPNA 2KX0A 5KFHA 8ICEA 1K1QA 3MKCA 4XA5A 1MNSA 3CSFA 4EBDA 4H4ZA 3U52E 1XSNA 1WX7A 4AYBC 3H0LB 1Z00A 3Q8PB 1EWCA 5E79U 1GC6A 3DBLI 4Z6DA 4MACA 1JOAA 4LIIA 2O6VD 3IG5A 5J0QA 1ECWA 4CF3A 4KLUA 1L8OA 4F4RA 2N1VA 2GH1A 1BKHA 3ZNGC 2KFJA 4FE3A 1X1MA 4G8TA 1D5MC 4WJPA 4CO7A 1IYFA 1JEHA 4H4TA 1FEHA 5J0XA 3PX6A 2F8LA 3RB4A 4WURA 5J0WA 4KX6B 2EH9A 4QZBA 1KFDA 4ROPA 1ZQGA 3QZ8A 8ICTA 3BIID 4I2CA 4FBTA 2DZJA 5EU9A 3DESA 4I2DA 1NDDA 4ZRJA 4PPXA 2QHOA 2KHQA 2PKOA 3FM9A 4KLSA 2HD5B 4RNMA 4ED8A 1LV5A 4GGBA 4RCOA 4KN7A 4DWDA 4O3QA 2CR5A 3VUXA 1GO3F 3GO2A 9ICOA 3LYYA 4EZJA 1HUZA 2Q4TA 2JEFA 4E74A 1YIWA 4PT5A 4B6WA 4DO9A 1RXVA 1OW5A 1S10A 2WLBA 4JQWC 2GBKA 5CJ7A 3S1FA 1V80A 4KKIA 4ED2A 1SB3B 1WI0A 4GGHA 1RYSA 1OGWA 5FS6A 4CF4A 1Y56A 3VH3B 3CIRB 4YQWA 1XS9D 5ALVA 1XCTL 2C60A 2KZMA 2NCNA 4BV6A 3WK9A 2OLAA 4LJOB 5DPSA 2O6KA 5KT2A 3PO4A 1NJZA 3AN1A 4I2AA 1AWDA 3H6NA 3ZQ4A 2BDPA 2JZBB 4YG2A 1NYRA 1F0MA 3B9JA 2UU7A 1ZOLA 4N9F4 1SE2A 3UM9A 2JGAA 5FXFA 3QU2A 1ZY8A 2XY6A 2R18A 2NBVB 3PFRA 2OPJA 3TEWA 3URYA 4NM1A 1N63A 4ECTA 4M9HA 2KANA 4OW0A 3Q8MA 2KMMA 3C0RB 4AS1A 4B9SA 1P43A 1JMSA 2R8HA 3QKEA 5EWFA 3KLJA 4YN4A 1WGDA 3GIKA 4C8LA 1E6EB 1BPDA 5DB6A 1BPYA 3HW8A 2FMQA 5AZFA 1NHQA 2HZGA 1DK3A 4H4PA 3UPQA 4ED6A 2KZ3A 1FECA 2W03A 4EOYA 4C8KA 4J6IA 5J2EA 3OHBA 3N3KB 1XF5L 1GRFA 1K4QA 2P66A 3N9YC 5KFVA 1ZQ1C 2IA6A 3JYUA 3D47A 4QJFB 2V4RA 2KKCA 3VA8A 3JPSA 4KN4A 2AL2B 5KFIA 2JX5A 2PTZA 3LB8C 4NY0A 5EBKA 1WYGA 3ZKJC 4WQOB 3TWAA 1ZQUA 2MU2A 3A4SC 3PMNA 2LVOA 2VFVA 2AH5A 2ZNVB 1GERA 1YN3A 3AECB 3Q8QB 1J7BA 1ZD5A 5KFOA 1AHVA 3QAQA 3B0AA 2L05A 4E3CA 2DPIA 4WIPA 4YSYB 1BZLA 3S5SA 3ML9A 1XLPA 1FD6A 3M95A 3AQEA 1FFVA 1PZNA 5AK5A 3ZRFA 2N9KA 4EZLA 2YVJA 3IAS1 2AEHA 3A9JA 2HQMA 3NTUA 2JVCA 2KIWA 2LM4A 1WSPA 4H4WA 3U8ZA 2AQ0A 2JMGA 4I2HA 2J53A 2K0PA 2E8NA 1E7UA 3O65B 1TS4A 4XYCA 5JRTA 5KT3A 3NZSA 4H4SA 3ZI4A 4F3OA 2KDEB 3JVZX 3H7VA 4UB8U 3IDWA 5ALGA 1HQRD 1Z00B 2PTLA 4OZBA 4KV2A 2BYTA 3E2EA 4HPLB 3ZGZA 3P0WA 2LM1A 2N1RA 3ZVHA 2YX8A 2ZXHA 3A0BU 4XQ8A 1KFSA 2J6UA 1XXGA 2VJ5A 4RQ7A 4DFMA 2DYMA 7ICEA 1L8PA 2QC8A 1NU5A 4MJSB 1KLGD 2CU1A 1AROP 1SJCA 2WAQF 2PA6A 3IN5A 1SE4A 3EFUA 4KSKC 3U30A 5AKHA 3R25A 5FXEA 2UUVA 1E9IA 4DN1A 1SL0A 4II3B 1PUTA 3OLMD 3AQFA 4RGTA 3V05A 2LHDA 3H8AA 3ZXRA 4Y2XA 2RQ5A 3R9KA 1PDYA 4L23A 4Y2TA 5JCMA 3ES8A 5D79A 2ZIVA 5EDSA 3KKAA 3Q14C 5BPCA 1ZPSA 3DWMA 2M0XA 3CYMA 1F9JA 2MW5A 4XX5A 3TEZA 4Z6EA 1V81A 5CTRC 1N5WC 1RFKA 3I6TA 3IC9A 4I2JA 2XBBC 1TKGA 4TQRA 4GXBA 1UQVA 4A8XC 4R63A 3N30A 1T6BX 1UA0A 4HNLA 2OO6A 5JTIA 5G5GB 1DIQA 3ISDA 4DNAA 2E5SA 2XN9C 2XI9A 5AKLA 1XLNA 4ASWC 1BXTA 2KEYA 2GOLA 3HWTA 1QKZA 2R61A 3SU8X 1X2IA 4EWJA 5BMHA 3RBEA 3ISCA 3N1YC 2L8JA 1NHPA 4APNA 1ZQHA 4UB6U 3SYZA 1WR6E 1BPBA 3VCNA 3RITA 2WXOA 3F5EA 3PHWB 2E6XA 4I2GA 3OP2A 3K75D 5AI9A 4UB4A 5E6PA 4HWIB 4K8GA 4WWNA 3FW9A 3AEFB 2DPJA 2HOIA 1NK4A 4EYIB 2MBRA 5H8YE 2JUOA 3PRPB 2PI4A 3GP7A 3V6CB 4F91B 4ZHOA 2LJ5A 2OCEA 4B6JA 1SXDA 5DLGA 3Q8LA 3IJQA 2NYVA 2KC1A 1VLBA 1V59A 1A76A 2DL0A 3NHEB 1TE6A 3SSZA 3AV8A 3V7KA 2V3SA 4GIVA 1ZD2P 2CJOA 2RLTA 4E4FA 1KEJA 4G11A 4ECSA 1AHZA 3I3TB 4J9OA 1QT9A 2BVFA 2HOFA 1F77A 1IGCA 1KD0A 1C4AA 3TAQA 2V0GA 4Y2QA 1ZRMA 2BC0A 2NQLA 4NXZA 4F1SA 3A7AA 4RT3A 4J9RA 5HR7A 1ZDLA 1DZNA 3QIJA 3SFDB 4WAAA 4ED1A 1WZ0A 3F5AA 2KQ4X 4YSZB 3LWMA 2R8GA 5E6JA 4KDLB 4DHZE 2ZIWA 4X2PA 2B21A 3DCGA 3MJWA 1QSSA 5C5JA 3PS6A 3AE5B 3DEQA 3Q8RB 2V6OA 3GIJA 1MO9A 4M52A 3UQBA 2G0AA 3KHRA 7ICLA 3MR6A 3QARA 1XS2A 2OAIA 3S6JA 4DL5A 7ICFA 3IG3A 2WU2B 4IRKA 4F8RA 2I1JA 2GGEA 3CB3A 3PZ8A 4G9BA 1XSLA 5DGAA 3QCAA 1B4FA 2IGDA 1FO4A 4XDDA 2Y4GA 1U45A 4YXDB 1FPYA 5E6OA 1TE2A 3A9JB 3KTQA 1ZQFA 3PZDA 3CYJA 3WAOA 2K89A 5DQIA 2LGXA 3KQ4A 4YVZA 4NAWA 4J9KA 1KLUD 4GN1A 3JPTA 1T5XD 5KG6A 3D9XA 1Z1BA 1I19A 2MBHA 3RR1A 5D4BA 3NXLA 2NV3A 2A19A 2D3DA 1Q10A 1WXAA 1BPEA 5LNK1 2N0SB 2OYYA 3RJHA 3ZVHB 5HHZA 1KH0A 2ZEQA 4WJNA 3QA8A 2Y0SF 1RM6C 2BCUA 1J19A 4O5EA 1KW4A 1KTQA 1KM7A 2KDMA 3AB5A 3G6VA 3APFA 4MEMA 1LVLA 2IY1B 3HPFA 2JYTA 4C4VA 1GXFA 3A7RA 1NI3A 5AM3A 5F9NA 3B2GA 2AQ2B 2P6UA 4MSQB 3E56A 1VQZA 1L4DB 2Y5CA 1KL9A 2WXPA 3KYCD 2WXFA 2ZIVB 4ECWA 3Q3OC 1TY0A 1JI7A 2FPLA 4C80A 2KSOB 1NK5A 3PY8A 4LNIA 1BQGA 7ICIA 3RMKC 3N6HA 2H3VA 2JU6X 4ZH4A 1Z4OA 1STZA 2HTME 8ICJA 2PCEA 2Q85A 1W1LA 2K22A 9ICAA 2L52A 4QWAA 4KVGB 1C9FA 7ICTA 3U9IA 3DV9A 3PRZA 1X9WA 4RH6A 2AAQA 2N9LA 2O2VA 2MUTA 1P3QU 5GRTA 2F76X 5FP0A 3JPNA 5AI4A 4R8UB 2FIFA 3OJSA 1UGJA 3ETRA 2KXJA 1GRAA 2KACA 3ALRA 3ZJVA 1GV4A 3HJEA 4HPPA 1TAQA 2ASLA 1V38A 3GQCA 3FKYA 1NK0A 4MF2A 2ES6A 4DSEA 3BJSA 2NRTA 2PMZF 1V97A 2NRVA 3G6YA 3AI5A 4M9GA 3TSSA 3JS8A 1K53A 3NO1A 5ALRA 3DEDA 3V7JA 2LWPA 2KWCA 3TJPA 2Z8LA 3CXBA 2F1JA 2N9EB 3OJ4B 1BNOA 1ZQVA 5J8YC 3N32A 3LB8A 2A8XA 3L0WB 3SD7A 2CHZA 3Q8FA 3QLDA 3IFWB 2RD0A 5KHOA 3PPAA 4AP9A 3MZNA 2LYAA 9ICHA 3HP6A 2KE7A 1E9MA 3S1CA 4DQIA 4TUUA 1NBFC 2A1JA 3DERA 5KFGA 2KQSA 1NYQA 3B2FA 3HSUA 4LZGA 2QQ6A 4UARA 3SI8A 4GYPC 3C2LA 1GOZA 3QX1A 5AM0A 4F4XA 3MR2A 3GZNB 2PS2A 4ZDVA 8ICFA 1ZKQA 1QF6A 1W1JA 2INCC 2GSHA 2HHVA 1LVHA 1D3ZA 4F5OA 5AZGA 2OH2A 4NPNA 3VC5A 4K7SA 5AI0A 2G07A 1COKA 4WJOA 1NKBA 1JPMA 1FNVA 1PVRA 3A1QB 2OWOA 2VZKD 2L00B 3TEYA 2CN1A 2RP5A 4PL1A 1SBBB 2GBRA 3IHPC 3UXPA 4EQSA 3SZ2A 5DG7A 3KUMA 3W8XA 1UGMA 4ANUA 1WGGA 2XY5A 1W1MA 4QZAA 1WJNA 4K1RB 4NAWB 4FX9A 1TVAA 1WX9A 1X2GA 2ZJDA 2WTFA 1EF1A 1YQ3B 4RUAA 3FV9A 8ICKA 1FHUA 1PVQA 5KFYA 1TS2A 5EWEA 4AYBF 3DDCB 1JX4A 4PVKA 3TFSA 4AJWA 2JK6A 5J17A 3QN3A 2DW6A 4UB5A 1L4ZB 2M17A 3AEGB 4DBGA 2W11A 2EELA 1HTOA 3A4RA 5EE9A 3M8RA 1VDVA 3R8BA 2P4PA 4QZFA 3PW7A 5F3XB 2VH1A 3B08A 1JDFA 8ICQA 3J81j 4TQSA 3SBFA 4PHDA 4W9DA 2WS3B 4FZNA 4C4VB 4YD2A 2Y3RA 1JROA 1C7YA 1KTKA 2PE9A 4MH0E 4HCNB 2BCQA 2WU5B 2DHZA 5I1WA 3D6JA 1S0NA 1S3SG 2KVZA 4LA1A 4YMMA 4GXIA 2C7HA 4OO1J 5DDMA 4XZ4A 3ZDBA 3TSJA 2C2DA 3EGRA 2IGHA 3GD6A 1JN3A 5KL1B 4DHJD 3LVWA 4IL6U 1OFFA 4UDUC 4DWFA 4JN8A 1N48A 3VVWB 3M6KA 2GGJA 3H12A 5IAAC 3QUBA 2WF9A 4M8NA 1EC7A 3O0FA 3HW2A 4NL9C 4B9LA 1QSYA 2F1HA 1B9RA 3MFHA 3GD3A 3KHLA 1RRBA 3K1GA 5AM4A 1OUQA 1I4GA 1RVKA 4XGAB 3BQ1A 2JQRB 4TUQA 4MKSA 2WDQB 3ETRB 1WE6A 2H3QA 2VIXA 4UB2A 3TANA 2KJHB 3L54A 3TCAA 3VH4B 5AK3A 5KFQA 2YVSA 5BYSA 3RR8A 8ICGA 3AEAB 3HM3A 3VUWA 2H88B 5L83A 1S0OA 4QNLA 5IILA 1U49A 2I38A 2AHOB 2LBOA 3WKCA 1EU3A 2FKPA 3VFCA 2VAOA 3Q3MC 2XNAC 4K7WA 4EM3A 3DBRI 4G50A 3WKEA 5AKXA 8ICYA 4GDLA 4WWOA 5ALQA 4GMVA 2YQUA 3PW5A 1FXAA 1AYFA 1BMLC 3SV3A 4EC3A 1RPLA 3DHIC 3U4FA 4HJGE 1UNSA 3LWLA 3EWAA 1TYPA 3RNMA 1EUVB 2X99A 5C3JB 1WWUA 4BKTA 4ICAA 1UWMA 3RRGA 3EECA 3P4RB 5FR3A 3UQAA 3R0KA 4JB1A 2W04A 4WJQA 5KAIU 2BS3B 2A1JB 1MFWA 2F5ZA 2XCAA 1E7VA 2P6RA 3EUB3 3FW8A 1KN5A 2WXRA 3RJIA 4NM2A 2JEIA 3NRZA 2PLPA 3W5UB 5JCNA 4YL8A 2IMWP 2BPCA 2ISPA 1UBQA 4AWJA 2XCPA 5U25A 1KBUA 2GQUA 5J0TA 2G4DB 2P3ZA 1KLNA 4PWBA 3T3FA 2J7QB 3N20C 2HOQA 3TOYA 2RGFA 1M4VA 5ALHA 2TPRA 2BB6A 4B0MA 2WP9B 3FILB 2KVRA 2YEPB 1TFRA 4HDQA 5KG1A 5AE3A 8ICMA 1ESFA 4I2IA 1SXEA 4YFKA 3RB0A 2XVTA 2UVRA 4Q45A 1UPHA 5LXIB 3VQIA 1H4RA 4H4XA 1R7SA 2UUUA 2QPMA 3LYSA 4BKSD 2EQ6A 2REXA 4UAZA 1Z3EB 4DL4A 5J0UA 3BYTB 2ZZCA 5AK4A 4P6VF 3QXGA 2BPSA 2ZZBA 2KJ5A 3L17A 3R7QA 4UAWA 5EE3A 4ICVA 1TS5A 2X8GA 2VH2A 1VZ6A 5DDYA 2YEPF 4KLEA 5L6FA 4DK5A 3MJ5A 4H4YA 3PSFA 3VC6A 2K4IA 1UF0A 2EKEC 3MGVA 4OJLA 4BVUC 4H19A 1IUEA 3FW7A 1KCZA 5IDZA 5DG8A 4XUSA 3EYZA 3Q8CA 1PUZA 2BF8B 2O6VA 2GI9A 3RYTA 3TX1A 4PHEA 1X9XA 8ICCA 2PEAA 3MR3A 2WHIA 3KBBA 1X6JA 3P42A 3TACB 1IP9A 5EE1A 4P1BC 4L2YA 5CHFA 1KFYB 4BZAA 2F44A 1HZ6A 1XQQA 1KOTA 4EBCA 4DSFA 1CRXA 3I9V1 1R4MB 2CHWA 4RQ4A 1EC8A 4HYRA 4ZA0A 2C7MB 4US9A 1ZQTA 3QU9A 1DNCA 5KFUA 4FHJA 3R3MA 4PVEA 2QB0A 4K81A 3OPXA 1QTMA 3V62A 1Z5SB 4NZLB 2FLNA 2YMLA 4KMOB 4REZA 4OJOA 1WXVA 3HPOA 3W1YA 1ZQYA 5HI1A 1ACCA 2INPE 2AWTA 4Y2RA 2KKPA 1G6JA 3GZNI 4RPZA 2JZBA 4YTNB 5KFTA 4FJZA 1OJTA 4Z1YA 1DK2A 4EEYA 1RXWA 5CRXA 2GR0A 5ALMA 3N1XC 2YQEA 4WWMA 2ASJA 4KT2A 3AMZA 5J8YA 2YAUA 2JH1A 1ZQLA 2BZFA 4YR3A 1ZDXA 3CMMB 5KVHA 2PGWA 1D5ZC 3F2BA 4URKA 4F72A 2LUEA 2KDFB 8ICIA 4TSSA 3QFBA 4QWEA 2QB1A 1C4CA 3DQVA 3FYYA 1A77A 2GH5A 1ZQAA 1XLQA 1MHXA 1JW9D 4H2HA 3NUHB 1MHHE 1ZRNA 1SKSA 2WXHA 3V7LA 2ON8A 4GDLB 4P16A 2NRWA 4GYPA 3MBYA 9ICIA 2KFNA 1IPGA 2N9XA 1U4AA 3R66C 4M01A 3UJFA 1QQRA 2UWQA 4K4HA 4K4GA 4F5PA 2JWZA 4MELA 2IPKD 3H0RB 4WQMA 7ICSA 1GRBA 2Y1IA 3Q2AC 2VJ4A 1P98A 1YNTE 3PWGA 1ELSA 4JPSA 5KG3A 3GS2A 4F71A 1ZD3A 2P8BA 3NRZB 4DS5A 4EEWA 3IT4B 1I4QA 1YN5A 2LYBA 2W43A 2W0HA 4FJVB 2ONEA 4RQ3A 1BT0A 2R8JA 1QOFA 2MH7A 4IRDA 3UXLA 3GE3C 2KP7A 1IIPA 4Y2JA 2G06A 4KSLC 4ECYA 3RJFA 2TSSA 1N5XA 4ANVA 2V9WA 2PIAA 3C5FA 4DFJA 4X57B 5DLFA 4NEWA 2HSZA 1L3SA 4GLSC 5AE1A 1ZD4A 1ZE3D 1D5XC 4LDTB 2WF8A 3N4MB 4DXAB 3PSEB 3NG0A 5L1KA 3PX0A 2D07B 3SN1A 1ZP0B 4M9JA 1RM6B 1NZPA 4GXKA 3KUCB 4GRTA 4IP4A 2ZIXB 2HBMA 5EOZA 2KWVB 2MEKA 3ABVB 3AU2A 7ICHA 2KQ7A 3OAWA 2IJ0A 3GFKB 5L1IA 1TYGB 3ZLFA 4RT2A 3ENLA 3HIZA 3IBEA 4BC9A 2N4FA 3RNAC 3HVDA 5JXVA 1E10A 4EE2A 2CPRA 9ICSA 1NK8A 3UJSA 4DL2A 1DXSA 1WGHA 4MJSA 4TURA 2KWDA 1Q46A 3TBLD 4ECQA 1SE9A 5DGBA 3UMBA 1S8OA 5EE0A 4EX7A 4HYKA 3DVNV 3QC8B 4ANXA 1FIQA 3MWCA 1PFDA 4FLHA 4K3BA 2JZZA 5ER0A 2O6VB 2WXJA 4TQ1A 4FS2A 1Y88A 4C4RA 1JWSD 2MJEA 3Q6BA 4DX3A 4RQ8A 2HHUA 1TTNA 4MF8A 4JWUC 2ODGA 2D8CA 1ZXHA 4ECUA 5D2MB 4TQ0A 3D46A 4NL9A 3IAM1 2BS4B 1S0MA 1SF0A 2G4SA 1ZDVA 2EQYA 1PDZA 2EANA 2C9WB 3TARA 5KFJA 1RZTA 1P0RA 4W9GA 1NJXA 2PTXA 2KTRA 1QOBA 3UMCA 5HNKA 4ARCA 3I6EA 2QB0B 2OM6A 5G5GA 2J0MA 1FFUC 2PPHA 2QDEA 2FUG1 2DW7A 4GC6A 2FIDA 2HW3A 2O3GA 5J2JA 2D5GA 2JZ3B 4EBEA 2CHXA 2YB1A 4JHMA 8ICUA 3SMVA 2K8AA 2J42A 9ICLA 2KN5A 1EWYC 2B6GA 5D3IB 1QLBB 1WE7A 3PK7A 2NBUA 2OZ8A 1GEUA 3S1DA 5ALXA 1PK3A 1QQ6A 4FS1A 2HJ8A 4MLAA 2Y08A 2BR0A 3X23A 2J3NA 1J97A 2AL6A 4PGYA 1XT9B 4KZ0A 4DLGA 4DOBA 3MC1A 2MNRA 1F3PA 3D2SA 5HMRA 3AEBB 4RGOS 2KC2A 1DRGA 3W9CB 3ALBA 3H1UA 1L2NA 1TY2A 4OVVA 2KTFA 3TMPB 3VUYA 2FCSA 2SEBD 4RGNA 2IGGA 3KHGA 2KFKA 3IT6B 1P48A 2HNEA 1QH9A 2KVSA 3BS5B 4O3OA 3VTVA 4BBYA 1SJBA 1WR1A 5KTQA 3OW1A 2NBWB 1L0VB 2GR3A 3RNGC 1L7MA 2Y5PA 2QDFA 1ZX9A 1LQBA 2D11A 1QSLA 2QVHA 2H5XA 3H8HA 4O3NA 2DNFA 3JPQA 3C1YA 3L3FX 3NS1A 1BNPA 1F2RI 2RK5A 4J9PA 2DUYA 2PVGC 2HMXA 3TTEA 2G5HB 2G5IB 4BBNC 3NGDA 1SGGA 2LMCA 1S9FA 2W55A 3BZKA 1Q3UA 5AIBA 1Q1OA 2BCSA 1SJED 1DXLA 3FJ4A 5FJPA 5DBAA 1SJAA 5DCNA 2PMQA 4IKGA 3N4EA 1Z4NA 3RCYA 2K5PA 2VFUA 1K5OA 1C3TA 2EAMA 5CWRA 2G08A 2FJ6A 5KFBA 1V1OA 1J2NA 5F9LA 2IBIB 3AH7A 2NVKX 4Q44A 5AKGA 3FXGA 3QU5A 1SJHD 3UQ2A 4ADWA 3V61A 3ZNHB 3VDZA 4C56C 1MC8A 2I6XA 4ZYNA 3HT3A 2K25A 5C2TB 2WP5A 1YQBA 4R66A 2ZVOA 2PI5A 5DQHA 3VTUA 1D7YA 1HIWA 4QZHA 1LFDA 3SENA 3W8ZA 3LVVA 5ALDA 2PP1A 3QHTA 1JWAD 2ZG6A 1JCKB 2SAKA 4GR1A 2FAZA 1AQ6A 4DXGA 5JCKA 1AOGA 3GB1A 3DQ0A 1D6EC 1YD8U 1WUDA 3QK0A 2DQNB 5JCLA 4HK2A 2DAJA 3H4BA 2L83A 3PGEA 5HR6A 1WFYA 1T8EA 1ZW7A 4P0QA 2J0JA 4UAVA 2WX0A 2VANA 1FIQB 2OKTA 3RJAA 1WF9A 3TIXA 2MAXA 5AKEA 4YXJA 3JPOA 2C7NB 1B0XA 4YR2A 2WXNA 3AE9B 3VFKA 2BKRB 4F5RA 5ENLA 5FJTA 5HHHA 4DOAA 3SHQA 2R8DA 3JPPA 3E0FA 2BVGA 4EEKA 4ELUA 3P3BA 3C21A 3SQSA 1WGYA 3U2SC 2KSOA 2WX1A 3RF9A 2ZCBA 1I4HA 3ENEA 3VHTC 3ZIMA 1F1HA 1GESA 3CGEA 5L1LA 5DKWA 8ICOA 4BDPA 1N2XA 1WCNA 3M7DA 4IQVA 2KTRB 2MBBB 3NOBA 4J3OD 2X8CA 3W1SC 4KLFA 4ECZA 1RDFA 1D8BA 4J9LA 1E8ZA 4RF1A 1P7FA 3LXFA 2WOWA 1NHSA 2KJ8A 3WANA 1IG6A 1JRUA 3C28A 2XY7A 1KF6B 4DOCA 1Y8RC 4R8UA 3AE7B 3EFCA 4LNKA 4F7ZA 3RR7A 4PYUA 2LZ6A 4EZ6A 5BOFA 2ZIUA 4FHKA 4BWJA 1VD2A 3RNCC 2C3CA 5FS7A 1SIFA 5B66U 3P1MA 3ZXVA 4DHGA 3D2JA 4EKUA 2JRIB 1D8LA 2WP6A 3I63C 5J2CA 2CRXA 4EMIA 2Q5WD 4U6PA 4ECVA 3OSNA 4TUPA 2E1FA 1T7PA 3WK4A 3DBHI 1JUDA 1MPEA 3EKGA 3OWEB 3MDAA 2ZZPB 4H4QA 3I4KA 3PREA 1BPXA 7ICOA 1STEA 5KFNA 1KRPA 2ZUCA 4NJCA 4RNAA 5ADZA 3H8WA 2ZC8A 4LTUA 3ZTCA 2G9HD 1NDAA 2KFKB 5FS8A 3PSPA 4DF4A 4UBCA 4ELVA 1L7YA 4BX9C 1TKYA 1GETA 4HCLA 4LVSA 2KJ6A 4M02A 3U7DA 1Q0WB 3L08A 4MFAA 6ENLA 4JLCA 2P3HA 4PVHA 3MHSD 4I2EA 1MQ3A 2HHXA 4OZCA 3BQ0A 3NS1B 4FO6A 3T4WA 4BOZB 4P4PA 3H4KA 3TUOA 4YR0A 1R0MA 4BGDA 7ICPA 1ET9A 2IZVB 2XSXA 3AU5A 2KKVA 5ALNA 5J2BA 1XLOA 1NKEA 4XC2A 4ARIA 3HUIA 4DQOC 3PR4A 3A1QA 2C3DA 2XICA 4KLLA 3K1RB 4QW9A 4F4YA 3B0XA 2B0CA 4KMUA 3QUCA 1P9DU 4Y2UA 3BZCA 2CJNA 3WCQA 1DIIA 3MC0B 2V3AA 3ZD9A 4NLZA 2KZZA 1SGHA 1ZQQA 3GE8C 2NTTA 1JPDX 3U4EG 3MDCA 4NEVA 4W9JA 4IC9A 1XCQL 2G1EA 3ECIA 2D3CA 4PVJA 5AM5A 5DPRA 1CK1A 1L8LA 4UASA 5K8EA 4KGRA 5IIMA 3TJ4A 3ZDEA 2Y5BB 5KFSA 1I4XA 2LEKA 1LGRA 1YJJA 2WYQA 3NY5A 3RZFA 3EF6A 3SAHA 3V6KA 4PZNA 3VCBA 3V3WA 2F2AB 5AWVA 2MA1A 4ZOHC 3RRHA 4FJYA 2VA2A 1IV8A 9ICQA 1JWBD 2K8CA 3X0WA 4DXFA 3T9LA 3CGCA 2R2ZA 2MQJA 4F93B 3OGUA 4TKNA 1ZQKA 2BYFA 4IR9A 3BZDB 2PTYA 2DKZA 5ALPA 3HRDD 1A70A 4QWDA 1C77A 1UELA 4HG0A 3D2QA 5IINA 2BBCA 5KL8B 4EENA 2FPKA 4P0QB 2JXTA 1FFUA 7ICGA 3BK2A 3ZVVA 2KD1A 4WAFA 1V9JA 9ICUA 3Q8AA 1E90A 4OJ6A 1Z19A 3PM9A 3WKDA 4RZRA 2BC1A 5KT5A 3ZVIA 2PW9A 3UXNA 4PH5A 3AEDB 2KICA 4DWIA 2W54A 5D7GA 3H70A 4E71A 3Q8BA 2P0IA 2Z59B 3ORYA 7ICMA 4GFIA 2W9MA 4A55A 2WBAA 3VRAB 2GGIA 2JRHA 2FLLA 4FN2A 2WF7A 3K4GA 2CDUA 1YQZA 2O56A 4M6UA 4EQXA 1W6TA 5L9XA 3WK5A 3TFRA 1R4NB 2WXQA 3BK1A 4USAA 2FPMA 3WK6A 1TS3A 2OJWA 5IIJA 5GTHU 3CWIA 2M19A 1NZBA 4KLMA 2DENB 2WNMA 2LFIA 4RQNA 3KWVA 5HG2A 1XO3A 4W9IA 4I2BA 2DLBA 2LVPA 4TVYA 3WIMA 5IKCM 5HP4A 1JRPA 2D3AA 2L0FA 2N7DA 2K1FA 2PU0A 4IWPA 2EZXA 1L5UA 2KK8A 4A6QA 2ZIUB 1J0GA 5KFZA 2C2EA 5CEHA 2ZPNA 4RM9A 5BYQA 2QMTA 1F9CA 2PLIA 1MSWD 3IK4A 2QAEA 2NPTA 1UH6A 3GRTA 4IHCA 4H50A 2PXIA 2K3UA 3RNEC 4YWGG 3FCPA 4PGQA 4ACFA 2Z0DB 1YZ7A 5AE2A 4JAYA 1SZHA 3D2NA 1GRTA 1OEPA 2FYMA 3DDHA 3DHGC 1CMXB 4NNJB 4KIKA 4OJ5A 3BDPA 1X9SA 2P35A 3C23A 3QEAZ 2J6SA 2YLMA 1AHUA 3WKBA 2LGYA 4AUQC 4B9VA 2FMPA 3L8KA 4FI4A 3NUQA 3JPRA 4Z17A 4E4UA 1PGBA 4M00A 3RRAA 3SEIA 2CHRA 2K4EA 3C2KA 8ICSA 2BYEA 3RUIB 3GZFA 4J9QA 2KDIA 1ZQSA 2AGPA 2PVOD 5H92C 4RPYA 2ZVNA 4K7UA 1H6VA 4O5CA 3K1ZA 1ZETA 5E6NA 4MHVA 1XANA 4I29A 2R2OA 4S0RA 3I76A 3H7PB 4TMAB 5KNIA 3PV8A 4A35A 4NAMA 4GU2A 2AQ1B 4RF0A 1HXYD 3MC9A 1F0XA 1FEAA 4JWSC 2PFOA 3LXDA 1N6ZA 4HXDA 2PODA 3CP8A 2ZJ8A 3MABA 3QPEA 2C22A 3FILA 2XK5A 4RQ0A 4IS7A 1VJKA 4YTPB 4CCHA 4KTQA 3UIPB 1WXSA 2MUCA 3Q69A 5FMHA 2RSUA 2KHVA 1YX5B 3H8JA 3OC4A 3TWBA 2WB1C 3N7PD 2IDYA 2MLBA 4M2YA 5J29A 1IM4A 2NR2A 4C7ZA 1PGXA 3SAFA 2EQ7A 4JL9A 1HEKA 4DL3A 3AEEB 2JSVX 3L16A 4FFDA 2VZKB 3QWZB 4PS8A 3P2BA 4K4IA 4ACOA 1TZOA 4BFRA 1B22A 4RQMA 1WH3A 3ZDMC 4C4SA 4MT5A 2WXLA 4WWPA 2ZADA 3P63A 2JV3A 2K8CB 2JZPA 4RQ2A 4BKSA 4GDKA 2W82A 4B9MA 4F92B 1N5WA 2EXRA 4RPXA 4F4WA 3Q8KA 4DSKA 1OTRB 2OXOA 2D10A 4OZAA 1X40A 3W1SA 1A6SA 4IL2A 1TAUA 4HKQA 2X38A 1KRHA 1ZXIC 4KLGA 2IOFA 2POZA 4W9EA 3RJJA 1GSNA 3IM1A 3RCZA 4DHZB 3TSHA 2JH7A 2KMCA 5FJRA 3IRUA 1K1SA 2BPGA 3E58A 2FE8A 3O13A 5DQGA 3FVDA 4NQLB 3SR6A 3HK0A 1AARA 3R07C 2ISOA 2L3ZA 2LHEA 1O08A 3DBSA 3CT2A 1QLTA 2KO3A 3K9PB 4QZ8A 4MM3B 3WK7A 1FNWA 3PR5B 2GLSA 3ICXA 3RZWC 2GO7A 3RFAA 2RR9A 3C2MA 4NJ6A 4E8GA 3FC4A 4GC7A 1K51A 4GIBA 3M1YA 5KFAA 2LI5A 1SJDA 2EQ8A 3N7SC 3H4DA 1CUKA 3DH9A 3E9SA 2GRTA 4ZYSA 3FAHA 1KJTA 1WIAA 2LGIA 4DCCA 2FBWB 3KFUF 1GG3A 2OEDA 1QQ5A 2ASDA 2ASQA 3ZUNA 4UB1A 4IW0A 2PFQA 2NPTB 2LMRA 2XEWA 3BS7A 2DZIA 2NS5A 2QEJC 4HVBA 1UHUA 5KFFA 3UQ0A 2YMPA 2IOFK 1JXLA 1SKWA 4W9FA 5ALZA 3P4PB 3ZYYX 5BOLA 3PV1A 3ZRCA 4RQ1A 3V72A 4UQGA 4KIKB 2HDOA 2D2QA 2VA8A 3LK9A 1EBGA 2JXXA 2M8SA 2QSDA 4EFOA 3I1YA 1UT5A 4DLEA 1EBHA 3H0MB 4ZRPA 4C8MA 7ICUA 1SV4A 1WYWB 5B5EU 2HBJA 3WA0A 1UWXA 1T3QC 4ELTA 3JW7A 4J9SA 4IRCA 3V6HA 4A90A 3QU4A 1SSNA 1OQYA 4YSXB 2ZTEA 1WCLA 1EC9A 1EU4A 2OZTA 4DQRA 4D2KA 2XH2A 2ALZA 2WOVA 3PQBA 2X50A 1M6YA 1TZ1A 3I5JC 3GDXA 1U9LA 3KOOA 5KFKA 3SEBA 2WF5A 3GILA 3NVVA 1HUOA 9ICPA 1COOA 4NLGA 4IP5A 3RO6A 3UXKA 2M4NA 3MSYA 1T4GA 1MA7A 1DOIA 4M0XA 4IQUA 4GIRA 3RBDA 2LJIA 4DYEA 2GQWA 4P0PA 2N7JA 4BBNF 5JZEB 4FBUA 3RB3A 4B9NA 1M6IA 3QYPA 2XK5B 3ZLZA 2OVLA 3SJNA 4NLNA 2JT4B 2J4XA 3J9CA 2PMVA 3M8SA 3C1ZA 2RPQA 4IT1A 4UBBA 2AKMA 2QJNA 5KG0A 3M63B 2B3AA 4OVZA 3MHZA 1GUAB 1KKRA 4C00A 1SEBD 3UGVA 2ZIXA 4O0IA 3B1LX 3VR8B 2H89B 4M0AA 2PP0A 5I1VA 3AE1B 2ICIA 2DBYA 3C8YA 3VTWA 3DVGY 5JU5A 4CDGA 3IXSA 3DK8A 2HHWA 1YN4A 2R8KA 2BKEA 4JV2A 1EBDA 3M9OB 2BWFA 4EX6A 3CRXA 1S76D 5ALSA 2DKXA 2L7RA 4RNNA 3UMGA 4K8DA 7ICKA 3RGTA 4HNCA 2BQ3A 1MJDA 2MHJA 4GDKB 5BO4B 4I6LB 2C2RA 2NO5A 5AI5A 5ALWA 2HHTA 4Q8EA 9ICKA 1LPFA 5AHXA 4C7YA 2RDBC 3STPA 3A0HU 3T5LA 3GU3A 9ICMA 1WJ4A 3NJTA 2CS4A 3BVZA 3IG8A 1TIFA 2YVCA 3GV8B 2FMSA 3VAWA 1FFVC 3KYDD 1Q1RA 2OOBB 3C19A 3TEXA 2QGYA 4ZCWA 1TK0A 1Q8KA 4GSWA 2K60A 2OJRA 1JALA 3NS8A 4W9CA 1LKYB 1SZPA 3M62B 3SR6B 3RNBC 2Y3AA 1ZJMA 4BC7A 3ML8A 5JH5C 3AUOA 1L5PA 4LCDE 1XPYA 3APDA 1K50A 2WHEA 1RYUA 1WM3A 3MFGA 2N7EA 3RFZB 3I28A 5JRBA 2IY0B 1QILA 1IXRA 1VZ8A 2BB5A 3ZTDA 2NVUI 7ENLA 3OTRA 1K52A 2Y3SA 3HRDC 2BQRA 4KGTA 4A8EA 4PL2A 5AUKA 3IV6A 3QTPA 3DHHC 2IHNA 5CB1A 3N4FA 4P4MA 4FZLA 2MWSB 3BYYB 4OJPA 4IOIE 2E1EA 3Q45A 3QE9Y 2PGEA 4JDRA 5DPWA 3S1EA 5CR0A 3B97A 4PS7A 4GXJA 1UZXB 3WAPA 3S2AA 2YN4A 3T5JA 2KFZA 1DOXA 5AK6A 3A7UA 2GBMA 4UD8A 4CQNA 4YWSA 2V4IB 4NLKA 3MGIA 3CSTA 4XLOA 4M8MA 3RH6A 5CX3A 2BCVA 2L76A 3IJLA 3KZXA 3QU7A 3UF8A 4N59A 4NV0A 1MG8A 2W9NA 1ZQIA 4O3RA 1AN8A 3L5OA 4E6MA 2HBLA 2YMMA 3SD5A 1E0ZA 5TR5A 3M6ZA 2XC9A 5DG9A 3JSVB 3GIIA 4FA6A 1E8WA 3PW0A 2LXAA 3EC8A 1L0XB 3BS5A 4M6WA 5ALOA 1N56A 2P8CA 2W7OA 4HDOA 3NASA 5CHVC 3ZDAA 1ZQXA 5FJOA 2OFJA 4MFFA 4GMEA 3TAPA 1EM7A 3Q3NC 5FS9A 1NK7A 1ZOYB 4DQQA 5ALUA 2WFAA 1T0YA 2L32A 1XO1A 4LNNA 1E8HA 1S77D 2L0TA 4RM8A 3PO5A 1D9DA 2ZW1A 3NVVB 3Q4DA 2IOHA 1I7HA 3PZ7A 1ZQOA 1TGZB 3WALA 3DFHA 1NJWA 1TT5B 5TSSA 5KG2A 3SDLC 1SV0C 4H83A 4YTMB 2KMAA 4P0PB 1X9MA 1J7AA 4CYEA 3OTQA 2EAOA 5AM2A 1QLNA 1T94A 1RYJA 3DGBA 4G3XB 4ZOHB 2KK0A 5KVIA 2HHQA 1D4BA 1BWCA 2FE9A 2JHDA 1ZYQA 1JIHA 1URJA 2LPEA 2XGQA 1YJ1A 2RMMA 3PHXB 2BYVE 5AEKB 4ECRA 1C78A 3DK9A 2YVFA 5ALTA 2BGWA 3W8WA 2GB1A 3W2DA 2KOXA 1SWWA 4I2FA 1ZQWA 1ZXIA 3N1ZC 1QQ7A 4F5QA 2YVGA 2MRLA 3MC8A 3VDGA 3R0UA 4J57A 4IDIA 4K2SA 1XDIA 3TL5A 3NVYA 9ICJA 2PSNA 3ZJTA 1UBIA 2YMQA 4FADA 1MDLA 5L95C 3F53A 1XHCA 4EQRA 4P2HA 4CE6A 2MX2A 2BCPA 3TADC 3VTEA 3OG5A 1A0PA 4RNOA 3BWUD 2R9ZA 1CQVA 2QJLA 5IA7A 4QZEA 4EM4A 4JV0A 2DAFA 3DGZA 3FG2P 4DFKA 1NENB 1LXDA 5HMMA 1X66A 5ALJA 4EELA 4X5VA 2V4LA 2P13A 1NNLA 1HTQA 3EZ5A 2V3NA 2XIDA 2XH4A 4H1ZA 2PU1A 1BVSA 5JHAA 1N61C 3ZLHA 2BCRA 3IJIA 1UXYA 3EUB2 5J2FA 3VRBB 5DBCA 1V6EA 1YJIA 2K4HA 2EMTA 2INNE 4YD1A 5DB7A 2D6FC 2OX4A 1KQQA 4J3ZA 8ICNA 3JVAA 1HZ5A 1OEYA
chains in the Genus database with same CATH topology
1MPEA 1QF6A 3OWEB 1W1JA 1MI0A 2WDRB 5FK9C 3LAEA 2NQWA 5BMGA 1ZUD2 1STEA 3NVWA 4KGSA 4NJCA 4RNAA 5ADZA 3P4SB 4LTUA 3MP9A 1FNVA 3C0PA 2G9HD 2VZKD 1P7EA 3TEYA 2BW2A 1SBBB 1GPXA 3PO0A 2BT6A 2VFRA 1TKYA 5HQXA 3W8XA 4H2AA 2I2YA 1T3QA 1W1MA 2P3HA 1E0YA 4PVHA 1ENFA 4NAWB 1WGKA 2WDWA 4OZCA 3NS1B 1X2GA 1YQ3B 3TUOA 1ET9A 1JWUD 1TS2A 1XLOA 2WXMA 4PVKA 2NTSA 4ARIA 3HUIA 4DQOC 1WXQA 4PYTA 5GXGB 4LK0M 1L4ZB 3AEGB 1WVEA 2CJNA 2EELA 3WCQA 1C4PA 1FM0D 3MC0B 5EE9A 1SIJA 1VDVA 2LUMA 4OHJA 3R8BA 1GB1A 2P4PA 2GRIA 1FNUA 2NTTA 4XDCA 3U4EG 2G1EA 1XCQL 4PVJA 1CK1A 2WS3B 2Y3RA 1JROA 1KTKA 5K8EA 4KGRA 2WXGA 4O1NA 2RDHA 5HFYA 1W1QA 3ZJUA 2WU5B 4BCAA 5I1WA 3RPFC 1I4XA 1L6UA 2LEKA 1YJJA 3KWLA 4A9AA 3AE2B 1E8FA 3SFEB 5AWVA 1VRAB 3TSJA 4ZOHC 1YMHE 3EGRA 4HRSA 4DXFA 1JMLA 1JWBD 2IGHA 1E7PB 4OALA 1OQQA 2R2ZA 4PZFA 1UUPA 1OFFA 4UDUC 2QKNA 3BZDB 1W1SA 1A70A 3HRDD 5G5HA 1C77A 4HG0A 2IPIA 1OQRA 2BBCA 2JXTA 3BK2A 4ZHPA 1FFUA 4R3DA 2RDGA 1B9RA 1PGAA 4WAFA 3Q8AA 2BTEA 3PM9A 1V8CA 1I4GA 2PW9A 1HEZE 1PDXA 3AEDB 5BMIA 2JQRB 2W54A 2RPVA 5MPOA 2WDQB 5D7GA 3ETRB 3Q8BA 1MVKA 1RWSA 4A55A 3VRAB 2WXIA 2YVSA 4HKZE 5BYSA 3AEAB 3T3OA 3P4QB 1HSKA 2H88B 3NVYB 4XWTA 1WRIA 2I38A 2VAOA 2M0AA 1EU3A 4HROA 2XNAC 1QOGA 2WXQA 3BK1A 4USAA 1TS3A 3CWIA 2M19A 2WNMA 5HG2A 3KWVA 2LFIA 4LLGM 1XO3A 2DLBA 1FXAA 1AYFA 1BMLC 1SXTA 4AQ7A 4TVYA 1JRPA 4EC3A 4HJGE 1UNSA 1E8GA 1C79A 2ACZB 3EA6A 5AUIA 1N60A 4A6QA 5C3JB 2HDEA 5BYQA 1W1KA 2QMTA 1UWMA 2PLIA 3BW7A 2BVHA 3NVZA 2JYEA 3P4RB 5FR3A 4JB1A 2J52A 3Q8EA 1N62A 5FXDA 2BS3B 2K3UA 1VR9A 4YWGG 2MJ3A 1CJEA 2M56B 5AE2A 3EUB3 3U7ZA 3UI3A 1HA5A 4XWWA 1QOAA 3FW8A 2WXRA 4JAYA 3NRZA 2PLPA 3W5UB 2GQUA 3U52E 1DIIA 1EWCA 4MACA 4PWBA 1FRDA 3AE6B 1AHUA 5L6GA 1M4VA 2BB6A 4B0MA 3NVWB 2AXRA 2WP9B 1PGBA 1F2RC 3FILB 2YEPB 1NEKB 2VFSA 5AE3A 2PVOD 5H92C 1D5MC 2W3SA 1ESFA 1FEHA 4WURA 3KJMA 4KX6B 4TMAB 3VQIA 1JQ4A 1R7SA 2NMQA 3BIID 2KN4A 2QPMA 2UUUA 4NAMA 2AQ1B 4RF0A 1HXYD 1WVFA 1GAQB 1F0XA 2PKOA 3BYTB 4JWSC 4P6VF 4RCOA 4XE0A 2JWUA 4RFBA 1TS5A 1I4PA 3R2TA 1VZ6A 2YEPF 3FILA 5EE3A 3B9JB 3LYYA 5L6FA 3MJ5A 1VJKA 4YTPB 3W8WA 4PT5A 3FW7A 3Q69A 1IUEA 2WLBA 4N58A 3T3NA 2IDYA 3S1FA 4KKIA 3Q8CA 1SB3B 4C7ZA 1PGXA 2GI9A 3TX1A 1GB4A 1TKEA 4ZRQA 1Y56A 3P42A 3CIRB 5EE1A 1XCTL 4L2YA 3ZQ4A 1KFYB 3AEEB 2JSVX 3AN1A 1AWDA 2VZKB 1NYRA 2CU3A 3B9JA 1HZ6A 1SE2A 1TZOA 3I9V1 5FXFA 4MT5A 2WXLA 1V1PA 1ROEA 3P63A 4US9A 4PVEA 2JZPA 3TEWA 3URYA 2W82A 1N63A 4NZLB 4OW0A 1N5WA 2KMMA 4AS1A 4FXCA 4REZA 2EXRA 4OZAA 5G5HB 5FXPA 3W1SA 5BYRA 1W1OA 4HKQA 1E6EB 2X38A 1KRHA 1ACCA 2INPE 5HI1A 1ZXIC 4YTNB 2WQYB 3TSHA 1NVID 1QLUA 3I99A 4HEA1 2FE8A 4WWMA 3AMZA 3O13A 1XF5L 3SR6A 1ZDXA 3R07C 3N9YC 1D5ZC 1IGDA 2LHEA 1QLTA 1N61A 5HHDG 4TVWA 4TSSA 4MM3B 1DOYA 1FNWA 1MBTA 2BS2B 1C4CA 4RGMA 2K9XA 1XLQA 2JX5A 1MHXA 1JW9D 3LB8C 1WYGA 3FC4A 1K51A 3NUHB 1MHHE 1J7CA 2WXHA 4GDLB 2PLSA 1JWMD 1AW7A 2ON8A 4P16A 2VFVA 3E9SA 1YN3A 4ZYSA 3FAHA 3AECB 2LGIA 1MBBA 1QQRA 1J7BA 1AHVA 2FBWB 1ET6A 2IPKD 1FXIA 2OEDA 4WIPA 4YSYB 4WQMA 1FD6A 1XLPA 1YQ4B 2GQTA 1FFVA 3NVZB 2N9KA 1FCCC 3IAS1 2W3RA 1YNTE 2QEJC 1WSPA 4JPSA 3GS2A 3P4PB 3ZYYX 2K0PA 2J53A 3NRZB 1TS4A 3IT4B 1I4QA 1YN5A 1HQRD 1QOFA 1PYWD 2QSDA 1FCLA 2PTLA 1VZ7A 2MH7A 4OZBA 2BYTA 3ZGZA 1C76A 2AQ3B 4ZRPA 1F0ZA 2DYMA 2TSSA 1N5XA 1XXGA 2QILA 1UWXA 2PIAA 1T3QC 3KLSX 1KLGD 4A90A 1X2HA 2ZW0A 1ZR6A 1SSNA 4GLSC 4YSXB 5AE1A 1ZE3D 1EU4A 1D5XC 3V3XA 1SE4A 4D2KA 3PQBA 4JX1C 2WXKA 2DYOA 4O95A 5FXEA 3SEBA 1ZP0B 2UUVA 1RM6B 1PUTA 3NVVA 4RGTA 4US8A 3V05A 2LHDA 4PWCA 4WH4A 2MEKA 3ABVB 4L23A 5D79A 1DOIA 2IJ0A 1TYGB 4BC9A 4Q2JA 2LJIA 5JXVA 3HVDA 1ZPSA 3RJ8A 1E10A 3DWMA 4EE2A 3TEZA 2N7JA 1CZPA 1SB3C 2AX5A 1N5WC 1RFKA 2KWDA 1TKGA 1WWTA 2ONQA 2J4XA 3J9CA 2PMVA 4A8XC 2DWQA 1T6BX 5EE0A 5G5GB 1DIQA 1FIQA 2XN9C 1XLNA 1PFDA 3MHZA 4OVZA 1BXTA 2WXJA 1IBXA 4TQ1A 1QKZA 1SEBD 2R61A 5I1VA 1JWSD 2H89B 2MJEA 3VR8B 5BMHA 2V3PA 3AE1B 2ICIA 2DBYA 4JWUC 3C8YA 4B0EA 1ZXHA 4TQ0A 3IAM1 3IXSA 2BS4B 1YN4A 2WXOA 1B1ZA 1SF0A 2E6XA 1ZDVA 3AE8B 3VR9B 3FW9A 1V1PB 3AEFB 4ML8A 4KKJA 2MBRA 1QOBA 3AE3B 5H8YE 4ARCA 5G5GA 4GDKB 1FFUC 3GP7A 4ZHOA 2FUG1 1L6VA 4C7YA 4JE3B 1VLBA 1BUIC 3AV8A 1L0YB 2O3GA 2D5GA 3W5VB 2CJOA 3BVZA 1AHZA 5I4DA 1FFVC 3FWAA 1QT9A 3TEXA 2BVFA 1F77A 1IGCA 2J42A 3HVZA 1C4AA 5D3IB 1EWYC 2V0GA 1JALA 1QLBB 3A7AA 4ITKA 1DZNA 3SR6B 3SFDB 3S1DA 3POPA 2Y3AA 2KQ4X 4YSZB 3D2HA 5E6JA 1I4RA 4MLAA 4BC7A 1L5PA 1FMAD 1K50A 3RFZB 1TJEA 2QIEB 3MFGA 3AE4B 1QILA 1VZ8A 2BB5A 3AE5B 5HMRA 1K52A 1LO5D 3AEBB 4RGOS 2Y3SA 3HRDC 1N60C 3W9CB 4KGTA 5AUKA 1TY2A 2OAIA 3BYYB 2SEBD 4RGNA 1N62C 4IOIE 2IGGA 3IT6B 2WU2B 3S1EA 3PZ8A 4BBYA 2E5AA 1DOXA 3L4PA 2IGDA 1FO4A 4XDDA 3A7UA 2Y4GA 4UD8A 4YXDB 1L0VB 4CQNA 1SE3A 2V4IB 2Y5PA 4DNSA 2VFTA 2L1AA 5D3DA 4XLOA 3KQ4A 3H8HA 4N6EB 1KLUD 4N59A 3NS1A 1F2RI 2RK5A 1AN8A 2PVGC 1T5XD 1E0ZA 1I19A 2LMCA 2W55A 1Q10A 1DYQA 1SJED 5LNK1 4MH8A 1L0XB 2N0SB 4IKGA 2VFUA 2K5PA 1V1OA 5HHZA 1KH0A 1RM6C 3AH7A 2OHFA 1SJHD 2KDMA 3AB5A 4C56C 1EM7A 2JYTA 5C2TB 3GSYA 1ZOYB 2EKIA 3A7RA 1DGJA 1NI3A 4L1BA 3B2GA 2AQ2B 2L32A 1E8HA 1VAOA 3NVVB 2ZW1A 3E56A 1VQZA 1L4DB 3W8ZA 2Y5CA 1I7HA 2WXPA 3PZ7A 2WXFA 5TSSA 1JWAD 1JCKB 2SAKA 1TY0A 4DXGA 4C80A 4M0WA 3GB1A 3DQ0A 4YTMB 1D6EC 1J7AA 5T8IA 2JU6X 2HTME 1RYJA 2Q85A 1W1LA 4YT0B 4ZOHB 2K22A 2L83A 1D4BA 2L52A 1C9FA 3RJAA 1FIQB 3R2IA 1IBXB 2Y08A 4RH6A 2N9LA 2RMMA 2WXNA 3AE9B 1C78A 3BVGA 2E3TA 2R8DA 2GB1A 3W2DA 1UGJA 3ETRA 2BVGA 3I57A 1ZXIA 2KACA 5FKAC 3DWGC 3U2SC 3ZJVA 1I4HA 2B76B 1N63C 4IDIA 3NVYA 4J3OD 3ZJTA 1W1RA 1V97A 3JS8A 1FRRA 3TSSA 3AM9A 2Q4WA 4RF1A 1K53A 1P7FA 3LXFA 3DEDA 3VTEA 2Z8LA 3BWUD 1CQVA 2QJLA 3AE7B 1KF6B 1NENB 3D2DA 2I0KA 2P13A 2V3NA 2KAJA 2MJDA 3Q8FA 1N61C 3LLBA 2WDVB 1UXYA 3P1MA 3S1CA 1E9MA 3EUB2 3VRBB 3D2JA 1YJIA 2INNE 1NYQA 3B2FA 3BVMA 3HSUA 2Q5WD 1XEEA 3NZ3A 1GOZA 1HZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QF6 A;  1W1J A;  2WDR B;  3LAE A;  2NQW A;  1ZUD 2;  3NVW A;  5ADZ A;  3P4S B;  4LTU A;  3C0P A;  1GPX A;  3PO0 A;  2BT6 A;  2VFR A;  1TKY A;  5HQX A;  3W8X A;  1T3Q A;  1W1M A;  2P3H A;  1E0Y A;  1WGK A;  3NS1 B;  1X2G A;  1YQ3 B;  1XLO A;  3HUI A;  1WXQ A;  4PYT A;  5GXG B;  3AEG B;  1WVE A;  2CJN A;  3WCQ A;  1DII A;  1FM0 D;  5EE9 A;  1SIJ A;  1VDV A;  2P4P A;  2G1E A;  2WS3 B;  1JRO A;  1W1Q A;  2WU5 B;  4BCA A;  3RPF C;  1L6U A;  4A9A A;  2LEK A;  1YJJ A;  3KWL A;  1E8F A;  3AE2 B;  3SFE B;  4ZOH C;  4HRS A;  1JWB D;  4OAL A;  1E7P B;  1OQQ A;  2R2Z A;  1OFF A;  2QKN A;  1W1S A;  1A70 A;  3HRD D;  5G5H A;  4HG0 A;  1OQR A;  4ZHP A;  1FFU A;  1B9R A;  3PM9 A;  1V8C A;  1PDX A;  3AED B;  2JQR B;  2W54 A;  5MPO A;  2WDQ B;  3ETR B;  1RWS A;  3VRA B;  2YVS A;  3AEA B;  3P4Q B;  1HSK A;  2H88 B;  3NVY B;  1WRI A;  2VAO A;  4HRO A;  1QOG A;  4USA A;  3CWI A;  2M19 A;  1XO3 A;  1FXA A;  1AYF A;  4TVY A;  1JRP A;  1E8G A;  2ACZ B;  5AUI A;  1W1K A;  1N60 A;  5C3J B;  2PLI A;  1UWM A;  3BW7 A;  2BVH A;  3NVZ A;  3P4R B;  4JB1 A;  1N62 A;  5FXD A;  2BS3 B;  2MJ3 A;  1CJE A;  2M56 B;  5AE2 A;  3EUB 3;  4JAY A;  1QOA A;  3NRZ A;  3W5U B;  2GQU A;  1FRD A;  3AE6 B;  1AHU A;  3NVW B;  2AXR A;  2WP9 B;  1NEK B;  2VFS A;  5AE3 A;  2PVO D;  5H92 C;  2W3S A;  3KJM A;  4KX6 B;  1JQ4 A;  1R7S A;  3BII D;  2QPM A;  1WVF A;  1GAQ B;  1F0X A;  2PKO A;  4JWS C;  4P6V F;  5EE3 A;  3B9J B;  1VJK A;  4YTP B;  3W8W A;  1IUE A;  2WLB A;  4N58 A;  3S1F A;  1SB3 B;  4C7Z A;  3TX1 A;  1TKE A;  3CIR B;  5EE1 A;  1KFY B;  3AEE B;  3AN1 A;  1AWD A;  1NYR A;  2CU3 A;  3B9J A;  5FXF A;  1ROE A;  3P63 A;  4US9 A;  1N63 A;  1N5W A;  2KMM A;  4FXC A;  2EXR A;  5G5H B;  5FXP A;  1W1O A;  1E6E B;  1KRH A;  1ZXI C;  4YTN B;  2WQY B;  1NVI D;  1QLU A;  3I99 A;  4WWM A;  3AMZ A;  3SR6 A;  3R07 C;  1QLT A;  1N61 A;  4TVW A;  1DOY A;  1MBT A;  2BS2 B;  2K9X A;  1XLQ A;  2JX5 A;  1JW9 D;  3LB8 C;  1WYG A;  3FC4 A;  1J7C A;  2PLS A;  2VFV A;  3FAH A;  3AEC B;  1MBB A;  1J7B A;  1AHV A;  2FBW B;  4YSY B;  1FXI A;  4WQM A;  1XLP A;  1YQ4 B;  2GQT A;  1FFV A;  3NVZ B;  2W3R A;  3P4P B;  3ZYY X;  3NRZ B;  1QOF A;  2MH7 A;  1F0Z A;  1N5X A;  2PIA A;  1T3Q C;  1X2H A;  1ZR6 A;  5AE1 A;  4YSX B;  4JX1 C;  5FXE A;  4O95 A;  1ZP0 B;  1RM6 B;  1PUT A;  3NVV A;  4US8 A;  3ABV B;  1DOI A;  4BC9 A;  1TYG B;  1E10 A;  3DWM A;  1CZP A;  1SB3 C;  2AX5 A;  1N5W C;  1RFK A;  1TKG A;  1WWT A;  2DWQ A;  5EE0 A;  5G5G B;  1DIQ A;  1FIQ A;  1XLN A;  1PFD A;  3VR8 B;  2H89 B;  2MJE A;  3AE1 B;  2DBY A;  4JWU C;  2BS4 B;  1SF0 A;  3AE8 B;  3VR9 B;  3AEF B;  4ML8 A;  2MBR A;  1QOB A;  3AE3 B;  5H8Y E;  5G5G A;  1FFU C;  4ZHO A;  1L6V A;  4C7Y A;  1VLB A;  3AV8 A;  2O3G A;  3W5V B;  2CJO A;  1AHZ A;  1FFV C;  1QT9 A;  2BVF A;  3HVZ A;  1EWY C;  1JAL A;  1QLB B;  3A7A A;  4ITK A;  1DZN A;  3SR6 B;  3SFD B;  3S1D A;  4YSZ B;  4BC7 A;  4MLA A;  1L5P A;  1FMA D;  1TJE A;  2QIE B;  3AE4 B;  3AE5 B;  5HMR A;  3AEB B;  3HRD C;  1N60 C;  3W9C B;  5AUK A;  2OAI A;  1N62 C;  2WU2 B;  3S1E A;  4BBY A;  2E5A A;  1DOX A;  3L4P A;  1FO4 A;  3A7U A;  4YXD B;  1L0V B;  2VFT A;  4XLO A;  4N6E B;  4N59 A;  3NS1 A;  2RK5 A;  2PVG C;  1E0Z A;  1I19 A;  2W55 A;  2N0S B;  2VFU A;  2K5P A;  5HHZ A;  1RM6 C;  3AH7 A;  2OHF A;  3AB5 A;  5C2T B;  1ZOY B;  2EKI A;  3A7R A;  1DGJ A;  1NI3 A;  3B2G A;  1E8H A;  1VAO A;  3NVV B;  1VQZ A;  3W8Z A;  2Y5C A;  1I7H A;  1JWA D;  4C80 A;  3DQ0 A;  4YTM B;  1J7A A;  1RYJ A;  2HTM E;  2Q85 A;  1W1L A;  4YT0 B;  4ZOH B;  2K22 A;  2L83 A;  2L52 A;  1FIQ B;  3AE9 B;  2E3T A;  2R8D A;  2BVG A;  3ETR A;  1ZXI A;  3DWG C;  2B76 B;  1N63 C;  4IDI A;  3NVY A;  1W1R A;  1V97 A;  3JS8 A;  1FRR A;  3AM9 A;  2Q4W A;  3LXF A;  3DED A;  2QJL A;  3AE7 B;  1KF6 B;  1NEN B;  2I0K A;  2P13 A;  2KAJ A;  2MJD A;  1N61 C;  3LLB A;  2WDV B;  1UXY A;  3P1M A;  3S1C A;  1E9M A;  3EUB 2;  3VRB B;  1YJI A;  1NYQ A;  3B2F A;  2Q5W D; 
#chains in the Genus database with same CATH topology
 4NQK E;  1OEY J;  5JCI A;  4IWQ A;  2WDR B;  1XSP A;  5BMG A;  4O3M A;  1ZUD 2;  3NVW A;  1TZZ A;  1KSP A;  4E0D A;  1LB2 B;  4KGS A;  1DTN A;  3EPG A;  1A5R A;  3PST A;  4KIT B;  2EQ9 A;  3C0P A;  3HKZ C;  2JF5 A;  3JW0 X;  2ZUD A;  2BW2 A;  3EEZ A;  1GPX A;  1NOM A;  5KFD A;  3T6C A;  1M94 A;  2HE7 A;  5FR6 A;  5HQX A;  4YMO A;  5T14 A;  3ISB A;  3GD4 A;  2I2Y A;  2F1I A;  1T3Q A;  3RH5 A;  1C1Y B;  1QZE A;  1V86 A;  1H8C A;  4QZD A;  2OQH A;  1RG6 A;  1E0Y A;  2P88 A;  5ALF A;  5C1Z A;  3OSP A;  2OG9 A;  2WDW A;  1ZQJ A;  1H2I A;  1PVP A;  2Z0E B;  2BQQ A;  2GLE A;  4C4T A;  3ZDT A;  4JIO U;  4AOF A;  2GR2 A;  4ECX A;  4C8N A;  2X8H A;  5KFX A;  1TAM A;  2G3Q B;  2JPH A;  2H3I A;  2NTS A;  3HHM A;  3T8M A;  4MMW A;  1OXJ A;  4PYT A;  4AJY B;  1GRE A;  4DF8 A;  3A33 B;  1C20 A;  5GXG B;  4M6W B;  3EHV A;  2M0N A;  1FM0 D;  2WPF A;  1V85 A;  1SIJ A;  2C28 A;  2KJR A;  2LUM A;  1GB1 A;  2PJH A;  3VCC A;  1V5T A;  4Y2V A;  3RB6 A;  3PLU A;  5CA7 A;  2GR1 A;  5AIC A;  2YTU A;  4K3C A;  5IOI A;  5J0S A;  4DQP A;  3H7S A;  4O1N A;  1W1Q A;  2WWZ A;  2RDH A;  2KD0 A;  2C5L C;  4BCA A;  2JY6 A;  1RLF A;  5HKH A;  1S0V A;  4KLJ A;  1L6U A;  4F4Z A;  3KWL A;  1E8F A;  3AE2 B;  3SFE B;  4FUL A;  2ZJA A;  5H2F U;  1WG8 A;  4M47 A;  1F52 A;  1VRA B;  3T9P A;  3TQ1 A;  2V1Y A;  3VXW A;  2IBK A;  4OAL A;  3AU4 A;  4PZF A;  4LNF A;  4QZI A;  1R4M I;  2GWS A;  2NRX A;  3ED5 A;  2D3G A;  2I5H A;  1ZQR A;  4IG7 B;  4RQ6 A;  5G5H A;  3KVF B;  2IPI A;  2WB1 F;  3FYH A;  2R8I A;  2E8O A;  1T0R C;  2RDG A;  1PGA A;  4LJX A;  1WZ3 A;  3K9O B;  2BTE A;  4J56 A;  1WJ6 A;  5KT6 A;  4K1W A;  4BXO A;  3AU6 A;  1WMH B;  3WU2 U;  3RAX A;  4ANW A;  3OJ3 A;  3THV A;  4ICU A;  4C8O A;  4KX5 A;  9ICN A;  1U48 A;  1MVK A;  1RWS A;  1K8R B;  1WRD B;  3CF6 E;  1GRG A;  2WXI A;  4UAY A;  3AEV A;  3QQ8 B;  4HKZ E;  3T3O A;  3MTN B;  4IQT A;  5C23 A;  2ZZ0 A;  3P4Q B;  3THU A;  3NVY B;  2HBK A;  5J2R A;  1LM8 B;  4F8C B;  1ONE A;  2MBQ A;  3II4 A;  2Y9T A;  3UGB B;  1NK6 A;  2F8K A;  4GGQ A;  3M3J A;  4RUC A;  4TUS A;  1NK9 A;  2BPF A;  2EDU A;  1TBE A;  2BVC A;  2X8X X;  1NKC A;  3O0H A;  2LI6 A;  1SXT A;  4CNQ A;  4EZ9 A;  5IP4 D;  3QX7 A;  1UD7 A;  2CFY A;  3NFU A;  4YXM A;  5C0Y A;  9ICG A;  1EXN A;  1E8G A;  1C79 A;  3EA6 A;  3PTF C;  9ICT A;  1DGS A;  1MUC A;  3N6J A;  4PJ0 U;  4J1O A;  4Y2Y A;  1WY8 A;  3NVZ A;  2VKQ A;  4M9L A;  4F4K A;  1KKX A;  3A9K A;  4HPM B;  1KKO A;  3QFA A;  1X42 A;  2J52 A;  2WGS A;  3Q8E A;  2V9H A;  5FXD A;  3SAG A;  3BJY A;  1Q3V A;  3SQP A;  1RQL A;  2MJ3 A;  1ZQN A;  4F2R A;  5U1O A;  2WDT B;  1HA5 A;  4XWW A;  1QOA A;  4A3R A;  2WPC A;  1YEY A;  2H3F A;  4ENL A;  3APC A;  2RDJ A;  4GOC A;  4H4R A;  1NJY A;  1L7P A;  3Q8S B;  3GIM A;  5J04 A;  1Z2M A;  5AI8 A;  1FRD A;  3AE6 B;  4CF5 A;  1S97 A;  4KLD A;  4W9L A;  5KHQ A;  4HCH A;  5L6G A;  2W9A A;  3TKA A;  2W8K A;  3NVW B;  3GOE A;  5AKK A;  2AXR A;  3KUZ A;  4IM2 A;  1F2R C;  1NEK B;  2VFS A;  1MOK A;  4QIW C;  3SN0 A;  4Z6C A;  2R2Q A;  2W3S A;  1L7N A;  5L1M A;  3PZP A;  2NRZ A;  4KLI A;  3KJM A;  1JQ4 A;  1TK8 A;  4HAI A;  2NMQ A;  3RUL A;  2KN4 A;  2GL5 A;  4RQ5 A;  4KDI C;  2RRD A;  2PE6 B;  1WVF A;  2A5U A;  1GAQ B;  2DZM A;  3V5C A;  1ED1 A;  2DGZ A;  3KUD B;  4JUZ A;  2IO0 B;  4Z6F A;  1NI2 A;  3DGH A;  3OZY A;  5J2I A;  1P1A A;  4P1C C;  4R64 A;  3PVL A;  2JWU A;  5AKY A;  9ICR A;  1I4P A;  3R2T A;  4RFB A;  4XE0 A;  2KG5 A;  2EAP A;  3B9J B;  1V9P A;  9ICE A;  2AKZ A;  3L10 B;  1R6W A;  3QZ7 A;  1UCV A;  4N58 A;  4AP4 C;  1SV0 A;  4ZRI A;  2HCF A;  3T3N A;  4O3S A;  1ZQP A;  2EZY A;  3T79 A;  3DDM A;  7ICV A;  3H7P A;  2E8P A;  4EQW A;  1GJZ A;  1SL2 A;  5TIS U;  4TV3 A;  5LXH A;  1GB4 A;  1TKE A;  4ZRQ A;  4YMN A;  5LLI A;  1ZGU B;  4JWN A;  3V60 A;  2PKE A;  1T0S C;  1FHV A;  3PW2 A;  3C29 A;  4S17 A;  3HIL A;  2CU3 A;  3MGH A;  2PFP A;  2LYH A;  1V1P A;  3ETL A;  1ROE A;  2N1W A;  2LGS A;  4GFJ A;  4JQ9 A;  5J2D A;  3ZNI D;  1KDH A;  3PX4 A;  1GNU A;  3Q6J A;  3G6X A;  3DPD A;  3RI7 C;  5DB9 A;  4IUM B;  4FXC A;  3UIO B;  5G5H B;  2GGG A;  8ICV A;  2BWE S;  5FXP A;  5BYR A;  1W1O A;  4LJP B;  2XH0 A;  1XNS A;  3RT3 B;  4IZG A;  4JN7 A;  1FXT B;  1TYT A;  3TAD A;  2FNJ B;  1NPX A;  2WQY B;  4FDC B;  3N7R C;  3H7I A;  4F50 A;  4BXO B;  1NVI D;  4GIS A;  3DJJ A;  4KPL A;  4HEA 1;  5D94 A;  1QLU A;  3I99 A;  9ICX A;  3GV5 B;  1O03 A;  4KLQ A;  1S7M A;  4ED0 A;  3ZD8 A;  3MFI A;  4PGX A;  1IGD A;  4R65 A;  1N61 A;  9ICF A;  5HHD G;  2FCN A;  2VA3 A;  3DBR B;  3DOW A;  3RN9 C;  1DOY A;  4TVW A;  4EMJ A;  1MBT A;  4DS4 A;  4PHA A;  8ICH A;  2BS2 B;  4RGM A;  2K9X A;  4HCD A;  4KLT A;  4QZG A;  2IYD B;  2W8L A;  1SKR A;  8ICA A;  4JGH B;  4A20 A;  4YWO A;  3QUQ A;  1YZ6 A;  5J18 A;  1J7C A;  1HJP A;  3IP4 B;  4CHK A;  1JWM D;  1AW7 A;  3NZU A;  2PLS A;  3DG3 A;  4EUT A;  2NO4 A;  5DBB A;  2AGQ A;  3AL0 B;  3LAD A;  1MBB A;  1H38 A;  4MEX A;  4M04 A;  2J6T A;  1V5O A;  2YB4 A;  2K8H A;  2HVH A;  1ET6 A;  3AUL A;  4DXK A;  1FXI A;  2JXJ A;  3V4B A;  1T0Q C;  1XWL A;  4H4U A;  4GLX A;  4JWM A;  3GV7 B;  1YQ4 B;  2GQT A;  3WKA A;  4DSI A;  4MGI E;  1Z1V A;  3DEE A;  1FCC C;  4DQS A;  2DYB A;  3A9K B;  4MM3 A;  5DPT A;  3MQT A;  3NVZ B;  2ESE A;  4G0N B;  2HJ1 A;  4O5K A;  2W3R A;  2XGZ A;  3H40 A;  2FUH B;  4UB3 A;  1MG4 A;  2GGH A;  1D8Y A;  2BHN A;  1ZQE A;  2QKQ A;  5TZV A;  4RMA A;  1KLV A;  2W7P A;  1PYW D;  2XH7 A;  1FCL A;  1VZ7 A;  3P93 A;  2Y9U A;  2KLG A;  2A3V A;  4XRH A;  1C76 A;  2AQ3 B;  1F0Z A;  4DFD A;  1J8C A;  4F5N A;  2KDB A;  2QIL A;  2I5Q A;  3KLS X;  1X2H A;  1ZR6 A;  4WJ3 B;  2ZW0 A;  1PK1 A;  4KLO A;  3RNF C;  4MDK E;  5J0Y A;  3BQT A;  3H9D A;  3V3X A;  1WWV A;  1BGX T;  1RQN A;  3R11 A;  5J0R A;  3ONS A;  2G09 A;  4JX1 C;  2BKF A;  3SV4 A;  2DYO A;  2WXK A;  4O95 A;  4KEM A;  3CAW A;  2LXC A;  4MGZ E;  3QNM A;  4US8 A;  3L5K A;  4PWC A;  3N97 B;  4WH4 A;  4ED3 A;  3UXO A;  5EWG A;  4JMU A;  2V4Q A;  2PFN A;  4II2 B;  4Q2J A;  3TW9 A;  3PT2 B;  5KG4 A;  1IYX A;  2LAS A;  3RJ8 A;  4BUR A;  2LRW A;  4JB3 A;  1CZP A;  2PPG A;  3DK4 A;  1SB3 C;  2AX5 A;  4IQW A;  1VJ5 A;  1ZQB A;  3TJI A;  3U26 A;  3OHA A;  2AJQ A;  1WM2 A;  1WWT A;  2M1M A;  2LRU A;  2ONQ A;  2RDI A;  2DWQ A;  3RD2 A;  1X6I A;  2MRP A;  3ZO5 B;  1YX6 B;  4W9H A;  2WF6 A;  5AKJ A;  2F77 X;  4FBJ B;  1IBX A;  9ICB A;  2RDX A;  2V3P A;  4QZ9 A;  4B0E A;  1ZMD A;  4MGG A;  5FJU A;  4MFC A;  1B1Z A;  1EF5 A;  2KN7 A;  4A6G A;  5TR3 A;  3AE8 B;  2W9C A;  1U4B A;  2K6D B;  3VR9 B;  2XO7 A;  3CGD A;  1XC9 A;  3DG6 A;  3DG7 A;  3PWI A;  1V1P B;  4ML8 A;  1FEB A;  3ZLG A;  3Q3J A;  4KKJ A;  2W9B A;  1L6N A;  2CXY A;  3AE3 B;  2VRR B;  3R7R A;  3ZDD A;  1HE8 A;  2XGP A;  5CHG A;  3F2C A;  1BPZ A;  2ZIW B;  4Y2S A;  3M9M B;  1L6V A;  4JE3 B;  5GMV A;  5HHI A;  3ZW3 A;  1BUI C;  1L0Y B;  3KW5 B;  3W5V B;  2LD9 A;  4DSL A;  3RJE A;  1ONF A;  1ZQD A;  2RAB A;  5I4D A;  2V3B A;  3FWA A;  1L3V A;  5G55 A;  7ICN A;  3R1Z A;  2JRZ A;  3HVZ A;  3PW4 A;  3SQI A;  3V6E B;  1F8W A;  1MQ2 A;  4ZRK A;  2DF4 B;  3CNH A;  1RYR A;  4NY8 A;  8ICZ A;  4ITK A;  4QAY A;  1CEZ A;  3POP A;  3D2H A;  2AL1 A;  1I4R A;  3CW2 C;  2ZNV C;  1FMA D;  5JUM A;  4DL6 A;  2HVI A;  1TJE A;  2QIE B;  3GRS A;  3T8Q A;  5KT4 A;  3M9N B;  2KHW B;  3AE4 B;  2BQU A;  1B43 A;  4QZC A;  4W9K A;  1LO5 D;  1J2M A;  1U47 A;  1UA1 A;  2ZXI A;  1S1Q B;  1N60 C;  2GDQ A;  1S5L U;  4BOS C;  1MDR A;  5J2K A;  2FCQ A;  4Y2P A;  2IND C;  3V5F A;  5IIK A;  1N62 C;  1LKY A;  4MGK E;  2WAQ C;  2F3N A;  2EZZ A;  4QW8 A;  1L3U A;  5D49 A;  2E5A A;  4J9M A;  3L4P A;  1V2Y A;  2HXT A;  1ISN A;  1YT3 A;  1SE3 A;  4DNS A;  2VFT A;  2L1A A;  5D3D A;  3CGB A;  3H8S A;  1TV9 A;  2KX3 A;  3CXO A;  4N6E B;  2K8B A;  4M9N A;  3QJZ A;  2FLP A;  2QDD A;  4EYH B;  4DHJ B;  5A0L A;  4CRX A;  1DYQ A;  5AKI A;  2MCN B;  3BQ2 A;  4Q43 A;  4MH8 A;  1Q5W B;  1TKK A;  3BW7 A;  1JCT A;  3N28 A;  4BUG A;  5L1J A;  1ZJN A;  1CI4 A;  4MSM B;  2KIV A;  3RAQ A;  5D46 A;  7ICR A;  2WOI A;  4E5T A;  1ZKH A;  2I9G A;  1NHR A;  2LHT A;  3FDS A;  4IL0 A;  2OHF A;  1PK1 B;  3HKZ F;  5ALE A;  5K4L A;  5IIO A;  3EAN A;  2AQ4 A;  3IVF A;  3GSY A;  5BOM A;  2EKI A;  2GMI C;  2BDU A;  3DBL B;  1DGJ A;  4DSJ A;  4L1B A;  3EPI A;  3GY1 A;  4EMW A;  3PNC A;  2QAR A;  1WJU A;  2GOW A;  2K39 A;  1VAO A;  5J0O A;  2O2V B;  2MUT B;  3RTV A;  3JSV A;  4BKG A;  4EZK A;  2GBN A;  3ZDC A;  3MY9 A;  8ICX A;  2ZUB A;  2I1K A;  3UIN B;  2GBJ A;  4OCZ A;  4M0W A;  2J0K A;  5T8I A;  2K6Q A;  2JEJ A;  5HML A;  3C5G A;  4BAX A;  2PP3 A;  4F2S A;  4KWS A;  4YT0 B;  4UAT A;  5IN7 A;  8ICP A;  3GC2 A;  4J9N A;  3UJE A;  3VC8 A;  2KJ9 A;  3TQP A;  2KVC A;  4C0Z A;  2WPE A;  3RJG A;  3R2I A;  2RHF A;  1IBX B;  3BVG A;  1KFT A;  2AYO B;  2E3T A;  3KHH A;  2OZ3 A;  4I28 A;  3PML A;  8ICB A;  3DFY A;  9ICW A;  4HCP B;  2AGO A;  1F44 A;  3I57 A;  3URH A;  8ICL A;  5FKA C;  3DWG C;  4H4V A;  3R10 A;  4JV1 A;  4CGZ A;  4G3I A;  3D32 A;  2B76 B;  1N63 C;  2YY6 A;  3V6J A;  3RH4 A;  3MUC A;  3BQ7 A;  2W9C B;  2ZJ5 A;  5D6J B;  3ES7 A;  4PS3 A;  2W9B B;  3QUT A;  7ICQ A;  2A1A A;  2FI1 A;  4NWI A;  2KTQ A;  3EAO A;  2I1Q A;  1W1R A;  3DVG X;  1FRR A;  5G2N A;  3AM9 A;  2UYZ B;  2Q4W A;  2KNJ A;  3KZI U;  3PVX A;  4NLB A;  1NEL A;  1ZQC A;  5ALK A;  8ICW A;  5KFL A;  4IM3 A;  1F5S A;  2KMD A;  1FEZ A;  2JR5 A;  1R4N I;  3D2D A;  2ZCC A;  8ICR A;  2I0K A;  2UVU A;  3DJG X;  2KAJ A;  2MJD A;  4I6P A;  5KFW A;  2QCZ A;  3LLB A;  2WDV B;  2FDR A;  3BIN A;  2KLC A;  4RU9 A;  2LGD A;  4ED7 A;  3LDZ E;  4IWO A;  1WGR A;  4NLC A;  1DOQ A;  4J03 A;  4GB9 A;  3BVM A;  2A4Z A;  2NPX A;  5AI6 A;  2MP2 A;  3PRM B;  1ZQZ A;  1XEE A;  3NZ3 A;  2IO1 B;  4OD0 A;  2KV2 A;  3T5H A;  2KWU B;  1GC7 A;  1MI0 A;  5FK9 C;  3LAE A;  2NQW A;  4IC7 B;  2M9N A;  3SN4 A;  2UVW A;  4U7C A;  3LJ3 A;  5KFP A;  2MSE D;  4YCX A;  2ZTD A;  3P4S B;  2Y0S C;  3MP9 A;  4KLH A;  4K7Z A;  1P7E A;  5AM1 A;  2KNB A;  3PO0 A;  2BT6 A;  3L13 A;  4A3O A;  4IM0 A;  4G7F A;  2VFR A;  2MBO A;  4H2A A;  3OZM A;  4YP3 A;  2DX5 B;  4LNO A;  2AL3 A;  3QEB Z;  2L5Y A;  5AZH A;  3BY4 B;  3WAM A;  1ENF A;  2K8B B;  4PHP A;  1WUF A;  3EW9 A;  1WGK A;  2Z7J A;  1WXM A;  2KYW A;  9ICC A;  1YOV B;  1L7O A;  5DB8 A;  1JWU D;  2E8M A;  4B9K A;  2QJM A;  2WXM A;  2LVQ A;  5KG7 A;  2N9P C;  1L3T A;  1JXE A;  3IHQ B;  2Q0Z X;  1WXQ A;  5IO9 A;  2MSN A;  4FZM A;  4O9M A;  4LK0 M;  1ZMC A;  3BSM A;  4HN8 A;  3ZNZ B;  1WVE A;  2UVV A;  1C4P A;  1XD3 B;  3RJK A;  4OVU A;  2D3B A;  5III A;  4KZC A;  2HI0 A;  4OHJ A;  4DL7 A;  2ATL A;  2GRI A;  1KN0 A;  1FNU A;  4BJQ A;  4DEZ A;  4QIW F;  5J0P A;  3HM6 X;  4XDC A;  4B95 A;  3UJR A;  4I27 A;  1E8Y A;  3PLV A;  4PYZ A;  1P7D A;  1UT8 A;  3KKA C;  2OEH A;  1I35 A;  2ZTC A;  2ZPY A;  5HFY A;  2WXG A;  2QAR B;  1ZK7 A;  3S47 A;  4P7I A;  1SL1 A;  3ZJU A;  4IR1 A;  4JK1 A;  5GTI U;  1TK5 A;  3RPF C;  4P4O A;  4A9A A;  1GRH A;  1Q1W A;  4QWB A;  3HX0 A;  4QWC A;  4KPR A;  2K4P A;  3DVN U;  3DIP A;  4PZO A;  1YMH E;  4HRS A;  1JML A;  4ZHP A;  4M0W B;  2PMZ C;  1E7P B;  1OQQ A;  1PQS A;  4A3P A;  1SWV A;  3H8M A;  1UUP A;  5KFE A;  3PG6 A;  2IO2 B;  2H3Z A;  5AKZ A;  2QKN A;  1W1S A;  1XU4 A;  5KFC A;  3OPS A;  1WX8 A;  2LKY A;  9ICV A;  5ALY A;  2G45 B;  2JEG A;  4I6N B;  4O3P A;  1OQR A;  4DFP A;  2HTH A;  2CKH B;  2QLT A;  4R3D A;  2AU0 A;  3WK8 A;  5KG5 A;  2EMS A;  1I42 A;  1MN8 A;  2KOB A;  1V8C A;  1HEZ E;  3F2D A;  1PDX A;  5BMI A;  5ALI A;  3PSI A;  1TKD A;  2RPV A;  5MPO A;  2HXU A;  1MRA A;  3ONN A;  4LZD A;  3UCC A;  3KD3 A;  5KFR A;  5KAF U;  4KX3 A;  4NJ7 A;  5AIA A;  1ECQ A;  3UCD A;  5J2A A;  2AXT U;  4HLE A;  4UW9 A;  3KH0 A;  1V49 A;  1HSK A;  3OJU A;  1WUE A;  1D9F A;  4PK1 A;  1E8X A;  2KT7 A;  4XWT A;  1WRI A;  2DFL A;  3T5K A;  4MEY A;  1QCK A;  1ZQM A;  4B9T A;  5CP2 A;  2KZR A;  2M0A A;  2AL2 A;  1E5W A;  4HRO A;  3UJ2 A;  2MBE A;  4FP1 A;  5J2H A;  1QOG A;  4BWM A;  3JZU A;  4UAU A;  1RFA A;  3NZG A;  1RAX A;  3BOX A;  4DDG D;  4LDT D;  3Q3F A;  4LLG M;  5CHW A;  1WMH A;  2DZK A;  5KFM A;  4AQ7 A;  3B0Y A;  3AXC A;  4HJK A;  5J2G A;  3TCS A;  1T3N A;  2FCM A;  4B9U A;  2ACZ B;  2Y1J A;  5AUI A;  1N60 A;  1W1K A;  5KT7 A;  2IHM A;  7ICJ A;  2BGF A;  2HHS A;  2HDE A;  2IO3 B;  2PTW A;  4MGY E;  2BVH A;  2JYE A;  4DDI D;  3TI0 A;  1EO6 A;  2QJJ A;  1XO0 A;  4NJ8 A;  1N62 A;  4Q8F A;  2MA9 B;  5BOE A;  2OQY A;  1VR9 A;  3MR5 A;  3LDA A;  1CJE A;  1VCB A;  5ALL A;  3NRW A;  2M56 B;  3DBH B;  5JHB A;  3U7Z A;  3UI3 A;  2MP2 B;  3CK5 A;  4HPN A;  2KX0 A;  5KFH A;  8ICE A;  1K1Q A;  3MKC A;  4XA5 A;  1MNS A;  3CSF A;  4EBD A;  4H4Z A;  3U52 E;  1XSN A;  1WX7 A;  4AYB C;  3H0L B;  1Z00 A;  3Q8P B;  1EWC A;  5E79 U;  1GC6 A;  3DBL I;  4Z6D A;  4MAC A;  1JOA A;  4LII A;  2O6V D;  3IG5 A;  5J0Q A;  1ECW A;  4CF3 A;  4KLU A;  1L8O A;  4F4R A;  2N1V A;  2GH1 A;  1BKH A;  3ZNG C;  2KFJ A;  4FE3 A;  1X1M A;  4G8T A;  1D5M C;  4WJP A;  4CO7 A;  1IYF A;  1JEH A;  4H4T A;  1FEH A;  5J0X A;  3PX6 A;  2F8L A;  3RB4 A;  4WUR A;  5J0W A;  4KX6 B;  2EH9 A;  4QZB A;  1KFD A;  4ROP A;  1ZQG A;  3QZ8 A;  8ICT A;  3BII D;  4I2C A;  4FBT A;  2DZJ A;  5EU9 A;  3DES A;  4I2D A;  1NDD A;  4ZRJ A;  4PPX A;  2QHO A;  2KHQ A;  2PKO A;  3FM9 A;  4KLS A;  2HD5 B;  4RNM A;  4ED8 A;  1LV5 A;  4GGB A;  4RCO A;  4KN7 A;  4DWD A;  4O3Q A;  2CR5 A;  3VUX A;  1GO3 F;  3GO2 A;  9ICO A;  3LYY A;  4EZJ A;  1HUZ A;  2Q4T A;  2JEF A;  4E74 A;  1YIW A;  4PT5 A;  4B6W A;  4DO9 A;  1RXV A;  1OW5 A;  1S10 A;  2WLB A;  4JQW C;  2GBK A;  5CJ7 A;  3S1F A;  1V80 A;  4KKI A;  4ED2 A;  1SB3 B;  1WI0 A;  4GGH A;  1RYS A;  1OGW A;  5FS6 A;  4CF4 A;  1Y56 A;  3VH3 B;  3CIR B;  4YQW A;  1XS9 D;  5ALV A;  1XCT L;  2C60 A;  2KZM A;  2NCN A;  4BV6 A;  3WK9 A;  2OLA A;  4LJO B;  5DPS A;  2O6K A;  5KT2 A;  3PO4 A;  1NJZ A;  3AN1 A;  4I2A A;  1AWD A;  3H6N A;  3ZQ4 A;  2BDP A;  2JZB B;  4YG2 A;  1NYR A;  1F0M A;  3B9J A;  2UU7 A;  1ZOL A;  4N9F 4;  1SE2 A;  3UM9 A;  2JGA A;  5FXF A;  3QU2 A;  1ZY8 A;  2XY6 A;  2R18 A;  2NBV B;  3PFR A;  2OPJ A;  3TEW A;  3URY A;  4NM1 A;  1N63 A;  4ECT A;  4M9H A;  2KAN A;  4OW0 A;  3Q8M A;  2KMM A;  3C0R B;  4AS1 A;  4B9S A;  1P43 A;  1JMS A;  2R8H A;  3QKE A;  5EWF A;  3KLJ A;  4YN4 A;  1WGD A;  3GIK A;  4C8L A;  1E6E B;  1BPD A;  5DB6 A;  1BPY A;  3HW8 A;  2FMQ A;  5AZF A;  1NHQ A;  2HZG A;  1DK3 A;  4H4P A;  3UPQ A;  4ED6 A;  2KZ3 A;  1FEC A;  2W03 A;  4EOY A;  4C8K A;  4J6I A;  5J2E A;  3OHB A;  3N3K B;  1XF5 L;  1GRF A;  1K4Q A;  2P66 A;  3N9Y C;  5KFV A;  1ZQ1 C;  2IA6 A;  3JYU A;  3D47 A;  4QJF B;  2V4R A;  2KKC A;  3VA8 A;  3JPS A;  4KN4 A;  2AL2 B;  5KFI A;  2JX5 A;  2PTZ A;  3LB8 C;  4NY0 A;  5EBK A;  1WYG A;  3ZKJ C;  4WQO B;  3TWA A;  1ZQU A;  2MU2 A;  3A4S C;  3PMN A;  2LVO A;  2VFV A;  2AH5 A;  2ZNV B;  1GER A;  1YN3 A;  3AEC B;  3Q8Q B;  1J7B A;  1ZD5 A;  5KFO A;  1AHV A;  3QAQ A;  3B0A A;  2L05 A;  4E3C A;  2DPI A;  4WIP A;  4YSY B;  1BZL A;  3S5S A;  3ML9 A;  1XLP A;  1FD6 A;  3M95 A;  3AQE A;  1FFV A;  1PZN A;  5AK5 A;  3ZRF A;  2N9K A;  4EZL A;  2YVJ A;  3IAS 1;  2AEH A;  3A9J A;  2HQM A;  3NTU A;  2JVC A;  2KIW A;  2LM4 A;  1WSP A;  4H4W A;  3U8Z A;  2AQ0 A;  2JMG A;  4I2H A;  2J53 A;  2K0P A;  2E8N A;  1E7U A;  3O65 B;  1TS4 A;  4XYC A;  5JRT A;  5KT3 A;  3NZS A;  4H4S A;  3ZI4 A;  4F3O A;  2KDE B;  3JVZ X;  3H7V A;  4UB8 U;  3IDW A;  5ALG A;  1HQR D;  1Z00 B;  2PTL A;  4OZB A;  4KV2 A;  2BYT A;  3E2E A;  4HPL B;  3ZGZ A;  3P0W A;  2LM1 A;  2N1R A;  3ZVH A;  2YX8 A;  2ZXH A;  3A0B U;  4XQ8 A;  1KFS A;  2J6U A;  1XXG A;  2VJ5 A;  4RQ7 A;  4DFM A;  2DYM A;  7ICE A;  1L8P A;  2QC8 A;  1NU5 A;  4MJS B;  1KLG D;  2CU1 A;  1ARO P;  1SJC A;  2WAQ F;  2PA6 A;  3IN5 A;  1SE4 A;  3EFU A;  4KSK C;  3U30 A;  5AKH A;  3R25 A;  5FXE A;  2UUV A;  1E9I A;  4DN1 A;  1SL0 A;  4II3 B;  1PUT A;  3OLM D;  3AQF A;  4RGT A;  3V05 A;  2LHD A;  3H8A A;  3ZXR A;  4Y2X A;  2RQ5 A;  3R9K A;  1PDY A;  4L23 A;  4Y2T A;  5JCM A;  3ES8 A;  5D79 A;  2ZIV A;  5EDS A;  3KKA A;  3Q14 C;  5BPC A;  1ZPS A;  3DWM A;  2M0X A;  3CYM A;  1F9J A;  2MW5 A;  4XX5 A;  3TEZ A;  4Z6E A;  1V81 A;  5CTR C;  1N5W C;  1RFK A;  3I6T A;  3IC9 A;  4I2J A;  2XBB C;  1TKG A;  4TQR A;  4GXB A;  1UQV A;  4A8X C;  4R63 A;  3N30 A;  1T6B X;  1UA0 A;  4HNL A;  2OO6 A;  5JTI A;  5G5G B;  1DIQ A;  3ISD A;  4DNA A;  2E5S A;  2XN9 C;  2XI9 A;  5AKL A;  1XLN A;  4ASW C;  1BXT A;  2KEY A;  2GOL A;  3HWT A;  1QKZ A;  2R61 A;  3SU8 X;  1X2I A;  4EWJ A;  5BMH A;  3RBE A;  3ISC A;  3N1Y C;  2L8J A;  1NHP A;  4APN A;  1ZQH A;  4UB6 U;  3SYZ A;  1WR6 E;  1BPB A;  3VCN A;  3RIT A;  2WXO A;  3F5E A;  3PHW B;  2E6X A;  4I2G A;  3OP2 A;  3K75 D;  5AI9 A;  4UB4 A;  5E6P A;  4HWI B;  4K8G A;  4WWN A;  3FW9 A;  3AEF B;  2DPJ A;  2HOI A;  1NK4 A;  4EYI B;  2MBR A;  5H8Y E;  2JUO A;  3PRP B;  2PI4 A;  3GP7 A;  3V6C B;  4F91 B;  4ZHO A;  2LJ5 A;  2OCE A;  4B6J A;  1SXD A;  5DLG A;  3Q8L A;  3IJQ A;  2NYV A;  2KC1 A;  1VLB A;  1V59 A;  1A76 A;  2DL0 A;  3NHE B;  1TE6 A;  3SSZ A;  3AV8 A;  3V7K A;  2V3S A;  4GIV A;  1ZD2 P;  2CJO A;  2RLT A;  4E4F A;  1KEJ A;  4G11 A;  4ECS A;  1AHZ A;  3I3T B;  4J9O A;  1QT9 A;  2BVF A;  2HOF A;  1F77 A;  1IGC A;  1KD0 A;  1C4A A;  3TAQ A;  2V0G A;  4Y2Q A;  1ZRM A;  2BC0 A;  2NQL A;  4NXZ A;  4F1S A;  3A7A A;  4RT3 A;  4J9R A;  5HR7 A;  1ZDL A;  1DZN A;  3QIJ A;  3SFD B;  4WAA A;  4ED1 A;  1WZ0 A;  3F5A A;  2KQ4 X;  4YSZ B;  3LWM A;  2R8G A;  5E6J A;  4KDL B;  4DHZ E;  2ZIW A;  4X2P A;  2B21 A;  3DCG A;  3MJW A;  1QSS A;  5C5J A;  3PS6 A;  3AE5 B;  3DEQ A;  3Q8R B;  2V6O A;  3GIJ A;  1MO9 A;  4M52 A;  3UQB A;  2G0A A;  3KHR A;  7ICL A;  3MR6 A;  3QAR A;  1XS2 A;  2OAI A;  3S6J A;  4DL5 A;  7ICF A;  3IG3 A;  2WU2 B;  4IRK A;  4F8R A;  2I1J A;  2GGE A;  3CB3 A;  3PZ8 A;  4G9B A;  1XSL A;  5DGA A;  3QCA A;  1B4F A;  2IGD A;  1FO4 A;  4XDD A;  2Y4G A;  1U45 A;  4YXD B;  1FPY A;  5E6O A;  1TE2 A;  3A9J B;  3KTQ A;  1ZQF A;  3PZD A;  3CYJ A;  3WAO A;  2K89 A;  5DQI A;  2LGX A;  3KQ4 A;  4YVZ A;  4NAW A;  4J9K A;  1KLU D;  4GN1 A;  3JPT A;  1T5X D;  5KG6 A;  3D9X A;  1Z1B A;  1I19 A;  2MBH A;  3RR1 A;  5D4B A;  3NXL A;  2NV3 A;  2A19 A;  2D3D A;  1Q10 A;  1WXA A;  1BPE A;  5LNK 1;  2N0S B;  2OYY A;  3RJH A;  3ZVH B;  5HHZ A;  1KH0 A;  2ZEQ A;  4WJN A;  3QA8 A;  2Y0S F;  1RM6 C;  2BCU A;  1J19 A;  4O5E A;  1KW4 A;  1KTQ A;  1KM7 A;  2KDM A;  3AB5 A;  3G6V A;  3APF A;  4MEM A;  1LVL A;  2IY1 B;  3HPF A;  2JYT A;  4C4V A;  1GXF A;  3A7R A;  1NI3 A;  5AM3 A;  5F9N A;  3B2G A;  2AQ2 B;  2P6U A;  4MSQ B;  3E56 A;  1VQZ A;  1L4D B;  2Y5C A;  1KL9 A;  2WXP A;  3KYC D;  2WXF A;  2ZIV B;  4ECW A;  3Q3O C;  1TY0 A;  1JI7 A;  2FPL A;  4C80 A;  2KSO B;  1NK5 A;  3PY8 A;  4LNI A;  1BQG A;  7ICI A;  3RMK C;  3N6H A;  2H3V A;  2JU6 X;  4ZH4 A;  1Z4O A;  1STZ A;  2HTM E;  8ICJ A;  2PCE A;  2Q85 A;  1W1L A;  2K22 A;  9ICA A;  2L52 A;  4QWA A;  4KVG B;  1C9F A;  7ICT A;  3U9I A;  3DV9 A;  3PRZ A;  1X9W A;  4RH6 A;  2AAQ A;  2N9L A;  2O2V A;  2MUT A;  1P3Q U;  5GRT A;  2F76 X;  5FP0 A;  3JPN A;  5AI4 A;  4R8U B;  2FIF A;  3OJS A;  1UGJ A;  3ETR A;  2KXJ A;  1GRA A;  2KAC A;  3ALR A;  3ZJV A;  1GV4 A;  3HJE A;  4HPP A;  1TAQ A;  2ASL A;  1V38 A;  3GQC A;  3FKY A;  1NK0 A;  4MF2 A;  2ES6 A;  4DSE A;  3BJS A;  2NRT A;  2PMZ F;  1V97 A;  2NRV A;  3G6Y A;  3AI5 A;  4M9G A;  3TSS A;  3JS8 A;  1K53 A;  3NO1 A;  5ALR A;  3DED A;  3V7J A;  2LWP A;  2KWC A;  3TJP A;  2Z8L A;  3CXB A;  2F1J A;  2N9E B;  3OJ4 B;  1BNO A;  1ZQV A;  5J8Y C;  3N32 A;  3LB8 A;  2A8X A;  3L0W B;  3SD7 A;  2CHZ A;  3Q8F A;  3QLD A;  3IFW B;  2RD0 A;  5KHO A;  3PPA A;  4AP9 A;  3MZN A;  2LYA A;  9ICH A;  3HP6 A;  2KE7 A;  1E9M A;  3S1C A;  4DQI A;  4TUU A;  1NBF C;  2A1J A;  3DER A;  5KFG A;  2KQS A;  1NYQ A;  3B2F A;  3HSU A;  4LZG A;  2QQ6 A;  4UAR A;  3SI8 A;  4GYP C;  3C2L A;  1GOZ A;  3QX1 A;  5AM0 A;  4F4X A;  3MR2 A;  3GZN B;  2PS2 A;  4ZDV A;  8ICF A;  1ZKQ A;  1QF6 A;  1W1J A;  2INC C;  2GSH A;  2HHV A;  1LVH A;  1D3Z A;  4F5O A;  5AZG A;  2OH2 A;  4NPN A;  3VC5 A;  4K7S A;  5AI0 A;  2G07 A;  1COK A;  4WJO A;  1NKB A;  1JPM A;  1FNV A;  1PVR A;  3A1Q B;  2OWO A;  2VZK D;  2L00 B;  3TEY A;  2CN1 A;  2RP5 A;  4PL1 A;  1SBB B;  2GBR A;  3IHP C;  3UXP A;  4EQS A;  3SZ2 A;  5DG7 A;  3KUM A;  3W8X A;  1UGM A;  4ANU A;  1WGG A;  2XY5 A;  1W1M A;  4QZA A;  1WJN A;  4K1R B;  4NAW B;  4FX9 A;  1TVA A;  1WX9 A;  1X2G A;  2ZJD A;  2WTF A;  1EF1 A;  1YQ3 B;  4RUA A;  3FV9 A;  8ICK A;  1FHU A;  1PVQ A;  5KFY A;  1TS2 A;  5EWE A;  4AYB F;  3DDC B;  1JX4 A;  4PVK A;  3TFS A;  4AJW A;  2JK6 A;  5J17 A;  3QN3 A;  2DW6 A;  4UB5 A;  1L4Z B;  2M17 A;  3AEG B;  4DBG A;  2W11 A;  2EEL A;  1HTO A;  3A4R A;  5EE9 A;  3M8R A;  1VDV A;  3R8B A;  2P4P A;  4QZF A;  3PW7 A;  5F3X B;  2VH1 A;  3B08 A;  1JDF A;  8ICQ A;  3J81 j;  4TQS A;  3SBF A;  4PHD A;  4W9D A;  2WS3 B;  4FZN A;  4C4V B;  4YD2 A;  2Y3R A;  1JRO A;  1C7Y A;  1KTK A;  2PE9 A;  4MH0 E;  4HCN B;  2BCQ A;  2WU5 B;  2DHZ A;  5I1W A;  3D6J A;  1S0N A;  1S3S G;  2KVZ A;  4LA1 A;  4YMM A;  4GXI A;  2C7H A;  4OO1 J;  5DDM A;  4XZ4 A;  3ZDB A;  3TSJ A;  2C2D A;  3EGR A;  2IGH A;  3GD6 A;  1JN3 A;  5KL1 B;  4DHJ D;  3LVW A;  4IL6 U;  1OFF A;  4UDU C;  4DWF A;  4JN8 A;  1N48 A;  3VVW B;  3M6K A;  2GGJ A;  3H12 A;  5IAA C;  3QUB A;  2WF9 A;  4M8N A;  1EC7 A;  3O0F A;  3HW2 A;  4NL9 C;  4B9L A;  1QSY A;  2F1H A;  1B9R A;  3MFH A;  3GD3 A;  3KHL A;  1RRB A;  3K1G A;  5AM4 A;  1OUQ A;  1I4G A;  1RVK A;  4XGA B;  3BQ1 A;  2JQR B;  4TUQ A;  4MKS A;  2WDQ B;  3ETR B;  1WE6 A;  2H3Q A;  2VIX A;  4UB2 A;  3TAN A;  2KJH B;  3L54 A;  3TCA A;  3VH4 B;  5AK3 A;  5KFQ A;  2YVS A;  5BYS A;  3RR8 A;  8ICG A;  3AEA B;  3HM3 A;  3VUW A;  2H88 B;  5L83 A;  1S0O A;  4QNL A;  5IIL A;  1U49 A;  2I38 A;  2AHO B;  2LBO A;  3WKC A;  1EU3 A;  2FKP A;  3VFC A;  2VAO A;  3Q3M C;  2XNA C;  4K7W A;  4EM3 A;  3DBR I;  4G50 A;  3WKE A;  5AKX A;  8ICY A;  4GDL A;  4WWO A;  5ALQ A;  4GMV A;  2YQU A;  3PW5 A;  1FXA A;  1AYF A;  1BML C;  3SV3 A;  4EC3 A;  1RPL A;  3DHI C;  3U4F A;  4HJG E;  1UNS A;  3LWL A;  3EWA A;  1TYP A;  3RNM A;  1EUV B;  2X99 A;  5C3J B;  1WWU A;  4BKT A;  4ICA A;  1UWM A;  3RRG A;  3EEC A;  3P4R B;  5FR3 A;  3UQA A;  3R0K A;  4JB1 A;  2W04 A;  4WJQ A;  5KAI U;  2BS3 B;  2A1J B;  1MFW A;  2F5Z A;  2XCA A;  1E7V A;  2P6R A;  3EUB 3;  3FW8 A;  1KN5 A;  2WXR A;  3RJI A;  4NM2 A;  2JEI A;  3NRZ A;  2PLP A;  3W5U B;  5JCN A;  4YL8 A;  2IMW P;  2BPC A;  2ISP A;  1UBQ A;  4AWJ A;  2XCP A;  5U25 A;  1KBU A;  2GQU A;  5J0T A;  2G4D B;  2P3Z A;  1KLN A;  4PWB A;  3T3F A;  2J7Q B;  3N20 C;  2HOQ A;  3TOY A;  2RGF A;  1M4V A;  5ALH A;  2TPR A;  2BB6 A;  4B0M A;  2WP9 B;  3FIL B;  2KVR A;  2YEP B;  1TFR A;  4HDQ A;  5KG1 A;  5AE3 A;  8ICM A;  1ESF A;  4I2I A;  1SXE A;  4YFK A;  3RB0 A;  2XVT A;  2UVR A;  4Q45 A;  1UPH A;  5LXI B;  3VQI A;  1H4R A;  4H4X A;  1R7S A;  2UUU A;  2QPM A;  3LYS A;  4BKS D;  2EQ6 A;  2REX A;  4UAZ A;  1Z3E B;  4DL4 A;  5J0U A;  3BYT B;  2ZZC A;  5AK4 A;  4P6V F;  3QXG A;  2BPS A;  2ZZB A;  2KJ5 A;  3L17 A;  3R7Q A;  4UAW A;  5EE3 A;  4ICV A;  1TS5 A;  2X8G A;  2VH2 A;  1VZ6 A;  5DDY A;  2YEP F;  4KLE A;  5L6F A;  4DK5 A;  3MJ5 A;  4H4Y A;  3PSF A;  3VC6 A;  2K4I A;  1UF0 A;  2EKE C;  3MGV A;  4OJL A;  4BVU C;  4H19 A;  1IUE A;  3FW7 A;  1KCZ A;  5IDZ A;  5DG8 A;  4XUS A;  3EYZ A;  3Q8C A;  1PUZ A;  2BF8 B;  2O6V A;  2GI9 A;  3RYT A;  3TX1 A;  4PHE A;  1X9X A;  8ICC A;  2PEA A;  3MR3 A;  2WHI A;  3KBB A;  1X6J A;  3P42 A;  3TAC B;  1IP9 A;  5EE1 A;  4P1B C;  4L2Y A;  5CHF A;  1KFY B;  4BZA A;  2F44 A;  1HZ6 A;  1XQQ A;  1KOT A;  4EBC A;  4DSF A;  1CRX A;  3I9V 1;  1R4M B;  2CHW A;  4RQ4 A;  1EC8 A;  4HYR A;  4ZA0 A;  2C7M B;  4US9 A;  1ZQT A;  3QU9 A;  1DNC A;  5KFU A;  4FHJ A;  3R3M A;  4PVE A;  2QB0 A;  4K81 A;  3OPX A;  1QTM A;  3V62 A;  1Z5S B;  4NZL B;  2FLN A;  2YML A;  4KMO B;  4REZ A;  4OJO A;  1WXV A;  3HPO A;  3W1Y A;  1ZQY A;  5HI1 A;  1ACC A;  2INP E;  2AWT A;  4Y2R A;  2KKP A;  1G6J A;  3GZN I;  4RPZ A;  2JZB A;  4YTN B;  5KFT A;  4FJZ A;  1OJT A;  4Z1Y A;  1DK2 A;  4EEY A;  1RXW A;  5CRX A;  2GR0 A;  5ALM A;  3N1X C;  2YQE A;  4WWM A;  2ASJ A;  4KT2 A;  3AMZ A;  5J8Y A;  2YAU A;  2JH1 A;  1ZQL A;  2BZF A;  4YR3 A;  1ZDX A;  3CMM B;  5KVH A;  2PGW A;  1D5Z C;  3F2B A;  4URK A;  4F72 A;  2LUE A;  2KDF B;  8ICI A;  4TSS A;  3QFB A;  4QWE A;  2QB1 A;  1C4C A;  3DQV A;  3FYY A;  1A77 A;  2GH5 A;  1ZQA A;  1XLQ A;  1MHX A;  1JW9 D;  4H2H A;  3NUH B;  1MHH E;  1ZRN A;  1SKS A;  2WXH A;  3V7L A;  2ON8 A;  4GDL B;  4P16 A;  2NRW A;  4GYP A;  3MBY A;  9ICI A;  2KFN A;  1IPG A;  2N9X A;  1U4A A;  3R66 C;  4M01 A;  3UJF A;  1QQR A;  2UWQ A;  4K4H A;  4K4G A;  4F5P A;  2JWZ A;  4MEL A;  2IPK D;  3H0R B;  4WQM A;  7ICS A;  1GRB A;  2Y1I A;  3Q2A C;  2VJ4 A;  1P98 A;  1YNT E;  3PWG A;  1ELS A;  4JPS A;  5KG3 A;  3GS2 A;  4F71 A;  1ZD3 A;  2P8B A;  3NRZ B;  4DS5 A;  4EEW A;  3IT4 B;  1I4Q A;  1YN5 A;  2LYB A;  2W43 A;  2W0H A;  4FJV B;  2ONE A;  4RQ3 A;  1BT0 A;  2R8J A;  1QOF A;  2MH7 A;  4IRD A;  3UXL A;  3GE3 C;  2KP7 A;  1IIP A;  4Y2J A;  2G06 A;  4KSL C;  4ECY A;  3RJF A;  2TSS A;  1N5X A;  4ANV A;  2V9W A;  2PIA A;  3C5F A;  4DFJ A;  4X57 B;  5DLF A;  4NEW A;  2HSZ A;  1L3S A;  4GLS C;  5AE1 A;  1ZD4 A;  1ZE3 D;  1D5X C;  4LDT B;  2WF8 A;  3N4M B;  4DXA B;  3PSE B;  3NG0 A;  5L1K A;  3PX0 A;  2D07 B;  3SN1 A;  1ZP0 B;  4M9J A;  1RM6 B;  1NZP A;  4GXK A;  3KUC B;  4GRT A;  4IP4 A;  2ZIX B;  2HBM A;  5EOZ A;  2KWV B;  2MEK A;  3ABV B;  3AU2 A;  7ICH A;  2KQ7 A;  3OAW A;  2IJ0 A;  3GFK B;  5L1I A;  1TYG B;  3ZLF A;  4RT2 A;  3ENL A;  3HIZ A;  3IBE A;  4BC9 A;  2N4F A;  3RNA C;  3HVD A;  5JXV A;  1E10 A;  4EE2 A;  2CPR A;  9ICS A;  1NK8 A;  3UJS A;  4DL2 A;  1DXS A;  1WGH A;  4MJS A;  4TUR A;  2KWD A;  1Q46 A;  3TBL D;  4ECQ A;  1SE9 A;  5DGB A;  3UMB A;  1S8O A;  5EE0 A;  4EX7 A;  4HYK A;  3DVN V;  3QC8 B;  4ANX A;  1FIQ A;  3MWC A;  1PFD A;  4FLH A;  4K3B A;  2JZZ A;  5ER0 A;  2O6V B;  2WXJ A;  4TQ1 A;  4FS2 A;  1Y88 A;  4C4R A;  1JWS D;  2MJE A;  3Q6B A;  4DX3 A;  4RQ8 A;  2HHU A;  1TTN A;  4MF8 A;  4JWU C;  2ODG A;  2D8C A;  1ZXH A;  4ECU A;  5D2M B;  4TQ0 A;  3D46 A;  4NL9 A;  3IAM 1;  2BS4 B;  1S0M A;  1SF0 A;  2G4S A;  1ZDV A;  2EQY A;  1PDZ A;  2EAN A;  2C9W B;  3TAR A;  5KFJ A;  1RZT A;  1P0R A;  4W9G A;  1NJX A;  2PTX A;  2KTR A;  1QOB A;  3UMC A;  5HNK A;  4ARC A;  3I6E A;  2QB0 B;  2OM6 A;  5G5G A;  2J0M A;  1FFU C;  2PPH A;  2QDE A;  2FUG 1;  2DW7 A;  4GC6 A;  2FID A;  2HW3 A;  2O3G A;  5J2J A;  2D5G A;  2JZ3 B;  4EBE A;  2CHX A;  2YB1 A;  4JHM A;  8ICU A;  3SMV A;  2K8A A;  2J42 A;  9ICL A;  2KN5 A;  1EWY C;  2B6G A;  5D3I B;  1QLB B;  1WE7 A;  3PK7 A;  2NBU A;  2OZ8 A;  1GEU A;  3S1D A;  5ALX A;  1PK3 A;  1QQ6 A;  4FS1 A;  2HJ8 A;  4MLA A;  2Y08 A;  2BR0 A;  3X23 A;  2J3N A;  1J97 A;  2AL6 A;  4PGY A;  1XT9 B;  4KZ0 A;  4DLG A;  4DOB A;  3MC1 A;  2MNR A;  1F3P A;  3D2S A;  5HMR A;  3AEB B;  4RGO S;  2KC2 A;  1DRG A;  3W9C B;  3ALB A;  3H1U A;  1L2N A;  1TY2 A;  4OVV A;  2KTF A;  3TMP B;  3VUY A;  2FCS A;  2SEB D;  4RGN A;  2IGG A;  3KHG A;  2KFK A;  3IT6 B;  1P48 A;  2HNE A;  1QH9 A;  2KVS A;  3BS5 B;  4O3O A;  3VTV A;  4BBY A;  1SJB A;  1WR1 A;  5KTQ A;  3OW1 A;  2NBW B;  1L0V B;  2GR3 A;  3RNG C;  1L7M A;  2Y5P A;  2QDF A;  1ZX9 A;  1LQB A;  2D11 A;  1QSL A;  2QVH A;  2H5X A;  3H8H A;  4O3N A;  2DNF A;  3JPQ A;  3C1Y A;  3L3F X;  3NS1 A;  1BNP A;  1F2R I;  2RK5 A;  4J9P A;  2DUY A;  2PVG C;  2HMX A;  3TTE A;  2G5H B;  2G5I B;  4BBN C;  3NGD A;  1SGG A;  2LMC A;  1S9F A;  2W55 A;  3BZK A;  1Q3U A;  5AIB A;  1Q1O A;  2BCS A;  1SJE D;  1DXL A;  3FJ4 A;  5FJP A;  5DBA A;  1SJA A;  5DCN A;  2PMQ A;  4IKG A;  3N4E A;  1Z4N A;  3RCY A;  2K5P A;  2VFU A;  1K5O A;  1C3T A;  2EAM A;  5CWR A;  2G08 A;  2FJ6 A;  5KFB A;  1V1O A;  1J2N A;  5F9L A;  2IBI B;  3AH7 A;  2NVK X;  4Q44 A;  5AKG A;  3FXG A;  3QU5 A;  1SJH D;  3UQ2 A;  4ADW A;  3V61 A;  3ZNH B;  3VDZ A;  4C56 C;  1MC8 A;  2I6X A;  4ZYN A;  3HT3 A;  2K25 A;  5C2T B;  2WP5 A;  1YQB A;  4R66 A;  2ZVO A;  2PI5 A;  5DQH A;  3VTU A;  1D7Y A;  1HIW A;  4QZH A;  1LFD A;  3SEN A;  3W8Z A;  3LVV A;  5ALD A;  2PP1 A;  3QHT A;  1JWA D;  2ZG6 A;  1JCK B;  2SAK A;  4GR1 A;  2FAZ A;  1AQ6 A;  4DXG A;  5JCK A;  1AOG A;  3GB1 A;  3DQ0 A;  1D6E C;  1YD8 U;  1WUD A;  3QK0 A;  2DQN B;  5JCL A;  4HK2 A;  2DAJ A;  3H4B A;  2L83 A;  3PGE A;  5HR6 A;  1WFY A;  1T8E A;  1ZW7 A;  4P0Q A;  2J0J A;  4UAV A;  2WX0 A;  2VAN A;  1FIQ B;  2OKT A;  3RJA A;  1WF9 A;  3TIX A;  2MAX A;  5AKE A;  4YXJ A;  3JPO A;  2C7N B;  1B0X A;  4YR2 A;  2WXN A;  3AE9 B;  3VFK A;  2BKR B;  4F5R A;  5ENL A;  5FJT A;  5HHH A;  4DOA A;  3SHQ A;  2R8D A;  3JPP A;  3E0F A;  2BVG A;  4EEK A;  4ELU A;  3P3B A;  3C21 A;  3SQS A;  1WGY A;  3U2S C;  2KSO A;  2WX1 A;  3RF9 A;  2ZCB A;  1I4H A;  3ENE A;  3VHT C;  3ZIM A;  1F1H A;  1GES A;  3CGE A;  5L1L A;  5DKW A;  8ICO A;  4BDP A;  1N2X A;  1WCN A;  3M7D A;  4IQV A;  2KTR B;  2MBB B;  3NOB A;  4J3O D;  2X8C A;  3W1S C;  4KLF A;  4ECZ A;  1RDF A;  1D8B A;  4J9L A;  1E8Z A;  4RF1 A;  1P7F A;  3LXF A;  2WOW A;  1NHS A;  2KJ8 A;  3WAN A;  1IG6 A;  1JRU A;  3C28 A;  2XY7 A;  1KF6 B;  4DOC A;  1Y8R C;  4R8U A;  3AE7 B;  3EFC A;  4LNK A;  4F7Z A;  3RR7 A;  4PYU A;  2LZ6 A;  4EZ6 A;  5BOF A;  2ZIU A;  4FHK A;  4BWJ A;  1VD2 A;  3RNC C;  2C3C A;  5FS7 A;  1SIF A;  5B66 U;  3P1M A;  3ZXV A;  4DHG A;  3D2J A;  4EKU A;  2JRI B;  1D8L A;  2WP6 A;  3I63 C;  5J2C A;  2CRX A;  4EMI A;  2Q5W D;  4U6P A;  4ECV A;  3OSN A;  4TUP A;  2E1F A;  1T7P A;  3WK4 A;  3DBH I;  1JUD A;  1MPE A;  3EKG A;  3OWE B;  3MDA A;  2ZZP B;  4H4Q A;  3I4K A;  3PRE A;  1BPX A;  7ICO A;  1STE A;  5KFN A;  1KRP A;  2ZUC A;  4NJC A;  4RNA A;  5ADZ A;  3H8W A;  2ZC8 A;  4LTU A;  3ZTC A;  2G9H D;  1NDA A;  2KFK B;  5FS8 A;  3PSP A;  4DF4 A;  4UBC A;  4ELV A;  1L7Y A;  4BX9 C;  1TKY A;  1GET A;  4HCL A;  4LVS A;  2KJ6 A;  4M02 A;  3U7D A;  1Q0W B;  3L08 A;  4MFA A;  6ENL A;  4JLC A;  2P3H A;  4PVH A;  3MHS D;  4I2E A;  1MQ3 A;  2HHX A;  4OZC A;  3BQ0 A;  3NS1 B;  4FO6 A;  3T4W A;  4BOZ B;  4P4P A;  3H4K A;  3TUO A;  4YR0 A;  1R0M A;  4BGD A;  7ICP A;  1ET9 A;  2IZV B;  2XSX A;  3AU5 A;  2KKV A;  5ALN A;  5J2B A;  1XLO A;  1NKE A;  4XC2 A;  4ARI A;  3HUI A;  4DQO C;  3PR4 A;  3A1Q A;  2C3D A;  2XIC A;  4KLL A;  3K1R B;  4QW9 A;  4F4Y A;  3B0X A;  2B0C A;  4KMU A;  3QUC A;  1P9D U;  4Y2U A;  3BZC A;  2CJN A;  3WCQ A;  1DII A;  3MC0 B;  2V3A A;  3ZD9 A;  4NLZ A;  2KZZ A;  1SGH A;  1ZQQ A;  3GE8 C;  2NTT A;  1JPD X;  3U4E G;  3MDC A;  4NEV A;  4W9J A;  4IC9 A;  1XCQ L;  2G1E A;  3ECI A;  2D3C A;  4PVJ A;  5AM5 A;  5DPR A;  1CK1 A;  1L8L A;  4UAS A;  5K8E A;  4KGR A;  5IIM A;  3TJ4 A;  3ZDE A;  2Y5B B;  5KFS A;  1I4X A;  2LEK A;  1LGR A;  1YJJ A;  2WYQ A;  3NY5 A;  3RZF A;  3EF6 A;  3SAH A;  3V6K A;  4PZN A;  3VCB A;  3V3W A;  2F2A B;  5AWV A;  2MA1 A;  4ZOH C;  3RRH A;  4FJY A;  2VA2 A;  1IV8 A;  9ICQ A;  1JWB D;  2K8C A;  3X0W A;  4DXF A;  3T9L A;  3CGC A;  2R2Z A;  2MQJ A;  4F93 B;  3OGU A;  4TKN A;  1ZQK A;  2BYF A;  4IR9 A;  3BZD B;  2PTY A;  2DKZ A;  5ALP A;  3HRD D;  1A70 A;  4QWD A;  1C77 A;  1UEL A;  4HG0 A;  3D2Q A;  5IIN A;  2BBC A;  5KL8 B;  4EEN A;  2FPK A;  4P0Q B;  2JXT A;  1FFU A;  7ICG A;  3BK2 A;  3ZVV A;  2KD1 A;  4WAF A;  1V9J A;  9ICU A;  3Q8A A;  1E90 A;  4OJ6 A;  1Z19 A;  3PM9 A;  3WKD A;  4RZR A;  2BC1 A;  5KT5 A;  3ZVI A;  2PW9 A;  3UXN A;  4PH5 A;  3AED B;  2KIC A;  4DWI A;  2W54 A;  5D7G A;  3H70 A;  4E71 A;  3Q8B A;  2P0I A;  2Z59 B;  3ORY A;  7ICM A;  4GFI A;  2W9M A;  4A55 A;  2WBA A;  3VRA B;  2GGI A;  2JRH A;  2FLL A;  4FN2 A;  2WF7 A;  3K4G A;  2CDU A;  1YQZ A;  2O56 A;  4M6U A;  4EQX A;  1W6T A;  5L9X A;  3WK5 A;  3TFR A;  1R4N B;  2WXQ A;  3BK1 A;  4USA A;  2FPM A;  3WK6 A;  1TS3 A;  2OJW A;  5IIJ A;  5GTH U;  3CWI A;  2M19 A;  1NZB A;  4KLM A;  2DEN B;  2WNM A;  2LFI A;  4RQN A;  3KWV A;  5HG2 A;  1XO3 A;  4W9I A;  4I2B A;  2DLB A;  2LVP A;  4TVY A;  3WIM A;  5IKC M;  5HP4 A;  1JRP A;  2D3A A;  2L0F A;  2N7D A;  2K1F A;  2PU0 A;  4IWP A;  2EZX A;  1L5U A;  2KK8 A;  4A6Q A;  2ZIU B;  1J0G A;  5KFZ A;  2C2E A;  5CEH A;  2ZPN A;  4RM9 A;  5BYQ A;  2QMT A;  1F9C A;  2PLI A;  1MSW D;  3IK4 A;  2QAE A;  2NPT A;  1UH6 A;  3GRT A;  4IHC A;  4H50 A;  2PXI A;  2K3U A;  3RNE C;  4YWG G;  3FCP A;  4PGQ A;  4ACF A;  2Z0D B;  1YZ7 A;  5AE2 A;  4JAY A;  1SZH A;  3D2N A;  1GRT A;  1OEP A;  2FYM A;  3DDH A;  3DHG C;  1CMX B;  4NNJ B;  4KIK A;  4OJ5 A;  3BDP A;  1X9S A;  2P35 A;  3C23 A;  3QEA Z;  2J6S A;  2YLM A;  1AHU A;  3WKB A;  2LGY A;  4AUQ C;  4B9V A;  2FMP A;  3L8K A;  4FI4 A;  3NUQ A;  3JPR A;  4Z17 A;  4E4U A;  1PGB A;  4M00 A;  3RRA A;  3SEI A;  2CHR A;  2K4E A;  3C2K A;  8ICS A;  2BYE A;  3RUI B;  3GZF A;  4J9Q A;  2KDI A;  1ZQS A;  2AGP A;  2PVO D;  5H92 C;  4RPY A;  2ZVN A;  4K7U A;  1H6V A;  4O5C A;  3K1Z A;  1ZET A;  5E6N A;  4MHV A;  1XAN A;  4I29 A;  2R2O A;  4S0R A;  3I76 A;  3H7P B;  4TMA B;  5KNI A;  3PV8 A;  4A35 A;  4NAM A;  4GU2 A;  2AQ1 B;  4RF0 A;  1HXY D;  3MC9 A;  1F0X A;  1FEA A;  4JWS C;  2PFO A;  3LXD A;  1N6Z A;  4HXD A;  2POD A;  3CP8 A;  2ZJ8 A;  3MAB A;  3QPE A;  2C22 A;  3FIL A;  2XK5 A;  4RQ0 A;  4IS7 A;  1VJK A;  4YTP B;  4CCH A;  4KTQ A;  3UIP B;  1WXS A;  2MUC A;  3Q69 A;  5FMH A;  2RSU A;  2KHV A;  1YX5 B;  3H8J A;  3OC4 A;  3TWB A;  2WB1 C;  3N7P D;  2IDY A;  2MLB A;  4M2Y A;  5J29 A;  1IM4 A;  2NR2 A;  4C7Z A;  1PGX A;  3SAF A;  2EQ7 A;  4JL9 A;  1HEK A;  4DL3 A;  3AEE B;  2JSV X;  3L16 A;  4FFD A;  2VZK B;  3QWZ B;  4PS8 A;  3P2B A;  4K4I A;  4ACO A;  1TZO A;  4BFR A;  1B22 A;  4RQM A;  1WH3 A;  3ZDM C;  4C4S A;  4MT5 A;  2WXL A;  4WWP A;  2ZAD A;  3P63 A;  2JV3 A;  2K8C B;  2JZP A;  4RQ2 A;  4BKS A;  4GDK A;  2W82 A;  4B9M A;  4F92 B;  1N5W A;  2EXR A;  4RPX A;  4F4W A;  3Q8K A;  4DSK A;  1OTR B;  2OXO A;  2D10 A;  4OZA A;  1X40 A;  3W1S A;  1A6S A;  4IL2 A;  1TAU A;  4HKQ A;  2X38 A;  1KRH A;  1ZXI C;  4KLG A;  2IOF A;  2POZ A;  4W9E A;  3RJJ A;  1GSN A;  3IM1 A;  3RCZ A;  4DHZ B;  3TSH A;  2JH7 A;  2KMC A;  5FJR A;  3IRU A;  1K1S A;  2BPG A;  3E58 A;  2FE8 A;  3O13 A;  5DQG A;  3FVD A;  4NQL B;  3SR6 A;  3HK0 A;  1AAR A;  3R07 C;  2ISO A;  2L3Z A;  2LHE A;  1O08 A;  3DBS A;  3CT2 A;  1QLT A;  2KO3 A;  3K9P B;  4QZ8 A;  4MM3 B;  3WK7 A;  1FNW A;  3PR5 B;  2GLS A;  3ICX A;  3RZW C;  2GO7 A;  3RFA A;  2RR9 A;  3C2M A;  4NJ6 A;  4E8G A;  3FC4 A;  4GC7 A;  1K51 A;  4GIB A;  3M1Y A;  5KFA A;  2LI5 A;  1SJD A;  2EQ8 A;  3N7S C;  3H4D A;  1CUK A;  3DH9 A;  3E9S A;  2GRT A;  4ZYS A;  3FAH A;  1KJT A;  1WIA A;  2LGI A;  4DCC A;  2FBW B;  3KFU F;  1GG3 A;  2OED A;  1QQ5 A;  2ASD A;  2ASQ A;  3ZUN A;  4UB1 A;  4IW0 A;  2PFQ A;  2NPT B;  2LMR A;  2XEW A;  3BS7 A;  2DZI A;  2NS5 A;  2QEJ C;  4HVB A;  1UHU A;  5KFF A;  3UQ0 A;  2YMP A;  2IOF K;  1JXL A;  1SKW A;  4W9F A;  5ALZ A;  3P4P B;  3ZYY X;  5BOL A;  3PV1 A;  3ZRC A;  4RQ1 A;  3V72 A;  4UQG A;  4KIK B;  2HDO A;  2D2Q A;  2VA8 A;  3LK9 A;  1EBG A;  2JXX A;  2M8S A;  2QSD A;  4EFO A;  3I1Y A;  1UT5 A;  4DLE A;  1EBH A;  3H0M B;  4ZRP A;  4C8M A;  7ICU A;  1SV4 A;  1WYW B;  5B5E U;  2HBJ A;  3WA0 A;  1UWX A;  1T3Q C;  4ELT A;  3JW7 A;  4J9S A;  4IRC A;  3V6H A;  4A90 A;  3QU4 A;  1SSN A;  1OQY A;  4YSX B;  2ZTE A;  1WCL A;  1EC9 A;  1EU4 A;  2OZT A;  4DQR A;  4D2K A;  2XH2 A;  2ALZ A;  2WOV A;  3PQB A;  2X50 A;  1M6Y A;  1TZ1 A;  3I5J C;  3GDX A;  1U9L A;  3KOO A;  5KFK A;  3SEB A;  2WF5 A;  3GIL A;  3NVV A;  1HUO A;  9ICP A;  1COO A;  4NLG A;  4IP5 A;  3RO6 A;  3UXK A;  2M4N A;  3MSY A;  1T4G A;  1MA7 A;  1DOI A;  4M0X A;  4IQU A;  4GIR A;  3RBD A;  2LJI A;  4DYE A;  2GQW A;  4P0P A;  2N7J A;  4BBN F;  5JZE B;  4FBU A;  3RB3 A;  4B9N A;  1M6I A;  3QYP A;  2XK5 B;  3ZLZ A;  2OVL A;  3SJN A;  4NLN A;  2JT4 B;  2J4X A;  3J9C A;  2PMV A;  3M8S A;  3C1Z A;  2RPQ A;  4IT1 A;  4UBB A;  2AKM A;  2QJN A;  5KG0 A;  3M63 B;  2B3A A;  4OVZ A;  3MHZ A;  1GUA B;  1KKR A;  4C00 A;  1SEB D;  3UGV A;  2ZIX A;  4O0I A;  3B1L X;  3VR8 B;  2H89 B;  4M0A A;  2PP0 A;  5I1V A;  3AE1 B;  2ICI A;  2DBY A;  3C8Y A;  3VTW A;  3DVG Y;  5JU5 A;  4CDG A;  3IXS A;  3DK8 A;  2HHW A;  1YN4 A;  2R8K A;  2BKE A;  4JV2 A;  1EBD A;  3M9O B;  2BWF A;  4EX6 A;  3CRX A;  1S76 D;  5ALS A;  2DKX A;  2L7R A;  4RNN A;  3UMG A;  4K8D A;  7ICK A;  3RGT A;  4HNC A;  2BQ3 A;  1MJD A;  2MHJ A;  4GDK B;  5BO4 B;  4I6L B;  2C2R A;  2NO5 A;  5AI5 A;  5ALW A;  2HHT A;  4Q8E A;  9ICK A;  1LPF A;  5AHX A;  4C7Y A;  2RDB C;  3STP A;  3A0H U;  3T5L A;  3GU3 A;  9ICM A;  1WJ4 A;  3NJT A;  2CS4 A;  3BVZ A;  3IG8 A;  1TIF A;  2YVC A;  3GV8 B;  2FMS A;  3VAW A;  1FFV C;  3KYD D;  1Q1R A;  2OOB B;  3C19 A;  3TEX A;  2QGY A;  4ZCW A;  1TK0 A;  1Q8K A;  4GSW A;  2K60 A;  2OJR A;  1JAL A;  3NS8 A;  4W9C A;  1LKY B;  1SZP A;  3M62 B;  3SR6 B;  3RNB C;  2Y3A A;  1ZJM A;  4BC7 A;  3ML8 A;  5JH5 C;  3AUO A;  1L5P A;  4LCD E;  1XPY A;  3APD A;  1K50 A;  2WHE A;  1RYU A;  1WM3 A;  3MFG A;  2N7E A;  3RFZ B;  3I28 A;  5JRB A;  2IY0 B;  1QIL A;  1IXR A;  1VZ8 A;  2BB5 A;  3ZTD A;  2NVU I;  7ENL A;  3OTR A;  1K52 A;  2Y3S A;  3HRD C;  2BQR A;  4KGT A;  4A8E A;  4PL2 A;  5AUK A;  3IV6 A;  3QTP A;  3DHH C;  2IHN A;  5CB1 A;  3N4F A;  4P4M A;  4FZL A;  2MWS B;  3BYY B;  4OJP A;  4IOI E;  2E1E A;  3Q45 A;  3QE9 Y;  2PGE A;  4JDR A;  5DPW A;  3S1E A;  5CR0 A;  3B97 A;  4PS7 A;  4GXJ A;  1UZX B;  3WAP A;  3S2A A;  2YN4 A;  3T5J A;  2KFZ A;  1DOX A;  5AK6 A;  3A7U A;  2GBM A;  4UD8 A;  4CQN A;  4YWS A;  2V4I B;  4NLK A;  3MGI A;  3CST A;  4XLO A;  4M8M A;  3RH6 A;  5CX3 A;  2BCV A;  2L76 A;  3IJL A;  3KZX A;  3QU7 A;  3UF8 A;  4N59 A;  4NV0 A;  1MG8 A;  2W9N A;  1ZQI A;  4O3R A;  1AN8 A;  3L5O A;  4E6M A;  2HBL A;  2YMM A;  3SD5 A;  1E0Z A;  5TR5 A;  3M6Z A;  2XC9 A;  5DG9 A;  3JSV B;  3GII A;  4FA6 A;  1E8W A;  3PW0 A;  2LXA A;  3EC8 A;  1L0X B;  3BS5 A;  4M6W A;  5ALO A;  1N56 A;  2P8C A;  2W7O A;  4HDO A;  3NAS A;  5CHV C;  3ZDA A;  1ZQX A;  5FJO A;  2OFJ A;  4MFF A;  4GME A;  3TAP A;  1EM7 A;  3Q3N C;  5FS9 A;  1NK7 A;  1ZOY B;  4DQQ A;  5ALU A;  2WFA A;  1T0Y A;  2L32 A;  1XO1 A;  4LNN A;  1E8H A;  1S77 D;  2L0T A;  4RM8 A;  3PO5 A;  1D9D A;  2ZW1 A;  3NVV B;  3Q4D A;  2IOH A;  1I7H A;  3PZ7 A;  1ZQO A;  1TGZ B;  3WAL A;  3DFH A;  1NJW A;  1TT5 B;  5TSS A;  5KG2 A;  3SDL C;  1SV0 C;  4H83 A;  4YTM B;  2KMA A;  4P0P B;  1X9M A;  1J7A A;  4CYE A;  3OTQ A;  2EAO A;  5AM2 A;  1QLN A;  1T94 A;  1RYJ A;  3DGB A;  4G3X B;  4ZOH B;  2KK0 A;  5KVI A;  2HHQ A;  1D4B A;  1BWC A;  2FE9 A;  2JHD A;  1ZYQ A;  1JIH A;  1URJ A;  2LPE A;  2XGQ A;  1YJ1 A;  2RMM A;  3PHX B;  2BYV E;  5AEK B;  4ECR A;  1C78 A;  3DK9 A;  2YVF A;  5ALT A;  2BGW A;  3W8W A;  2GB1 A;  3W2D A;  2KOX A;  1SWW A;  4I2F A;  1ZQW A;  1ZXI A;  3N1Z C;  1QQ7 A;  4F5Q A;  2YVG A;  2MRL A;  3MC8 A;  3VDG A;  3R0U A;  4J57 A;  4IDI A;  4K2S A;  1XDI A;  3TL5 A;  3NVY A;  9ICJ A;  2PSN A;  3ZJT A;  1UBI A;  2YMQ A;  4FAD A;  1MDL A;  5L95 C;  3F53 A;  1XHC A;  4EQR A;  4P2H A;  4CE6 A;  2MX2 A;  2BCP A;  3TAD C;  3VTE A;  3OG5 A;  1A0P A;  4RNO A;  3BWU D;  2R9Z A;  1CQV A;  2QJL A;  5IA7 A;  4QZE A;  4EM4 A;  4JV0 A;  2DAF A;  3DGZ A;  3FG2 P;  4DFK A;  1NEN B;  1LXD A;  5HMM A;  1X66 A;  5ALJ A;  4EEL A;  4X5V A;  2V4L A;  2P13 A;  1NNL A;  1HTQ A;  3EZ5 A;  2V3N A;  2XID A;  2XH4 A;  4H1Z A;  2PU1 A;  1BVS A;  5JHA A;  1N61 C;  3ZLH A;  2BCR A;  3IJI A;  1UXY A;  3EUB 2;  5J2F A;  3VRB B;  5DBC A;  1V6E A;  1YJI A;  2K4H A;  2EMT A;  2INN E;  4YD1 A;  5DB7 A;  2D6F C;  2OX4 A;  1KQQ A;  4J3Z A;  8ICN A;  3JVA A;  1HZ5 A;  1OEY A; 
#chains in the Genus database with same CATH homology
 1MPE A;  1QF6 A;  3OWE B;  1W1J A;  1MI0 A;  2WDR B;  5FK9 C;  3LAE A;  2NQW A;  5BMG A;  1ZUD 2;  1STE A;  3NVW A;  4KGS A;  4NJC A;  4RNA A;  5ADZ A;  3P4S B;  4LTU A;  3MP9 A;  1FNV A;  3C0P A;  2G9H D;  2VZK D;  1P7E A;  3TEY A;  2BW2 A;  1SBB B;  1GPX A;  3PO0 A;  2BT6 A;  2VFR A;  1TKY A;  5HQX A;  3W8X A;  4H2A A;  2I2Y A;  1T3Q A;  1W1M A;  2P3H A;  1E0Y A;  4PVH A;  1ENF A;  4NAW B;  1WGK A;  2WDW A;  4OZC A;  3NS1 B;  1X2G A;  1YQ3 B;  3TUO A;  1ET9 A;  1JWU D;  1TS2 A;  1XLO A;  2WXM A;  4PVK A;  2NTS A;  4ARI A;  3HUI A;  4DQO C;  1WXQ A;  4PYT A;  5GXG B;  4LK0 M;  1L4Z B;  3AEG B;  1WVE A;  2CJN A;  2EEL A;  3WCQ A;  1C4P A;  1FM0 D;  3MC0 B;  5EE9 A;  1SIJ A;  1VDV A;  2LUM A;  4OHJ A;  3R8B A;  1GB1 A;  2P4P A;  2GRI A;  1FNU A;  2NTT A;  4XDC A;  3U4E G;  2G1E A;  1XCQ L;  4PVJ A;  1CK1 A;  2WS3 B;  2Y3R A;  1JRO A;  1KTK A;  5K8E A;  4KGR A;  2WXG A;  4O1N A;  2RDH A;  5HFY A;  1W1Q A;  3ZJU A;  2WU5 B;  4BCA A;  5I1W A;  3RPF C;  1I4X A;  1L6U A;  2LEK A;  1YJJ A;  3KWL A;  4A9A A;  3AE2 B;  1E8F A;  3SFE B;  5AWV A;  1VRA B;  3TSJ A;  4ZOH C;  1YMH E;  3EGR A;  4HRS A;  4DXF A;  1JML A;  1JWB D;  2IGH A;  1E7P B;  4OAL A;  1OQQ A;  2R2Z A;  4PZF A;  1UUP A;  1OFF A;  4UDU C;  2QKN A;  3BZD B;  1W1S A;  1A70 A;  3HRD D;  5G5H A;  1C77 A;  4HG0 A;  2IPI A;  1OQR A;  2BBC A;  2JXT A;  3BK2 A;  4ZHP A;  1FFU A;  4R3D A;  2RDG A;  1B9R A;  1PGA A;  4WAF A;  3Q8A A;  2BTE A;  3PM9 A;  1V8C A;  1I4G A;  2PW9 A;  1HEZ E;  1PDX A;  3AED B;  5BMI A;  2JQR B;  2W54 A;  2RPV A;  5MPO A;  2WDQ B;  5D7G A;  3ETR B;  3Q8B A;  1MVK A;  1RWS A;  4A55 A;  3VRA B;  2WXI A;  2YVS A;  4HKZ E;  5BYS A;  3AEA B;  3T3O A;  3P4Q B;  1HSK A;  2H88 B;  3NVY B;  4XWT A;  1WRI A;  2I38 A;  2VAO A;  2M0A A;  1EU3 A;  4HRO A;  2XNA C;  1QOG A;  2WXQ A;  3BK1 A;  4USA A;  1TS3 A;  3CWI A;  2M19 A;  2WNM A;  5HG2 A;  3KWV A;  2LFI A;  4LLG M;  1XO3 A;  2DLB A;  1FXA A;  1AYF A;  1BML C;  1SXT A;  4AQ7 A;  4TVY A;  1JRP A;  4EC3 A;  4HJG E;  1UNS A;  1E8G A;  1C79 A;  2ACZ B;  3EA6 A;  5AUI A;  1N60 A;  4A6Q A;  5C3J B;  2HDE A;  5BYQ A;  1W1K A;  2QMT A;  1UWM A;  2PLI A;  3BW7 A;  2BVH A;  3NVZ A;  2JYE A;  3P4R B;  5FR3 A;  4JB1 A;  2J52 A;  3Q8E A;  1N62 A;  5FXD A;  2BS3 B;  2K3U A;  1VR9 A;  4YWG G;  2MJ3 A;  1CJE A;  2M56 B;  5AE2 A;  3EUB 3;  3U7Z A;  3UI3 A;  1HA5 A;  4XWW A;  1QOA A;  3FW8 A;  2WXR A;  4JAY A;  3NRZ A;  2PLP A;  3W5U B;  2GQU A;  3U52 E;  1DII A;  1EWC A;  4MAC A;  4PWB A;  1FRD A;  3AE6 B;  1AHU A;  5L6G A;  1M4V A;  2BB6 A;  4B0M A;  3NVW B;  2AXR A;  2WP9 B;  1PGB A;  1F2R C;  3FIL B;  2YEP B;  1NEK B;  2VFS A;  5AE3 A;  2PVO D;  5H92 C;  1D5M C;  2W3S A;  1ESF A;  1FEH A;  4WUR A;  3KJM A;  4KX6 B;  4TMA B;  3VQI A;  1JQ4 A;  1R7S A;  2NMQ A;  3BII D;  2KN4 A;  2QPM A;  2UUU A;  4NAM A;  2AQ1 B;  4RF0 A;  1HXY D;  1WVF A;  1GAQ B;  1F0X A;  2PKO A;  3BYT B;  4JWS C;  4P6V F;  4RCO A;  4XE0 A;  2JWU A;  4RFB A;  1TS5 A;  1I4P A;  3R2T A;  1VZ6 A;  2YEP F;  3FIL A;  5EE3 A;  3B9J B;  3LYY A;  5L6F A;  3MJ5 A;  1VJK A;  4YTP B;  3W8W A;  4PT5 A;  3FW7 A;  3Q69 A;  1IUE A;  2WLB A;  4N58 A;  3T3N A;  2IDY A;  3S1F A;  4KKI A;  3Q8C A;  1SB3 B;  4C7Z A;  1PGX A;  2GI9 A;  3TX1 A;  1GB4 A;  1TKE A;  4ZRQ A;  1Y56 A;  3P42 A;  3CIR B;  5EE1 A;  1XCT L;  4L2Y A;  3ZQ4 A;  1KFY B;  3AEE B;  2JSV X;  3AN1 A;  1AWD A;  2VZK B;  1NYR A;  2CU3 A;  3B9J A;  1HZ6 A;  1SE2 A;  1TZO A;  3I9V 1;  5FXF A;  4MT5 A;  2WXL A;  1V1P A;  1ROE A;  3P63 A;  4US9 A;  4PVE A;  2JZP A;  3TEW A;  3URY A;  2W82 A;  1N63 A;  4NZL B;  4OW0 A;  1N5W A;  2KMM A;  4AS1 A;  4FXC A;  4REZ A;  2EXR A;  4OZA A;  5G5H B;  5FXP A;  3W1S A;  5BYR A;  1W1O A;  4HKQ A;  1E6E B;  2X38 A;  1KRH A;  1ACC A;  2INP E;  5HI1 A;  1ZXI C;  4YTN B;  2WQY B;  3TSH A;  1NVI D;  1QLU A;  3I99 A;  4HEA 1;  2FE8 A;  4WWM A;  3AMZ A;  3O13 A;  1XF5 L;  3SR6 A;  1ZDX A;  3R07 C;  3N9Y C;  1D5Z C;  1IGD A;  2LHE A;  1QLT A;  1N61 A;  5HHD G;  4TVW A;  4TSS A;  4MM3 B;  1DOY A;  1FNW A;  1MBT A;  2BS2 B;  1C4C A;  4RGM A;  2K9X A;  1XLQ A;  2JX5 A;  1MHX A;  1JW9 D;  3LB8 C;  1WYG A;  3FC4 A;  1K51 A;  3NUH B;  1MHH E;  1J7C A;  2WXH A;  4GDL B;  2PLS A;  1JWM D;  1AW7 A;  2ON8 A;  4P16 A;  2VFV A;  3E9S A;  1YN3 A;  4ZYS A;  3FAH A;  3AEC B;  2LGI A;  1MBB A;  1QQR A;  1J7B A;  1AHV A;  2FBW B;  1ET6 A;  2IPK D;  1FXI A;  2OED A;  4WIP A;  4YSY B;  4WQM A;  1FD6 A;  1XLP A;  1YQ4 B;  2GQT A;  1FFV A;  3NVZ B;  2N9K A;  1FCC C;  3IAS 1;  2W3R A;  1YNT E;  2QEJ C;  1WSP A;  4JPS A;  3GS2 A;  3P4P B;  3ZYY X;  2K0P A;  2J53 A;  3NRZ B;  1TS4 A;  3IT4 B;  1I4Q A;  1YN5 A;  1HQR D;  1QOF A;  1PYW D;  2QSD A;  1FCL A;  2PTL A;  1VZ7 A;  2MH7 A;  4OZB A;  2BYT A;  3ZGZ A;  1C76 A;  2AQ3 B;  4ZRP A;  1F0Z A;  2DYM A;  2TSS A;  1N5X A;  1XXG A;  2QIL A;  1UWX A;  2PIA A;  1T3Q C;  3KLS X;  1KLG D;  4A90 A;  1X2H A;  2ZW0 A;  1ZR6 A;  1SSN A;  4GLS C;  4YSX B;  5AE1 A;  1ZE3 D;  1EU4 A;  1D5X C;  3V3X A;  1SE4 A;  4D2K A;  3PQB A;  4JX1 C;  2WXK A;  2DYO A;  4O95 A;  5FXE A;  3SEB A;  1ZP0 B;  2UUV A;  1RM6 B;  1PUT A;  3NVV A;  4RGT A;  4US8 A;  3V05 A;  2LHD A;  4PWC A;  4WH4 A;  2MEK A;  3ABV B;  4L23 A;  5D79 A;  1DOI A;  2IJ0 A;  1TYG B;  4BC9 A;  4Q2J A;  2LJI A;  5JXV A;  3HVD A;  1ZPS A;  3RJ8 A;  1E10 A;  3DWM A;  4EE2 A;  3TEZ A;  2N7J A;  1CZP A;  1SB3 C;  2AX5 A;  1N5W C;  1RFK A;  2KWD A;  1TKG A;  1WWT A;  2ONQ A;  2J4X A;  3J9C A;  2PMV A;  4A8X C;  2DWQ A;  1T6B X;  5EE0 A;  5G5G B;  1DIQ A;  1FIQ A;  2XN9 C;  1XLN A;  1PFD A;  3MHZ A;  4OVZ A;  1BXT A;  2WXJ A;  1IBX A;  4TQ1 A;  1QKZ A;  1SEB D;  2R61 A;  5I1V A;  1JWS D;  2H89 B;  2MJE A;  3VR8 B;  5BMH A;  2V3P A;  3AE1 B;  2ICI A;  2DBY A;  4JWU C;  3C8Y A;  4B0E A;  1ZXH A;  4TQ0 A;  3IAM 1;  3IXS A;  2BS4 B;  1YN4 A;  2WXO A;  1B1Z A;  1SF0 A;  2E6X A;  1ZDV A;  3AE8 B;  3VR9 B;  3FW9 A;  1V1P B;  3AEF B;  4ML8 A;  4KKJ A;  2MBR A;  1QOB A;  3AE3 B;  5H8Y E;  4ARC A;  5G5G A;  4GDK B;  1FFU C;  3GP7 A;  4ZHO A;  2FUG 1;  1L6V A;  4C7Y A;  4JE3 B;  1VLB A;  1BUI C;  3AV8 A;  1L0Y B;  2O3G A;  2D5G A;  3W5V B;  2CJO A;  3BVZ A;  1AHZ A;  5I4D A;  1FFV C;  3FWA A;  1QT9 A;  3TEX A;  2BVF A;  1F77 A;  1IGC A;  2J42 A;  3HVZ A;  1C4A A;  5D3I B;  1EWY C;  2V0G A;  1JAL A;  1QLB B;  3A7A A;  4ITK A;  1DZN A;  3SR6 B;  3SFD B;  3S1D A;  3POP A;  2Y3A A;  2KQ4 X;  4YSZ B;  3D2H A;  5E6J A;  1I4R A;  4MLA A;  4BC7 A;  1L5P A;  1FMA D;  1K50 A;  3RFZ B;  1TJE A;  2QIE B;  3MFG A;  3AE4 B;  1QIL A;  1VZ8 A;  2BB5 A;  3AE5 B;  5HMR A;  1K52 A;  1LO5 D;  3AEB B;  4RGO S;  2Y3S A;  3HRD C;  1N60 C;  3W9C B;  4KGT A;  5AUK A;  1TY2 A;  2OAI A;  3BYY B;  2SEB D;  4RGN A;  1N62 C;  4IOI E;  2IGG A;  3IT6 B;  2WU2 B;  3S1E A;  3PZ8 A;  4BBY A;  2E5A A;  1DOX A;  3L4P A;  2IGD A;  1FO4 A;  4XDD A;  3A7U A;  2Y4G A;  4UD8 A;  4YXD B;  1L0V B;  4CQN A;  1SE3 A;  2V4I B;  2Y5P A;  4DNS A;  2VFT A;  2L1A A;  5D3D A;  4XLO A;  3KQ4 A;  3H8H A;  4N6E B;  1KLU D;  4N59 A;  3NS1 A;  1F2R I;  2RK5 A;  1AN8 A;  2PVG C;  1T5X D;  1E0Z A;  1I19 A;  2LMC A;  2W55 A;  1Q10 A;  1DYQ A;  1SJE D;  5LNK 1;  4MH8 A;  1L0X B;  2N0S B;  4IKG A;  2VFU A;  2K5P A;  1V1O A;  5HHZ A;  1KH0 A;  1RM6 C;  3AH7 A;  2OHF A;  1SJH D;  2KDM A;  3AB5 A;  4C56 C;  1EM7 A;  2JYT A;  5C2T B;  3GSY A;  1ZOY B;  2EKI A;  3A7R A;  1DGJ A;  1NI3 A;  4L1B A;  3B2G A;  2AQ2 B;  2L32 A;  1E8H A;  1VAO A;  3NVV B;  2ZW1 A;  3E56 A;  1VQZ A;  1L4D B;  3W8Z A;  2Y5C A;  1I7H A;  2WXP A;  3PZ7 A;  2WXF A;  5TSS A;  1JWA D;  1JCK B;  2SAK A;  1TY0 A;  4DXG A;  4C80 A;  4M0W A;  3GB1 A;  3DQ0 A;  4YTM B;  1D6E C;  1J7A A;  5T8I A;  2JU6 X;  2HTM E;  1RYJ A;  2Q85 A;  1W1L A;  4YT0 B;  4ZOH B;  2K22 A;  2L83 A;  1D4B A;  2L52 A;  1C9F A;  3RJA A;  1FIQ B;  3R2I A;  1IBX B;  2Y08 A;  4RH6 A;  2N9L A;  2RMM A;  2WXN A;  3AE9 B;  1C78 A;  3BVG A;  2E3T A;  2R8D A;  2GB1 A;  3W2D A;  1UGJ A;  3ETR A;  2BVG A;  3I57 A;  1ZXI A;  2KAC A;  5FKA C;  3DWG C;  3U2S C;  3ZJV A;  1I4H A;  2B76 B;  1N63 C;  4IDI A;  3NVY A;  4J3O D;  3ZJT A;  1W1R A;  1V97 A;  3JS8 A;  1FRR A;  3TSS A;  3AM9 A;  2Q4W A;  4RF1 A;  1K53 A;  1P7F A;  3LXF A;  3DED A;  3VTE A;  2Z8L A;  3BWU D;  1CQV A;  2QJL A;  3AE7 B;  1KF6 B;  1NEN B;  3D2D A;  2I0K A;  2P13 A;  2V3N A;  2KAJ A;  2MJD A;  3Q8F A;  1N61 C;  3LLB A;  2WDV B;  1UXY A;  3P1M A;  3S1C A;  1E9M A;  3EUB 2;  3VRB B;  3D2J A;  1YJI A;  2INN E;  1NYQ A;  3B2F A;  3BVM A;  3HSU A;  2Q5W D;  1XEE A;  3NZ3 A;  1GOZ A;  1HZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...