1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
3NVZB 1RM6C 1YJJA 5AUKA 1T3QC 1NVID 1TKEA 5EE0A 4YSYB 3CIRB 1KRHA 5MPOA 4MLAA 2VFUA 3AM9A 3SFDB 1N5XA 2RK5A 1E7PB 2W55A 2W3RA 2WU2B 1PUTA 3LXFA 1WVFA 1SF0A 1XO3A 2K5PA 1WGKA 3P4RB 2PLIA 4C7ZA 1I19A 1WRIA 2WDQB 1JALA 2GQUA 4PYTA 2HTME 2L83A 5GXGB 1E6EB 2BS3B 1FXIA 1FFVA 3NS1A 1PDXA 1TKGA 3AEGB 1AYFA 1E8FA 1KFYB 4FXCA 1E0YA 3FAHA 3A7UA 2ACZB 1JWAD 3L4PA 1J7AA 1MBBA 4ML8A 1W1KA 1QT9A 3S1CA 3ETRA 4JX1C 1V8CA 3HRDD 3ABVB 2MJ3A 3NVWA 4US9A 2MBRA 2MJEA 1DOXA 1VLBA 2VFRA 5G5GB 1ZXIA 1ZOYB 3RPFC 1QOGA 2GQTA 5HHZA 1R7SA 1L0VB 4USAA 1J7CA 4N58A 5G5HA 4P6VF 3S1FA 1DIIA 3AB5A 3W9CB 4C7YA 4US8A 3DWGC 1F0XA 2WU5B 1N63C 1ZUD2 3AEBB 2H88B 1HSKA 3NRZA 5C3JB 3NVYA 2CJOA 3A7RA 1FM0D 1FFUC 3AE4B 1RYJA 1AWDA 2P3HA 3P4PB 1JW9D 1QLTA 3P63A 3W5UB 2QPMA 4TVWA 2Q5WD 1FO4A 4HROA 3W8ZA 2E5AA 1N61A 4JB1A 2N0SB 1GPXA 3P1MA 1AHZA 1X2HA 2L52A 1DOIA 2VFVA 2VFSA 1NENB 2P4PA 3W5VB 3AE8B 1W1SA 3HRDC 4HRSA 1W1JA 2R2ZA 3NVZA 3AE7B 4JWSC 1I7HA 1N60C 1W1LA 1J7BA 1PFDA 2OHFA 3LAEA 2DWQA 3DQ0A 1UXYA 3AEDB 4YTMB 5EE9A 4BC7A 3R07C 1QF6A 1T3QA 4IDIA 2WP9B 1ROEA 3DWMA 2CU3A 3AE6B 1MBTA 1WXQA 2K9XA 2E3TA 1IUEA 4O95A 1N5WC 1CZPA 1B9RA 4TVYA 3EUB3 3HUIA 1JWBD 5FXFA 1WVEA 1VAOA 1DOYA 2PLSA 1FRDA 3VRAB 1XLPA 1QLBB 3NVVB 3AECB 1ZP0B 3I99A 2QIEB 1ZXIC 2WDRB 1W1QA 3B9JA 2M56B 2NQWA 1V97A 2FBWB 1YQ4B 1ZR6A 2PIAA 3AEFB 2O3GA 1YQ3B 2BVFA 2JQRB 1EWYC 1TJEA 1DIQA 3AEAB 1OQQA 4ZHOA 2BS2B 5FXEA 1E9MA 2G1EA 3SR6A 2WDVB 1WYGA 5G5GA 1FIQB 1X2GA 4ITKA 3AN1A 5EE1A 3NRZB 5H92C 2EXRA 1FRRA 3KJMA 1L6VA 1TYGB 1VJKA 2WS3B 1DGJA 3PM9A 3S1DA 3AV8A 4LTUA 1N61C 1JRPA 4WQMA 2Q85A 4XLOA 3ZYYX 2PKOA 3VR9B 1N62A 1F0ZA 4WWMA 3B2FA 4A9AA 3VRBB 3A7AA 1QOAA 1AHVA 1N63A 1NEKB 4YTNB 4BBYA 1XLOA 2QJLA 2M19A 2AX5A 5AE2A 2OAIA 5AE3A 2QKNA 1SB3C 5HMRA 2MJDA 1E8GA 1WWTA 3P4QB 4HG0A 1XLNA 1SB3B 3VR8B 3BIID 5EE3A 2BVGA 4BC9A 1RM6B 1TKYA 2VAOA 5ADZA 3EUB2 1CJEA 1FFVC 4ZOHC 2KAJA 3LB8C 4YSXB 3KWLA 1QLUA 2AXRA 2CJNA 2B76B 2VFTA 2Q4WA 3B2GA 3S1EA 1VQZA 1OQRA 3NS1B 3W8WA 4ZOHB 1N60A 2PVOD 5AE1A 1FMAD 1GAQB 4N6EB 2YVSA 1JROA 4OALA 2R8DA 2P13A 3AE2B 4N59A 1L6UA 1OFFA 1AHUA 4KX6B 3PO0A 3DEDA 3ETRB 1E10A 3HVZA 1YJIA 1KF6B 5AUIA 3B9JB 3NVWB 4YSZB 3P4SB 1N5WA 1W1RA 1QOFA 4YXDB 3AMZA 1NYQA 4C80A 4JAYA 1FXAA 3NVVA 3BW7A 4YTPB 2Y5CA 3LLBA 1RFKA 1RWSA 1E0ZA 1W1OA 5G5HB 3AE9B 2K22A 1JQ4A 3SR6B 5HQXA 3JS8A 2W3SA 3TX1A 3NVYB 3SFEB 1L5PA 3AE5B 4ZHPA 1W1MA 2BT6A 2MH7A 2BVHA 2PVGC 4JWUC 1N62C 4YT0B 2BS4B 5FXPA 5C2TB 1DZNA 1FIQA 2LEKA 1NYRA 1NI3A 3W8XA 1XLQA 5H8YE 1SIJA 3AH7A 3C0PA 1VDVA 2WQYB 1QOBA 3AE1B 1A70A 2KMMA 1E8HA 3CWIA 2DBYA 2I0KA 1FFUA 3FC4A 2H89B 3AE3B 2EKIA 2W54A 3WCQA 2JX5A 5FXDA 2WLBA 4BCAA 1UWMA 3AEEB
chains in the Genus database with same CATH superfamily
1C79A 3ZNID 2WDTB 3SV3A 4AP9A 4CF4A 4QZAA 9ICAA 3A9KA 2I1QA 4DFDA 5BOFA 1YJJA 3O65B 4EZKA 4LA1A 1KRPA 3LWLA 1XSNA 2V3SA 1ZD3A 4C8KA 5EE0A 3TANA 2BKFA 1S0OA 5J0YA 4Y2QA 5KT5A 4REZA 3PR5B 5MPOA 4E8GA 4MLAA 4PGQA 2XGQA 2BCUA 2YMLA 1F2RC 2P6UA 3QU5A 2ZG6A 2FI1A 2JK6A 3IG5A 2MP2A 2AL2A 2W8LA 4IQWA 5J2AA 5ALOA 1OUQA 2YVCA 2EQ8A 3RNBC 1UQVA 4QWAA 4EZJA 3LDAA 3H6NA 3MZNA 3CXOA 2W55A 4RT2A 2W3RA 1ZDVA 2OPJA 4PHPA 1BXTA 4R3DA 4RZRA 3LXFA 4IL2A 2JZ3B 1WVFA 1Q1RA 2PGWA 2DQNB 2Y9UA 4PS3A 4DHZB 3VXWA 3QQ8B 4B9VA 1UA0A 2PLIA 3MR5A 4EBCA 1WJ6A 3UMGA 5D7GA 3GV7B 4C7ZA 5HHHA 3N1XC 3RH5A 1H6VA 2FKPA 3R11A 3T9PA 1WRIA 2AQ2B 2LUEA 2WDQB 5DPWA 1ZD2P 4QW8A 2WGSA 4U6PA 3IP4B 3H8JA 3BK2A 3VTVA 2KYWA 2HTME 2L83A 1NDAA 2GR1A 1HTOA 1E6EB 5CEHA 1AARA 2JYEA 1FXIA 1F5SA 2KZRA 1FFVA 3CT2A 2HW3A 1HZ6A 5KFKA 1UGMA 1ZOLA 5ALTA 2KJ5A 3WKCA 3O0FA 4RFBA 3DFHA 8ICRA 4Q44A 2NV3A 1PVQA 2DZMA 8ICLA 3P3BA 1E0YA 2HHXA 2RD0A 3OC4A 1COOA 2BR0A 3ZJUA 2ACZB 3NGDA 3QCAA 3UXOA 1JWAD 2W82A 4RH6A 3FKYA 1E7VA 4J9PA 4RGNA 4Y2TA 2HDOA 1J7AA 1ENFA 1GRTA 2PP0A 3RGTA 1L0XB 3V7JA 5KFGA 3H9DA 1W1KA 3A0BU 3Q8KA 4ML8A 4KLHA 4EBDA 2LUMA 2HMXA 2NRVA 4M9JA 4NM2A 1KW4A 5AEKB 2V4QA 1HEZE 2DHZA 4AJYB 4IS7A 2V3AA 2EMSA 3NVWA 3IDWA 3R10A 1J2MA 4LJXA 2G09A 7ICVA 4DFMA 2BQ3A 5ALLA 1EU3A 2KFKB 1SGHA 3GOEA 3CB3A 4RF0A 3PO4A 2VFRA 1ZXIA 2IPKD 1ZOYB 4MSMB 3H8SA 3RPFC 2JY6A 3T5HA 1I4HA 3HJEA 2GQTA 5HHZA 1HZ5A 2J4XA 4DXKA 5IIMA 5KG7A 4O3NA 1LO5D 2GB1A 1L0VB 3MKCA 5AWVA 1J7CA 2LVPA 3NZGA 2DGZA 2FLNA 5DPTA 2HVIA 4DFJA 5KT7A 2KNJA 2LFIA 3W9CB 3GV8B 1TKDA 3ZJTA 2JT4B 2X38A 4US8A 3DWGC 1NK8A 1NHQA 9ICVA 1FNWA 2ZUBA 2GR3A 2UUVA 1IXRA 1NPXA 2PI4A 1KJTA 2DLBA 2LGXA 1ZQZA 2H88B 2N7DA 4C4VA 1DTNA 1MJDA 1JPDX 2ON8A 3UIOB 1S7MA 3A7RA 3PMNA 1FM0D 2J53A 4FI4A 2KTRA 5DPSA 4DXAB 1F8WA 1RYJA 1X9SA 3M1YA 3M8RA 4B9SA 3W1SC 4DQPA 2WX0A 3D32A 3L54A 1JUDA 2JEIA 3D2QA 5AKGA 5AKYA 1KH0A 2JV3A 3MGVA 3ALRA 3ISBA 4EUTA 4PWCA 1QLTA 5JHBA 3WAOA 4ECUA 3W5UB 1NZPA 5JCLA 5L95C 3TEYA 1T5XD 2QSDA 4ROPA 4EQRA 2ZCBA 1DGSA 2D3AA 4CRXA 3Q8EA 3PWIA 5C5JA 1CQVA 2KFZA 3NO1A 2WYQA 3PW0A 4CGZA 1T0RC 1U4AA 2F8LA 4YWGG 9ICLA 4PL1A 5HR7A 1GSNA 1ISNA 4EOYA 2C3DA 1K52A 3H7PB 3T4WA 3UPQA 2YVFA 3BYTB 3VUYA 1FHUA 2AWTA 1SSNA 3MY9A 3OTRA 2ZZBA 3QARA 2N0SB 2YN4A 1GPXA 2P35A 2VH1A 4KLDA 2L8JA 2PP1A 4ZRIA 1SL0A 2G5IB 2JYTA 2LRUA 2GR0A 1R4NI 4GYPA 3N7SC 2ZIVB 3KZIU 4UB1A 1P3QU 1AHZA 3R7RA 2JMGA 4OVZA 2C2EA 2PPHA 3RJEA 4B9TA 1NK7A 1DOIA 2G0AA 3PFRA 2UYZB 2AQ4A 1UA1A 5BPCA 4UAWA 1WJNA 3QHTA 4PK1A 1NENB 2VFSA 3W5VB 4I2BA 1PDZA 2FDRA 3PRMB 3HRDC 7ICJA 4M01A 4YP3A 2DYBA 3MC8A 4GSWA 1W1JA 2NVKX 3TJIA 3NVZA 2KJHB 1ZMDA 3MC0B 2NMQA 3I63C 4A3PA 2W03A 1GB4A 4TQ0A 4JHMA 5AK4A 4YL8A 2YEPB 1W1LA 1J7BA 1PFDA 1ZQKA 4AUQC 3ES7A 4H4XA 5KFFA 3KUDB 1A0PA 2BWES 2ZJ8A 3NASA 2FMSA 4Z17A 2PFOA 3KLJA 5J2EA 1TE6A 4GDLA 3F53A 1YT3A 3BWUD 1Q1WA 2D8CA 1X1MA 3QX1A 1BPEA 1W6TA 4ECVA 4Y2UA 4QW9A 4YTMB 1QF6A 4F71A 1C20A 4NV0A 2CR5A 2O2VB 2QB0A 1ZQYA 2DPIA 2FCMA 3DHIC 1KOTA 1P43A 3OSNA 3CGDA 3JW7A 4O3PA 2G9HD 3ZTCA 2KD0A 5DCNA 3T5KA 3N9YC 1FEAA 3L5OA 1ZQ1C 3H0LB 3RB0A 2REXA 3AE6B 2Y3RA 3JPSA 1T3NA 4M47A 2AGPA 1T4GA 3SZ2A 3DDMA 3OJSA 1XC9A 4M00A 3T8MA 3Q8FA 4E4UA 4GDKA 2NTTA 3WA0A 1WGDA 3E58A 4PS7A 1B9RA 2BGFA 3TSHA 4F8CB 2DAFA 1SKWA 3VCNA 5ER0A 2G07A 4A55A 3CXBA 1ECWA 5TR3A 3QTPA 2QJMA 2MU2A 2HOFA 3U2SC 4YR2A 2M17A 2WXHA 2V0GA 3HKZF 4YFKA 3SN1A 2QHOA 3AECB 1X9XA 2QLTA 2XCPA 4FULA 4TKNA 2WF7A 3MFGA 4ICVA 4RQNA 3RJJA 1HIWA 5DGBA 4FBTA 2L32A 1ZXIC 1UNSA 3E2EA 3RT3B 3WAMA 3QX7A 1BPBA 4FN2A 3ZRFA 3IHPC 2PODA 3ZLGA 5KNIA 2VA2A 4BXOA 3ZGZA 4J56A 4O3SA 1HXYD 1GEUA 2R8IA 2JRIB 2M56B 4EMJA 2C3CA 2NQWA 2PFQA 1QZEA 3RJGA 2DYOA 2DZIA 2FBWB 3MR2A 3H4DA 1ZR6A 3ZQ4A 1XHCA 3VTEA 4DQQA 5ALRA 3UINB 3M63B 5DB9A 1ET6A 1TZOA 4EE2A 1MA7A 3IN5A 1UT5A 5ALSA 3VCBA 4ECZA 1SKSA 3GIMA 4F8RA 4G3IA 3BJSA 2JQRB 3N6HA 4KEMA 1HQRD 1D6EC 3C8YA 1JXEA 1NKCA 4HCDA 4RNMA 2B3AA 4H4PA 1ZDLA 1UBIA 3ZDBA 3CSTA 5D6JB 4PJ0U 4WJ3B 4DS5A 1MOKA 2BS2B 4NM1A 5KFJA 4KN7A 2D3DA 3QUCA 1PVRA 1KFSA 1WYGA 4Q8FA 1XU4A 2W9NA 5J2RA 1GRGA 2SAKA 3PK7A 3UJRA 1TTNA 2H3VA 3AN1A 2GOLA 2IOHA 5EE1A 2NTSA 3CMMB 3NRZB 3SYZA 3NZSA 3TQ1A 2DFLA 3BQ1A 1TBEA 5H92C 1SXEA 2FPKA 3L3FX 3UXPA 4M2YA 1XCQL 1AN8A 4PYZA 5BOEA 2MLBA 3KJMA 2Y3SA 3UMBA 1QCKA 4JK1A 3WK9A 4HEA1 4Y2SA 5E6JA 2LYAA 1LKYA 4UB2A 2KVZA 2V3PA 3EPGA 4IUMB 4LTUA 4DL3A 3IV6A 3ML8A 2NRXA 2Y5PA 5E79U 5J0PA 4CNQA 2AU0A 2BBCA 3H70A 4BJQA 2JZZA 1TYPA 2PKOA 4BOSC 1F0ZA 2B6GA 4GYPC 5KFNA 3NZ3A 4ZH4A 4JV2A 1QOAA 3U9IA 1RRBA 5AI6A 5DQIA 3RJFA 2BF8B 2XGZA 2O6VD 5CR0A 5J0QA 3TADC 1XLOA 2N1VA 2QJLA 3RCZA 3KQ4A 2AX5A 4I2CA 3NOBA 2A1JA 4IG7B 4IRKA 4W9KA 1L3SA 2KDBA 3CSFA 1ZK7A 3RNMA 2IOFK 3SAGA 1C7YA 4RQMA 2KZMA 3N30A 2K8BA 3UQAA 4EZ9A 1JPMA 1D7YA 1KBUA 2M0NA 4UB3A 2RR9A 2VZKB 2LASA 4BKTA 2MJDA 4AQ7A 1RLFA 4WJQA 1EC8A 2IGGA 3DBRI 3C29A 3C1ZA 1SWWA 3IT6B 4QWEA 5KTQA 3RNGC 1J8CA 1KKXA 2HOIA 2C2RA 3I5JC 1R4MB 2LM4A 3VR8B 5FMHA 3ZDDA 2LGYA 2Z0EB 4ACFA 4EQSA 2WF6A 2RRDA 2KHVA 4BC9A 1RM6B 5CTRC 2YVJA 2AEHA 2KKVA 2KJ9A 5U25A 1HA5A 1WRDB 5K4LA 3EUB2 1N48A 2OZ3A 1HUZA 3QK0A 5C23A 2Y4GA 4ZOHC 2KAJA 3DGHA 1V9JA 3ZLZA 5AIBA 3DVGY 2KQ4X 1D9FA 1NNLA 4YSXB 2LBOA 3EECA 3KWLA 2JF5A 2CJNA 3M9NB 2PLPA 2WPFA 1PK1A 4Z6DA 3NRWA 1OQRA 3FW7A 2V1YA 3NS1B 2XNAC 5L9XA 1B0XA 2OYYA 4KITB 5AM2A 2RDJA 2MX2A 3BSMA 2MCNB 4RM9A 2E6XA 2JZBB 5ALMA 3GY1A 3H7IA 5J17A 2SEBD 5AE1A 9ICNA 5KFMA 2W04A 2OWOA 1FMAD 1TGZB 1B4FA 5I1WA 1C4CA 4M52A 4OALA 2Z59B 1T0YA 4ECYA 3QFBA 3DK8A 3V3WA 4KGTA 2WXGA 1YEYA 4I2GA 1JX4A 2QKQA 1JDFA 1TAUA 3EPIA 2NRZA 4GGHA 1L6UA 4EMWA 1X9WA 3DESA 2EQYA 3KWVA 1SJDA 1WGGA 1WY8A 3HM3A 3RMKC 2MUCA 3DEDA 2W43A 5J0OA 3G6XA 2PGEA 2Y1JA 3EA6A 3TCSA 3CNHA 3URHA 4Y2YA 8ICHA 3Q8PB 3SD5A 4NLBA 1FNVA 3APCA 4O5CA 4BBNC 4PZNA 3H0RB 4DXGA 1LXDA 3DBLB 2CKHB 3M3JA 4O3OA 1N5WA 5AI0A 3TFSA 1W1RA 2DW7A 4YXDB 3AMZA 2ZJAA 2F77X 1I4RA 1TAMA 4P0PA 2C9WB 3TBLD 4YTPB 3LLBA 4KPLA 1RFKA 2FNJB 1RWSA 4KVGB 2NCNA 2H3IA 1MRAA 3S47A 4H1ZA 1FHVA 2ASJA 4A35A 1S0VA 5G5HB 4CF5A 5J2CA 3QWZB 1ZQDA 1D4BA 5EDSA 3H0MB 1E90A 4HPPA 1SE3A 3U7DA 2BPFA 1FNUA 3AU4A 3V5CA 1JQ4A 4EELA 5CHGA 1I4QA 2D07B 3BZDB 3QA8A 3IG3A 2KXJA 3KHLA 3TJPA 3DG7A 1BUIC 1U4BA 3K1ZA 2WXJA 2OCEA 4URKA 3TFRA 1XO0A 2D3GA 3TX1A 3SFEB 3NUHB 4I6LB 2B21A 5KFXA 5AKJA 2FMQA 5KFEA 4II3B 1VZ8A 4KN4A 4HNLA 5J29A 2PVGC 1JRUA 3GS2A 1CEZA 3E9SA 2D6FC 4YT0B 1MQ2A 2BS4B 5FXPA 2XK5B 4IQUA 3U26A 3MBYA 2NPTA 4P0QB 3KYCD 3GIIA 4IWOA 4IWPA 4LJOB 4ED2A 4XX5A 4ASWC 5IKCM 4AYBF 4KZ0A 4ZRKA 3U30A 2X99A 1ELSA 3DDHA 1XLQA 3BK1A 2JVCA 5ALZA 2WOWA 3H8AA 2HBKA 1V80A 2LYBA 1MHXA 4YCXA 3SDLC 5FP0A 3LAEA 1JWMD 2QGYA 3AE1B 4W9GA 1NK9A 2PU1A 3JVAA 4AWJA 2KJ6A 2KMMA 2GBRA 3A9JB 3PHWB 4RGOS 3I3TB 2I0KA 3MFHA 4K3CA 2W54A 4OZCA 2NVUI 3WCQA 1XT9B 3M95A 1AOGA 3IAM1 4TMAB 1BT0A 1EC9A 1IG6A 3IAS1 3ZNHB 5FXDA 1A76A 5B66U 5KAIU 3BJYA 3IC9A 3AEEB 2E1EA 3KTQA 3SEBA 4J1OA 5L1MA 4NLCA 1F44A 4FS2A 1RM6C 3RNFC 1N56A 2D3BA 2LI5A 2A3VA 4JL9A 4UATA 3GE3C 1LGRA 2QARB 5AUKA 1WIAA 4FJYA 2ZZCA 1ZQLA 3PV8A 1T3QC 2H3ZA 2HNEA 5L1JA 4R66A 4YSYB 1ET9A 1ZQQA 4BWJA 3CIRB 3T3FA 4ECRA 1Y56A 2KQ7A 1IP9A 1FEBA 5DQGA 3AM9A 5DQHA 4IP4A 1ZRMA 1N5XA 2RK5A 2GGIA 3Q6BA 3BVZA 4B0MA 4MFFA 3N4MB 3PZPA 1L7PA 4R8UB 1KEJA 1RAXA 1FCLA 2PP3A 2K0PA 1SE2A 4H4YA 1J19A 4RU9A 1QQRA 2X8GA 3THUA 4P4MA 1ZPSA 3DK4A 3K9PB 3R2IA 1ZX9A 2Z0DB 1PUTA 5J18A 2V9HA 4C4TA 4WAAA 3ZIMA 3VFKA 1SF0A 3MP9A 4FLHA 3VTWA 1XO3A 1WM2A 3FVDA 1T7PA 3MDCA 2G3QB 4KLGA 4P1BC 3UI3A 1I19A 5DBCA 4XYCA 2QCZA 3L16A 9ICIA 1JALA 5HFYA 5KVHA 1QSLA 4RQ8A 5DLGA 1Q3VA 3OLMD 4BAXA 1GO3F 3FW8A 1D8YA 1L6NA 1Z5SB 4RQ6A 2MSED 1XWLA 1ZRNA 3UXLA 3B0XA 4BKSD 2BS3B 5ALIA 3CW2C 3ZD9A 1NELA 2GGGA 1GC7A 2PA6A 3WKBA 2RPQA 1PDXA 4I2AA 4J9LA 1TKGA 5AZGA 2J0JA 2JEGA 2FCSA 2ZW1A 4KSLC 3AEGB 3H7SA 4G3XB 4KWSA 3MR3A 3RB4A 3O13A 1GRAA 2YQUA 1E8FA 3JSVA 3DBSA 1KFYB 4YMOA 3GE8C 2LHEA 5FS6A 2W8KA 3BQ0A 2P66A 5FS7A 3LVVA 2FLPA 4ARCA 2OXOA 3GZFA 4PH5A 1V1PA 5AM0A 8ICSA 3OGUA 2WXOA 3V6HA 1YZ6A 4WJNA 4KX3A 3DGZA 2I9GA 2HXUA 3Q3JA 1QT9A 1ZQUA 2KFJA 3T3NA 1SL1A 3BYYB 3QXGA 3KUCB 5LXHA 1VJ5A 2MJ3A 3HILA 1ZQOA 2IY1B 4GN1A 3K75D 3OPXA 5AI5A 1NK0A 1TY2A 1DOXA 3L5KA 2HHQA 4TUQA 5TISU 1E9IA 2ZUDA 4PGYA 3D2JA 5JUMA 4NNJB 1S8OA 3JPOA 2MNRA 3Q8MA 1QOGA 3GP7A 9ICUA 2ZPNA 4YR0A 2O6VA 4IR1A 4ECXA 5AM1A 4R63A 4H4RA 3DHGC 3ZJVA 1ACCA 4RQ3A 4LNKA 3EZ5A 4N58A 1Q46A 2AQ1B 4GOCA 5KHQA 3S1FA 1DIIA 5ALNA 5JZEB 1SIFA 2IO2B 3AB5A 2BC0A 3SQSA 4YWSA 2F1HA 3MFIA 1C1YB 4ECTA 5JTIA 3APFA 3RITA 4DL4A 3I4KA 3TACB 1V49A 1N63C 4OW0A 1MN8A 3QC8B 5EOZA 1PYWD 3SN0A 3EWAA 1GXFA 1WX7A 4JLCA 3NVYA 1Z2MA 4JIOU 5FJTA 3SD7A 4U7CA 2GRIA 1PGAA 1V38A 3AE4B 1L0YB 2ZJDA 3PVXA 5F3XB 1AWDA 2J7QB 1EBHA 2GH5A 3K1GA 3EHVA 2IA6A 2HDEA 4I2JA 3P4PB 3KUZA 1ZQMA 3D2NA 4K4HA 1HE8A 3P63A 5AKHA 1P1AA 2OJWA 2KSOA 4EM4A 2GR2A 4I29A 3R8BA 3C23A 4E74A 3DG6A 5ALGA 4HYKA 1ZQFA 3AQFA 2IJ0A 1JCTA 5KFBA 4OO1J 2ZTCA 4NQLB 4FO6A 3ES8A 5J0SA 3DG3A 2W9BA 1U47A 3G6YA 1WX8A 1MC8A 2D5GA 4GU2A 1N61A 4J03A 3QU2A 3KHHA 4E6MA 5J2DA 1TK8A 4F5NA 8ICVA 5HR6A 1TYTA 1PGBA 3DJJA 5L6GA 3IJIA 4KTQA 1L5UA 2OZTA 1QQ7A 1ED1A 2KJ8A 1X2HA 4NL9C 3VTUA 2KX3A 1D5XC 4FJZA 4EFOA 2PW9A 5AKLA 3MC1A 3UXNA 3JPTA 3QKEA 3TMPB 3RI7C 2N9LA 3RJHA 3D2HA 3C5GA 2V4IB 8ICIA 3AE8B 2KMDA 1XS9D 2GBNA 2W7OA 3RZWC 4A8XC 8ICTA 2MP2B 4RQ5A 1TS5A 2AL2B 3ISCA 2C7MB 1ONEA 1WCLA 2E1FA 3TARA 3AE7B 4KT2A 1XSLA 1N60C 2KD1A 2RGFA 1Q1OA 2OHFA 4DS4A 4DL5A 5HHIA 4ACOA 4DO9A 2KZ3A 5IILA 2C22A 8ICEA 2UU7A 4W9CA 5CHWA 3X0WA 2KK0A 1DOQA 3DQ0A 2J6SA 3VAWA 7ICEA 4BWMA 5HKHA 3AEDB 4BC7A 3GZNB 4KSKC 2HZGA 1ZQNA 2K6QA 4GLXA 4PS8A 4FBJB 1BQGA 1H2IA 3OPSA 2WP9B 3C21A 1ROEA 5KT2A 2VJ5A 1STEA 5J0RA 3DWMA 4NJCA 2WB1F 1RXWA 4Q8EA 1NHRA 3RFZB 3FXGA 2XH2A 3M6ZA 1J0GA 2NRWA 4WQOB 4MFCA 3JVZX 3VA8A 3ZD8A 1NK4A 1WXQA 2K9XA 2OOBB 1MBTA 4IM0A 2RQ5A 3HSUA 3HW2A 4O95A 2L05A 5AI8A 3LVWA 3IXSA 1ZY8A 4G0NB 3LYYA 2ICIA 1C77A 3VC8A 4GC7A 4XQ8A 3HUIA 1D9DA 1GG3A 2DUYA 2MBEA 4QZBA 5GTIU 1L7NA 1SV0C 2WHIA 4JN8A 5KG6A 3RBDA 3RAXA 4WAFA 2VZKD 1DOYA 2PLSA 1ZKHA 1KL9A 2PI5A 1IYXA 3CGBA 4DF8A 1L8LA 1M94A 1XEEA 3KLSX 2W9AA 3VRAB 4K4GA 1LVLA 1WXVA 1QLBB 1XLPA 4JPSA 3BY4B 3HPOA 3ML9A 4F91B 4A90A 3RYTA 2WBAA 3IJQA 4IM3A 4G11A 3I99A 4PVJA 2QIEB 3N97B 4FZLA 2WFAA 3SAFA 1ZQPA 4KLOA 3Q3MC 1YJ1A 5F9LA 2FYMA 3PQBA 1V5TA 2KO3A 3I28A 3EFUA 3V7LA 2W7PA 1W1QA 4I2HA 4DEZA 3GRSA 4M9LA 3A33B 2QMTA 4ICUA 4QZCA 1GV4A 5ENLA 2WXKA 2I5HA 4KZCA 1UD7A 2KG5A 1T0SC 5ALYA 1EWCA 1SJHD 1YQ4B 2PIAA 3BS5B 5AM3A 3CF6E 3HT3A 3SHQA 3N1ZC 2M9NA 4LZGA 5C0YA 1G6JA 1EF1A 2PMVA 3DBHB 4B0EA 1PZNA 2KDEB 4GB9A 2Y0SF 3PO5A 2ZZPB 2YEPF 2JGAA 2RDBC 3MQTA 4IOIE 4ZHOA 2IHNA 1MPEA 1QTMA 5FXEA 3SR6A 4RM8A 1ZJNA 1KKOA 2ZXIA 1X2GA 4ITKA 1XPYA 4K4IA 3S5SA 2LD9A 4C4VB 3NFUA 1EXNA 4JQ9A 5KVIA 4ADWA 2JRHA 4MM3A 2YMQA 2KTRB 4AOFA 2WOIA 1OGWA 3FYHA 3U4EG 4HPNA 2L76A 1D3ZA 1L6VA 2H3QA 3PM9A 1DYQA 1DGJA 1EU4A 2R8KA 3S1DA 3S2AA 3IRUA 4HKQA 1FEHA 2Q0ZX 4WJPA 3AV8A 4K81A 1J97A 3RRAA 3JYUA 3GB1A 2KTQA 2LRWA 1N61C 2AQ3B 1ZQWA 1JRPA 2EDUA 3AEVA 2J52A 2CHWA 4XZ4A 4DL6A 2L3ZA 3B1LX 1M6IA 4GFIA 1CUKA 2XICA 1KN0A 3PHXB 3PRPB 2PE9A 3VR9B 4JV1A 1N62A 4M0WA 4WWMA 5AICA 1ZW7A 7ICTA 4GISA 1LB2B 3B2FA 4A9AA 2KKCA 2WPEA 2N1RA 3A7AA 1AHVA 4R65A 3KUMA 1MFWA 4YTNB 2LGSA 5E6NA 4DSIA 1NJYA 5JXVA 4JN7A 4BBYA 3RNCC 7ICSA 1YIWA 4H4WA 1U9LA 5JCMA 3ISDA 3RB3A 4BFRA 4FDCB 2XBBC 4ZRPA 2F3NA 2QJJA 3DH9A 3VQIA 2OKTA 1UF0A 2KWCA 1RXVA 3IM1A 3H4KA 1UUPA 5FJUA 5BMHA 4M9GA 3QU7A 1QLNA 3H7PA 4H4ZA 2E8MA 3FDSA 4RPZA 2Y08A 5J2JA 3N28A 3PSPA 3QAQA 2XIDA 4AS1A 4KMUA 1SXTA 5EWFA 1V6EA 4F4WA 7ICIA 5IA7A 2PMZF 2CHXA 7ICNA 1ONFA 2PXIA 3RRHA 7ICOA 1FEZA 2DNFA 7ICHA 2ZIVA 2V4LA 2I38A 3R0KA 5ALXA 5KFUA 2RABA 2HCFA 1L7MA 1OQYA 1ZQSA 4KKJA 4EENA 4JGHB 1T0QC 2E8NA 3NTUA 5DGAA 4J9RA 4HDOA 4FADA 2KFNA 2VAOA 3QUBA 2FCNA 1FFVC 4K2SA 4K1RB 4ANWA 5JCNA 4MGYE 3V60A 1BPZA 4NEWA 2ZIWA 2AXRA 2B76B 2VFTA 3MGHA 2Q4WA 3B2GA 3D9XA 3R66C 1VQZA 2LKYA 2KICA 4QJFB 4GXIA 2OLAA 4BZAA 3RNAC 4ZOHB 4DL2A 3R7QA 3APDA 5KT4A 1ZQCA 2M0XA 4J57A 2E8OA 2MWSB 2O2VA 4ZRQA 1GAQB 4N6EB 3KVFB 3I6TA 2BPGA 2YVSA 4CE6A 3TW9A 2INPE 3LWMA 9ICXA 4L23A 3HM6X 2FAZA 4A3OA 1YNTE 4EEWA 8ICXA 3PX4A 3T5JA 2R8DA 8ICJA 9ICHA 3RTVA 3WKEA 3AE2B 1OFFA 2ATLA 3LADA 1AHUA 3PNCA 3KBBA 2TPRA 5J04A 4KX6B 2PFPA 3PO0A 1R4MI 4NEVA 2GLSA 5JH5C 4EZLA 5A0LA 4HCNB 2VH2A 1NHPA 2WP6A 1GNUA 3ETRB 1NBFC 4QIWF 3L8KA 2JZPA 4H4TA 1YJIA 4ANUA 1B22A 1JMSA 4YSZB 1ZKQA 9ICRA 2KWUB 3C2KA 2KK8A 2A5UA 3PPAA 2KWDA 2ONEA 2KN5A 1UPHA 4FE3A 1QOFA 5DG8A 4QWDA 1BNOA 4C80A 3B97A 3AU6A 1FXAA 1MG4A 2BQUA 4P7IA 4F72A 2JXJA 1RYRA 5BYSA 5ALHA 1XCTL 3PS6A 1DK2A 2N7JA 3GO2A 2RDIA 4JWNA 4K7WA 4B6WA 2UUUA 3KKAA 4A6GA 3F5AA 5DB6A 2XH0A 2MSNA 4DWIA 3FWAA 2K22A 2FE8A 3Q6JA 2FE9A 2Y1IA 4F5RA 4GIRA 3H8WA 4MH8A 1RYUA 2FLLA 3LK9A 4I6NB 2AKZA 3QEAZ 1WGRA 3JS8A 1XD3B 2F8KA 4XUSA 3RNEC 1EBGA 1P9DU 1SWVA 2KDFB 2PTWA 4O1NA 4ENLA 3I76A 3GQCA 2X8XX 2RDXA 5J0TA 3AE5B 5BYRA 2PEAA 2OZ8A 3UJ2A 2MRPA 4FHJA 2AGQA 1WYWB 5ALFA 1R0MA 2MH7A 2BVHA 4QWBA 1R4NB 3IT4B 4JWUC 5JCKA 4BVUC 1Z00B 5KFRA 2LGIA 1N62C 5L1LA 3H8HA 4FBUA 2NBWB 4A8EA 2BB6A 2PU0A 2KLGA 1V5OA 4TV3A 2MBHA 1S1QB 3PTFC 1WF9A 2WAQF 1NYRA 1ZQTA 4S17A 4BURA 2D2QA 1ZQVA 3DBLI 2AYOB 1DK3A 4IL6U 2YVGA 4GLSC 5D49A 2BZFA 1C4PA 3QE9Y 1KFTA 2KMCA 3AH7A 5H8YE 3E56A 2C2DA 4DNAA 4IC7B 2NR2A 1SE4A 4I27A 1VDVA 4DL7A 3TOYA 2RHFA 4O5KA 1XS2A 4E5TA 1L3UA 3CRXA 2JUOA 1ZD5A 2A1JB 4IRCA 3CWIA 2DBYA 3U4FA 3FC4A 4XRHA 3AE3B 3J81j 3UQ0A 1WG8A 3CYJA 3BINA 4F2SA 3QIJA 4MGKE 3ICXA 2DPJA 2KV2A 1IYFA 2K8BB 1WJ4A 2X8CA 2EAOA 3DVGX 1L4ZB 4KIKA 1ECQA 3NUQA 4II2B 1LPFA 3QUQA 2IGHA 4UB4A 4HYRA 3AI5A 3PLVA 2KT7A 3WANA 3IK4A 2UVUA 4K8DA 5DB7A 2LVQA 4MGZE 2PTZA 4RQ0A 1NVID 2BYFA 4YXMA 4NLKA 2BTEA 1ZQAA 1TKEA 2MBOA 2YLMA 3L10B 5FKAC 1YX5B 3NZUA 5KFAA 8ICCA 3ZDCA 4KKIA 2F5ZA 4W9FA 2VFUA 2HSZA 4ED7A 5JRBA 1XXGA 4OJLA 1H4RA 2BPSA 2ALZA 1WWUA 3SFDB 4I2EA 3KZXA 1BPYA 2XI9A 2MUTB 5AZFA 5L1KA 3N7RC 5LNK1 3RJ8A 2XVTA 2ZIUA 3PSIA 2J6TA 4EBEA 4PT5A 2POZA 1Y8RC 1IBXB 3EKGA 3ZVVA 4NAWA 4ZYSA 3EFCA 9ICTA 2CDUA 1VZ6A 4TUUA 5FJOA 2K39A 2D11A 3M6KA 5F9NA 1QKZA 3QZ7A 2KDIA 2PTYA 3VC6A 1F77A 4J9MA 4MMWA 4MDKE 2KZZA 3FILB 3P4RB 2PPGA 4F1SA 2WF9A 2N9XA 4HVBA 3SJNA 4BGDA 2GI9A 2OO6A 4ELVA 5AM4A 4M04A 1KTKA 4OD0A 4PYTA 5DPRA 1KDHA 4S0RA 5GXGB 3I1YA 5KG0A 2JRZA 2L5YA 4F3OA 2ZEQA 4NJ8A 2IPIA 4F4YA 4QZEA 4J3ZA 2I1KA 3Q3NC 3NS1A 4K7UA 2EQ9A 2K8AA 4F50A 3DDCB 2XY6A 3LB8A 1ESFA 3ZDEA 5ALEA 2J0MA 2JZBA 2ZJ5A 4BKGA 4RPXA 3N20C 5ALJA 3N3KB 2A8XA 3DERA 4RUAA 4ECSA 3Q8AA 2N7EA 3ZVIA 4LK0M 4Y2PA 4F4ZA 5TZVA 4LVSA 4M8NA 1V59A 3KKAC 2HJ1A 5IO9A 2WDWA 3MGIA 4P0PB 4NY0A 4DF4A 3FCPA 3L0WB 4HNCA 5ALPA 3ZKJC 2P6RA 5H2FU 3Q8SB 1GETA 2HBJA 2V6OA 3S1CA 3V6CB 4Y2XA 3PX6A 2O56A 4JX1C 1F2RI 4HK2A 2WPCA 3EW9A 3HRDD 4F92B 8ICNA 1VZ7A 1JI7A 3ABVB 4IKGA 4YG2A 3JPQA 4US9A 1C9FA 1WJUA 3RH6A 3C0RB 1CMXB 3T9LA 4DHGA 2PSNA 3MR6A 2BB5A 2HBMA 4DLGA 2MJEA 4MACA 5T8IA 4JQWC 4CHKA 1VLBA 2JR5A 4Y2JA 1S0MA 1K51A 2BKRB 5G5GB 3RR1A 3LYSA 1S9FA 1OEYA 2IDYA 5JHAA 4B9UA 8ICWA 1SJAA 1L7OA 1C78A 3CAWA 4HCPB 3FYYA 3UJFA 1MO9A 4HWIB 4MFAA 2GLEA 4GXBA 1KSPA 2CHZA 1KLGD 4ED0A 3B0AA 4USAA 3FM9A 2QVHA 4EEKA 5G5HA 4P4PA 3C28A 5DKWA 4GIVA 4LJPB 3TWAA 4DYEA 4DSJA 4MH0E 1UCVA 3D6JA 2HHSA 1WMHA 1Z3EB 4C7YA 3UQBA 3UJSA 3K1RB 5ALUA 1ZUD2 2C7HA 3S6JA 1URJA 2LYHA 1ZQRA 4W9EA 2AH5A 3V6EB 2WP5A 2V4RA 2BHNA 2OH2A 4RCOA 1TS3A 5AHXA 2GGHA 1S97A 1V86A 3EF6A 3C1YA 5CA7A 2KQSA 2LZ6A 4WWOA 4YMNA 3UF8A 2P3HA 1F1HA 3QU4A 3RJKA 1JW9D 3HKZC 2KANA 4CYEA 3DFYA 4H4QA 3OWEB 1K50A 1KLNA 4P16A 3VDGA 5DG7A 2FMPA 4FZMA 2QPMA 3TCAA 4B9KA 1C3TA 3OP2A 4TVWA 2WX1A 2UVVA 4BOZB 2JEJA 4C8NA 4J9KA 2IYDB 2OJRA 4KV2A 4XGAB 4MHVA 4J3OD 1X6IA 4K7ZA 1FO4A 4F5QA 1MVKA 3BQTA 2C5LC 5LXIB 3ZDAA 4Y2VA 5E6PA 3W8ZA 2E5AA 1WR6E 3GD6A 5FJPA 1YD8U 3RR8A 2OEDA 4HJGE 4JB1A 2ZNVC 4M0XA 1LVHA 1NKBA 2HVHA 1RG6A 1KQQA 1GOZA 4DQOC 2NPXA 3MUCA 4MGGA 2KACA 4M6WA 4MEYA 4YR3A 4M9NA 3P1MA 3A9JA 3BVMA 1AQ6A 4BDPA 1MNSA 1BVSA 1MI0A 3BZKA 2KC1A 1H38A 2L52A 3OZMA 2KP7A 2WWZA 3CK5A 3L13A 1I4GA 2K4EA 9ICMA 3THVA 2MBBB 2ZCCA 2IO1B 2AJQA 2JSVX 3D46A 3RFAA 4HRSA 4MSQB 4BUGA 1NI2A 4TSSA 2INNE 2KN4A 5TSSA 4X2PA 1JCKB 2QARA 2XCAA 3IVFA 4LCDE 3W1YA 2LMRA 4PGXA 3DCGA 4GR1A 3HVDA 2Z8LA 3PV1A 4G50A 3PZ8A 5HG2A 3EAOA 2HBLA 3ECIA 2EH9A 3QYPA 1JWUD 1TY0A 4OJ5A 3HHMA 4B95A 1UXYA 2PKEA 5DLFA 3A4SC 3N7PD 5IIOA 2CU1A 4ED6A 5BOMA 5DG9A 2WXQA 2X8HA 2QDFA 5FR6A 2BCVA 3PZDA 4IDIA 3TIXA 4NZLB 2F76X 4NPNA 4R8UA 3PW4A 3HK0A 4MJSA 1GJZA 1TKKA 2QAEA 2LJ5A 3LXDA 2HXTA 2BDUA 3M9MB 4XWTA 3Q2AC 4Z6CA 2MBQA 4UAUA 1WUDA 5AK5A 4O3MA 2BKEA 3ONSA 2E3TA 6ENLA 1QSSA 1N5WC 2KX0A 2KJRA 4XDDA 3T6CA 1WZ0A 7ICGA 2YQEA 2RLTA 1ZYQA 1CZPA 2AL6A 3MHSD 8ICPA 2C7NB 4WWPA 2ONQA 4MKSA 4TVYA 1JWBD 4MELA 2EZZA 1HUOA 1TVAA 1NZBA 4O9MA 2NBVB 4PHEA 1L7YA 4DLEA 3JSVB 1SV4A 2ESEA 4M6UA 2GH1A 4MF8A 1FRDA 4NWIA 4ZRJA 5CB1A 2DF4B 3NVVB 1P7FA 3UIPB 4Z1YA 1ZP0B 3K9OB 3WK7A 3URYA 3IJLA 3Q4DA 1Q5WB 3ZVHB 5DDYA 3SENA 5KFOA 2Y9TA 1KLUD 3FV9A 3ZUNA 3TL5A 5E6OA 2ZADA 3ZRCA 2F2AB 2KHQA 3B9JA 3DVNU 4LNIA 3JW0X 5DBAA 4I2IA 2C28A 1EUVB 2ZIXA 4P2HA 4DSFA 1Q8KA 1V97A 1Z1BA 2WXFA 3GZNI 2BCQA 1L2NA 1P7EA 3VFCA 4O3QA 3AEFB 2HHTA 4DWDA 1YQ3B 2K3UA 3ZDMC 2ODGA 3R9KA 1BGXT 3CGEA 2O3GA 1X2IA 2KOBA 4DOCA 2JH1A 2RDHA 1TJEA 2R8JA 4NY8A 2EKEC 1GB1A 3TTEA 4HCHA 4F4KA 2K8CA 1WWVA 3AEAB 2CN1A 4WJOA 2BCPA 1SZHA 1YOVB 1I42A 3UQ2A 5KT6A 1N6ZA 1KM7A 2HQMA 2FUG1 2FPMA 3U7ZA 3N6JA 2G1EA 1F0MA 3BQ2A 3L08A 4FS1A 3Q8RB 2WOVA 1D5MC 1FIQB 4CDGA 1PUZA 2NO5A 1FECA 4BV6A 4QZDA 2FPLA 2W9CB 4EEYA 4A20A 2FJ6A 3MABA 2GOWA 2BQQA 1JMLA 1RZTA 4KLMA 2WXPA 1WGHA 4OJPA 4KDIC 1YZ7A 3OJUA 1MSWD 1RVKA 4DFKA 1X9MA 2P0IA 2VIXA 2AGOA 1VJKA 2WS3B 1TV9A 3VH4B 3RAQA 3RULA 2GWSA 1M4VA 2W11A 2WXMA 4EC3A 2GQWA 3D2DA 1BWCA 5KG3A 2YTUA 3AU2A 2ZC8A 4UQGA 1WSPA 2DX5B 2N9KA 1KCZA 4OZAA 4B9MA 4K7SA 1NEKB 3V6KA 2KVRA 3DEQA 4TQSA 4PL2A 4FHKA 3DBHI 4I28A 1LV5A 2M19A 3A9KB 3P93A 5HI1A 3WK6A 5AE3A 2EANA 5KFCA 4HDQA 4ZDVA 4F5OA 3W1SA 4UBBA 4LIIA 2EZXA 3AULA 4W9LA 2QKNA 4YN4A 1SB3C 1V1OA 4LNFA 5BMGA 3RN9C 3RB6A 3A1QA 4A3RA 4F4XA 1P98A 4B9NA 7ICFA 3IBEA 3F2CA 4UB5A 1GC6A 2PE6B 2IHMA 3EGRA 1GRFA 1WUFA 1E8GA 1UZXB 1WWTA 3P4QB 3MWCA 4M02A 1XLNA 1XDIA 2I1JA 1FPYA 1R6WA 3WIMA 5DB8A 3H7VA 3UCCA 3MSYA 4YD2A 1EO6A 2BYVE 2UVWA 2I6XA 3TKAA 5J2HA 2KN7A 1HTQA 5EE3A 3BIID 4DWFA 3DOWA 2A19A 4FP1A 2G5HB 3KOOA 1TKYA 3MJ5A 4YQWA 4W9IA 1SL2A 2A1AA 2QJNA 2WTFA 3PY8A 3FW9A 1TAQA 3AUOA 5ADZA 2LHTA 3OJ4B 5AI9A 8ICOA 2R18A 3CP8A 1SKRA 1HJPA 8ICAA 3ZDTA 3F2DA 2NBUA 4WH4A 4AYBC 3ZNZB 2NO4A 4GMEA 2HD5B 2MAXA 3ORYA 3S1EA 5FS8A 2MBRA 5EU9A 1Q0WB 2JPHA 2AHOB 7ICRA 4JWMA 8ICFA 1H8CA 1I4XA 1DXSA 4CQNA 2P8CA 2LGDA 2RSUA 1IGDA 4FJVB 4HCLA 3F2BA 3PW2A 9ICKA 1JROA 3Q69A 2GGEA 3QPEA 1D8LA 4ELUA 3QLDA 3Q45A 4PWBA 4C0ZA 4B9LA 1PQSA 5KG2A 3GFKB 1J2NA 3GDXA 5CHVC 3QFAA 2KC2A 4N59A 4NLNA 1CI4A 5KFDA 3PMLA 3TAPA 4NXZA 2GBKA 3Q14C 3C2MA 1STZA 1VCBA 2FUHB 1ZQGA 4ELTA 4LDTB 4UW9A 4KLTA 2LI6A 4X57B 4KLSA 2JXTA 3A0HU 1KF6B 2XN9C 4GGQA 2L00B 5AUIA 3NVWB 2AKMA 4IT1A 1JXLA 5AKXA 3WK5A 1E7UA 3U8ZA 4I2FA 1NYQA 1NKEA 2BYTA 4JAYA 3BW7A 1EM7A 3RJIA 2Y5CA 5FS9A 3JPPA 3EYZA 2OEHA 4KGRA 3UXKA 3SBFA 1Z1VA 3B0YA 1E0ZA 3SSZA 2WXRA 2LMCA 4XA5A 3JPNA 1W1OA 2I5QA 4J9OA 3ZW3A 2Z7JA 2AL3A 3AE9B 3STPA 4H4UA 3BZCA 2FCQA 5KG4A 1TE2A 1NK5A 1NK6A 2KFKA 4EZ6A 1YQBA 3SR6B 3V05A 1SGGA 5J2BA 1I4PA 2W3SA 4AP4C 3MJWA 3BS5A 3N32A 5CWRA 2B0CA 4ECWA 4K3BA 2HOQA 3I9V1 3R3MA 5KFYA 2BGWA 2G06A 1B43A 5J8YA 5D3DA 2JH7A 4JV0A 2HHVA 7ICPA 4MM3B 2L7RA 4ZHPA 1W1MA 2BT6A 5IIIA 2EQ6A 4TURA 1TZ1A 1YN5A 2M4NA 3NXLA 5KG1A 2IGDA 1WXMA 1CK1A 4Z6EA 1WE7A 2X50A 3TJ4A 5AKZA 2IMWP 4F2RA 5C2TB 3GD4A 1P0RA 5B5EU 2OFJA 4TUSA 4PVKA 2XGPA 3DVNV 3H40A 2ZVNA 5J2KA 3AU5A 1V9PA 4KLLA 2R61A 4OHJA 4XWWA 2OQHA 1TFRA 4O3RA 2ZUCA 4RQ7A 1NJZA 4M0WB 4F7ZA 2AL1A 3W8XA 3RO6A 1SIJA 5KFWA 4PZFA 1XNSA 2JWZA 3VUXA 2WQYB 5IIJA 2Y3AA 4HKZE 1QOBA 2DL0A 1F52A 1MUCA 4K1WA 1EF5A 5KAFU 1WX9A 2MEKA 4FFDA 1A70A 3V61A 3VC5A 4OJOA 2HJ8A 1FFUA 4DQIA 4TQRA 1OTRB 2D10A 2H89B 3Q8CA 4X5VA 3QJZA 3GD3A 4DN1A 1D8BA 3EC8A 5KFVA 9ICCA 1GRHA 2QILA 3PVLA 1DRGA 4G9BA 2N4FA 2GBMA 4E3CA 5KL8B 4O0IA 2WLBA 1M6YA 4DNSA 4OZBA 1UWMA 3K4GA 1NJWA 4F5PA 5JU5A 3IG8A 4BKSA 5ALWA 1TT5B 2WF5A 1E5WA 4J9SA 4RNAA 3NVZB 2PTXA 3TSJA 4DSLA 3FG2P 2PMQA 3WALA 1A5RA 2CS4A 3BOXA 2GDQA 3E0FA 3M7DA 4BBNF 3ZI4A 3RF9A 1UHUA 2AXTU 1S3SG 3W2DA 4EM3A 3KD3A 4JMUA 4QZHA 4GDLB 4HAIA 4L1BA 2KVSA 4I6PA 3VHTC 2GL5A 1KRHA 5AKEA 2EELA 1ZQXA 3TADA 2IO3B 2ZXHA 1A77A 2RPVA 4H4SA 3GIJA 1JIHA 9ICEA 5IP4D 2F1IA 2QB0B 1EBDA 1E7PB 3KHGA 4IM2A 8ICUA 2EQ7A 3I57A 4EWJA 3MDAA 2W0HA 3BQ7A 4RT3A 3KFUF 3PW5A 2ZIWB 1T8EA 2NRTA 2WU2B 1F3PA 2M0AA 1WXSA 4GDKB 1Z4NA 2WXIA 5KFQA 3RUIB 1GRBA 4DOAA 5BOLA 4MF2A 4E71A 3PSEB 3PREA 2JU6X 1F9JA 2BPCA 2HI0A 2K5PA 1BZLA 2QB1A 1K53A 5U1OA 1WGKA 4FA6A 5I4DA 2MRLA 4KLIA 4K8GA 4W9JA 4IQTA 2IY0B 2KIWA 2LPEA 3O0HA 1EC7A 5AK3A 3OHBA 4J9NA 4CF3A 1NJXA 1CRXA 2GQUA 2J42A 4RNOA 2KHWB 4KLEA 4ED1A 1RQLA 4EYIB 2TSSA 4KLJA 5LLIA 4UAYA 2QDEA 1TK0A 4NLGA 2PCEA 2K4IA 2JHDA 4DQSA 3H1UA 3NS8A 4C4RA 2HHWA 2D3CA 1DNCA 3QEBZ 3PR4A 2DZJA 2YMMA 4DBGA 2NQLA 2KE7A 4DQRA 5AKKA 4BXOB 1AYFA 2V9WA 3TEWA 1RYSA 1KFDA 1WZ3A 5KL1B 1B1ZA 4FXCA 3FAHA 5KFZA 3HX0A 4O5EA 1SZPA 4I2DA 3A7UA 3KYDD 4H19A 5C1ZA 3ETLA 3L4PA 3T3OA 1BKHA 4M9HA 4KLQA 3IHQB 3QUTA 4DFPA 1ZQJA 3V62A 2GSHA 1IM4A 5J2GA 4TUPA 1MBBA 4F4RA 1L8OA 1IGCA 5D79A 2OX4A 3HWTA 4MT5A 2YAUA 2UWQA 4RF1A 3TEZA 3ETRA 1V8CA 3G6VA 2LJIA 3ZLFA 2CRXA 1C76A 2PTLA 2W9MA 5ALQA 4YXJA 5J8YC 2MW5A 4YVZA 4DHZE 1GREA 4GC6A 1YN4A 3UMCA 1QQ6A 2XC9A 1LM8B 1HEKA 1IIPA 4DHJD 5EBKA 3SI8A 1MHHE 3PWGA 1R7SA 5G55A 4PZOA 4QZ9A 3Q3OC 3GU3A 3QU9A 4HJKA 9ICWA 4OVVA 2V3BA 4G8TA 2A4ZA 1AROP 2WB1C 1WCNA 4P6VF 2XH4A 4OCZA 2ZVOA 3TSSA 1XQQA 4RQ2A 4RMAA 1KTQA 3CYMA 1UELA 1LKYB 2QEJC 1A6SA 4NJ7A 4ZCWA 1L4DB 2GO7A 1S77D 1ZQIA 1F0XA 2JWUA 3ENEA 2WU5B 2QDDA 3SMVA 2R8GA 5D3IB 1V2YA 4QZIA 2DAJA 3AEBB 3DK9A 1HSKA 3NRZA 5C3JB 2CJOA 4F93B 3PLUA 3LDZE 3ZLHA 1FFUC 2I2YA 4PHDA 5HP4A 2K8HA 3BVGA 1OEPA 3MTNB 1SE9A 2GBJA 3BS7A 1TZZA 2AAQA 3EANA 2ZTDA 5AM5A 1UH6A 1Z00A 2L0FA 3II4A 3RRGA 7ICUA 3FJ4A 2KNBA 1KD0A 4UAZA 4HXDA 4IWQA 3ZNGC 1OJTA 3UGVA 1Y88A 2Q5WD 1U48A 2VA3A 5BMIA 3AL0B 3V5FA 2P88A 1X66A 2JEFA 2HTHA 2R8HA 1XSPA 1C4AA 1VRAB 2K6DB 2Y5BB 4PHAA 3C2LA 2N9EB 4KIKB 3RCYA 1ZQEA 5JCIA 4HROA 5CX3A 4UB8U 3MC9A 3DIPA 2K4PA 1ZJMA 8ICQA 3SQPA 3VCCA 2DKZA 2UVRA 4ICAA 3N4FA 5I1VA 1GERA 8ICMA 4CO7A 2M8SA 1KLVA 2C60A 4C56C 4B6JA 4DOBA 8ICBA 3ZXVA 1FXTB 2Y0SC 1ZXHA 4M8MA 3TWBA 2DYMA 3UGBB 4C8MA 5CRXA 4UDUC 1K1SA 4QZ8A 2ZNVB 1NU5A 2G08A 2VANA 3B08A 5GRTA 2VFVA 2IBKA 2BWFA 2P4PA 3WK8A 1W1SA 3UM9A 2BYEA 3SU8X 7ICKA 5KFTA 5AKIA 5T14A 1N2XA 4N9F4 3DJGX 2R2ZA 4IL0A 1WFYA 2ZIUB 5KFPA 3KHRA 4QNLA 2MQJA 4GFJA 4JWSC 2EAPA 4ED3A 1I7HA 4JB3A 3AXCA 3DEEA 3TAQA 4DDGD 3AQEA 4NAWB 3PRZA 3OW1A 5CP2A 1PK1B 3R0UA 2DWQA 5D2MB 4RQ1A 7ICMA 7ICLA 3R25A 1QQ5A 4JUZA 5FK9C 3ED5A 4PVHA 2XH7A 4HN8A 5EE9A 2G4SA 4G7FA 4IZGA 3R07C 2N9PC 1OEYJ 4XE0A 4DXFA 2PS2A 3DQVA 5TR5A 2MUTA 5KG5A 2HE7A 4NJ6A 4W9DA 1T3QA 1MDRA 1GESA 3M62B 2H5XA 2ASQA 3NHEB 3WAPA 2YX8A 1TS2A 2INDC 4RGMA 2P3ZA 7ICQA 2BCRA 2CU3A 4EX7A 1IBXA 1TIFA 4J6IA 1U49A 2OG9A 3ZXRA 9ICPA 3SAHA 1UWXA 1IUEA 4PYUA 1OXJA 5ALDA 5KFLA 5KFIA 1NHSA 4Q45A 3ZO5B 3TI0A 1ZETA 1Z19A 2KEYA 4KGSA 2BCSA 3FILA 3RZFA 4ANXA 3WKDA 2XO7A 3PSFA 3OSPA 2R2OA 3EUB3 3LJ3A 4EQWA 3EEZA 3VDZA 4HPLB 2K4HA 4WURA 5FXFA 4MEXA 1E8YA 1WVEA 4ANVA 5DDMA 4FZNA 2ZPYA 2XEWA 1MDLA 1VAOA 2J0KA 2KDMA 3GC2A 1RFAA 2IO0B 4NAMA 3D47A 3QN3A 5FJRA 5AI4A 5L6FA 5D94A 3Q8QB 1E8ZA 2IZVB 3NG0A 4GXKA 2XY7A 1RPLA 9ICGA 3V6JA 4DK5A 3ZTDA 5G2NA 1JEHA 1NOMA 2R9ZA 3VH3B 2WDRB 4IW0A 2PMZC 3VUWA 2K89A 4OJ6A 3BDPA 5EWGA 4CCHA 4NLZA 3V72A 1X42A 5L83A 4MGIE 4RUCA 4DCCA 3CGCA 3SEIA 1X40A 4EQXA 1LFDA 4KMOB 1JOAA 2DW6A 2CFYA 4APNA 1ZD4A 3X23A 2BVFA 4UD8A 2IOFA 3SN4A 1EWYC 2NYVA 1VD2A 1S0NA 2PFNA 2ES6A 1WM3A 1SJED 2GMIC 1DIQA 9ICSA 1P7DA 1PDYA 3TEXA 2Q4TA 5J0UA 1PVPA 1OQQA 1SJCA 3P0WA 1BMLC 1IPGA 1WMHB 2EZYA 1E9MA 3PW7A 1QSYA 2NPTB 4Q2JA 2WDVB 2ASDA 3T8QA 5G5GA 4YD1A 4KX5A 4FX9A 1TS4A 4XDCA 9ICOA 3KW5B 1PGXA 1P48A 2L1AA 3PG6A 3F5EA 3D2SA 3C5FA 3DBRB 4LNNA 2RP5A 5L1IA 5IDZA 4EX6A 4IHCA 4XC2A 1JN3A 4Z6FA 2VA8A 2DENB 4TQ1A 2EXRA 1FRRA 4MEMA 4YWOA 3HW8A 4WIPA 4OVUA 1WUEA 1UT8A 4DX3A 1TYGB 4RQ4A 5CHFA 4PVEA 9ICQA 2IBIB 3J9CA 4DSEA 8ICGA 1GUAB 2XK5A 2K60A 1SXDA 4LDTD 3V7KA 3OJ3A 4P0QA 3SQIA 2MA9B 4WQMA 1XF5L 2BQRA 2ASLA 2Q85A 4ZYNA 2GRTA 4L2YA 4XLOA 5KFHA 3Q8BA 3OZYA 3ZYYX 4QIWC 3OHAA 4RPYA 1SBBB 1SEBD 2V3NA 9ICBA 5FR3A 1FD6A 1MG8A 4RGTA 4H83A 2QC8A 2WXNA 4LNOA 3VRBB 2WHEA 1I35A 1Z4OA 1N63A 1S76D 5GTHU 5EWEA 2MA1A 3POPA 4BX9C 2LHDA 5J0WA 3GILA 5AE2A 4IQVA 4M6WB 2ZTEA 2FIDA 1ZQBA 2WXLA 2OAIA 5ALVA 3PGEA 4UARA 3C19A 5IN7A 3M9OB 3R2TA 2NS5A 3VVWB 4H50A 1T94A 1WE6A 3N4EA 3PT2B 5HMRA 4D2KA 3RJAA 1L3TA 2K25A 3DV9A 1KKRA 4C4SA 2CPRA 2FIFA 1K5OA 4IR9A 2XSXA 3T79A 3IFWB 1O03A 2F1JA 1ZGUB 3OG5A 3TUOA 3WU2U 4IP5A 4HG0A 7ENLA 1SB3B 1QILA 2J3NA 3WKAA 4C8LA 4R64A 4HPMB 2M1MA 4C00A 4RNNA 2O6KA 3H4BA 5J2IA 1L8PA 4KLFA 4E4FA 5DBBA 1AW7A 1ZE3D 1S5LU 2BVGA 8ICYA 1QH9A 4EYHB 2CXYA 4Q43A 3M8SA 5D4BA 5JRTA 2R2QA 3ALBA 4DDID 4ARIA 4GGBA 1Q3UA 3SV4A 2E5SA 4DHJB 4C8OA 1CJEA 4DSKA 1WGYA 2JXXA 3LB8C 2QQ6A 4ZA0A 5CJ7A 4NL9A 2WAQC 4MJSB 2EMTA 1OW5A 3TQPA 1QLUA 4H2AA 3UCDA 1K4QA 9ICJA 3R1ZA 3GV5B 3V4BA 2L0TA 5IAAC 3JPRA 1TK5A 3W8WA 2BW2A 4QAYA 2N1WA 1IV8A 5BYQA 3RD2A 1V81A 1N60A 2H3FA 3HIZA 9ICFA 2PVOD 8ICZA 2OVLA 2DKXA 4ECQA 4H4VA 3GSYA 3RBEA 5KFSA 1S10A 2GGJA 2ZW0A 4NQKE 2E8PA 1YX6B 4GRTA 2VRRB 2P13A 4GXJA 1FCCC 3OAWA 3V3XA 2K1FA 1K1QA 1V1PB 4EKUA 4P4OA 4UBCA 2WF8A 2PJHA 1SJBA 1YQZA 5IOIA 2WNMA 4IRDA 2AQ0A 5HNKA 3NY5A 2YY6A 4QZFA 1WI0A 1X6JA 2YB1A 3PZ7A 3DGBA 4AJWA 3I6EA 1UBQA 2ISOA 1E10A 2KLCA 3HVZA 2XY5A 2G4DB 1U45A 3B9JB 3QZ8A 3Q3FA 5ALKA 3H8MA 2ZIXB 2MHJA 1PK3A 5D46A 3P4SB 3DPDA 1ZMCA 2DZKA 1RQNA 4LZDA 2G45B 3GRTA 4UAVA 2KKPA 1WH3A 3T5LA 5AK6A 3NVVA 2KWVB 1KN5A 3PSTA 2J6UA 4GMVA 2O6VB 4QZGA 3JZUA 4QWCA 4ED8A 1SV0A 4KDLB 3ZVHA 2KTFA 5KT3A 2LM1A 3WK4A 2F44A 2K8CB 1RDFA 3HPFA 3DHHC 1BPXA 3A4RA 3HP6A 4E0DA 1T6BX 2KIVA 2LWPA 5HQXA 3KH0A 5BO4B 4YMMA 2LXCA 2YB4A 1MQ3A 8ICKA 1COKA 3QNMA 1O08A 1XO1A 3RR7A 2HHUA 2YMPA 4WWNA 2OM6A 3Q8LA 4P1CC 4HLEA 2CHRA 1L3VA 3NVYB 1BPDA 1L5PA 1YN3A 3ENLA 4IC9A 1JWSD 2BC1A 4PPXA 4J9QA 2INCC 4A6QA 5IIKA 4Y2RA 1WR1A 5KHOA 1E8XA 3H12A 4EMIA 1DZNA 2ISPA 2KSOB 2EAMA 2VJ4A 5AIAA 1XANA 3PX0A 1FIQA 2LEKA 2KVCA 1WXAA 1F9CA 5K8EA 3N1YC 5AZHA 2VKQA 1BNPA 1LQBA 1NI3A 2W9CA 3UJEA 3P2BA 1DXLA 2RDGA 1Q10A 2LVOA 2P8BA 2W9BB 3C0PA 2OQYA 3P42A 4JDRA 4KPRA 1K8RB 4H2HA 1ZQHA 2BDPA 5IINA 1UGJA 1VR9A 4UASA 2RMMA 2KOXA 3U52E 1E8HA 3GIKA 2KMAA 1YMHE 3L17A 2EKIA 4M0AA 5J0XA 4KLUA 3ONNA 4W9HA 1D5ZC 1ZDXA 2JX5A 5J2FA 4LLGM 5GMVA 2ZZ0A 3A1QB 4BCAA 2LXAA 4UB6U 3MHZA 1NDDA 5HMMA 4JE3B 4GIBA 5HMLA 1E8WA 3OTQA 1V85A 5HHDG 3RH4A 3NJTA 2BVCA
chains in the Genus database with same CATH topology
3NVZB 1C79A 1RM6C 3TSJA 1YJJA 5AUKA 3W2DA 1NVID 2BTEA 1T3QC 1TKEA 5EE0A 5FKAC 4GDLB 4YSYB 1ET9A 4L1BA 3CIRB 4KKIA 1KRHA 4REZA 5MPOA 4MLAA 1Y56A 2EELA 2VFUA 3AM9A 1XXGA 2RPVA 3SFDB 1N5XA 1F2RC 2RK5A 1E7PB 3BVZA 4B0MA 5LNK1 3RJ8A 3I57A 1FCLA 4PT5A 2K0PA 1SE2A 1IBXB 1QQRA 2W55A 4ZYSA 2W3RA 1ZDVA 1ZPSA 3R2IA 1BXTA 2WU2B 1VZ6A 2M0AA 1PUTA 4R3DA 3LXFA 4GDKB 2WXIA 1QKZA 1WVFA 1F77A 1SF0A 3MP9A 2JU6X 1XO3A 2K5PA 1K53A 3FILB 1WGKA 3P4RB 5I4DA 2PLIA 5D7GA 3UI3A 4C7ZA 2GI9A 1I19A 1WRIA 2AQ2B 2WDQB 1JALA 5HFYA 2GQUA 1KTKA 3FW8A 4PYTA 2J42A 3BK2A 2HTME 2L83A 5GXGB 1E6EB 2BS3B 2IPIA 2TSSA 2JYEA 1FXIA 1FFVA 3NS1A 1HZ6A 1PDXA 1TKGA 1ESFA 2ZW1A 4RFBA 3AEGB 1AYFA 1E8FA 3O13A 3TEWA 1B1ZA 1KFYB 3Q8AA 4FXCA 4LK0M 3FAHA 1E0YA 2LHEA 3A7UA 3ZJUA 2ACZB 1JWAD 3L4PA 2W82A 4RH6A 4ARCA 3T3OA 1V1PA 2WXOA 2WDWA 4RGNA 1J7AA 1ENFA 1MBBA 1L0XB 4ML8A 1IGCA 1W1KA 5D79A 1QT9A 4MT5A 2LUMA 4RF1A 3S1CA 3TEZA 3ETRA 3T3NA 4JX1C 1F2RI 1V8CA 1HEZE 2LJIA 3BYYB 3HRDD 3ABVB 2MJ3A 1VZ7A 1C76A 2PTLA 4IKGA 3NVWA 1C9FA 4US9A 2MBRA 1EU3A 2BB5A 2MJEA 5T8IA 1TY2A 4MACA 4RF0A 1DOXA 1VLBA 1K51A 1YN4A 5G5GB 2VFRA 1ZXIA 2IPKD 1ZOYB 3D2JA 2IDYA 3RPFC 1MHHE 1I4HA 1QOGA 3GP7A 2GQTA 1HZ5A 2J4XA 1C78A 5HHZA 1R7SA 1LO5D 2GB1A 1KLGD 1L0VB 1ACCA 3ZJVA 4USAA 5AWVA 1J7CA 4N58A 5G5HA 4P6VF 2AQ1B 3S1FA 3TSSA 1DIIA 3AB5A 2QEJC 2LFIA 3W9CB 3ZJTA 2X38A 4C7YA 1L4DB 4US8A 3DWGC 1F0XA 2JWUA 2WU5B 1FNWA 4OW0A 1N63C 2UUVA 1PYWD 1ZUD2 5D3IB 2DLBA 3AEBB 2H88B 1HSKA 3NRZA 5C3JB 3NVYA 2ON8A 2CJOA 3A7RA 4RCOA 1FM0D 1TS3A 2GRIA 2J53A 1PGAA 2I2YA 1FFUC 3BVGA 3AE4B 1RYJA 1L0YB 1AWDA 1KH0A 2P3HA 4PWCA 2HDEA 3P4PB 1JW9D 1QLTA 3OWEB 1K50A 3P63A 4P16A 3W5UB 3TEYA 1T5XD 2QSDA 3R8BA 2QPMA 3Q8EA 4TVWA 2Q5WD 1CQVA 5BMIA 2IJ0A 4YWGG 4J3OD 1C4AA 1VRAB 1FO4A 1K52A 1MVKA 4HROA 2D5GA 3W8ZA 2E5AA 1N61A 3BYTB 1SSNA 2OEDA 4HJGE 4JB1A 2N0SB 1GPXA 4DQOC 5I1VA 1GOZA 2KACA 1PGBA 3P1MA 5L6GA 2JYTA 3BVMA 4C56C 1AHZA 1X2HA 1MI0A 2L52A 4OVZA 1D5XC 1ZXHA 2DYMA 1DOIA 2PW9A 4UDUC 1I4GA 2VFVA 2VFSA 2N9LA 1NENB 2P4PA 3W5VB 3D2HA 2V4IB 3AE8B 1W1SA 3HRDC 2JSVX 4A8XC 1TS5A 4HRSA 1W1JA 2R2ZA 3NVZA 4TSSA 2INNE 3MC0B 2NMQA 2KN4A 5TSSA 1GB4A 3AE7B 4JWSC 1I7HA 1JCKB 4TQ0A 1N60C 2YEPB 1W1LA 1J7BA 1PFDA 4NAWB 2OHFA 3HVDA 3LAEA 2Z8LA 2DWQA 3DQ0A 3PZ8A 5HG2A 3BWUD 1JWUD 1TY0A 1UXYA 5FK9C 4PVHA 3AEDB 4YTMB 5EE9A 4BC7A 3R07C 4XE0A 2WXQA 4DXFA 1QF6A 1T3QA 4IDIA 2WP9B 2G9HD 1ROEA 3DWMA 4NZLB 1STEA 1TS2A 3N9YC 4NJCA 4RGMA 2Y3RA 2CU3A 3AE6B 3RFZB 1IBXA 4XWTA 1MBTA 1WXQA 1UWXA 2K9XA 3Q8FA 2E3TA 2NTTA 1IUEA 3HSUA 4O95A 1N5WC 4XDDA 3IXSA 1CZPA 4KGSA 3LYYA 3FILA 1B9RA 3EUB3 2ICIA 2ONQA 1C77A 3HUIA 1JWBD 4TVYA 3TSHA 1E8HA 4WURA 5FXFA 1WVEA 1VAOA 4A55A 4WAFA 1DOYA 2VZKD 2PLSA 1FRDA 2KDMA 3U2SC 2WXHA 3KLSX 1XEEA 3VRAB 4NAMA 2V0GA 1XLPA 1QLBB 4JPSA 4A90A 3NVVB 5L6FA 3AECB 1P7FA 1ZP0B 3I99A 4PVJA 2QIEB 3URYA 3MFGA 3PQBA 2L32A 1ZXIC 1KLUD 1UNSA 2WDRB 1W1QA 3B9JA 3ZGZA 2QMTA 2WXKA 1HXYD 2M56B 2NQWA 1EWCA 2DYOA 1V97A 2FBWB 1SJHD 1YQ4B 2WXFA 1ZR6A 3ZQ4A 3VTEA 1P7EA 2PIAA 3AEFB 2O3GA 1ET6A 1TZOA 1YQ3B 2K3UA 4EE2A 2BVFA 4UD8A 2RDHA 2PMVA 4B0EA 2JQRB 1HQRD 1EWYC 1D6EC 1TJEA 3C8YA 1GB1A 1SJED 1DIQA 3AEAB 2YEPF 3TEXA 1OQQA 1BMLC 4IOIE 4ZHOA 2FUG1 3U7ZA 2BS2B 1MPEA 5FXEA 1E9MA 2G1EA 4Q2JA 3SR6A 2WDVB 1WYGA 5G5GA 1D5MC 1FIQB 2SAKA 1TS4A 4XDCA 1X2GA 4ITKA 1PGXA 3AN1A 2L1AA 2NTSA 5EE1A 3NRZB 1JMLA 2WXPA 5H92C 4TQ1A 2EXRA 1FRRA 1AN8A 1XCQL 3U4EG 3KJMA 4WIPA 1L6VA 1TYGB 1VJKA 1DYQA 1DGJA 2WS3B 4HEA1 1EU4A 2Y3SA 5E6JA 3PM9A 3J9CA 4PVEA 3S1DA 4HKQA 1FEHA 1M4VA 2V3PA 3AV8A 4LTUA 3GB1A 1N61C 2AQ3B 1JRPA 1XF5L 2J52A 2WXMA 4WQMA 2Q85A 4EC3A 2Y5PA 4L2YA 4XLOA 2BBCA 3Q8BA 3D2DA 3ZYYX 1SEBD 2V3NA 5FR3A 1SBBB 2PKOA 3VR9B 1N62A 1F0ZA 4M0WA 4WWMA 4RGTA 1FD6A 1WSPA 3B2FA 2N9KA 2WXNA 3NZ3A 4OZAA 3VRBB 4A9AA 3A7AA 1QOAA 1AHVA 1N63A 1NEKB 4YTNB 5JXVA 4BBYA 3POPA 1XLOA 2LHDA 2QJLA 2M19A 3KQ4A 2AX5A 5HI1A 5AE2A 2WXLA 2OAIA 5AE3A 4ZRPA 3R2TA 3VQIA 3W1SA 2QKNA 1UUPA 1SB3C 1V1OA 5BMHA 5BMGA 2VZKB 4D2KA 5HMRA 3RJAA 2MJDA 2Y08A 1E8GA 3EGRA 4AQ7A 4AS1A 1WWTA 3P4QB 1SXTA 2IGGA 3TUOA 4HG0A 1XLNA 3IT6B 1SB3B 1QILA 3VR8B 3BIID 1AW7A 1ZE3D 2I38A 5EE3A 2BVGA 4BC9A 1RM6B 1TKYA 3MJ5A 4ARIA 4KKJA 3FW9A 1HA5A 2VAOA 5ADZA 3EUB2 1CJEA 1FFVC 2Y4GA 4ZOHC 2KAJA 3LB8C 2KQ4X 4WH4A 4YSXB 3KWLA 5HHDG 1QLUA 2AXRA 2CJNA 4H2AA 2B76B 2PLPA 2VFTA 2Q4WA 3B2GA 3S1EA 1VQZA 1OQRA 3FW7A 3NS1B 2XNAC 3W8WA 4ZOHB 2BW2A 5BYQA 2E6XA 1I4XA 1N60A 4CQNA 3GSYA 2PVOD 2SEBD 5AE1A 1FMAD 1IGDA 4ZRQA 1GAQB 4N6EB 5I1WA 1C4CA 2ZW0A 2YVSA 3Q69A 1JROA 4OALA 2INPE 4L23A 4PWBA 1YNTE 2R8DA 4KGTA 2P13A 2WXGA 1FCCC 3V3XA 1V1PB 3AE2B 4N59A 2WNMA 1L6UA 1OFFA 3PZ7A 1AHUA 3KWVA 4KX6B 3PO0A 3DEDA 3ETRB 1E10A 3EA6A 2JXTA 3HVZA 2JZPA 1YJIA 1KF6B 2XN9C 5AUIA 3B9JB 3NVWB 1FNVA 4DXGA 4YSZB 3P4SB 1N5WA 2KWDA 1W1RA 1QOFA 4YXDB 3AMZA 1NYQA 4C80A 1I4RA 1FXAA 2BYTA 4JAYA 3NVVA 3BW7A 4YTPB 1EM7A 2Y5CA 3LLBA 1RFKA 4KGRA 1RWSA 5BYSA 1E0ZA 1XCTL 2WXRA 2N7JA 2LMCA 1W1OA 2UUUA 5G5HB 3AE9B 1D4BA 3FWAA 2K22A 2FE8A 1SE3A 1T6BX 1FNUA 4MH8A 1JQ4A 3V05A 3SR6B 1I4QA 5HQXA 1I4PA 3BZDB 3JS8A 2W3SA 1BUIC 4O1NA 2WXJA 3I9V1 3TX1A 3NVYB 3SFEB 3NUHB 1L5PA 3AE5B 5D3DA 5BYRA 4ZHPA 1YN3A 4MM3B 1W1MA 1JWSD 2BT6A 1VZ8A 2MH7A 2BVHA 1YN5A 2PVGC 3IT4B 2IGDA 3GS2A 4JWUC 1CK1A 4A6QA 3E9SA 2LGIA 1N62C 3H8HA 4YT0B 2BS4B 5FXPA 5C2TB 2BB6A 1DZNA 4PVKA 1FIQA 2LEKA 5K8EA 1NYRA 2R61A 4OHJA 4XWWA 1NI3A 4GLSC 2RDGA 1Q10A 3W8XA 1XLQA 1C4PA 3BK1A 5H8YE 1SIJA 3AH7A 3C0PA 3E56A 4PZFA 3P42A 1SE4A 1VDVA 1MHXA 2WQYB 2Y3AA 4HKZE 1QOBA 1JWMD 3AE1B 2MEKA 1A70A 1UGJA 1VR9A 2KMMA 2RMMA 3CWIA 3U52E 2DBYA 3Q8CA 1FFUA 4RGOS 3FC4A 2H89B 3AE3B 2I0KA 1YMHE 2EKIA 2W54A 4OZCA 3WCQA 1D5ZC 1ZDXA 2JX5A 4LLGM 2QILA 3IAM1 4TMAB 5FXDA 3IAS1 1L4ZB 2WLBA 4DNSA 4BCAA 4OZBA 1UWMA 3MHZA 4JE3B 2IGHA 3AEEB 3SEBA 4RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVZ B;  1RM6 C;  1YJJ A;  5AUK A;  1T3Q C;  1NVI D;  1TKE A;  5EE0 A;  4YSY B;  3CIR B;  1KRH A;  5MPO A;  4MLA A;  2VFU A;  3AM9 A;  3SFD B;  1N5X A;  2RK5 A;  1E7P B;  2W55 A;  2W3R A;  2WU2 B;  1PUT A;  3LXF A;  1WVF A;  1SF0 A;  1XO3 A;  2K5P A;  1WGK A;  3P4R B;  2PLI A;  4C7Z A;  1I19 A;  1WRI A;  2WDQ B;  1JAL A;  2GQU A;  4PYT A;  2HTM E;  2L83 A;  5GXG B;  1E6E B;  2BS3 B;  1FXI A;  1FFV A;  3NS1 A;  1PDX A;  1TKG A;  3AEG B;  1AYF A;  1E8F A;  1KFY B;  4FXC A;  1E0Y A;  3FAH A;  3A7U A;  2ACZ B;  1JWA D;  3L4P A;  1J7A A;  1MBB A;  4ML8 A;  1W1K A;  1QT9 A;  3S1C A;  3ETR A;  4JX1 C;  1V8C A;  3HRD D;  3ABV B;  2MJ3 A;  3NVW A;  4US9 A;  2MBR A;  2MJE A;  1DOX A;  1VLB A;  2VFR A;  5G5G B;  1ZXI A;  1ZOY B;  3RPF C;  1QOG A;  2GQT A;  5HHZ A;  1R7S A;  1L0V B;  4USA A;  1J7C A;  4N58 A;  5G5H A;  4P6V F;  3S1F A;  1DII A;  3AB5 A;  3W9C B;  4C7Y A;  4US8 A;  3DWG C;  1F0X A;  2WU5 B;  1N63 C;  1ZUD 2;  3AEB B;  2H88 B;  1HSK A;  3NRZ A;  5C3J B;  3NVY A;  2CJO A;  3A7R A;  1FM0 D;  1FFU C;  3AE4 B;  1RYJ A;  1AWD A;  2P3H A;  3P4P B;  1JW9 D;  1QLT A;  3P63 A;  3W5U B;  2QPM A;  4TVW A;  2Q5W D;  1FO4 A;  4HRO A;  3W8Z A;  2E5A A;  1N61 A;  4JB1 A;  2N0S B;  1GPX A;  3P1M A;  1AHZ A;  1X2H A;  2L52 A;  1DOI A;  2VFV A;  2VFS A;  1NEN B;  2P4P A;  3W5V B;  3AE8 B;  1W1S A;  3HRD C;  4HRS A;  1W1J A;  2R2Z A;  3NVZ A;  3AE7 B;  4JWS C;  1I7H A;  1N60 C;  1W1L A;  1J7B A;  1PFD A;  2OHF A;  3LAE A;  2DWQ A;  3DQ0 A;  1UXY A;  3AED B;  4YTM B;  5EE9 A;  4BC7 A;  3R07 C;  1QF6 A;  1T3Q A;  4IDI A;  2WP9 B;  1ROE A;  3DWM A;  2CU3 A;  3AE6 B;  1MBT A;  1WXQ A;  2K9X A;  2E3T A;  1IUE A;  4O95 A;  1N5W C;  1CZP A;  1B9R A;  4TVY A;  3EUB 3;  3HUI A;  1JWB D;  5FXF A;  1WVE A;  1VAO A;  1DOY A;  2PLS A;  1FRD A;  3VRA B;  1XLP A;  1QLB B;  3NVV B;  3AEC B;  1ZP0 B;  3I99 A;  2QIE B;  1ZXI C;  2WDR B;  1W1Q A;  3B9J A;  2M56 B;  2NQW A;  1V97 A;  2FBW B;  1YQ4 B;  1ZR6 A;  2PIA A;  3AEF B;  2O3G A;  1YQ3 B;  2BVF A;  2JQR B;  1EWY C;  1TJE A;  1DIQ A;  3AEA B;  1OQQ A;  4ZHO A;  2BS2 B;  5FXE A;  1E9M A;  2G1E A;  3SR6 A;  2WDV B;  1WYG A;  5G5G A;  1FIQ B;  1X2G A;  4ITK A;  3AN1 A;  5EE1 A;  3NRZ B;  5H92 C;  2EXR A;  1FRR A;  3KJM A;  1L6V A;  1TYG B;  1VJK A;  2WS3 B;  1DGJ A;  3PM9 A;  3S1D A;  3AV8 A;  4LTU A;  1N61 C;  1JRP A;  4WQM A;  2Q85 A;  4XLO A;  3ZYY X;  2PKO A;  3VR9 B;  1N62 A;  1F0Z A;  4WWM A;  3B2F A;  4A9A A;  3VRB B;  3A7A A;  1QOA A;  1AHV A;  1N63 A;  1NEK B;  4YTN B;  4BBY A;  1XLO A;  2QJL A;  2M19 A;  2AX5 A;  5AE2 A;  2OAI A;  5AE3 A;  2QKN A;  1SB3 C;  5HMR A;  2MJD A;  1E8G A;  1WWT A;  3P4Q B;  4HG0 A;  1XLN A;  1SB3 B;  3VR8 B;  3BII D;  5EE3 A;  2BVG A;  4BC9 A;  1RM6 B;  1TKY A;  2VAO A;  5ADZ A;  3EUB 2;  1CJE A;  1FFV C;  4ZOH C;  2KAJ A;  3LB8 C;  4YSX B;  3KWL A;  1QLU A;  2AXR A;  2CJN A;  2B76 B;  2VFT A;  2Q4W A;  3B2G A;  3S1E A;  1VQZ A;  1OQR A;  3NS1 B;  3W8W A;  4ZOH B;  1N60 A;  2PVO D;  5AE1 A;  1FMA D;  1GAQ B;  4N6E B;  2YVS A;  1JRO A;  4OAL A;  2R8D A;  2P13 A;  3AE2 B;  4N59 A;  1L6U A;  1OFF A;  1AHU A;  4KX6 B;  3PO0 A;  3DED A;  3ETR B;  1E10 A;  3HVZ A;  1YJI A;  1KF6 B;  5AUI A;  3B9J B;  3NVW B;  4YSZ B;  3P4S B;  1N5W A;  1W1R A;  1QOF A;  4YXD B;  3AMZ A;  1NYQ A;  4C80 A;  4JAY A;  1FXA A;  3NVV A;  3BW7 A;  4YTP B;  2Y5C A;  3LLB A;  1RFK A;  1RWS A;  1E0Z A;  1W1O A;  5G5H B;  3AE9 B;  2K22 A;  1JQ4 A;  3SR6 B;  5HQX A;  3JS8 A;  2W3S A;  3TX1 A;  3NVY B;  3SFE B;  1L5P A;  3AE5 B;  4ZHP A;  1W1M A;  2BT6 A;  2MH7 A;  2BVH A;  2PVG C;  4JWU C;  1N62 C;  4YT0 B;  2BS4 B;  5FXP A;  5C2T B;  1DZN A;  1FIQ A;  2LEK A;  1NYR A;  1NI3 A;  3W8X A;  1XLQ A;  5H8Y E;  1SIJ A;  3AH7 A;  3C0P A;  1VDV A;  2WQY B;  1QOB A;  3AE1 B;  1A70 A;  2KMM A;  1E8H A;  3CWI A;  2DBY A;  2I0K A;  1FFU A;  3FC4 A;  2H89 B;  3AE3 B;  2EKI A;  2W54 A;  3WCQ A;  2JX5 A;  5FXD A;  2WLB A;  4BCA A;  1UWM A;  3AEE B; 
#chains in the Genus database with same CATH topology
 1C79 A;  3ZNI D;  2WDT B;  3SV3 A;  4AP9 A;  4CF4 A;  4QZA A;  9ICA A;  3A9K A;  2I1Q A;  4DFD A;  5BOF A;  1YJJ A;  3O65 B;  4EZK A;  4LA1 A;  1KRP A;  3LWL A;  1XSN A;  2V3S A;  1ZD3 A;  4C8K A;  5EE0 A;  3TAN A;  2BKF A;  1S0O A;  5J0Y A;  4Y2Q A;  5KT5 A;  4REZ A;  3PR5 B;  5MPO A;  4E8G A;  4MLA A;  4PGQ A;  2XGQ A;  2BCU A;  2YML A;  1F2R C;  2P6U A;  3QU5 A;  2ZG6 A;  2FI1 A;  2JK6 A;  3IG5 A;  2MP2 A;  2AL2 A;  2W8L A;  4IQW A;  5J2A A;  5ALO A;  1OUQ A;  2YVC A;  2EQ8 A;  3RNB C;  1UQV A;  4QWA A;  4EZJ A;  3LDA A;  3H6N A;  3MZN A;  3CXO A;  2W55 A;  4RT2 A;  2W3R A;  1ZDV A;  2OPJ A;  4PHP A;  1BXT A;  4R3D A;  4RZR A;  3LXF A;  4IL2 A;  2JZ3 B;  1WVF A;  1Q1R A;  2PGW A;  2DQN B;  2Y9U A;  4PS3 A;  4DHZ B;  3VXW A;  3QQ8 B;  4B9V A;  1UA0 A;  2PLI A;  3MR5 A;  4EBC A;  1WJ6 A;  3UMG A;  5D7G A;  3GV7 B;  4C7Z A;  5HHH A;  3N1X C;  3RH5 A;  1H6V A;  2FKP A;  3R11 A;  3T9P A;  1WRI A;  2AQ2 B;  2LUE A;  2WDQ B;  5DPW A;  1ZD2 P;  4QW8 A;  2WGS A;  4U6P A;  3IP4 B;  3H8J A;  3BK2 A;  3VTV A;  2KYW A;  2HTM E;  2L83 A;  1NDA A;  2GR1 A;  1HTO A;  1E6E B;  5CEH A;  1AAR A;  2JYE A;  1FXI A;  1F5S A;  2KZR A;  1FFV A;  3CT2 A;  2HW3 A;  1HZ6 A;  5KFK A;  1UGM A;  1ZOL A;  5ALT A;  2KJ5 A;  3WKC A;  3O0F A;  4RFB A;  3DFH A;  8ICR A;  4Q44 A;  2NV3 A;  1PVQ A;  2DZM A;  8ICL A;  3P3B A;  1E0Y A;  2HHX A;  2RD0 A;  3OC4 A;  1COO A;  2BR0 A;  3ZJU A;  2ACZ B;  3NGD A;  3QCA A;  3UXO A;  1JWA D;  2W82 A;  4RH6 A;  3FKY A;  1E7V A;  4J9P A;  4RGN A;  4Y2T A;  2HDO A;  1J7A A;  1ENF A;  1GRT A;  2PP0 A;  3RGT A;  1L0X B;  3V7J A;  5KFG A;  3H9D A;  1W1K A;  3A0B U;  3Q8K A;  4ML8 A;  4KLH A;  4EBD A;  2LUM A;  2HMX A;  2NRV A;  4M9J A;  4NM2 A;  1KW4 A;  5AEK B;  2V4Q A;  1HEZ E;  2DHZ A;  4AJY B;  4IS7 A;  2V3A A;  2EMS A;  3NVW A;  3IDW A;  3R10 A;  1J2M A;  4LJX A;  2G09 A;  7ICV A;  4DFM A;  2BQ3 A;  5ALL A;  1EU3 A;  2KFK B;  1SGH A;  3GOE A;  3CB3 A;  4RF0 A;  3PO4 A;  2VFR A;  1ZXI A;  2IPK D;  1ZOY B;  4MSM B;  3H8S A;  3RPF C;  2JY6 A;  3T5H A;  1I4H A;  3HJE A;  2GQT A;  5HHZ A;  1HZ5 A;  2J4X A;  4DXK A;  5IIM A;  5KG7 A;  4O3N A;  1LO5 D;  2GB1 A;  1L0V B;  3MKC A;  5AWV A;  1J7C A;  2LVP A;  3NZG A;  2DGZ A;  2FLN A;  5DPT A;  2HVI A;  4DFJ A;  5KT7 A;  2KNJ A;  2LFI A;  3W9C B;  3GV8 B;  1TKD A;  3ZJT A;  2JT4 B;  2X38 A;  4US8 A;  3DWG C;  1NK8 A;  1NHQ A;  9ICV A;  1FNW A;  2ZUB A;  2GR3 A;  2UUV A;  1IXR A;  1NPX A;  2PI4 A;  1KJT A;  2DLB A;  2LGX A;  1ZQZ A;  2H88 B;  2N7D A;  4C4V A;  1DTN A;  1MJD A;  1JPD X;  2ON8 A;  3UIO B;  1S7M A;  3A7R A;  3PMN A;  1FM0 D;  2J53 A;  4FI4 A;  2KTR A;  5DPS A;  4DXA B;  1F8W A;  1RYJ A;  1X9S A;  3M1Y A;  3M8R A;  4B9S A;  3W1S C;  4DQP A;  2WX0 A;  3D32 A;  3L54 A;  1JUD A;  2JEI A;  3D2Q A;  5AKG A;  5AKY A;  1KH0 A;  2JV3 A;  3MGV A;  3ALR A;  3ISB A;  4EUT A;  4PWC A;  1QLT A;  5JHB A;  3WAO A;  4ECU A;  3W5U B;  1NZP A;  5JCL A;  5L95 C;  3TEY A;  1T5X D;  2QSD A;  4ROP A;  4EQR A;  2ZCB A;  1DGS A;  2D3A A;  4CRX A;  3Q8E A;  3PWI A;  5C5J A;  1CQV A;  2KFZ A;  3NO1 A;  2WYQ A;  3PW0 A;  4CGZ A;  1T0R C;  1U4A A;  2F8L A;  4YWG G;  9ICL A;  4PL1 A;  5HR7 A;  1GSN A;  1ISN A;  4EOY A;  2C3D A;  1K52 A;  3H7P B;  3T4W A;  3UPQ A;  2YVF A;  3BYT B;  3VUY A;  1FHU A;  2AWT A;  1SSN A;  3MY9 A;  3OTR A;  2ZZB A;  3QAR A;  2N0S B;  2YN4 A;  1GPX A;  2P35 A;  2VH1 A;  4KLD A;  2L8J A;  2PP1 A;  4ZRI A;  1SL0 A;  2G5I B;  2JYT A;  2LRU A;  2GR0 A;  1R4N I;  4GYP A;  3N7S C;  2ZIV B;  3KZI U;  4UB1 A;  1P3Q U;  1AHZ A;  3R7R A;  2JMG A;  4OVZ A;  2C2E A;  2PPH A;  3RJE A;  4B9T A;  1NK7 A;  1DOI A;  2G0A A;  3PFR A;  2UYZ B;  2AQ4 A;  1UA1 A;  5BPC A;  4UAW A;  1WJN A;  3QHT A;  4PK1 A;  1NEN B;  2VFS A;  3W5V B;  4I2B A;  1PDZ A;  2FDR A;  3PRM B;  3HRD C;  7ICJ A;  4M01 A;  4YP3 A;  2DYB A;  3MC8 A;  4GSW A;  1W1J A;  2NVK X;  3TJI A;  3NVZ A;  2KJH B;  1ZMD A;  3MC0 B;  2NMQ A;  3I63 C;  4A3P A;  2W03 A;  1GB4 A;  4TQ0 A;  4JHM A;  5AK4 A;  4YL8 A;  2YEP B;  1W1L A;  1J7B A;  1PFD A;  1ZQK A;  4AUQ C;  3ES7 A;  4H4X A;  5KFF A;  3KUD B;  1A0P A;  2BWE S;  2ZJ8 A;  3NAS A;  2FMS A;  4Z17 A;  2PFO A;  3KLJ A;  5J2E A;  1TE6 A;  4GDL A;  3F53 A;  1YT3 A;  3BWU D;  1Q1W A;  2D8C A;  1X1M A;  3QX1 A;  1BPE A;  1W6T A;  4ECV A;  4Y2U A;  4QW9 A;  4YTM B;  1QF6 A;  4F71 A;  1C20 A;  4NV0 A;  2CR5 A;  2O2V B;  2QB0 A;  1ZQY A;  2DPI A;  2FCM A;  3DHI C;  1KOT A;  1P43 A;  3OSN A;  3CGD A;  3JW7 A;  4O3P A;  2G9H D;  3ZTC A;  2KD0 A;  5DCN A;  3T5K A;  3N9Y C;  1FEA A;  3L5O A;  1ZQ1 C;  3H0L B;  3RB0 A;  2REX A;  3AE6 B;  2Y3R A;  3JPS A;  1T3N A;  4M47 A;  2AGP A;  1T4G A;  3SZ2 A;  3DDM A;  3OJS A;  1XC9 A;  4M00 A;  3T8M A;  3Q8F A;  4E4U A;  4GDK A;  2NTT A;  3WA0 A;  1WGD A;  3E58 A;  4PS7 A;  1B9R A;  2BGF A;  3TSH A;  4F8C B;  2DAF A;  1SKW A;  3VCN A;  5ER0 A;  2G07 A;  4A55 A;  3CXB A;  1ECW A;  5TR3 A;  3QTP A;  2QJM A;  2MU2 A;  2HOF A;  3U2S C;  4YR2 A;  2M17 A;  2WXH A;  2V0G A;  3HKZ F;  4YFK A;  3SN1 A;  2QHO A;  3AEC B;  1X9X A;  2QLT A;  2XCP A;  4FUL A;  4TKN A;  2WF7 A;  3MFG A;  4ICV A;  4RQN A;  3RJJ A;  1HIW A;  5DGB A;  4FBT A;  2L32 A;  1ZXI C;  1UNS A;  3E2E A;  3RT3 B;  3WAM A;  3QX7 A;  1BPB A;  4FN2 A;  3ZRF A;  3IHP C;  2POD A;  3ZLG A;  5KNI A;  2VA2 A;  4BXO A;  3ZGZ A;  4J56 A;  4O3S A;  1HXY D;  1GEU A;  2R8I A;  2JRI B;  2M56 B;  4EMJ A;  2C3C A;  2NQW A;  2PFQ A;  1QZE A;  3RJG A;  2DYO A;  2DZI A;  2FBW B;  3MR2 A;  3H4D A;  1ZR6 A;  3ZQ4 A;  1XHC A;  3VTE A;  4DQQ A;  5ALR A;  3UIN B;  3M63 B;  5DB9 A;  1ET6 A;  1TZO A;  4EE2 A;  1MA7 A;  3IN5 A;  1UT5 A;  5ALS A;  3VCB A;  4ECZ A;  1SKS A;  3GIM A;  4F8R A;  4G3I A;  3BJS A;  2JQR B;  3N6H A;  4KEM A;  1HQR D;  1D6E C;  3C8Y A;  1JXE A;  1NKC A;  4HCD A;  4RNM A;  2B3A A;  4H4P A;  1ZDL A;  1UBI A;  3ZDB A;  3CST A;  5D6J B;  4PJ0 U;  4WJ3 B;  4DS5 A;  1MOK A;  2BS2 B;  4NM1 A;  5KFJ A;  4KN7 A;  2D3D A;  3QUC A;  1PVR A;  1KFS A;  1WYG A;  4Q8F A;  1XU4 A;  2W9N A;  5J2R A;  1GRG A;  2SAK A;  3PK7 A;  3UJR A;  1TTN A;  2H3V A;  3AN1 A;  2GOL A;  2IOH A;  5EE1 A;  2NTS A;  3CMM B;  3NRZ B;  3SYZ A;  3NZS A;  3TQ1 A;  2DFL A;  3BQ1 A;  1TBE A;  5H92 C;  1SXE A;  2FPK A;  3L3F X;  3UXP A;  4M2Y A;  1XCQ L;  1AN8 A;  4PYZ A;  5BOE A;  2MLB A;  3KJM A;  2Y3S A;  3UMB A;  1QCK A;  4JK1 A;  3WK9 A;  4HEA 1;  4Y2S A;  5E6J A;  2LYA A;  1LKY A;  4UB2 A;  2KVZ A;  2V3P A;  3EPG A;  4IUM B;  4LTU A;  4DL3 A;  3IV6 A;  3ML8 A;  2NRX A;  2Y5P A;  5E79 U;  5J0P A;  4CNQ A;  2AU0 A;  2BBC A;  3H70 A;  4BJQ A;  2JZZ A;  1TYP A;  2PKO A;  4BOS C;  1F0Z A;  2B6G A;  4GYP C;  5KFN A;  3NZ3 A;  4ZH4 A;  4JV2 A;  1QOA A;  3U9I A;  1RRB A;  5AI6 A;  5DQI A;  3RJF A;  2BF8 B;  2XGZ A;  2O6V D;  5CR0 A;  5J0Q A;  3TAD C;  1XLO A;  2N1V A;  2QJL A;  3RCZ A;  3KQ4 A;  2AX5 A;  4I2C A;  3NOB A;  2A1J A;  4IG7 B;  4IRK A;  4W9K A;  1L3S A;  2KDB A;  3CSF A;  1ZK7 A;  3RNM A;  2IOF K;  3SAG A;  1C7Y A;  4RQM A;  2KZM A;  3N30 A;  2K8B A;  3UQA A;  4EZ9 A;  1JPM A;  1D7Y A;  1KBU A;  2M0N A;  4UB3 A;  2RR9 A;  2VZK B;  2LAS A;  4BKT A;  2MJD A;  4AQ7 A;  1RLF A;  4WJQ A;  1EC8 A;  2IGG A;  3DBR I;  3C29 A;  3C1Z A;  1SWW A;  3IT6 B;  4QWE A;  5KTQ A;  3RNG C;  1J8C A;  1KKX A;  2HOI A;  2C2R A;  3I5J C;  1R4M B;  2LM4 A;  3VR8 B;  5FMH A;  3ZDD A;  2LGY A;  2Z0E B;  4ACF A;  4EQS A;  2WF6 A;  2RRD A;  2KHV A;  4BC9 A;  1RM6 B;  5CTR C;  2YVJ A;  2AEH A;  2KKV A;  2KJ9 A;  5U25 A;  1HA5 A;  1WRD B;  5K4L A;  3EUB 2;  1N48 A;  2OZ3 A;  1HUZ A;  3QK0 A;  5C23 A;  2Y4G A;  4ZOH C;  2KAJ A;  3DGH A;  1V9J A;  3ZLZ A;  5AIB A;  3DVG Y;  2KQ4 X;  1D9F A;  1NNL A;  4YSX B;  2LBO A;  3EEC A;  3KWL A;  2JF5 A;  2CJN A;  3M9N B;  2PLP A;  2WPF A;  1PK1 A;  4Z6D A;  3NRW A;  1OQR A;  3FW7 A;  2V1Y A;  3NS1 B;  2XNA C;  5L9X A;  1B0X A;  2OYY A;  4KIT B;  5AM2 A;  2RDJ A;  2MX2 A;  3BSM A;  2MCN B;  4RM9 A;  2E6X A;  2JZB B;  5ALM A;  3GY1 A;  3H7I A;  5J17 A;  2SEB D;  5AE1 A;  9ICN A;  5KFM A;  2W04 A;  2OWO A;  1FMA D;  1TGZ B;  1B4F A;  5I1W A;  1C4C A;  4M52 A;  4OAL A;  2Z59 B;  1T0Y A;  4ECY A;  3QFB A;  3DK8 A;  3V3W A;  4KGT A;  2WXG A;  1YEY A;  4I2G A;  1JX4 A;  2QKQ A;  1JDF A;  1TAU A;  3EPI A;  2NRZ A;  4GGH A;  1L6U A;  4EMW A;  1X9W A;  3DES A;  2EQY A;  3KWV A;  1SJD A;  1WGG A;  1WY8 A;  3HM3 A;  3RMK C;  2MUC A;  3DED A;  2W43 A;  5J0O A;  3G6X A;  2PGE A;  2Y1J A;  3EA6 A;  3TCS A;  3CNH A;  3URH A;  4Y2Y A;  8ICH A;  3Q8P B;  3SD5 A;  4NLB A;  1FNV A;  3APC A;  4O5C A;  4BBN C;  4PZN A;  3H0R B;  4DXG A;  1LXD A;  3DBL B;  2CKH B;  3M3J A;  4O3O A;  1N5W A;  5AI0 A;  3TFS A;  1W1R A;  2DW7 A;  4YXD B;  3AMZ A;  2ZJA A;  2F77 X;  1I4R A;  1TAM A;  4P0P A;  2C9W B;  3TBL D;  4YTP B;  3LLB A;  4KPL A;  1RFK A;  2FNJ B;  1RWS A;  4KVG B;  2NCN A;  2H3I A;  1MRA A;  3S47 A;  4H1Z A;  1FHV A;  2ASJ A;  4A35 A;  1S0V A;  5G5H B;  4CF5 A;  5J2C A;  3QWZ B;  1ZQD A;  1D4B A;  5EDS A;  3H0M B;  1E90 A;  4HPP A;  1SE3 A;  3U7D A;  2BPF A;  1FNU A;  3AU4 A;  3V5C A;  1JQ4 A;  4EEL A;  5CHG A;  1I4Q A;  2D07 B;  3BZD B;  3QA8 A;  3IG3 A;  2KXJ A;  3KHL A;  3TJP A;  3DG7 A;  1BUI C;  1U4B A;  3K1Z A;  2WXJ A;  2OCE A;  4URK A;  3TFR A;  1XO0 A;  2D3G A;  3TX1 A;  3SFE B;  3NUH B;  4I6L B;  2B21 A;  5KFX A;  5AKJ A;  2FMQ A;  5KFE A;  4II3 B;  1VZ8 A;  4KN4 A;  4HNL A;  5J29 A;  2PVG C;  1JRU A;  3GS2 A;  1CEZ A;  3E9S A;  2D6F C;  4YT0 B;  1MQ2 A;  2BS4 B;  5FXP A;  2XK5 B;  4IQU A;  3U26 A;  3MBY A;  2NPT A;  4P0Q B;  3KYC D;  3GII A;  4IWO A;  4IWP A;  4LJO B;  4ED2 A;  4XX5 A;  4ASW C;  5IKC M;  4AYB F;  4KZ0 A;  4ZRK A;  3U30 A;  2X99 A;  1ELS A;  3DDH A;  1XLQ A;  3BK1 A;  2JVC A;  5ALZ A;  2WOW A;  3H8A A;  2HBK A;  1V80 A;  2LYB A;  1MHX A;  4YCX A;  3SDL C;  5FP0 A;  3LAE A;  1JWM D;  2QGY A;  3AE1 B;  4W9G A;  1NK9 A;  2PU1 A;  3JVA A;  4AWJ A;  2KJ6 A;  2KMM A;  2GBR A;  3A9J B;  3PHW B;  4RGO S;  3I3T B;  2I0K A;  3MFH A;  4K3C A;  2W54 A;  4OZC A;  2NVU I;  3WCQ A;  1XT9 B;  3M95 A;  1AOG A;  3IAM 1;  4TMA B;  1BT0 A;  1EC9 A;  1IG6 A;  3IAS 1;  3ZNH B;  5FXD A;  1A76 A;  5B66 U;  5KAI U;  3BJY A;  3IC9 A;  3AEE B;  2E1E A;  3KTQ A;  3SEB A;  4J1O A;  5L1M A;  4NLC A;  1F44 A;  4FS2 A;  1RM6 C;  3RNF C;  1N56 A;  2D3B A;  2LI5 A;  2A3V A;  4JL9 A;  4UAT A;  3GE3 C;  1LGR A;  2QAR B;  5AUK A;  1WIA A;  4FJY A;  2ZZC A;  1ZQL A;  3PV8 A;  1T3Q C;  2H3Z A;  2HNE A;  5L1J A;  4R66 A;  4YSY B;  1ET9 A;  1ZQQ A;  4BWJ A;  3CIR B;  3T3F A;  4ECR A;  1Y56 A;  2KQ7 A;  1IP9 A;  1FEB A;  5DQG A;  3AM9 A;  5DQH A;  4IP4 A;  1ZRM A;  1N5X A;  2RK5 A;  2GGI A;  3Q6B A;  3BVZ A;  4B0M A;  4MFF A;  3N4M B;  3PZP A;  1L7P A;  4R8U B;  1KEJ A;  1RAX A;  1FCL A;  2PP3 A;  2K0P A;  1SE2 A;  4H4Y A;  1J19 A;  4RU9 A;  1QQR A;  2X8G A;  3THU A;  4P4M A;  1ZPS A;  3DK4 A;  3K9P B;  3R2I A;  1ZX9 A;  2Z0D B;  1PUT A;  5J18 A;  2V9H A;  4C4T A;  4WAA A;  3ZIM A;  3VFK A;  1SF0 A;  3MP9 A;  4FLH A;  3VTW A;  1XO3 A;  1WM2 A;  3FVD A;  1T7P A;  3MDC A;  2G3Q B;  4KLG A;  4P1B C;  3UI3 A;  1I19 A;  5DBC A;  4XYC A;  2QCZ A;  3L16 A;  9ICI A;  1JAL A;  5HFY A;  5KVH A;  1QSL A;  4RQ8 A;  5DLG A;  1Q3V A;  3OLM D;  4BAX A;  1GO3 F;  3FW8 A;  1D8Y A;  1L6N A;  1Z5S B;  4RQ6 A;  2MSE D;  1XWL A;  1ZRN A;  3UXL A;  3B0X A;  4BKS D;  2BS3 B;  5ALI A;  3CW2 C;  3ZD9 A;  1NEL A;  2GGG A;  1GC7 A;  2PA6 A;  3WKB A;  2RPQ A;  1PDX A;  4I2A A;  4J9L A;  1TKG A;  5AZG A;  2J0J A;  2JEG A;  2FCS A;  2ZW1 A;  4KSL C;  3AEG B;  3H7S A;  4G3X B;  4KWS A;  3MR3 A;  3RB4 A;  3O13 A;  1GRA A;  2YQU A;  1E8F A;  3JSV A;  3DBS A;  1KFY B;  4YMO A;  3GE8 C;  2LHE A;  5FS6 A;  2W8K A;  3BQ0 A;  2P66 A;  5FS7 A;  3LVV A;  2FLP A;  4ARC A;  2OXO A;  3GZF A;  4PH5 A;  1V1P A;  5AM0 A;  8ICS A;  3OGU A;  2WXO A;  3V6H A;  1YZ6 A;  4WJN A;  4KX3 A;  3DGZ A;  2I9G A;  2HXU A;  3Q3J A;  1QT9 A;  1ZQU A;  2KFJ A;  3T3N A;  1SL1 A;  3BYY B;  3QXG A;  3KUC B;  5LXH A;  1VJ5 A;  2MJ3 A;  3HIL A;  1ZQO A;  2IY1 B;  4GN1 A;  3K75 D;  3OPX A;  5AI5 A;  1NK0 A;  1TY2 A;  1DOX A;  3L5K A;  2HHQ A;  4TUQ A;  5TIS U;  1E9I A;  2ZUD A;  4PGY A;  3D2J A;  5JUM A;  4NNJ B;  1S8O A;  3JPO A;  2MNR A;  3Q8M A;  1QOG A;  3GP7 A;  9ICU A;  2ZPN A;  4YR0 A;  2O6V A;  4IR1 A;  4ECX A;  5AM1 A;  4R63 A;  4H4R A;  3DHG C;  3ZJV A;  1ACC A;  4RQ3 A;  4LNK A;  3EZ5 A;  4N58 A;  1Q46 A;  2AQ1 B;  4GOC A;  5KHQ A;  3S1F A;  1DII A;  5ALN A;  5JZE B;  1SIF A;  2IO2 B;  3AB5 A;  2BC0 A;  3SQS A;  4YWS A;  2F1H A;  3MFI A;  1C1Y B;  4ECT A;  5JTI A;  3APF A;  3RIT A;  4DL4 A;  3I4K A;  3TAC B;  1V49 A;  1N63 C;  4OW0 A;  1MN8 A;  3QC8 B;  5EOZ A;  1PYW D;  3SN0 A;  3EWA A;  1GXF A;  1WX7 A;  4JLC A;  3NVY A;  1Z2M A;  4JIO U;  5FJT A;  3SD7 A;  4U7C A;  2GRI A;  1PGA A;  1V38 A;  3AE4 B;  1L0Y B;  2ZJD A;  3PVX A;  5F3X B;  1AWD A;  2J7Q B;  1EBH A;  2GH5 A;  3K1G A;  3EHV A;  2IA6 A;  2HDE A;  4I2J A;  3P4P B;  3KUZ A;  1ZQM A;  3D2N A;  4K4H A;  1HE8 A;  3P63 A;  5AKH A;  1P1A A;  2OJW A;  2KSO A;  4EM4 A;  2GR2 A;  4I29 A;  3R8B A;  3C23 A;  4E74 A;  3DG6 A;  5ALG A;  4HYK A;  1ZQF A;  3AQF A;  2IJ0 A;  1JCT A;  5KFB A;  4OO1 J;  2ZTC A;  4NQL B;  4FO6 A;  3ES8 A;  5J0S A;  3DG3 A;  2W9B A;  1U47 A;  3G6Y A;  1WX8 A;  1MC8 A;  2D5G A;  4GU2 A;  1N61 A;  4J03 A;  3QU2 A;  3KHH A;  4E6M A;  5J2D A;  1TK8 A;  4F5N A;  8ICV A;  5HR6 A;  1TYT A;  1PGB A;  3DJJ A;  5L6G A;  3IJI A;  4KTQ A;  1L5U A;  2OZT A;  1QQ7 A;  1ED1 A;  2KJ8 A;  1X2H A;  4NL9 C;  3VTU A;  2KX3 A;  1D5X C;  4FJZ A;  4EFO A;  2PW9 A;  5AKL A;  3MC1 A;  3UXN A;  3JPT A;  3QKE A;  3TMP B;  3RI7 C;  2N9L A;  3RJH A;  3D2H A;  3C5G A;  2V4I B;  8ICI A;  3AE8 B;  2KMD A;  1XS9 D;  2GBN A;  2W7O A;  3RZW C;  4A8X C;  8ICT A;  2MP2 B;  4RQ5 A;  1TS5 A;  2AL2 B;  3ISC A;  2C7M B;  1ONE A;  1WCL A;  2E1F A;  3TAR A;  3AE7 B;  4KT2 A;  1XSL A;  1N60 C;  2KD1 A;  2RGF A;  1Q1O A;  2OHF A;  4DS4 A;  4DL5 A;  5HHI A;  4ACO A;  4DO9 A;  2KZ3 A;  5IIL A;  2C22 A;  8ICE A;  2UU7 A;  4W9C A;  5CHW A;  3X0W A;  2KK0 A;  1DOQ A;  3DQ0 A;  2J6S A;  3VAW A;  7ICE A;  4BWM A;  5HKH A;  3AED B;  4BC7 A;  3GZN B;  4KSK C;  2HZG A;  1ZQN A;  2K6Q A;  4GLX A;  4PS8 A;  4FBJ B;  1BQG A;  1H2I A;  3OPS A;  2WP9 B;  3C21 A;  1ROE A;  5KT2 A;  2VJ5 A;  1STE A;  5J0R A;  3DWM A;  4NJC A;  2WB1 F;  1RXW A;  4Q8E A;  1NHR A;  3RFZ B;  3FXG A;  2XH2 A;  3M6Z A;  1J0G A;  2NRW A;  4WQO B;  4MFC A;  3JVZ X;  3VA8 A;  3ZD8 A;  1NK4 A;  1WXQ A;  2K9X A;  2OOB B;  1MBT A;  4IM0 A;  2RQ5 A;  3HSU A;  3HW2 A;  4O95 A;  2L05 A;  5AI8 A;  3LVW A;  3IXS A;  1ZY8 A;  4G0N B;  3LYY A;  2ICI A;  1C77 A;  3VC8 A;  4GC7 A;  4XQ8 A;  3HUI A;  1D9D A;  1GG3 A;  2DUY A;  2MBE A;  4QZB A;  5GTI U;  1L7N A;  1SV0 C;  2WHI A;  4JN8 A;  5KG6 A;  3RBD A;  3RAX A;  4WAF A;  2VZK D;  1DOY A;  2PLS A;  1ZKH A;  1KL9 A;  2PI5 A;  1IYX A;  3CGB A;  4DF8 A;  1L8L A;  1M94 A;  1XEE A;  3KLS X;  2W9A A;  3VRA B;  4K4G A;  1LVL A;  1WXV A;  1QLB B;  1XLP A;  4JPS A;  3BY4 B;  3HPO A;  3ML9 A;  4F91 B;  4A90 A;  3RYT A;  2WBA A;  3IJQ A;  4IM3 A;  4G11 A;  3I99 A;  4PVJ A;  2QIE B;  3N97 B;  4FZL A;  2WFA A;  3SAF A;  1ZQP A;  4KLO A;  3Q3M C;  1YJ1 A;  5F9L A;  2FYM A;  3PQB A;  1V5T A;  2KO3 A;  3I28 A;  3EFU A;  3V7L A;  2W7P A;  1W1Q A;  4I2H A;  4DEZ A;  3GRS A;  4M9L A;  3A33 B;  2QMT A;  4ICU A;  4QZC A;  1GV4 A;  5ENL A;  2WXK A;  2I5H A;  4KZC A;  1UD7 A;  2KG5 A;  1T0S C;  5ALY A;  1EWC A;  1SJH D;  1YQ4 B;  2PIA A;  3BS5 B;  5AM3 A;  3CF6 E;  3HT3 A;  3SHQ A;  3N1Z C;  2M9N A;  4LZG A;  5C0Y A;  1G6J A;  1EF1 A;  2PMV A;  3DBH B;  4B0E A;  1PZN A;  2KDE B;  4GB9 A;  2Y0S F;  3PO5 A;  2ZZP B;  2YEP F;  2JGA A;  2RDB C;  3MQT A;  4IOI E;  4ZHO A;  2IHN A;  1MPE A;  1QTM A;  5FXE A;  3SR6 A;  4RM8 A;  1ZJN A;  1KKO A;  2ZXI A;  1X2G A;  4ITK A;  1XPY A;  4K4I A;  3S5S A;  2LD9 A;  4C4V B;  3NFU A;  1EXN A;  4JQ9 A;  5KVI A;  4ADW A;  2JRH A;  4MM3 A;  2YMQ A;  2KTR B;  4AOF A;  2WOI A;  1OGW A;  3FYH A;  3U4E G;  4HPN A;  2L76 A;  1D3Z A;  1L6V A;  2H3Q A;  3PM9 A;  1DYQ A;  1DGJ A;  1EU4 A;  2R8K A;  3S1D A;  3S2A A;  3IRU A;  4HKQ A;  1FEH A;  2Q0Z X;  4WJP A;  3AV8 A;  4K81 A;  1J97 A;  3RRA A;  3JYU A;  3GB1 A;  2KTQ A;  2LRW A;  1N61 C;  2AQ3 B;  1ZQW A;  1JRP A;  2EDU A;  3AEV A;  2J52 A;  2CHW A;  4XZ4 A;  4DL6 A;  2L3Z A;  3B1L X;  1M6I A;  4GFI A;  1CUK A;  2XIC A;  1KN0 A;  3PHX B;  3PRP B;  2PE9 A;  3VR9 B;  4JV1 A;  1N62 A;  4M0W A;  4WWM A;  5AIC A;  1ZW7 A;  7ICT A;  4GIS A;  1LB2 B;  3B2F A;  4A9A A;  2KKC A;  2WPE A;  2N1R A;  3A7A A;  1AHV A;  4R65 A;  3KUM A;  1MFW A;  4YTN B;  2LGS A;  5E6N A;  4DSI A;  1NJY A;  5JXV A;  4JN7 A;  4BBY A;  3RNC C;  7ICS A;  1YIW A;  4H4W A;  1U9L A;  5JCM A;  3ISD A;  3RB3 A;  4BFR A;  4FDC B;  2XBB C;  4ZRP A;  2F3N A;  2QJJ A;  3DH9 A;  3VQI A;  2OKT A;  1UF0 A;  2KWC A;  1RXV A;  3IM1 A;  3H4K A;  1UUP A;  5FJU A;  5BMH A;  4M9G A;  3QU7 A;  1QLN A;  3H7P A;  4H4Z A;  2E8M A;  3FDS A;  4RPZ A;  2Y08 A;  5J2J A;  3N28 A;  3PSP A;  3QAQ A;  2XID A;  4AS1 A;  4KMU A;  1SXT A;  5EWF A;  1V6E A;  4F4W A;  7ICI A;  5IA7 A;  2PMZ F;  2CHX A;  7ICN A;  1ONF A;  2PXI A;  3RRH A;  7ICO A;  1FEZ A;  2DNF A;  7ICH A;  2ZIV A;  2V4L A;  2I38 A;  3R0K A;  5ALX A;  5KFU A;  2RAB A;  2HCF A;  1L7M A;  1OQY A;  1ZQS A;  4KKJ A;  4EEN A;  4JGH B;  1T0Q C;  2E8N A;  3NTU A;  5DGA A;  4J9R A;  4HDO A;  4FAD A;  2KFN A;  2VAO A;  3QUB A;  2FCN A;  1FFV C;  4K2S A;  4K1R B;  4ANW A;  5JCN A;  4MGY E;  3V60 A;  1BPZ A;  4NEW A;  2ZIW A;  2AXR A;  2B76 B;  2VFT A;  3MGH A;  2Q4W A;  3B2G A;  3D9X A;  3R66 C;  1VQZ A;  2LKY A;  2KIC A;  4QJF B;  4GXI A;  2OLA A;  4BZA A;  3RNA C;  4ZOH B;  4DL2 A;  3R7Q A;  3APD A;  5KT4 A;  1ZQC A;  2M0X A;  4J57 A;  2E8O A;  2MWS B;  2O2V A;  4ZRQ A;  1GAQ B;  4N6E B;  3KVF B;  3I6T A;  2BPG A;  2YVS A;  4CE6 A;  3TW9 A;  2INP E;  3LWM A;  9ICX A;  4L23 A;  3HM6 X;  2FAZ A;  4A3O A;  1YNT E;  4EEW A;  8ICX A;  3PX4 A;  3T5J A;  2R8D A;  8ICJ A;  9ICH A;  3RTV A;  3WKE A;  3AE2 B;  1OFF A;  2ATL A;  3LAD A;  1AHU A;  3PNC A;  3KBB A;  2TPR A;  5J04 A;  4KX6 B;  2PFP A;  3PO0 A;  1R4M I;  4NEV A;  2GLS A;  5JH5 C;  4EZL A;  5A0L A;  4HCN B;  2VH2 A;  1NHP A;  2WP6 A;  1GNU A;  3ETR B;  1NBF C;  4QIW F;  3L8K A;  2JZP A;  4H4T A;  1YJI A;  4ANU A;  1B22 A;  1JMS A;  4YSZ B;  1ZKQ A;  9ICR A;  2KWU B;  3C2K A;  2KK8 A;  2A5U A;  3PPA A;  2KWD A;  2ONE A;  2KN5 A;  1UPH A;  4FE3 A;  1QOF A;  5DG8 A;  4QWD A;  1BNO A;  4C80 A;  3B97 A;  3AU6 A;  1FXA A;  1MG4 A;  2BQU A;  4P7I A;  4F72 A;  2JXJ A;  1RYR A;  5BYS A;  5ALH A;  1XCT L;  3PS6 A;  1DK2 A;  2N7J A;  3GO2 A;  2RDI A;  4JWN A;  4K7W A;  4B6W A;  2UUU A;  3KKA A;  4A6G A;  3F5A A;  5DB6 A;  2XH0 A;  2MSN A;  4DWI A;  3FWA A;  2K22 A;  2FE8 A;  3Q6J A;  2FE9 A;  2Y1I A;  4F5R A;  4GIR A;  3H8W A;  4MH8 A;  1RYU A;  2FLL A;  3LK9 A;  4I6N B;  2AKZ A;  3QEA Z;  1WGR A;  3JS8 A;  1XD3 B;  2F8K A;  4XUS A;  3RNE C;  1EBG A;  1P9D U;  1SWV A;  2KDF B;  2PTW A;  4O1N A;  4ENL A;  3I76 A;  3GQC A;  2X8X X;  2RDX A;  5J0T A;  3AE5 B;  5BYR A;  2PEA A;  2OZ8 A;  3UJ2 A;  2MRP A;  4FHJ A;  2AGQ A;  1WYW B;  5ALF A;  1R0M A;  2MH7 A;  2BVH A;  4QWB A;  1R4N B;  3IT4 B;  4JWU C;  5JCK A;  4BVU C;  1Z00 B;  5KFR A;  2LGI A;  1N62 C;  5L1L A;  3H8H A;  4FBU A;  2NBW B;  4A8E A;  2BB6 A;  2PU0 A;  2KLG A;  1V5O A;  4TV3 A;  2MBH A;  1S1Q B;  3PTF C;  1WF9 A;  2WAQ F;  1NYR A;  1ZQT A;  4S17 A;  4BUR A;  2D2Q A;  1ZQV A;  3DBL I;  2AYO B;  1DK3 A;  4IL6 U;  2YVG A;  4GLS C;  5D49 A;  2BZF A;  1C4P A;  3QE9 Y;  1KFT A;  2KMC A;  3AH7 A;  5H8Y E;  3E56 A;  2C2D A;  4DNA A;  4IC7 B;  2NR2 A;  1SE4 A;  4I27 A;  1VDV A;  4DL7 A;  3TOY A;  2RHF A;  4O5K A;  1XS2 A;  4E5T A;  1L3U A;  3CRX A;  2JUO A;  1ZD5 A;  2A1J B;  4IRC A;  3CWI A;  2DBY A;  3U4F A;  3FC4 A;  4XRH A;  3AE3 B;  3J81 j;  3UQ0 A;  1WG8 A;  3CYJ A;  3BIN A;  4F2S A;  3QIJ A;  4MGK E;  3ICX A;  2DPJ A;  2KV2 A;  1IYF A;  2K8B B;  1WJ4 A;  2X8C A;  2EAO A;  3DVG X;  1L4Z B;  4KIK A;  1ECQ A;  3NUQ A;  4II2 B;  1LPF A;  3QUQ A;  2IGH A;  4UB4 A;  4HYR A;  3AI5 A;  3PLV A;  2KT7 A;  3WAN A;  3IK4 A;  2UVU A;  4K8D A;  5DB7 A;  2LVQ A;  4MGZ E;  2PTZ A;  4RQ0 A;  1NVI D;  2BYF A;  4YXM A;  4NLK A;  2BTE A;  1ZQA A;  1TKE A;  2MBO A;  2YLM A;  3L10 B;  5FKA C;  1YX5 B;  3NZU A;  5KFA A;  8ICC A;  3ZDC A;  4KKI A;  2F5Z A;  4W9F A;  2VFU A;  2HSZ A;  4ED7 A;  5JRB A;  1XXG A;  4OJL A;  1H4R A;  2BPS A;  2ALZ A;  1WWU A;  3SFD B;  4I2E A;  3KZX A;  1BPY A;  2XI9 A;  2MUT B;  5AZF A;  5L1K A;  3N7R C;  5LNK 1;  3RJ8 A;  2XVT A;  2ZIU A;  3PSI A;  2J6T A;  4EBE A;  4PT5 A;  2POZ A;  1Y8R C;  1IBX B;  3EKG A;  3ZVV A;  4NAW A;  4ZYS A;  3EFC A;  9ICT A;  2CDU A;  1VZ6 A;  4TUU A;  5FJO A;  2K39 A;  2D11 A;  3M6K A;  5F9N A;  1QKZ A;  3QZ7 A;  2KDI A;  2PTY A;  3VC6 A;  1F77 A;  4J9M A;  4MMW A;  4MDK E;  2KZZ A;  3FIL B;  3P4R B;  2PPG A;  4F1S A;  2WF9 A;  2N9X A;  4HVB A;  3SJN A;  4BGD A;  2GI9 A;  2OO6 A;  4ELV A;  5AM4 A;  4M04 A;  1KTK A;  4OD0 A;  4PYT A;  5DPR A;  1KDH A;  4S0R A;  5GXG B;  3I1Y A;  5KG0 A;  2JRZ A;  2L5Y A;  4F3O A;  2ZEQ A;  4NJ8 A;  2IPI A;  4F4Y A;  4QZE A;  4J3Z A;  2I1K A;  3Q3N C;  3NS1 A;  4K7U A;  2EQ9 A;  2K8A A;  4F50 A;  3DDC B;  2XY6 A;  3LB8 A;  1ESF A;  3ZDE A;  5ALE A;  2J0M A;  2JZB A;  2ZJ5 A;  4BKG A;  4RPX A;  3N20 C;  5ALJ A;  3N3K B;  2A8X A;  3DER A;  4RUA A;  4ECS A;  3Q8A A;  2N7E A;  3ZVI A;  4LK0 M;  4Y2P A;  4F4Z A;  5TZV A;  4LVS A;  4M8N A;  1V59 A;  3KKA C;  2HJ1 A;  5IO9 A;  2WDW A;  3MGI A;  4P0P B;  4NY0 A;  4DF4 A;  3FCP A;  3L0W B;  4HNC A;  5ALP A;  3ZKJ C;  2P6R A;  5H2F U;  3Q8S B;  1GET A;  2HBJ A;  2V6O A;  3S1C A;  3V6C B;  4Y2X A;  3PX6 A;  2O56 A;  4JX1 C;  1F2R I;  4HK2 A;  2WPC A;  3EW9 A;  3HRD D;  4F92 B;  8ICN A;  1VZ7 A;  1JI7 A;  3ABV B;  4IKG A;  4YG2 A;  3JPQ A;  4US9 A;  1C9F A;  1WJU A;  3RH6 A;  3C0R B;  1CMX B;  3T9L A;  4DHG A;  2PSN A;  3MR6 A;  2BB5 A;  2HBM A;  4DLG A;  2MJE A;  4MAC A;  5T8I A;  4JQW C;  4CHK A;  1VLB A;  2JR5 A;  4Y2J A;  1S0M A;  1K51 A;  2BKR B;  5G5G B;  3RR1 A;  3LYS A;  1S9F A;  1OEY A;  2IDY A;  5JHA A;  4B9U A;  8ICW A;  1SJA A;  1L7O A;  1C78 A;  3CAW A;  4HCP B;  3FYY A;  3UJF A;  1MO9 A;  4HWI B;  4MFA A;  2GLE A;  4GXB A;  1KSP A;  2CHZ A;  1KLG D;  4ED0 A;  3B0A A;  4USA A;  3FM9 A;  2QVH A;  4EEK A;  5G5H A;  4P4P A;  3C28 A;  5DKW A;  4GIV A;  4LJP B;  3TWA A;  4DYE A;  4DSJ A;  4MH0 E;  1UCV A;  3D6J A;  2HHS A;  1WMH A;  1Z3E B;  4C7Y A;  3UQB A;  3UJS A;  3K1R B;  5ALU A;  1ZUD 2;  2C7H A;  3S6J A;  1URJ A;  2LYH A;  1ZQR A;  4W9E A;  2AH5 A;  3V6E B;  2WP5 A;  2V4R A;  2BHN A;  2OH2 A;  4RCO A;  1TS3 A;  5AHX A;  2GGH A;  1S97 A;  1V86 A;  3EF6 A;  3C1Y A;  5CA7 A;  2KQS A;  2LZ6 A;  4WWO A;  4YMN A;  3UF8 A;  2P3H A;  1F1H A;  3QU4 A;  3RJK A;  1JW9 D;  3HKZ C;  2KAN A;  4CYE A;  3DFY A;  4H4Q A;  3OWE B;  1K50 A;  1KLN A;  4P16 A;  3VDG A;  5DG7 A;  2FMP A;  4FZM A;  2QPM A;  3TCA A;  4B9K A;  1C3T A;  3OP2 A;  4TVW A;  2WX1 A;  2UVV A;  4BOZ B;  2JEJ A;  4C8N A;  4J9K A;  2IYD B;  2OJR A;  4KV2 A;  4XGA B;  4MHV A;  4J3O D;  1X6I A;  4K7Z A;  1FO4 A;  4F5Q A;  1MVK A;  3BQT A;  2C5L C;  5LXI B;  3ZDA A;  4Y2V A;  5E6P A;  3W8Z A;  2E5A A;  1WR6 E;  3GD6 A;  5FJP A;  1YD8 U;  3RR8 A;  2OED A;  4HJG E;  4JB1 A;  2ZNV C;  4M0X A;  1LVH A;  1NKB A;  2HVH A;  1RG6 A;  1KQQ A;  1GOZ A;  4DQO C;  2NPX A;  3MUC A;  4MGG A;  2KAC A;  4M6W A;  4MEY A;  4YR3 A;  4M9N A;  3P1M A;  3A9J A;  3BVM A;  1AQ6 A;  4BDP A;  1MNS A;  1BVS A;  1MI0 A;  3BZK A;  2KC1 A;  1H38 A;  2L52 A;  3OZM A;  2KP7 A;  2WWZ A;  3CK5 A;  3L13 A;  1I4G A;  2K4E A;  9ICM A;  3THV A;  2MBB B;  2ZCC A;  2IO1 B;  2AJQ A;  2JSV X;  3D46 A;  3RFA A;  4HRS A;  4MSQ B;  4BUG A;  1NI2 A;  4TSS A;  2INN E;  2KN4 A;  5TSS A;  4X2P A;  1JCK B;  2QAR A;  2XCA A;  3IVF A;  4LCD E;  3W1Y A;  2LMR A;  4PGX A;  3DCG A;  4GR1 A;  3HVD A;  2Z8L A;  3PV1 A;  4G50 A;  3PZ8 A;  5HG2 A;  3EAO A;  2HBL A;  3ECI A;  2EH9 A;  3QYP A;  1JWU D;  1TY0 A;  4OJ5 A;  3HHM A;  4B95 A;  1UXY A;  2PKE A;  5DLF A;  3A4S C;  3N7P D;  5IIO A;  2CU1 A;  4ED6 A;  5BOM A;  5DG9 A;  2WXQ A;  2X8H A;  2QDF A;  5FR6 A;  2BCV A;  3PZD A;  4IDI A;  3TIX A;  4NZL B;  2F76 X;  4NPN A;  4R8U A;  3PW4 A;  3HK0 A;  4MJS A;  1GJZ A;  1TKK A;  2QAE A;  2LJ5 A;  3LXD A;  2HXT A;  2BDU A;  3M9M B;  4XWT A;  3Q2A C;  4Z6C A;  2MBQ A;  4UAU A;  1WUD A;  5AK5 A;  4O3M A;  2BKE A;  3ONS A;  2E3T A;  6ENL A;  1QSS A;  1N5W C;  2KX0 A;  2KJR A;  4XDD A;  3T6C A;  1WZ0 A;  7ICG A;  2YQE A;  2RLT A;  1ZYQ A;  1CZP A;  2AL6 A;  3MHS D;  8ICP A;  2C7N B;  4WWP A;  2ONQ A;  4MKS A;  4TVY A;  1JWB D;  4MEL A;  2EZZ A;  1HUO A;  1TVA A;  1NZB A;  4O9M A;  2NBV B;  4PHE A;  1L7Y A;  4DLE A;  3JSV B;  1SV4 A;  2ESE A;  4M6U A;  2GH1 A;  4MF8 A;  1FRD A;  4NWI A;  4ZRJ A;  5CB1 A;  2DF4 B;  3NVV B;  1P7F A;  3UIP B;  4Z1Y A;  1ZP0 B;  3K9O B;  3WK7 A;  3URY A;  3IJL A;  3Q4D A;  1Q5W B;  3ZVH B;  5DDY A;  3SEN A;  5KFO A;  2Y9T A;  1KLU D;  3FV9 A;  3ZUN A;  3TL5 A;  5E6O A;  2ZAD A;  3ZRC A;  2F2A B;  2KHQ A;  3B9J A;  3DVN U;  4LNI A;  3JW0 X;  5DBA A;  4I2I A;  2C28 A;  1EUV B;  2ZIX A;  4P2H A;  4DSF A;  1Q8K A;  1V97 A;  1Z1B A;  2WXF A;  3GZN I;  2BCQ A;  1L2N A;  1P7E A;  3VFC A;  4O3Q A;  3AEF B;  2HHT A;  4DWD A;  1YQ3 B;  2K3U A;  3ZDM C;  2ODG A;  3R9K A;  1BGX T;  3CGE A;  2O3G A;  1X2I A;  2KOB A;  4DOC A;  2JH1 A;  2RDH A;  1TJE A;  2R8J A;  4NY8 A;  2EKE C;  1GB1 A;  3TTE A;  4HCH A;  4F4K A;  2K8C A;  1WWV A;  3AEA B;  2CN1 A;  4WJO A;  2BCP A;  1SZH A;  1YOV B;  1I42 A;  3UQ2 A;  5KT6 A;  1N6Z A;  1KM7 A;  2HQM A;  2FUG 1;  2FPM A;  3U7Z A;  3N6J A;  2G1E A;  1F0M A;  3BQ2 A;  3L08 A;  4FS1 A;  3Q8R B;  2WOV A;  1D5M C;  1FIQ B;  4CDG A;  1PUZ A;  2NO5 A;  1FEC A;  4BV6 A;  4QZD A;  2FPL A;  2W9C B;  4EEY A;  4A20 A;  2FJ6 A;  3MAB A;  2GOW A;  2BQQ A;  1JML A;  1RZT A;  4KLM A;  2WXP A;  1WGH A;  4OJP A;  4KDI C;  1YZ7 A;  3OJU A;  1MSW D;  1RVK A;  4DFK A;  1X9M A;  2P0I A;  2VIX A;  2AGO A;  1VJK A;  2WS3 B;  1TV9 A;  3VH4 B;  3RAQ A;  3RUL A;  2GWS A;  1M4V A;  2W11 A;  2WXM A;  4EC3 A;  2GQW A;  3D2D A;  1BWC A;  5KG3 A;  2YTU A;  3AU2 A;  2ZC8 A;  4UQG A;  1WSP A;  2DX5 B;  2N9K A;  1KCZ A;  4OZA A;  4B9M A;  4K7S A;  1NEK B;  3V6K A;  2KVR A;  3DEQ A;  4TQS A;  4PL2 A;  4FHK A;  3DBH I;  4I28 A;  1LV5 A;  2M19 A;  3A9K B;  3P93 A;  5HI1 A;  3WK6 A;  5AE3 A;  2EAN A;  5KFC A;  4HDQ A;  4ZDV A;  4F5O A;  3W1S A;  4UBB A;  4LII A;  2EZX A;  3AUL A;  4W9L A;  2QKN A;  4YN4 A;  1SB3 C;  1V1O A;  4LNF A;  5BMG A;  3RN9 C;  3RB6 A;  3A1Q A;  4A3R A;  4F4X A;  1P98 A;  4B9N A;  7ICF A;  3IBE A;  3F2C A;  4UB5 A;  1GC6 A;  2PE6 B;  2IHM A;  3EGR A;  1GRF A;  1WUF A;  1E8G A;  1UZX B;  1WWT A;  3P4Q B;  3MWC A;  4M02 A;  1XLN A;  1XDI A;  2I1J A;  1FPY A;  1R6W A;  3WIM A;  5DB8 A;  3H7V A;  3UCC A;  3MSY A;  4YD2 A;  1EO6 A;  2BYV E;  2UVW A;  2I6X A;  3TKA A;  5J2H A;  2KN7 A;  1HTQ A;  5EE3 A;  3BII D;  4DWF A;  3DOW A;  2A19 A;  4FP1 A;  2G5H B;  3KOO A;  1TKY A;  3MJ5 A;  4YQW A;  4W9I A;  1SL2 A;  2A1A A;  2QJN A;  2WTF A;  3PY8 A;  3FW9 A;  1TAQ A;  3AUO A;  5ADZ A;  2LHT A;  3OJ4 B;  5AI9 A;  8ICO A;  2R18 A;  3CP8 A;  1SKR A;  1HJP A;  8ICA A;  3ZDT A;  3F2D A;  2NBU A;  4WH4 A;  4AYB C;  3ZNZ B;  2NO4 A;  4GME A;  2HD5 B;  2MAX A;  3ORY A;  3S1E A;  5FS8 A;  2MBR A;  5EU9 A;  1Q0W B;  2JPH A;  2AHO B;  7ICR A;  4JWM A;  8ICF A;  1H8C A;  1I4X A;  1DXS A;  4CQN A;  2P8C A;  2LGD A;  2RSU A;  1IGD A;  4FJV B;  4HCL A;  3F2B A;  3PW2 A;  9ICK A;  1JRO A;  3Q69 A;  2GGE A;  3QPE A;  1D8L A;  4ELU A;  3QLD A;  3Q45 A;  4PWB A;  4C0Z A;  4B9L A;  1PQS A;  5KG2 A;  3GFK B;  1J2N A;  3GDX A;  5CHV C;  3QFA A;  2KC2 A;  4N59 A;  4NLN A;  1CI4 A;  5KFD A;  3PML A;  3TAP A;  4NXZ A;  2GBK A;  3Q14 C;  3C2M A;  1STZ A;  1VCB A;  2FUH B;  1ZQG A;  4ELT A;  4LDT B;  4UW9 A;  4KLT A;  2LI6 A;  4X57 B;  4KLS A;  2JXT A;  3A0H U;  1KF6 B;  2XN9 C;  4GGQ A;  2L00 B;  5AUI A;  3NVW B;  2AKM A;  4IT1 A;  1JXL A;  5AKX A;  3WK5 A;  1E7U A;  3U8Z A;  4I2F A;  1NYQ A;  1NKE A;  2BYT A;  4JAY A;  3BW7 A;  1EM7 A;  3RJI A;  2Y5C A;  5FS9 A;  3JPP A;  3EYZ A;  2OEH A;  4KGR A;  3UXK A;  3SBF A;  1Z1V A;  3B0Y A;  1E0Z A;  3SSZ A;  2WXR A;  2LMC A;  4XA5 A;  3JPN A;  1W1O A;  2I5Q A;  4J9O A;  3ZW3 A;  2Z7J A;  2AL3 A;  3AE9 B;  3STP A;  4H4U A;  3BZC A;  2FCQ A;  5KG4 A;  1TE2 A;  1NK5 A;  1NK6 A;  2KFK A;  4EZ6 A;  1YQB A;  3SR6 B;  3V05 A;  1SGG A;  5J2B A;  1I4P A;  2W3S A;  4AP4 C;  3MJW A;  3BS5 A;  3N32 A;  5CWR A;  2B0C A;  4ECW A;  4K3B A;  2HOQ A;  3I9V 1;  3R3M A;  5KFY A;  2BGW A;  2G06 A;  1B43 A;  5J8Y A;  5D3D A;  2JH7 A;  4JV0 A;  2HHV A;  7ICP A;  4MM3 B;  2L7R A;  4ZHP A;  1W1M A;  2BT6 A;  5III A;  2EQ6 A;  4TUR A;  1TZ1 A;  1YN5 A;  2M4N A;  3NXL A;  5KG1 A;  2IGD A;  1WXM A;  1CK1 A;  4Z6E A;  1WE7 A;  2X50 A;  3TJ4 A;  5AKZ A;  2IMW P;  4F2R A;  5C2T B;  3GD4 A;  1P0R A;  5B5E U;  2OFJ A;  4TUS A;  4PVK A;  2XGP A;  3DVN V;  3H40 A;  2ZVN A;  5J2K A;  3AU5 A;  1V9P A;  4KLL A;  2R61 A;  4OHJ A;  4XWW A;  2OQH A;  1TFR A;  4O3R A;  2ZUC A;  4RQ7 A;  1NJZ A;  4M0W B;  4F7Z A;  2AL1 A;  3W8X A;  3RO6 A;  1SIJ A;  5KFW A;  4PZF A;  1XNS A;  2JWZ A;  3VUX A;  2WQY B;  5IIJ A;  2Y3A A;  4HKZ E;  1QOB A;  2DL0 A;  1F52 A;  1MUC A;  4K1W A;  1EF5 A;  5KAF U;  1WX9 A;  2MEK A;  4FFD A;  1A70 A;  3V61 A;  3VC5 A;  4OJO A;  2HJ8 A;  1FFU A;  4DQI A;  4TQR A;  1OTR B;  2D10 A;  2H89 B;  3Q8C A;  4X5V A;  3QJZ A;  3GD3 A;  4DN1 A;  1D8B A;  3EC8 A;  5KFV A;  9ICC A;  1GRH A;  2QIL A;  3PVL A;  1DRG A;  4G9B A;  2N4F A;  2GBM A;  4E3C A;  5KL8 B;  4O0I A;  2WLB A;  1M6Y A;  4DNS A;  4OZB A;  1UWM A;  3K4G A;  1NJW A;  4F5P A;  5JU5 A;  3IG8 A;  4BKS A;  5ALW A;  1TT5 B;  2WF5 A;  1E5W A;  4J9S A;  4RNA A;  3NVZ B;  2PTX A;  3TSJ A;  4DSL A;  3FG2 P;  2PMQ A;  3WAL A;  1A5R A;  2CS4 A;  3BOX A;  2GDQ A;  3E0F A;  3M7D A;  4BBN F;  3ZI4 A;  3RF9 A;  1UHU A;  2AXT U;  1S3S G;  3W2D A;  4EM3 A;  3KD3 A;  4JMU A;  4QZH A;  4GDL B;  4HAI A;  4L1B A;  2KVS A;  4I6P A;  3VHT C;  2GL5 A;  1KRH A;  5AKE A;  2EEL A;  1ZQX A;  3TAD A;  2IO3 B;  2ZXH A;  1A77 A;  2RPV A;  4H4S A;  3GIJ A;  1JIH A;  9ICE A;  5IP4 D;  2F1I A;  2QB0 B;  1EBD A;  1E7P B;  3KHG A;  4IM2 A;  8ICU A;  2EQ7 A;  3I57 A;  4EWJ A;  3MDA A;  2W0H A;  3BQ7 A;  4RT3 A;  3KFU F;  3PW5 A;  2ZIW B;  1T8E A;  2NRT A;  2WU2 B;  1F3P A;  2M0A A;  1WXS A;  4GDK B;  1Z4N A;  2WXI A;  5KFQ A;  3RUI B;  1GRB A;  4DOA A;  5BOL A;  4MF2 A;  4E71 A;  3PSE B;  3PRE A;  2JU6 X;  1F9J A;  2BPC A;  2HI0 A;  2K5P A;  1BZL A;  2QB1 A;  1K53 A;  5U1O A;  1WGK A;  4FA6 A;  5I4D A;  2MRL A;  4KLI A;  4K8G A;  4W9J A;  4IQT A;  2IY0 B;  2KIW A;  2LPE A;  3O0H A;  1EC7 A;  5AK3 A;  3OHB A;  4J9N A;  4CF3 A;  1NJX A;  1CRX A;  2GQU A;  2J42 A;  4RNO A;  2KHW B;  4KLE A;  4ED1 A;  1RQL A;  4EYI B;  2TSS A;  4KLJ A;  5LLI A;  4UAY A;  2QDE A;  1TK0 A;  4NLG A;  2PCE A;  2K4I A;  2JHD A;  4DQS A;  3H1U A;  3NS8 A;  4C4R A;  2HHW A;  2D3C A;  1DNC A;  3QEB Z;  3PR4 A;  2DZJ A;  2YMM A;  4DBG A;  2NQL A;  2KE7 A;  4DQR A;  5AKK A;  4BXO B;  1AYF A;  2V9W A;  3TEW A;  1RYS A;  1KFD A;  1WZ3 A;  5KL1 B;  1B1Z A;  4FXC A;  3FAH A;  5KFZ A;  3HX0 A;  4O5E A;  1SZP A;  4I2D A;  3A7U A;  3KYD D;  4H19 A;  5C1Z A;  3ETL A;  3L4P A;  3T3O A;  1BKH A;  4M9H A;  4KLQ A;  3IHQ B;  3QUT A;  4DFP A;  1ZQJ A;  3V62 A;  2GSH A;  1IM4 A;  5J2G A;  4TUP A;  1MBB A;  4F4R A;  1L8O A;  1IGC A;  5D79 A;  2OX4 A;  3HWT A;  4MT5 A;  2YAU A;  2UWQ A;  4RF1 A;  3TEZ A;  3ETR A;  1V8C A;  3G6V A;  2LJI A;  3ZLF A;  2CRX A;  1C76 A;  2PTL A;  2W9M A;  5ALQ A;  4YXJ A;  5J8Y C;  2MW5 A;  4YVZ A;  4DHZ E;  1GRE A;  4GC6 A;  1YN4 A;  3UMC A;  1QQ6 A;  2XC9 A;  1LM8 B;  1HEK A;  1IIP A;  4DHJ D;  5EBK A;  3SI8 A;  1MHH E;  3PWG A;  1R7S A;  5G55 A;  4PZO A;  4QZ9 A;  3Q3O C;  3GU3 A;  3QU9 A;  4HJK A;  9ICW A;  4OVV A;  2V3B A;  4G8T A;  2A4Z A;  1ARO P;  2WB1 C;  1WCN A;  4P6V F;  2XH4 A;  4OCZ A;  2ZVO A;  3TSS A;  1XQQ A;  4RQ2 A;  4RMA A;  1KTQ A;  3CYM A;  1UEL A;  1LKY B;  2QEJ C;  1A6S A;  4NJ7 A;  4ZCW A;  1L4D B;  2GO7 A;  1S77 D;  1ZQI A;  1F0X A;  2JWU A;  3ENE A;  2WU5 B;  2QDD A;  3SMV A;  2R8G A;  5D3I B;  1V2Y A;  4QZI A;  2DAJ A;  3AEB B;  3DK9 A;  1HSK A;  3NRZ A;  5C3J B;  2CJO A;  4F93 B;  3PLU A;  3LDZ E;  3ZLH A;  1FFU C;  2I2Y A;  4PHD A;  5HP4 A;  2K8H A;  3BVG A;  1OEP A;  3MTN B;  1SE9 A;  2GBJ A;  3BS7 A;  1TZZ A;  2AAQ A;  3EAN A;  2ZTD A;  5AM5 A;  1UH6 A;  1Z00 A;  2L0F A;  3II4 A;  3RRG A;  7ICU A;  3FJ4 A;  2KNB A;  1KD0 A;  4UAZ A;  4HXD A;  4IWQ A;  3ZNG C;  1OJT A;  3UGV A;  1Y88 A;  2Q5W D;  1U48 A;  2VA3 A;  5BMI A;  3AL0 B;  3V5F A;  2P88 A;  1X66 A;  2JEF A;  2HTH A;  2R8H A;  1XSP A;  1C4A A;  1VRA B;  2K6D B;  2Y5B B;  4PHA A;  3C2L A;  2N9E B;  4KIK B;  3RCY A;  1ZQE A;  5JCI A;  4HRO A;  5CX3 A;  4UB8 U;  3MC9 A;  3DIP A;  2K4P A;  1ZJM A;  8ICQ A;  3SQP A;  3VCC A;  2DKZ A;  2UVR A;  4ICA A;  3N4F A;  5I1V A;  1GER A;  8ICM A;  4CO7 A;  2M8S A;  1KLV A;  2C60 A;  4C56 C;  4B6J A;  4DOB A;  8ICB A;  3ZXV A;  1FXT B;  2Y0S C;  1ZXH A;  4M8M A;  3TWB A;  2DYM A;  3UGB B;  4C8M A;  5CRX A;  4UDU C;  1K1S A;  4QZ8 A;  2ZNV B;  1NU5 A;  2G08 A;  2VAN A;  3B08 A;  5GRT A;  2VFV A;  2IBK A;  2BWF A;  2P4P A;  3WK8 A;  1W1S A;  3UM9 A;  2BYE A;  3SU8 X;  7ICK A;  5KFT A;  5AKI A;  5T14 A;  1N2X A;  4N9F 4;  3DJG X;  2R2Z A;  4IL0 A;  1WFY A;  2ZIU B;  5KFP A;  3KHR A;  4QNL A;  2MQJ A;  4GFJ A;  4JWS C;  2EAP A;  4ED3 A;  1I7H A;  4JB3 A;  3AXC A;  3DEE A;  3TAQ A;  4DDG D;  3AQE A;  4NAW B;  3PRZ A;  3OW1 A;  5CP2 A;  1PK1 B;  3R0U A;  2DWQ A;  5D2M B;  4RQ1 A;  7ICM A;  7ICL A;  3R25 A;  1QQ5 A;  4JUZ A;  5FK9 C;  3ED5 A;  4PVH A;  2XH7 A;  4HN8 A;  5EE9 A;  2G4S A;  4G7F A;  4IZG A;  3R07 C;  2N9P C;  1OEY J;  4XE0 A;  4DXF A;  2PS2 A;  3DQV A;  5TR5 A;  2MUT A;  5KG5 A;  2HE7 A;  4NJ6 A;  4W9D A;  1T3Q A;  1MDR A;  1GES A;  3M62 B;  2H5X A;  2ASQ A;  3NHE B;  3WAP A;  2YX8 A;  1TS2 A;  2IND C;  4RGM A;  2P3Z A;  7ICQ A;  2BCR A;  2CU3 A;  4EX7 A;  1IBX A;  1TIF A;  4J6I A;  1U49 A;  2OG9 A;  3ZXR A;  9ICP A;  3SAH A;  1UWX A;  1IUE A;  4PYU A;  1OXJ A;  5ALD A;  5KFL A;  5KFI A;  1NHS A;  4Q45 A;  3ZO5 B;  3TI0 A;  1ZET A;  1Z19 A;  2KEY A;  4KGS A;  2BCS A;  3FIL A;  3RZF A;  4ANX A;  3WKD A;  2XO7 A;  3PSF A;  3OSP A;  2R2O A;  3EUB 3;  3LJ3 A;  4EQW A;  3EEZ A;  3VDZ A;  4HPL B;  2K4H A;  4WUR A;  5FXF A;  4MEX A;  1E8Y A;  1WVE A;  4ANV A;  5DDM A;  4FZN A;  2ZPY A;  2XEW A;  1MDL A;  1VAO A;  2J0K A;  2KDM A;  3GC2 A;  1RFA A;  2IO0 B;  4NAM A;  3D47 A;  3QN3 A;  5FJR A;  5AI4 A;  5L6F A;  5D94 A;  3Q8Q B;  1E8Z A;  2IZV B;  3NG0 A;  4GXK A;  2XY7 A;  1RPL A;  9ICG A;  3V6J A;  4DK5 A;  3ZTD A;  5G2N A;  1JEH A;  1NOM A;  2R9Z A;  3VH3 B;  2WDR B;  4IW0 A;  2PMZ C;  3VUW A;  2K89 A;  4OJ6 A;  3BDP A;  5EWG A;  4CCH A;  4NLZ A;  3V72 A;  1X42 A;  5L83 A;  4MGI E;  4RUC A;  4DCC A;  3CGC A;  3SEI A;  1X40 A;  4EQX A;  1LFD A;  4KMO B;  1JOA A;  2DW6 A;  2CFY A;  4APN A;  1ZD4 A;  3X23 A;  2BVF A;  4UD8 A;  2IOF A;  3SN4 A;  1EWY C;  2NYV A;  1VD2 A;  1S0N A;  2PFN A;  2ES6 A;  1WM3 A;  1SJE D;  2GMI C;  1DIQ A;  9ICS A;  1P7D A;  1PDY A;  3TEX A;  2Q4T A;  5J0U A;  1PVP A;  1OQQ A;  1SJC A;  3P0W A;  1BML C;  1IPG A;  1WMH B;  2EZY A;  1E9M A;  3PW7 A;  1QSY A;  2NPT B;  4Q2J A;  2WDV B;  2ASD A;  3T8Q A;  5G5G A;  4YD1 A;  4KX5 A;  4FX9 A;  1TS4 A;  4XDC A;  9ICO A;  3KW5 B;  1PGX A;  1P48 A;  2L1A A;  3PG6 A;  3F5E A;  3D2S A;  3C5F A;  3DBR B;  4LNN A;  2RP5 A;  5L1I A;  5IDZ A;  4EX6 A;  4IHC A;  4XC2 A;  1JN3 A;  4Z6F A;  2VA8 A;  2DEN B;  4TQ1 A;  2EXR A;  1FRR A;  4MEM A;  4YWO A;  3HW8 A;  4WIP A;  4OVU A;  1WUE A;  1UT8 A;  4DX3 A;  1TYG B;  4RQ4 A;  5CHF A;  4PVE A;  9ICQ A;  2IBI B;  3J9C A;  4DSE A;  8ICG A;  1GUA B;  2XK5 A;  2K60 A;  1SXD A;  4LDT D;  3V7K A;  3OJ3 A;  4P0Q A;  3SQI A;  2MA9 B;  4WQM A;  1XF5 L;  2BQR A;  2ASL A;  2Q85 A;  4ZYN A;  2GRT A;  4L2Y A;  4XLO A;  5KFH A;  3Q8B A;  3OZY A;  3ZYY X;  4QIW C;  3OHA A;  4RPY A;  1SBB B;  1SEB D;  2V3N A;  9ICB A;  5FR3 A;  1FD6 A;  1MG8 A;  4RGT A;  4H83 A;  2QC8 A;  2WXN A;  4LNO A;  3VRB B;  2WHE A;  1I35 A;  1Z4O A;  1N63 A;  1S76 D;  5GTH U;  5EWE A;  2MA1 A;  3POP A;  4BX9 C;  2LHD A;  5J0W A;  3GIL A;  5AE2 A;  4IQV A;  4M6W B;  2ZTE A;  2FID A;  1ZQB A;  2WXL A;  2OAI A;  5ALV A;  3PGE A;  4UAR A;  3C19 A;  5IN7 A;  3M9O B;  3R2T A;  2NS5 A;  3VVW B;  4H50 A;  1T94 A;  1WE6 A;  3N4E A;  3PT2 B;  5HMR A;  4D2K A;  3RJA A;  1L3T A;  2K25 A;  3DV9 A;  1KKR A;  4C4S A;  2CPR A;  2FIF A;  1K5O A;  4IR9 A;  2XSX A;  3T79 A;  3IFW B;  1O03 A;  2F1J A;  1ZGU B;  3OG5 A;  3TUO A;  3WU2 U;  4IP5 A;  4HG0 A;  7ENL A;  1SB3 B;  1QIL A;  2J3N A;  3WKA A;  4C8L A;  4R64 A;  4HPM B;  2M1M A;  4C00 A;  4RNN A;  2O6K A;  3H4B A;  5J2I A;  1L8P A;  4KLF A;  4E4F A;  5DBB A;  1AW7 A;  1ZE3 D;  1S5L U;  2BVG A;  8ICY A;  1QH9 A;  4EYH B;  2CXY A;  4Q43 A;  3M8S A;  5D4B A;  5JRT A;  2R2Q A;  3ALB A;  4DDI D;  4ARI A;  4GGB A;  1Q3U A;  3SV4 A;  2E5S A;  4DHJ B;  4C8O A;  1CJE A;  4DSK A;  1WGY A;  2JXX A;  3LB8 C;  2QQ6 A;  4ZA0 A;  5CJ7 A;  4NL9 A;  2WAQ C;  4MJS B;  2EMT A;  1OW5 A;  3TQP A;  1QLU A;  4H2A A;  3UCD A;  1K4Q A;  9ICJ A;  3R1Z A;  3GV5 B;  3V4B A;  2L0T A;  5IAA C;  3JPR A;  1TK5 A;  3W8W A;  2BW2 A;  4QAY A;  2N1W A;  1IV8 A;  5BYQ A;  3RD2 A;  1V81 A;  1N60 A;  2H3F A;  3HIZ A;  9ICF A;  2PVO D;  8ICZ A;  2OVL A;  2DKX A;  4ECQ A;  4H4V A;  3GSY A;  3RBE A;  5KFS A;  1S10 A;  2GGJ A;  2ZW0 A;  4NQK E;  2E8P A;  1YX6 B;  4GRT A;  2VRR B;  2P13 A;  4GXJ A;  1FCC C;  3OAW A;  3V3X A;  2K1F A;  1K1Q A;  1V1P B;  4EKU A;  4P4O A;  4UBC A;  2WF8 A;  2PJH A;  1SJB A;  1YQZ A;  5IOI A;  2WNM A;  4IRD A;  2AQ0 A;  5HNK A;  3NY5 A;  2YY6 A;  4QZF A;  1WI0 A;  1X6J A;  2YB1 A;  3PZ7 A;  3DGB A;  4AJW A;  3I6E A;  1UBQ A;  2ISO A;  1E10 A;  2KLC A;  3HVZ A;  2XY5 A;  2G4D B;  1U45 A;  3B9J B;  3QZ8 A;  3Q3F A;  5ALK A;  3H8M A;  2ZIX B;  2MHJ A;  1PK3 A;  5D46 A;  3P4S B;  3DPD A;  1ZMC A;  2DZK A;  1RQN A;  4LZD A;  2G45 B;  3GRT A;  4UAV A;  2KKP A;  1WH3 A;  3T5L A;  5AK6 A;  3NVV A;  2KWV B;  1KN5 A;  3PST A;  2J6U A;  4GMV A;  2O6V B;  4QZG A;  3JZU A;  4QWC A;  4ED8 A;  1SV0 A;  4KDL B;  3ZVH A;  2KTF A;  5KT3 A;  2LM1 A;  3WK4 A;  2F44 A;  2K8C B;  1RDF A;  3HPF A;  3DHH C;  1BPX A;  3A4R A;  3HP6 A;  4E0D A;  1T6B X;  2KIV A;  2LWP A;  5HQX A;  3KH0 A;  5BO4 B;  4YMM A;  2LXC A;  2YB4 A;  1MQ3 A;  8ICK A;  1COK A;  3QNM A;  1O08 A;  1XO1 A;  3RR7 A;  2HHU A;  2YMP A;  4WWN A;  2OM6 A;  3Q8L A;  4P1C C;  4HLE A;  2CHR A;  1L3V A;  3NVY B;  1BPD A;  1L5P A;  1YN3 A;  3ENL A;  4IC9 A;  1JWS D;  2BC1 A;  4PPX A;  4J9Q A;  2INC C;  4A6Q A;  5IIK A;  4Y2R A;  1WR1 A;  5KHO A;  1E8X A;  3H12 A;  4EMI A;  1DZN A;  2ISP A;  2KSO B;  2EAM A;  2VJ4 A;  5AIA A;  1XAN A;  3PX0 A;  1FIQ A;  2LEK A;  2KVC A;  1WXA A;  1F9C A;  5K8E A;  3N1Y C;  5AZH A;  2VKQ A;  1BNP A;  1LQB A;  1NI3 A;  2W9C A;  3UJE A;  3P2B A;  1DXL A;  2RDG A;  1Q10 A;  2LVO A;  2P8B A;  2W9B B;  3C0P A;  2OQY A;  3P42 A;  4JDR A;  4KPR A;  1K8R B;  4H2H A;  1ZQH A;  2BDP A;  5IIN A;  1UGJ A;  1VR9 A;  4UAS A;  2RMM A;  2KOX A;  3U52 E;  1E8H A;  3GIK A;  2KMA A;  1YMH E;  3L17 A;  2EKI A;  4M0A A;  5J0X A;  4KLU A;  3ONN A;  4W9H A;  1D5Z C;  1ZDX A;  2JX5 A;  5J2F A;  4LLG M;  5GMV A;  2ZZ0 A;  3A1Q B;  4BCA A;  2LXA A;  4UB6 U;  3MHZ A;  1NDD A;  5HMM A;  4JE3 B;  4GIB A;  5HML A;  1E8W A;  3OTQ A;  1V85 A;  5HHD G;  3RH4 A;  3NJT A;  2BVC A; 
#chains in the Genus database with same CATH homology
 3NVZ B;  1C79 A;  1RM6 C;  3TSJ A;  1YJJ A;  5AUK A;  3W2D A;  1NVI D;  2BTE A;  1T3Q C;  1TKE A;  5EE0 A;  5FKA C;  4GDL B;  4YSY B;  1ET9 A;  4L1B A;  3CIR B;  4KKI A;  1KRH A;  4REZ A;  5MPO A;  4MLA A;  1Y56 A;  2EEL A;  2VFU A;  3AM9 A;  1XXG A;  2RPV A;  3SFD B;  1N5X A;  1F2R C;  2RK5 A;  1E7P B;  3BVZ A;  4B0M A;  5LNK 1;  3RJ8 A;  3I57 A;  1FCL A;  4PT5 A;  2K0P A;  1SE2 A;  1IBX B;  1QQR A;  2W55 A;  4ZYS A;  2W3R A;  1ZDV A;  1ZPS A;  3R2I A;  1BXT A;  2WU2 B;  1VZ6 A;  2M0A A;  1PUT A;  4R3D A;  3LXF A;  4GDK B;  2WXI A;  1QKZ A;  1WVF A;  1F77 A;  1SF0 A;  3MP9 A;  2JU6 X;  1XO3 A;  2K5P A;  1K53 A;  3FIL B;  1WGK A;  3P4R B;  5I4D A;  2PLI A;  5D7G A;  3UI3 A;  4C7Z A;  2GI9 A;  1I19 A;  1WRI A;  2AQ2 B;  2WDQ B;  1JAL A;  5HFY A;  2GQU A;  1KTK A;  3FW8 A;  4PYT A;  2J42 A;  3BK2 A;  2HTM E;  2L83 A;  5GXG B;  1E6E B;  2BS3 B;  2IPI A;  2TSS A;  2JYE A;  1FXI A;  1FFV A;  3NS1 A;  1HZ6 A;  1PDX A;  1TKG A;  1ESF A;  2ZW1 A;  4RFB A;  3AEG B;  1AYF A;  1E8F A;  3O13 A;  3TEW A;  1B1Z A;  1KFY B;  3Q8A A;  4FXC A;  4LK0 M;  3FAH A;  1E0Y A;  2LHE A;  3A7U A;  3ZJU A;  2ACZ B;  1JWA D;  3L4P A;  2W82 A;  4RH6 A;  4ARC A;  3T3O A;  1V1P A;  2WXO A;  2WDW A;  4RGN A;  1J7A A;  1ENF A;  1MBB A;  1L0X B;  4ML8 A;  1IGC A;  1W1K A;  5D79 A;  1QT9 A;  4MT5 A;  2LUM A;  4RF1 A;  3S1C A;  3TEZ A;  3ETR A;  3T3N A;  4JX1 C;  1F2R I;  1V8C A;  1HEZ E;  2LJI A;  3BYY B;  3HRD D;  3ABV B;  2MJ3 A;  1VZ7 A;  1C76 A;  2PTL A;  4IKG A;  3NVW A;  1C9F A;  4US9 A;  2MBR A;  1EU3 A;  2BB5 A;  2MJE A;  5T8I A;  1TY2 A;  4MAC A;  4RF0 A;  1DOX A;  1VLB A;  1K51 A;  1YN4 A;  5G5G B;  2VFR A;  1ZXI A;  2IPK D;  1ZOY B;  3D2J A;  2IDY A;  3RPF C;  1MHH E;  1I4H A;  1QOG A;  3GP7 A;  2GQT A;  1HZ5 A;  2J4X A;  1C78 A;  5HHZ A;  1R7S A;  1LO5 D;  2GB1 A;  1KLG D;  1L0V B;  1ACC A;  3ZJV A;  4USA A;  5AWV A;  1J7C A;  4N58 A;  5G5H A;  4P6V F;  2AQ1 B;  3S1F A;  3TSS A;  1DII A;  3AB5 A;  2QEJ C;  2LFI A;  3W9C B;  3ZJT A;  2X38 A;  4C7Y A;  1L4D B;  4US8 A;  3DWG C;  1F0X A;  2JWU A;  2WU5 B;  1FNW A;  4OW0 A;  1N63 C;  2UUV A;  1PYW D;  1ZUD 2;  5D3I B;  2DLB A;  3AEB B;  2H88 B;  1HSK A;  3NRZ A;  5C3J B;  3NVY A;  2ON8 A;  2CJO A;  3A7R A;  4RCO A;  1FM0 D;  1TS3 A;  2GRI A;  2J53 A;  1PGA A;  2I2Y A;  1FFU C;  3BVG A;  3AE4 B;  1RYJ A;  1L0Y B;  1AWD A;  1KH0 A;  2P3H A;  4PWC A;  2HDE A;  3P4P B;  1JW9 D;  1QLT A;  3OWE B;  1K50 A;  3P63 A;  4P16 A;  3W5U B;  3TEY A;  1T5X D;  2QSD A;  3R8B A;  2QPM A;  3Q8E A;  4TVW A;  2Q5W D;  1CQV A;  5BMI A;  2IJ0 A;  4YWG G;  4J3O D;  1C4A A;  1VRA B;  1FO4 A;  1K52 A;  1MVK A;  4HRO A;  2D5G A;  3W8Z A;  2E5A A;  1N61 A;  3BYT B;  1SSN A;  2OED A;  4HJG E;  4JB1 A;  2N0S B;  1GPX A;  4DQO C;  5I1V A;  1GOZ A;  2KAC A;  1PGB A;  3P1M A;  5L6G A;  2JYT A;  3BVM A;  4C56 C;  1AHZ A;  1X2H A;  1MI0 A;  2L52 A;  4OVZ A;  1D5X C;  1ZXH A;  2DYM A;  1DOI A;  2PW9 A;  4UDU C;  1I4G A;  2VFV A;  2VFS A;  2N9L A;  1NEN B;  2P4P A;  3W5V B;  3D2H A;  2V4I B;  3AE8 B;  1W1S A;  3HRD C;  2JSV X;  4A8X C;  1TS5 A;  4HRS A;  1W1J A;  2R2Z A;  3NVZ A;  4TSS A;  2INN E;  3MC0 B;  2NMQ A;  2KN4 A;  5TSS A;  1GB4 A;  3AE7 B;  4JWS C;  1I7H A;  1JCK B;  4TQ0 A;  1N60 C;  2YEP B;  1W1L A;  1J7B A;  1PFD A;  4NAW B;  2OHF A;  3HVD A;  3LAE A;  2Z8L A;  2DWQ A;  3DQ0 A;  3PZ8 A;  5HG2 A;  3BWU D;  1JWU D;  1TY0 A;  1UXY A;  5FK9 C;  4PVH A;  3AED B;  4YTM B;  5EE9 A;  4BC7 A;  3R07 C;  4XE0 A;  2WXQ A;  4DXF A;  1QF6 A;  1T3Q A;  4IDI A;  2WP9 B;  2G9H D;  1ROE A;  3DWM A;  4NZL B;  1STE A;  1TS2 A;  3N9Y C;  4NJC A;  4RGM A;  2Y3R A;  2CU3 A;  3AE6 B;  3RFZ B;  1IBX A;  4XWT A;  1MBT A;  1WXQ A;  1UWX A;  2K9X A;  3Q8F A;  2E3T A;  2NTT A;  1IUE A;  3HSU A;  4O95 A;  1N5W C;  4XDD A;  3IXS A;  1CZP A;  4KGS A;  3LYY A;  3FIL A;  1B9R A;  3EUB 3;  2ICI A;  2ONQ A;  1C77 A;  3HUI A;  1JWB D;  4TVY A;  3TSH A;  1E8H A;  4WUR A;  5FXF A;  1WVE A;  1VAO A;  4A55 A;  4WAF A;  1DOY A;  2VZK D;  2PLS A;  1FRD A;  2KDM A;  3U2S C;  2WXH A;  3KLS X;  1XEE A;  3VRA B;  4NAM A;  2V0G A;  1XLP A;  1QLB B;  4JPS A;  4A90 A;  3NVV B;  5L6F A;  3AEC B;  1P7F A;  1ZP0 B;  3I99 A;  4PVJ A;  2QIE B;  3URY A;  3MFG A;  3PQB A;  2L32 A;  1ZXI C;  1KLU D;  1UNS A;  2WDR B;  1W1Q A;  3B9J A;  3ZGZ A;  2QMT A;  2WXK A;  1HXY D;  2M56 B;  2NQW A;  1EWC A;  2DYO A;  1V97 A;  2FBW B;  1SJH D;  1YQ4 B;  2WXF A;  1ZR6 A;  3ZQ4 A;  3VTE A;  1P7E A;  2PIA A;  3AEF B;  2O3G A;  1ET6 A;  1TZO A;  1YQ3 B;  2K3U A;  4EE2 A;  2BVF A;  4UD8 A;  2RDH A;  2PMV A;  4B0E A;  2JQR B;  1HQR D;  1EWY C;  1D6E C;  1TJE A;  3C8Y A;  1GB1 A;  1SJE D;  1DIQ A;  3AEA B;  2YEP F;  3TEX A;  1OQQ A;  1BML C;  4IOI E;  4ZHO A;  2FUG 1;  3U7Z A;  2BS2 B;  1MPE A;  5FXE A;  1E9M A;  2G1E A;  4Q2J A;  3SR6 A;  2WDV B;  1WYG A;  5G5G A;  1D5M C;  1FIQ B;  2SAK A;  1TS4 A;  4XDC A;  1X2G A;  4ITK A;  1PGX A;  3AN1 A;  2L1A A;  2NTS A;  5EE1 A;  3NRZ B;  1JML A;  2WXP A;  5H92 C;  4TQ1 A;  2EXR A;  1FRR A;  1AN8 A;  1XCQ L;  3U4E G;  3KJM A;  4WIP A;  1L6V A;  1TYG B;  1VJK A;  1DYQ A;  1DGJ A;  2WS3 B;  4HEA 1;  1EU4 A;  2Y3S A;  5E6J A;  3PM9 A;  3J9C A;  4PVE A;  3S1D A;  4HKQ A;  1FEH A;  1M4V A;  2V3P A;  3AV8 A;  4LTU A;  3GB1 A;  1N61 C;  2AQ3 B;  1JRP A;  1XF5 L;  2J52 A;  2WXM A;  4WQM A;  2Q85 A;  4EC3 A;  2Y5P A;  4L2Y A;  4XLO A;  2BBC A;  3Q8B A;  3D2D A;  3ZYY X;  1SEB D;  2V3N A;  5FR3 A;  1SBB B;  2PKO A;  3VR9 B;  1N62 A;  1F0Z A;  4M0W A;  4WWM A;  4RGT A;  1FD6 A;  1WSP A;  3B2F A;  2N9K A;  2WXN A;  3NZ3 A;  4OZA A;  3VRB B;  4A9A A;  3A7A A;  1QOA A;  1AHV A;  1N63 A;  1NEK B;  4YTN B;  5JXV A;  4BBY A;  3POP A;  1XLO A;  2LHD A;  2QJL A;  2M19 A;  3KQ4 A;  2AX5 A;  5HI1 A;  5AE2 A;  2WXL A;  2OAI A;  5AE3 A;  4ZRP A;  3R2T A;  3VQI A;  3W1S A;  2QKN A;  1UUP A;  1SB3 C;  1V1O A;  5BMH A;  5BMG A;  2VZK B;  4D2K A;  5HMR A;  3RJA A;  2MJD A;  2Y08 A;  1E8G A;  3EGR A;  4AQ7 A;  4AS1 A;  1WWT A;  3P4Q B;  1SXT A;  2IGG A;  3TUO A;  4HG0 A;  1XLN A;  3IT6 B;  1SB3 B;  1QIL A;  3VR8 B;  3BII D;  1AW7 A;  1ZE3 D;  2I38 A;  5EE3 A;  2BVG A;  4BC9 A;  1RM6 B;  1TKY A;  3MJ5 A;  4ARI A;  4KKJ A;  3FW9 A;  1HA5 A;  2VAO A;  5ADZ A;  3EUB 2;  1CJE A;  1FFV C;  2Y4G A;  4ZOH C;  2KAJ A;  3LB8 C;  2KQ4 X;  4WH4 A;  4YSX B;  3KWL A;  5HHD G;  1QLU A;  2AXR A;  2CJN A;  4H2A A;  2B76 B;  2PLP A;  2VFT A;  2Q4W A;  3B2G A;  3S1E A;  1VQZ A;  1OQR A;  3FW7 A;  3NS1 B;  2XNA C;  3W8W A;  4ZOH B;  2BW2 A;  5BYQ A;  2E6X A;  1I4X A;  1N60 A;  4CQN A;  3GSY A;  2PVO D;  2SEB D;  5AE1 A;  1FMA D;  1IGD A;  4ZRQ A;  1GAQ B;  4N6E B;  5I1W A;  1C4C A;  2ZW0 A;  2YVS A;  3Q69 A;  1JRO A;  4OAL A;  2INP E;  4L23 A;  4PWB A;  1YNT E;  2R8D A;  4KGT A;  2P13 A;  2WXG A;  1FCC C;  3V3X A;  1V1P B;  3AE2 B;  4N59 A;  2WNM A;  1L6U A;  1OFF A;  3PZ7 A;  1AHU A;  3KWV A;  4KX6 B;  3PO0 A;  3DED A;  3ETR B;  1E10 A;  3EA6 A;  2JXT A;  3HVZ A;  2JZP A;  1YJI A;  1KF6 B;  2XN9 C;  5AUI A;  3B9J B;  3NVW B;  1FNV A;  4DXG A;  4YSZ B;  3P4S B;  1N5W A;  2KWD A;  1W1R A;  1QOF A;  4YXD B;  3AMZ A;  1NYQ A;  4C80 A;  1I4R A;  1FXA A;  2BYT A;  4JAY A;  3NVV A;  3BW7 A;  4YTP B;  1EM7 A;  2Y5C A;  3LLB A;  1RFK A;  4KGR A;  1RWS A;  5BYS A;  1E0Z A;  1XCT L;  2WXR A;  2N7J A;  2LMC A;  1W1O A;  2UUU A;  5G5H B;  3AE9 B;  1D4B A;  3FWA A;  2K22 A;  2FE8 A;  1SE3 A;  1T6B X;  1FNU A;  4MH8 A;  1JQ4 A;  3V05 A;  3SR6 B;  1I4Q A;  5HQX A;  1I4P A;  3BZD B;  3JS8 A;  2W3S A;  1BUI C;  4O1N A;  2WXJ A;  3I9V 1;  3TX1 A;  3NVY B;  3SFE B;  3NUH B;  1L5P A;  3AE5 B;  5D3D A;  5BYR A;  4ZHP A;  1YN3 A;  4MM3 B;  1W1M A;  1JWS D;  2BT6 A;  1VZ8 A;  2MH7 A;  2BVH A;  1YN5 A;  2PVG C;  3IT4 B;  2IGD A;  3GS2 A;  4JWU C;  1CK1 A;  4A6Q A;  3E9S A;  2LGI A;  1N62 C;  3H8H A;  4YT0 B;  2BS4 B;  5FXP A;  5C2T B;  2BB6 A;  1DZN A;  4PVK A;  1FIQ A;  2LEK A;  5K8E A;  1NYR A;  2R61 A;  4OHJ A;  4XWW A;  1NI3 A;  4GLS C;  2RDG A;  1Q10 A;  3W8X A;  1XLQ A;  1C4P A;  3BK1 A;  5H8Y E;  1SIJ A;  3AH7 A;  3C0P A;  3E56 A;  4PZF A;  3P42 A;  1SE4 A;  1VDV A;  1MHX A;  2WQY B;  2Y3A A;  4HKZ E;  1QOB A;  1JWM D;  3AE1 B;  2MEK A;  1A70 A;  1UGJ A;  1VR9 A;  2KMM A;  2RMM A;  3CWI A;  3U52 E;  2DBY A;  3Q8C A;  1FFU A;  4RGO S;  3FC4 A;  2H89 B;  3AE3 B;  2I0K A;  1YMH E;  2EKI A;  2W54 A;  4OZC A;  3WCQ A;  1D5Z C;  1ZDX A;  2JX5 A;  4LLG M;  2QIL A;  3IAM 1;  4TMA B;  5FXD A;  3IAS 1;  1L4Z B;  2WLB A;  4DNS A;  4BCA A;  4OZB A;  1UWM A;  3MHZ A;  4JE3 B;  2IGH A;  3AEE B;  3SEB A;  4RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...