1JRPA

Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 132
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jrpA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jrpA01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jrpA04
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jrpA03
5HHZA 2I0KA 2VFRA 1SIJA 1YQ4B 4ZOHC 3AE2B 3KJMA 1E8HA 4JAYA 2Q4WA 1DZNA 1IUEA 3HVZA 1W1RA 2YVSA 3AE4B 3AH7A 1FIQB 1N60C 2P4PA 5G5GA 5FXDA 2CJOA 4USAA 1E0YA 1JWAD 3P4PB 3HRDD 4ZHPA 4JB1A 4YSXB 1PDXA 2B76B 1NEKB 2L83A 5EE9A 1WVEA 3B2GA 1A70A 2WDVB 2WS3B 3B9JA 3P4SB 2QJLA 1DOIA 1QT9A 2M56B 1FIQA 3L4PA 5AE1A 2M19A 1UWMA 2FBWB 5G5HB 2N0SB 1RM6B 1X2HA 1VAOA 2ACZB 1YQ3B 1MBTA 5EE3A 3DQ0A 5EE1A 1NYRA 2HTME 1XLQA 1E0ZA 5GXGB 1T3QA 2E3TA 3A7UA 2BVGA 2VFTA 4LTUA 5ADZA 1WRIA 3W9CB 4WWMA 1VQZA 1W1SA 3W8XA 1F0ZA 4JX1C 4PYTA 1N5XA 1T3QC 2RK5A 4JWUC 1OFFA 4P6VF 3W8ZA 3NVYA 1J7BA 2MJEA 1DOXA 3AE7B 1WXQA 2NQWA 5HMRA 2EXRA 1L0VB 1X2GA 3C0PA 3CIRB 1E8FA 2DWQA 3AB5A 1J7CA 4YSZB 2H89B 3WCQA 1W1JA 2WLBA 2WQYB 3S1DA 1XLNA 1FRRA 1JQ4A 1RFKA 4C7ZA 2WDRB 1WGKA 5FXFA 2E5AA 2VFUA 2W55A 1R7SA 2WU5B 2VAOA 1N61A 1QOAA 1KF6B 4ITKA 1JWBD 3NVWA 2GQUA 3AE9B 3ZYYX 3S1CA 3NS1B 1DOYA 5H8YE 1OQRA 2H88B 4A9AA 1DIIA 1NYQA 1NENB 2K5PA 1N61C 3AV8A 1W1QA 1ZXIA 3AE6B 3VRBB 1QOFA 1FRDA 2CU3A 1F0XA 3HRDC 3EUB2 1XO3A 2L52A 1FFVA 1V97A 3FAHA 2DBYA 4HROA 1ZXIC 4ML8A 3AN1A 3AEAB 2VFVA 5H92C 1JALA 4YTNB 1AWDA 3AE1B 1E7PB 4TVWA 1FFVC 1W1KA 3B2FA 3LB8C 3AE5B 4BC9A 1VJKA 2PVGC 4YTMB 2Q85A 3AEFB 1VDVA 1FXAA 3NRZB 1UXYA 1N62A 2WU2B 3NVZB 3S1EA 4IDIA 4KX6B 2BVFA 3P1MA 1TKYA 2EKIA 2KMMA 4N6EB 5G5HA 4HRSA 2R8DA 1E6EB 3DEDA 2G1EA 1AHUA 2AX5A 2LEKA 1AYFA 1N62C 3VR8B 3NRZA 3HUIA 3NVZA 4TVYA 3VR9B 1KRHA 3PO0A 2Y5CA 1RM6C 2BVHA 1JRPA 1ZOYB 1HSKA 2KAJA 2BT6A 4C80A 3I99A 2QPMA 1W1OA 1WWTA 1QLTA 1SF0A 2AXRA 1YJJA 3AMZA 3SFDB 5AE2A 3AE3B 3PM9A 1JROA 1E10A 2JX5A 2MBRA 1WVFA 3LXFA 3DWGC 1N63A 2PVOD 1W1LA 3AEBB 3AE8B 4ZOHB 1DIQA 1L5PA 3NVVB 2OHFA 3P4RB 1L6UA 3LLBA 2QKNA 1XLPA 1N63C 2R2ZA 3ETRB 1B9RA 1GAQB 1NI3A 5C2TB 1PUTA 3NS1A 2PKOA 1FXIA 2CJNA 1FFUA 1AHZA 5C3JB 5AUKA 3AECB 2MJDA 1FM0D 3AM9A 3ETRA 4WQMA 1J7AA 1NVID 3B9JB 1YJIA 1TYGB 2BS3B 1RYJA 1FMAD 4JWSC 1V8CA 2MH7A 3BW7A 1FFUC 1QF6A 2GQTA 4N59A 4N58A 2QIEB 2P13A 4XLOA 1ZUD2 2PLIA 3A7RA 1QOGA 3CWIA 1KFYB 1TKEA 2WP9B 5MPOA 1I19A 4C7YA 4US9A 1CJEA 1W1MA 2K9XA 1GPXA 1PFDA 3KWLA 4YSYB 3S1FA 4O95A 4BC7A 3ABVB 1JW9D 3AEDB 5HQXA 4BCAA 1CZPA 3EUB3 2W54A 1ROEA 2VFSA 4OALA 3AEEB 1MBBA 3P63A 5AUIA 1E9MA 1QLBB 4HG0A 3NVYB 1EWYC 2W3RA 4YT0B 1ZR6A 1N5WA 3W8WA 3TX1A 3SR6B 3W5VB 2PIAA 1QLUA 1FO4A 3FC4A 1I7HA 3A7AA 3W5UB 1XLOA 2BS2B 3LAEA 1TKGA 4ZHOA 3AEGB 1N5WC 1SB3B 1OQQA 1VLBA 3P4QB 1QOBA 2MJ3A 1AHVA 3SR6A 1RWSA 3R07C 2WDQB 1DGJA 3JS8A 3NVWB 2K22A 3SFEB 1TJEA 2W3SA 1ZP0B 2OAIA 4YTPB 4US8A 2PLSA 2BS4B 3BIID 5FXEA 4MLAA 4YXDB 3DWMA 5FXPA 4FXCA 1L6VA 1E8GA 3RPFC 2JQRB 1SB3C 2Q5WD 2O3GA 3VRAB 3NVVA 1WYGA 4BBYA 5G5GB 5EE0A 5AE3A 2P3HA 1N60A
chains in the Genus database with same CATH superfamily
2Y0SF 4FBUA 2YMPA 1WR1A 4EUTA 3WKBA 2FE8A 2KWVB 3M95A 3H8WA 2K4HA 2V3AA 4GYPC 2WF7A 2GR0A 3EPGA 3N7SC 1ZQRA 9ICQA 2GBKA 4F7ZA 3KLJA 1VCBA 1RLFA 3EECA 2NRTA 2YVSA 2ZIXA 3ISDA 1UZXB 3L13A 3ZRFA 2PCEA 2ISPA 5GRTA 3QC8B 3MC8A 2BCPA 2PFQA 3GV5B 2P4PA 2R18A 4E71A 4OJ5A 4K81A 1WM2A 5CX3A 4EE2A 3AQFA 2G45B 3O65B 1JWAD 3JVAA 3KW5B 4ZHPA 3N28A 1L7OA 2Y9UA 1PDXA 4WIPA 2LM1A 2D6FC 1M4VA 1NEKB 1NI2A 4DFJA 1WVEA 2W43A 2WOVA 3WKAA 1A70A 2WDVB 3RB4A 2WS3B 3B9JA 4GDLA 4TMAB 3VC8A 3SBFA 2QJLA 4KLSA 3O13A 4IWOA 2MCNB 5HG2A 1WJNA 2EMTA 4ROPA 4E4UA 3PQBA 2NS5A 1WX9A 5AKZA 2QMTA 1S1QB 4J6IA 5AE1A 2KJ5A 1GRTA 1R6WA 4RQ0A 1PGXA 1S5LU 2AQ2B 1UWMA 4H4RA 5G5HB 2DZIA 4FP1A 2KD0A 3D6JA 2N0SB 5J0YA 3H0MB 2IO0B 2GB1A 3CK5A 3NXLA 2N4FA 3R7RA 4OVZA 3ZKJC 5AKKA 1SXTA 1FNUA 4JWMA 2NQLA 3BS5A 2MUCA 1MBTA 3FCPA 3IM1A 1FEBA 2PODA 1UT5A 3SEIA 4DOCA 2GLSA 5EE1A 3PLUA 5HI1A 4XA5A 4GISA 1Q5WB 4E4FA 2JWUA 4GC7A 1XLQA 4KV2A 3C5GA 2BYFA 8ICBA 1KW4A 1WRDB 2HHVA 3M9OB 1U4BA 3PRMB 4JMUA 3EWAA 1X2IA 1H4RA 4M8MA 3W9CB 4GU2A 1J2NA 1JMLA 2LM4A 1EC7A 4RGMA 4HKQA 4HPMB 2HI0A 1W1SA 1PZNA 3SV3A 1FNWA 4MSMB 2BCQA 3IV6A 1X9MA 4DSKA 2K3UA 4K4IA 3D46A 2GO7A 2GGHA 3EAOA 5AKLA 5A0LA 5J29A 2KQ7A 2NR2A 4XDDA 4DXKA 5GTIU 5KNIA 2RK5A 3KLSX 1B1ZA 4P6VF 2CN1A 3QK0A 3PHWB 5L1KA 2JRZA 3KZIU 2NQWA 5HMRA 2EXRA 4O3QA 1L0VB 1X2GA 3NS8A 3MC1A 1Y56A 1JN3A 4MEYA 3PS6A 3QUCA 2BCSA 4PVEA 1TY0A 2N1VA 3P93A 5AZHA 2H89B 2V9WA 3CB3A 4A20A 3IJIA 2I6XA 2HBLA 1V80A 5J0RA 2WQYB 3V3XA 4EM4A 3S1DA 1CRXA 3BJYA 3RNEC 1FRRA 1ONEA 2YX8A 1NK7A 5J2IA 3D32A 2EQ8A 3RO6A 1V38A 4RQ5A 3MSYA 2INCC 2KZRA 2WDRB 3ZNID 1F2RI 5LLIA 1ZETA 5FXFA 1XT9B 4YVZA 1K1QA 1K1SA 3ML8A 4C8NA 1MVKA 5T14A 4J3ZA 4H4UA 2JMGA 1XD3B 1RFAA 4A90A 5J8YA 4B95A 1SKRA 1ZKQA 1GERA 1TZ1A 3HK0A 2WU5B 4NQLB 2EAPA 1KSPA 2MBHA 4TSSA 3NZGA 1N61A 3ZW3A 3OP2A 4JGHB 1VR9A 2JV3A 4KN4A 3QUTA 4DEZA 2VA8A 2ZZPB 3RD2A 2ESEA 4KKIA 1Z4OA 5DGAA 3AE9B 1P98A 3A9JA 4H4YA 2IO3B 5H8YE 1KFSA 2AHOB 3V5CA 1TKDA 2JRIB 3PW7A 4MGYE 5KHQA 3UMBA 1MSWD 3L0WB 2HSZA 4W9HA 1NK8A 5AHXA 5AI4A 3PSPA 3N4FA 1J97A 3K4GA 1NENB 2K5PA 2MW5A 2I5QA 4KVGB 1NKBA 8ICXA 3VFCA 3PR5B 1QOFA 3L5KA 1WM3A 2C60A 5L9XA 2D8CA 2LZ6A 5DB9A 2HCFA 4W9JA 2AEHA 3ZNGC 4AUQC 5BOFA 5FS7A 4BVUC 3Q6BA 4IHCA 2J6SA 2CU3A 2PI5A 1FEZA 3H4BA 5CR0A 9ICEA 2QJMA 2NVUI 2RQ5A 2ZEQA 3EUB2 2KWCA 3HRDC 5ALFA 5AICA 3N4MB 1N56A 9ICTA 2PJHA 4A8XC 3FAHA 2DBYA 4PVHA 4EX7A 2GRTA 3SQSA 5KT6A 2LGSA 1X9SA 4A6QA 4QWCA 1JCKB 4UARA 2KVRA 2WXPA 4I2JA 4A3OA 3MUCA 4K2SA 2PXIA 4WQOB 3D2NA 4IRCA 1WZ0A 3TSHA 1AWDA 4PH5A 3DGBA 4DLGA 2FJ6A 2ZW1A 2YQEA 5AK6A 4ELVA 1Z1VA 2E5SA 1S77D 2JT4B 2LMCA 4G11A 1FFVC 3FG2P 4TVWA 3F2DA 1AOGA 3B2FA 1H8CA 1ZQXA 3ONNA 5CHGA 3LVWA 4O3MA 1UGMA 5BYRA 3BVZA 1NZBA 3TQPA 4P4PA 2XGZA 1VJKA 2YB1A 4UD8A 2G06A 2KN4A 1U47A 4MFFA 2IOFA 3C21A 2BBCA 3KHHA 2WWZA 3RRHA 4C4RA 2V4IB 1A5RA 1NK4A 1C9FA 5FJUA 2Q85A 1VD2A 1WJ6A 5FS6A 5C5JA 3FW9A 4JDRA 3NHEB 3VCNA 2JY6A 2EQ7A 2YMQA 5DQIA 4ACFA 4DL3A 3IG3A 4FO6A 1ZQOA 2XEWA 4PHPA 1XO0A 3QU7A 3ZDAA 1N62A 5J2EA 3IK4A 1J8CA 1QQ5A 2XICA 1V1PA 2D5GA 3CF6E 1ZDLA 3DESA 3K9PB 1GEUA 1S7MA 2XSXA 1A6SA 1PYWD 4F92B 5JCKA 3AU5A 5G5HA 4I27A 1KN5A 1ZMDA 2RDXA 4WAFA 1R0MA 2ZADA 4KLQA 2QC8A 2KFNA 1QQ6A 2R8DA 5KG1A 2NPTB 1T7PA 2LHTA 5D6JB 4APNA 1YOVB 3HP6A 4A35A 5IINA 3ZNHB 3R2TA 2OH2A 2C3CA 4F4XA 4KPLA 3Q8BA 4M0XA 1TFRA 3Q8LA 4K7SA 4J9QA 2KFJA 3DGZA 2BZFA 3VR9B 3OAWA 3PO0A 1BKHA 5BOLA 1I4RA 4OJPA 1RM6C 5L1IA 4KPRA 1UA1A 3OTQA 3ISCA 1KKRA 3BVMA 5B66U 1ZOYB 1E7UA 1UBIA 3X0WA 2I2YA 9ICNA 1MO9A 5KFNA 3L54A 1Z5SB 2N1WA 4IQTA 2KANA 3PX6A 2BT6A 3MKCA 4KGSA 3H8AA 2QPMA 1UCVA 2XN9C 5KHOA 1ZOLA 4MGKE 5D3IB 4EZKA 4WJQA 2KIVA 3FV9A 4O5CA 1QLTA 1ZYQA 4ED3A 3GIMA 1T4GA 4EOYA 2IGHA 2LRUA 2KMDA 2AXRA 1YJJA 5BO4B 1U4AA 3UJSA 1T94A 1M6YA 4XQ8A 1D3ZA 3VHTC 2MRLA 5GMVA 4NM1A 3H8SA 3Q2AC 1BWCA 4Q8EA 1WSPA 2JX5A 4RPZA 2MBRA 2BWES 3UIOB 2CS4A 1WVFA 3LWMA 2BPCA 1OEYA 5CP2A 4ANVA 3DWGC 3RUIB 4MF8A 3URYA 4BBNF 2PVOD 1YN4A 3STPA 4LJXA 1Z3EB 1XDIA 2DYOA 3ZXRA 3SU8X 4YMNA 2VH1A 3RH5A 3C8YA 2XH0A 4IRDA 4GXBA 3V3WA 5KFOA 4F5RA 3EGRA 4KLUA 2BQRA 1MUCA 3GQCA 1C78A 3CXOA 3I6EA 4REZA 1AARA 3QFBA 3TI0A 3V6JA 2FI1A 5D4BA 3P4RB 1S0NA 1KJTA 4JL9A 3GP7A 5AKGA 2FIFA 4RMAA 1Q1WA 1WYWB 3QYPA 1XLPA 9ICOA 4C8MA 4DSJA 3QAQA 4GR1A 3PMLA 3QU2A 3D2JA 3Q8KA 1ZD4A 4EZ9A 3SN4A 4KWSA 3HM6X 4C8KA 3V5FA 2LHEA 3H0LB 1YMHE 4P4OA 3BYYB 4JQWC 4ENLA 4I2HA 2AYOB 5C2TB 1Z1BA 1WE6A 8ICUA 3TAQA 3UJ2A 4PT5A 1KEJA 7ICTA 2IPKD 2PKOA 4RNOA 4FHKA 2PS2A 3N9YC 3BQ7A 1ISNA 5J0SA 3ZTCA 1FFUA 5IO9A 2DHZA 1BUIC 4O5KA 2JK6A 1SL2A 4AOFA 5AUKA 2PW9A 4C4SA 2AXTU 5DB6A 2MBEA 3AECB 2GL5A 2MJDA 2ZZ0A 4M9LA 2QKQA 1E7VA 3PW0A 2HJ8A 2OPJA 3H7PB 3BYTB 5AKJA 2JHDA 2G07A 5CHWA 1WUEA 4GGHA 4HNLA 4IC9A 5L1JA 1J7AA 1NVID 1SJAA 2O56A 1L7YA 5L83A 4ELTA 1TYGB 2BS3B 4PWCA 4F2RA 4I2AA 3AU6A 3U4EG 4ZYSA 1FMAD 1V8CA 2AL3A 3BW7A 1MDLA 2GQWA 1ECWA 4N59A 4N58A 4ANWA 2P13A 1ZRMA 2W11A 4GIRA 3QXGA 1K52A 4XLOA 2W9BB 3TTEA 5KFLA 3UXOA 4YR2A 1N48A 1D5XC 1EU4A 3II4A 1Q3VA 1KFYB 5J2GA 2L76A 2KDFB 2WP9B 4EX6A 1S0VA 5MPOA 2MBQA 2V3PA 2JGAA 1DK2A 5DPWA 1I19A 2OEHA 5BOMA 3MDCA 4DS5A 3D2HA 1ET6A 5KG4A 1XWLA 3AU2A 1DYQA 3R8BA 1PFDA 3QUBA 8ICGA 3CSFA 1TK5A 3PREA 2NRZA 1ZQEA 4YSYB 2A3VA 3D2SA 2LD9A 4QZ8A 4DHJD 3RN9C 2XCPA 3TQ1A 3K75D 4QZCA 3SDLC 4H4WA 2Q0ZX 3TADC 3WIMA 3OJSA 2FDRA 1FCCC 3B97A 2BC0A 2GI9A 2PU1A 2P6RA 3BINA 4BCAA 9ICFA 2OX4A 3NUQA 3TBLD 4Z1YA 4F50A 1CZPA 5JCLA 2WOIA 2WB1C 2W54A 1JWUD 4W9GA 4E5TA 3N7RC 2POZA 4MM3B 4HCLA 1TAQA 4ED7A 3TANA 2WXHA 5JXVA 3MR6A 3RJHA 2MEKA 3P63A 4DS4A 3GZFA 4KLGA 2Z8LA 4U7CA 3ZTDA 5DBBA 4RQ4A 2O6VD 1IG6A 1EWYC 4K3BA 4OVVA 3DK9A 3R1ZA 2LVPA 1UGJA 3WU2U 1P3QU 4EQRA 3ALBA 3N3KB 1MI0A 4QIWF 3NZUA 3WAPA 1JXEA 5D49A 1ZQ1C 5J0UA 4IL6U 3G6XA 2NPTA 3PZDA 3VAWA 1RVKA 4IL2A 3V7KA 3TL5A 3SR6B 3TARA 2D3DA 1I4QA 3ZVVA 5KFJA 4DQRA 4J9PA 2PIAA 4KT2A 4WJ3B 3M63B 1YQZA 2VKQA 1NJWA 2YVCA 5EU9A 4JB3A 4WJOA 3W5UB 1XLOA 2BS2B 2BYVE 4CF5A 1TKGA 3LAEA 1ZQIA 2D07B 3TEWA 3Q8EA 1SB3B 2XVTA 2XI9A 3DGHA 1OQQA 1SE3A 2I1JA 4FLHA 3P0WA 2C5LC 4YWOA 3SN0A 2SAKA 5KVHA 3LWLA 2ZTCA 4KN7A 1KOTA 2K1FA 5L6GA 1FD6A 2V0GA 4R63A 3MFHA 4FHJA 4BOSC 3Q6JA 2AGPA 2TSSA 4K3CA 3H8HA 3R07C 3TWAA 3H0RB 3A0BU 1GSNA 2PP3A 3JS8A 5J0PA 2ZNVC 4KLHA 8ICNA 3NVWB 1ENFA 3PSIA 2ZTDA 2R61A 4AYBF 5JTIA 3LDAA 3QWZB 4ZRPA 2BYEA 4JE3B 4B9NA 5KFQA 2J6UA 2N9LA 2KE7A 4F4ZA 3PG6A 3OC4A 3BIID 1K53A 2KC2A 2OXOA 2KKVA 2NRWA 3I4KA 1NJZA 4URKA 1NNLA 3WK7A 2GH1A 5ALMA 4ELUA 3RJ8A 3W1SC 4B9KA 2Y3AA 3O0HA 3DWMA 4HYKA 4WJPA 2ZJAA 2LUMA 2DGZA 2MNRA 2JXXA 2IO1B 1SV4A 2L0FA 1ZK7A 4IM2A 3UJEA 4DWDA 3IJLA 4GRTA 4XE0A 1V1OA 4GYPA 2KTFA 4QAYA 5IILA 3ZDBA 3R2IA 3CAWA 4F4KA 1WYGA 2BKFA 2GDQA 1L3TA 1FHUA 4RQ1A 5KFEA 2IBIB 2W03A 4DSIA 2JWZA 2WXQA 2MBBB 2I0KA 1EWCA 3D9XA 4KZCA 3IG5A 2VFRA 3H12A 4P16A 2FMQA 4EZJA 4YWSA 3MGHA 3I1YA 1E9IA 4MSQB 1C4PA 3RR8A 3AE2B 4IQWA 2HHTA 3KJMA 3JPPA 4M47A 3ZJVA 3CGCA 3OG5A 1IUEA 3HVZA 1W1RA 4F4WA 2DENB 9ICWA 3AE4B 3RGTA 2C7MB 2KQSA 3VTWA 2PI4A 3RNGC 4RF1A 1N60C 1UA0A 3H1UA 5B5EU 5FXDA 2CJOA 2PSNA 1MC8A 1YN5A 4M00A 3VH4B 2VZKD 3T6CA 4FBTA 4X57B 5E6OA 3RBDA 1NKCA 4PZOA 3RH4A 1B4FA 3ZIMA 1GRHA 1ZQYA 1WG8A 4GSWA 5ALVA 4PZFA 4RF0A 2XK5B 2ZTEA 5IIKA 3H7PA 4ZRIA 3R0UA 1D8BA 1A0PA 5AM1A 1JX4A 2JUOA 3DK8A 9ICGA 3B2GA 4Y2XA 2LBOA 1KLGD 4M0WB 2KHQA 5ALZA 1QT9A 2M56B 1HZ5A 2J52A 2YTUA 3JZUA 4Z6FA 8ICZA 4AJWA 3L4PA 3RNMA 2M19A 5DQGA 1ZD3A 3U2SC 4P7IA 3MR5A 1A76A 4NLGA 4P0PB 2W9BA 1RM6B 2IY0B 2NMQA 2R8GA 3FXGA 4FZNA 1HUOA 1YQ3B 2PMZC 4UB8U 3ZDCA 4H4ZA 2YEPB 4EYIB 5FP0A 4RQ6A 2Y1IA 1V6EA 4YCXA 2JRHA 2VRRB 2DF4B 5KG2A 3DVGX 2KFZA 9ICRA 1E90A 1NYRA 4H2AA 2ZCBA 1TS2A 1GV4A 3MQTA 3RJKA 8ICCA 1KTQA 2LI6A 5ALOA 4Z6DA 3WK5A 2ASJA 2ZJ5A 1CMXB 3QJZA 1C3TA 2H3IA 3RNAC 3A7UA 2QVHA 2E8NA 3RT3B 3NO1A 3EYZA 4LTUA 2F1JA 3M9MB 4LVSA 2IGDA 3VVWB 4I2DA 5DLGA 2GBJA 2GRIA 4PYZA 5U1OA 5C1ZA 5KFTA 3A1QB 4H4SA 3FYHA 2DFLA 2UUVA 1NHQA 5AKIA 4O9MA 4MM3A 4DK5A 1VJ5A 5BOEA 1SWWA 1AROP 2EZZA 3Q3JA 1MQ3A 4KLDA 1F0ZA 1R4MB 3V7LA 4PYTA 1RDFA 5TR5A 1T3QC 2C2DA 4P4MA 2LFIA 2V3BA 5HR6A 2RDHA 3PLVA 3JW0X 2GWSA 3RJFA 1J7BA 1L0XB 3UQ2A 2FNJB 2RDJA 1KN0A 1VZ6A 2N7EA 4Y2JA 4QWAA 3RBEA 3M6KA 5H2FU 2VJ4A 1TVAA 2WXRA 3C0PA 1ZQDA 1QSYA 1E8ZA 5KFHA 2V3NA 4RNAA 3SN1A 3MJ5A 3MFGA 1P1AA 3Q3FA 3BVGA 5AKXA 2K89A 2P8BA 3PW4A 1HJPA 4BKTA 2NTSA 4II3B 3DFHA 2ICIA 5HNKA 1W1JA 2JXJA 1BVSA 4AP4C 4DDGD 3SHQA 4G9BA 4C4VA 3EANA 1NELA 4FFDA 3PSTA 3ZJUA 5DPRA 3E0FA 2L8JA 4KGTA 1RFKA 4ZYNA 3A9JB 1RG6A 4Y2YA 4R64A 1SBBB 3MGIA 9ICBA 3CXBA 1JMSA 1ZGUB 4RQ7A 2HOIA 1DGSA 4QW9A 2V9HA 1E5WA 2LGXA 3U8ZA 2BVCA 3TUOA 3P3BA 1JUDA 5BMIA 3S2AA 2PEAA 1V9PA 3GILA 2JH1A 2MUTB 2K4EA 4RUAA 4NJ6A 4C0ZA 2EELA 3RITA 1YZ6A 3AU4A 1QOAA 4E3CA 4YR3A 4NM2A 3U7ZA 4OZCA 3UI3A 3NVWA 1UWXA 3DHIC 3RULA 3KZXA 5L1LA 2CHRA 2HBMA 2JZBA 2NTTA 5DGBA 3NS1B 1NJXA 3PVXA 2E8PA 3OLMD 1S8OA 2Z0EB 4IT1A 4TURA 3MC9A 3QUQA 4A9AA 3JPQA 2W9CB 2WX1A 4NJ7A 4KMOB 5KT5A 2JF5A 1DIIA 2AGQA 4RGNA 1NYQA 4DDID 2OM6A 4HK2A 1WXMA 5J0XA 3QTPA 2K25A 3RNBC 3L8KA 4QJFB 2QB1A 5J0QA 1LV5A 5KFUA 3GIKA 1T0RC 4H83A 3R10A 1D8LA 4YR0A 2HDEA 2LJ5A 4DOBA 3LYSA 4PGXA 1T8EA 2BQUA 1FRDA 1OGWA 5DCNA 1WR6E 1T0SC 4Y2RA 1LFDA 4HXDA 2KLGA 3NG0A 4W9IA 3JPOA 2GMIC 2QCZA 3KHLA 5DLFA 1XO3A 2L52A 3QN3A 1FFVA 4H50A 3TSJA 4G0NB 4Q8FA 3M8SA 1JPMA 1ZQJA 1HUZA 4I2GA 1EF1A 2PFOA 1ZQPA 2LYAA 1Z19A 1UBQA 3ONSA 4YL8A 4JV0A 8ICSA 1ZQAA 4YD1A 3NZSA 1ZXIC 3GO2A 3UGVA 4NEVA 4CRXA 3WKEA 3KHRA 1JALA 5DBAA 4PHDA 3BSMA 4AQ7A 4RT2A 9ICIA 2UVUA 2RPVA 1ZD2P 4YN4A 7ICMA 3T5JA 3EF6A 1R4MI 5FS9A 4QZEA 3TCAA 4BKGA 5AK3A 3RB3A 1F1HA 1E7PB 2BGWA 5ALXA 1V1PB 2AWTA 2JZPA 1G6JA 4C00A 1UELA 1ZQCA 3LB8C 4HLEA 4KSLC 5I1VA 4BWMA 1RPLA 3AE5B 8ICIA 1NDAA 2JH7A 4ZH4A 1MA7A 1GRFA 5HMLA 2PGWA 9ICAA 5HHDG 3L5OA 2BTEA 5KAFU 2XK5A 1EUVB 4M52A 1VDVA 3VCCA 1KFDA 9ICVA 3N1ZC 2FKPA 3PY8A 7ICQA 1FXAA 4M0WA 1GREA 3QPEA 1F9JA 3TEYA 3IT6B 1YN3A 4KX6B 3G6VA 2FIDA 3PZ7A 3GE8C 2MU2A 1F52A 1J2MA 1NK0A 4TUQA 9ICCA 1RYSA 4GDKB 3MR3A 1KCZA 3DEQA 2MRPA 1X40A 2C2RA 4MJSB 3TOYA 1JIHA 1BXTA 3TFSA 1D8YA 4OVUA 4P0PA 4HPLB 1SGGA 2BB5A 1TS3A 1L6NA 3IJQA 9ICLA 3UIPB 4HRSA 4EFOA 3CGDA 5L1MA 2G1EA 2KQ4X 3SSZA 2SEBD 4QZHA 2LEKA 1AYFA 2OVLA 3T3FA 5ER0A 4TV3A 5AI5A 2OZ8A 1SXDA 3KOOA 3NRZA 2G5HB 5AKEA 5CEHA 1XNSA 1CEZA 2ZNVB 3HUIA 1ZJNA 3UF8A 2JEGA 3S5SA 4O1NA 1KRHA 4EELA 1EBGA 2Y0SC 2IBKA 2HVHA 2ZZCA 4ECUA 4BKSA 2Y5CA 3FKYA 2GGIA 3SAFA 4HCDA 1ZW7A 1N2XA 1ZE3D 1HSKA 3A1QA 3TKAA 2KC1A 5KFCA 5BPCA 4KLLA 3U52E 7ICOA 3OHBA 5IIJA 5HHHA 2BKEA 4CCHA 5J2BA 3I5JC 1IPGA 7ICUA 3CNHA 1L8LA 2MP2A 3EHVA 4FA6A 1CQVA 5KFRA 5HR7A 3SQPA 3C2MA 2W9MA 2PTYA 4PS3A 2CDUA 2KDEB 1RYRA 3QFAA 2LYHA 3R11A 3DFYA 4M6WB 4MDKE 1TS5A 3SFDB 4ACOA 4PVJA 3PM9A 2PFPA 3UM9A 4RNNA 4Z6CA 2UWQA 4M0AA 4E6MA 1YNTE 4NNJB 1TYTA 4MH8A 4CF3A 3MZNA 4W9FA 3T4WA 1HA5A 4EEWA 2ZXHA 1YEYA 3VC5A 4DF4A 4BOZB 3JW7A 4DQPA 5ALTA 5EOZA 3N30A 4XYCA 3BZKA 2HHXA 2FMSA 3B0AA 1D7YA 3FW8A 4KMUA 1GB1A 3VDZA 4D2KA 1MRAA 2GGJA 3PV8A 3KKAC 1EXNA 8ICQA 2BPSA 4ZRJA 5FKAC 3EEZA 2BPGA 3NVVB 2BPFA 5J17A 4GGBA 2XO7A 2W7OA 1RZTA 1RQLA 3LLBA 4UAWA 2R8HA 2DL0A 2ZG6A 1U48A 2ZCCA 4M01A 1LB2B 3KUCB 3HHMA 1SEBD 3C1YA 2INPE 3F53A 4KTQA 4HDOA 3H7IA 1V5OA 1XXGA 2MUTA 2RSUA 2OZTA 5CWRA 1J0GA 1ZQQA 3N1XC 4RNMA 1GAQB 3E2EA 3PR4A 2HZGA 1NI3A 2KO3A 3P42A 1C77A 1X6JA 2JXTA 3GV8B 3UQ0A 4K4GA 1WIAA 4BZAA 1I4GA 2KJ9A 3EPIA 3ENEA 3NS1A 3QU5A 3OZMA 1VZ8A 2JEJA 1RXWA 1V2YA 4DXFA 1L4DB 1P7EA 3GS2A 3VA8A 3PX0A 3JVZX 4UB6U 2D3GA 2H5XA 2W9CA 3MDAA 5C3JB 2G9HD 4WURA 8ICKA 3D2QA 4FDCB 4PS8A 5FR3A 3VTUA 4K1RB 1TYPA 3MTNB 3TCSA 2M0XA 1V59A 2Y3RA 3Q8FA 3ZVIA 4G3IA 2YEPF 2LI5A 5HMMA 1JWMD 3IT4B 4YG2A 1ZQVA 1JWSD 2KJ6A 3Q3OC 4HWIB 5J2HA 7ICRA 4J56A 1Q0WB 2K6DB 4OJ6A 1KM7A 4F4RA 4FE3A 5EWGA 4MF2A 4X2PA 1UT8A 3ZI4A 4DQIA 4KSKC 4RM8A 4LJPB 3BZDB 4GOCA 1WUFA 2GR2A 1BZLA 2XC9A 1IGCA 1P43A 4HPNA 2PLIA 1C4CA 1ZQZA 5JCMA 1QOGA 3CWIA 3TADA 3U7DA 2HD5B 4NXZA 2AQ3B 3Q3MC 1WI0A 3OJUA 1E8WA 2X38A 1AQ6A 1LM8B 2REXA 2ZIWB 1L3VA 4C7YA 7ICHA 1WY8A 2DYMA 4US9A 1ZD5A 5E6NA 1ZX9A 5JRBA 5HKHA 3C23A 3M6ZA 2K9XA 2IMWP 3WAOA 5JU5A 4UB4A 4DO9A 1KKXA 1KLUD 2JR5A 1L8PA 4HYRA 3KWLA 4YWGG 4I2IA 4DX3A 5KFIA 2BW2A 1L0YB 2G4DB 3S1FA 2B3AA 4O95A 4BX9C 3ABVB 2C3DA 2F77X 4BC7A 1EC9A 2RP5A 4ED0A 2WPEA 3ETLA 1R4NB 3RJIA 3EA6A 5IIIA 1E8YA 2E8OA 2MAXA 1OUQA 2V3SA 2JEIA 3APCA 1SKSA 2P66A 2N9EB 2GH5A 1PGBA 1HIWA 3N1YC 3OSNA 2CHZA 2RLTA 5KTQA 5J0WA 4KLOA 2N7JA 3EKGA 1MBBA 4PPXA 2KN5A 4TQ1A 2F8KA 1QLBB 1F0MA 2J0KA 1I4XA 3IHPC 3N6HA 4HG0A 4QZBA 2KNBA 2W3RA 5DG7A 1I4PA 2X8XX 4GDKA 4MJSA 2WXOA 4YT0B 4QW8A 5ALSA 2WXFA 2KV2A 3KD3A 1NK9A 5EWEA 4FJYA 3ES8A 3HILA 2FLNA 4GB9A 8ICOA 1SJDA 2EKEC 1H38A 3DBHB 1QLUA 5DBCA 4Y2QA 3FM9A 1TZOA 5ALHA 2INDC 1FO4A 4C4TA 5J2KA 2DW7A 4TUSA 3DV9A 4NLCA 2G5IB 1LO5D 4F8CB 5K4LA 3PZ8A 2KK0A 4NLBA 3QZ8A 4DXGA 5L95C 4NEWA 2NPXA 2BR0A 1N5WC 4NZLB 5FK9C 5C0YA 5IOIA 4HVBA 3ZLFA 3GOEA 1YX6B 2AH5A 4DSLA 3P4QB 3ENLA 2PTZA 3FJ4A 4M9JA 4J9KA 3FDSA 4JN8A 2XCAA 1OXJA 4UAYA 3W1SA 3TMPB 1RWSA 2Y9TA 2KMAA 5JHBA 2AU0A 4KX5A 2DZJA 2O2VB 3UQBA 2ISOA 1Z00B 4PL1A 2KHWB 3UXLA 2A8XA 1XS9D 2WAQF 2K22A 2QEJC 2W82A 3OJ3A 3SFEB 4IUMB 1UD7A 3SEBA 2W3SA 4M2YA 4XX5A 4G8TA 2QJNA 2WXGA 2NBUA 4MEXA 2OOBB 5ALNA 2HOQA 3A9KB 4M6WA 1UQVA 4DNSA 1MG8A 2BS4B 4H4VA 3GZNB 4GMVA 5FXEA 4P0QB 7ICVA 4C8LA 2ODGA 4F72A 4YXDB 1GXFA 2DPIA 2XBBC 2VJ5A 8ICTA 4HEA1 3ISBA 3E9SA 3RPFC 3PFRA 1WGRA 5KT4A 4ED1A 4ECTA 2JQRB 4EBCA 5ALWA 4RT3A 3QEAZ 2Q5WD 4KITB 4LZGA 1IYFA 3NVVA 3HIZA 2GR1A 4GLXA 4CE6A 5EE0A 1ZDXA 2P3HA 1N60A 2ASQA 4DL4A 2WX0A 4B9TA 1QSLA 4K4HA 2BWFA 1JEHA 5HHZA 4MT5A 4XGAB 2FCNA 2OKTA 1L7NA 1BMLC 3V60A 3CGBA 1TK0A 3RJEA 1SIJA 3DEEA 8ICFA 1YQ4B 4ZOHC 5AM0A 3OPXA 1E8HA 3ML9A 2L7RA 3KWVA 3PNCA 4JAYA 1XCTL 4LJOB 3R7QA 1X1MA 4PWBA 4DL5A 4IKGA 2HTHA 5F9NA 3NY5A 2ZPYA 4L2YA 3I28A 2M8SA 1NOMA 2UVVA 1MQ2A 1F44A 3V6HA 3I63C 3ZRCA 2OQHA 4USAA 2KJHB 5L6FA 5ALKA 1GRBA 2R8KA 4A3PA 4NL9C 3P4PB 3HRDD 4JB1A 2J42A 2IYDB 2JSVX 1Q8KA 4YSXB 4FX9A 3HKZF 5HHIA 2L83A 4Y2UA 5LXIB 1ZDVA 4GFJA 4PHAA 2XY7A 3ED5A 4IR1A 3BWUD 3P4SB 1DOIA 1FHVA 1D9FA 2OZ3A 4FULA 2AKMA 3UXKA 4B9LA 1V49A 2KDMA 5EDSA 3AI5A 2GOWA 1FIQA 3THVA 1XS2A 1SIFA 4Z6EA 3UJFA 3BK1A 4KLJA 3T5LA 2FBWB 2P3ZA 3GRSA 2KTRB 5D79A 3PW5A 4FZLA 3PHXB 4BBNC 1ECQA 1QCKA 2NRXA 1WMHB 3PT2B 1X2HA 4ICAA 3B0XA 2Q4TA 1GUAB 1OW5A 2ACZB 4ZDVA 3MR2A 2AL6A 4DFDA 3GD6A 4OCZA 2I1QA 4BAXA 1V81A 2ZIWA 3UJRA 4KLMA 2JPHA 3T5KA 3SQIA 2HTME 3K1ZA 3H40A 4QWBA 1EBDA 3TJIA 1T3QA 1X6IA 2E3TA 2ASLA 5E6JA 2VFTA 4J3OD 1NK6A 1HZ6A 2KACA 5TISU 4J9MA 5ADZA 4J1OA 4NLZA 3GZNI 2DQNB 2ZJDA 4NAWA 4BDPA 2BQ3A 2Y5PA 5J18A 4K8DA 2FPLA 2A1AA 1ZRNA 1WX8A 2V6OA 2HMXA 3DK4A 4DFMA 4C4VB 2DX5B 2XY5A 2W8LA 1Q1RA 4UAVA 3W8XA 2XH4A 4J03A 4JX1C 1N5XA 2WXLA 1C1YB 3WAMA 2AQ1B 3ZVHB 2A19A 3UXNA 4YXMA 4GXIA 2MA9B 2CU1A 4WWNA 1AW7A 2ON8A 3PX4A 2PLPA 5AI9A 4DQQA 3AE7B 4CHKA 1WXQA 3MHZA 3PV1A 3ZUNA 3WA0A 4RQ3A 3N32A 1KDHA 3OWEB 1E8FA 3KTQA 2DZMA 3AB5A 3W2DA 4IG7B 1QILA 2KFKB 3GDXA 4YSZB 2OJWA 1S97A 2VA3A 4I28A 1IGDA 4HNCA 1LPFA 5I1WA 3RB6A 3WCQA 3PSEB 3HJEA 4PGYA 1TBEA 4CYEA 1TZZA 1SZHA 4UBBA 1XLNA 2BGFA 5D7GA 9ICHA 1X66A 3VDGA 2MHJA 4Q2JA 2JZBB 5KFGA 5J2DA 1WGKA 1O03A 3V7JA 2E5AA 3MBYA 3H6NA 1M94A 2YMMA 1WGHA 2W55A 3TACB 3D47A 2P0IA 4UQGA 2K6QA 3B1LX 3DJJA 2WTFA 4ZCWA 5F3XB 5HP4A 2WHEA 4BKSD 2QDEA 4YD2A 3V6KA 2K8HA 5CA7A 3DDMA 3AXCA 3RRAA 3SAHA 2ZJ8A 5DB8A 1ONFA 8ICRA 3PZPA 3VQIA 9ICMA 4EKUA 1SV0C 3UCDA 4RFBA 1F8WA 2Z59B 2VAOA 4ITKA 1JWBD 3IAM1 2O2VA 4GLSC 4B9SA 2RDGA 1Z00A 1DXSA 2KSOB 4NJCA 4B6JA 2WXJA 1FPYA 4IM3A 1UH6A 4OD0A 3Q8AA 4TUUA 3OPSA 3S1CA 2D10A 2DAFA 5JZEB 3PO5A 2ONQA 1SKWA 2W04A 2H88B 2HXTA 3A9KA 3PPAA 3T3NA 4RPYA 1JCTA 4P0QA 4EQWA 7ICEA 4ARIA 4JUZA 2HDOA 3AV8A 4KLEA 4RH6A 1W1QA 1ZXIA 3BOXA 1B0XA 4QZDA 4NLNA 3VRBB 4X5VA 4WAAA 2NBWB 3DBRB 1COKA 2B6GA 4S17A 1IBXB 4J9OA 2M9NA 1TGZB 2H3ZA 3MY9A 3QKEA 5ALGA 4F93B 3T9PA 3VUXA 4TUPA 4JPSA 1QH9A 2BQQA 2YVGA 1F0XA 1C20A 2XH7A 5F9LA 8ICAA 4ICUA 4QIWC 3I57A 2KX3A 3ZXVA 1L3SA 2EQ9A 1ZQGA 4ED8A 4GXKA 4HROA 3LB8A 2EQ6A 1A77A 2C7NB 5JUMA 1ZQKA 3LADA 5AKYA 4KIKB 3AN1A 3AEAB 3RYTA 3DG7A 2BCRA 5KT2A 4HJKA 5CTRC 3QU9A 2WP6A 3OGUA 4LNFA 1M6IA 5T8IA 2D2QA 1YQBA 5J2CA 2R8IA 1DRGA 5FR6A 2RD0A 3RZWC 3TSSA 5ALLA 3C29A 4QZIA 3RJJA 1NDDA 2ZIVB 4DL2A 2G4SA 2KWDA 3TWBA 1W1KA 3PK7A 2EQYA 1STEA 1EF5A 4UB3A 3BQ2A 2P88A 4XUSA 1K51A 4BC9A 4H4TA 2K60A 2E8MA 1K8RB 5IIOA 3DCGA 4YTMB 2J3NA 2L00B 3KYDD 4H4QA 5KL1B 1WXAA 4PGQA 2ALZA 4GN1A 5BYSA 4Q44A 4AYBC 3B0YA 1VZ7A 3UMCA 3PRPB 2J6TA 3HM3A 2ZPNA 3NRZB 5AI0A 3S1EA 2QAEA 4OJOA 2XNAC 4IDIA 2JU6X 1P7DA 3S6JA 2WFAA 4M02A 5JRTA 4H19A 2WHIA 4O3PA 4KGRA 3LJ3A 4XC2A 4F2SA 1BNPA 3S47A 1L8OA 1EM7A 2KTRA 1L5UA 3C19A 2KWUB 1WMHA 1ZQWA 1T3NA 5DG8A 4KEMA 5ENLA 4I2FA 1MOKA 3H4KA 2YY6A 1E6EB 3DEDA 1MPEA 5KG3A 3RCZA 4B9VA 1AHUA 5AIBA 2FCMA 1FNVA 1UUPA 1XEEA 2DKXA 5K8EA 2ZVNA 2K39A 3H8MA 4I2BA 4IR9A 2MP2B 4ASWC 9ICJA 3VR8B 2ZUBA 2QGYA 4BWJA 2CHWA 2WXNA 4IC7B 3NVZA 4GIVA 2GBMA 2H3FA 4MGGA 1WCNA 2DAJA 2M17A 2NCNA 5TZVA 5I4DA 2KXJA 1X9XA 2LUEA 2WXKA 3Q4DA 2BVHA 1GC7A 4ZRKA 4CO7A 2QARB 3N7PD 4LNOA 2KP7A 1JRPA 3G6YA 4NQKE 2EMSA 1XSNA 3ZQ4A 2GGEA 1IM4A 1S3SG 2LKYA 2F2AB 2KKPA 2Y1JA 1ZQSA 3DDCB 3KUDB 2KKCA 2BC1A 3I99A 2F8LA 3H70A 4IP5A 1URJA 5IAAC 1KTKA 3QA8A 2KYWA 2OCEA 3ZVHA 4ANXA 2QHOA 3AMZA 2D3BA 2M0AA 4HCPB 3IRUA 1ET9A 1L3UA 3AE3B 2AAQA 5AE2A 3KKAA 1U49A 1V5TA 1T0YA 1L4ZB 2XY6A 2KTQA 3QQ8B 2RABA 7ICSA 3DBSA 3LXFA 4MGZE 3CRXA 1BPZA 2KFKA 3ZLZA 4FN2A 1QQRA 4DWFA 4BV6A 1SL0A 2D3AA 4U6PA 3AEBB 3J9CA 5C23A 1W1LA 1QZEA 4CDGA 1S0MA 1XHCA 3AE8B 3U30A 2RGFA 4PYUA 3HPFA 4ZOHB 1DIQA 4DHZB 3BS7A 3PRZA 4AWJA 2IA6A 2KJRA 3QEBZ 2BHNA 4FBJB 2RPQA 1PVQA 4HAIA 5FJOA 2OHFA 4RUCA 1L6UA 4IW0A 2OO6A 2HJ1A 5TR3A 2Z7JA 2YVFA 3N6JA 2H3QA 5IIMA 3FILB 3I6TA 5JHAA 4NY0A 3L17A 5KG7A 4WWOA 1GOZA 1N63C 1STZA 1ZMCA 2OFJA 2YN4A 2QDDA 5CRXA 1P0RA 5AKHA 5KFZA 1UF0A 2MLBA 2GLEA 1WE7A 2LGDA 3W1YA 4F71A 1B9RA 4KX3A 1LVLA 4F5OA 3Q8SB 1SE4A 2LXAA 2VA2A 2KSOA 4M9HA 4ICVA 4LLGM 2OG9A 3HWTA 1PUTA 1RRBA 3Q8RB 4JV1A 4HKZE 1EU3A 1FXIA 2KX0A 4RGTA 3RRGA 1HEZE 2CJNA 3APDA 1XF5L 1U9LA 3JPSA 2HQMA 3HW2A 2PTWA 3KFUF 5AWVA 2IO2B 4H4PA 3HX0A 2NO4A 4Y2TA 3APFA 3AM9A 2WF6A 3ETRA 2V4RA 1ZQTA 5BMHA 2M1MA 4B9UA 3LK9A 4EEKA 5G55A 3K1RB 3KH0A 4K7ZA 4IQVA 2INNE 1ZQMA 2IDYA 2RDIA 4WQMA 2PA6A 2FPKA 5AM3A 2K8CB 1V9JA 1YJIA 1LVHA 1RYJA 8ICPA 1IBXA 1PK1B 1PDYA 5FJTA 2IHNA 4EYHB 1Y88A 3P2BA 2W7PA 3IC9A 1HE8A 2PFNA 3CYJA 1ZQLA 4O3SA 3GIJA 3H4DA 4UATA 1ZQHA 2FLLA 3QARA 5DB7A 2ASDA 4NAMA 1QF6A 4ECRA 2QIEB 4P1CC 1PK3A 2MA1A 4QZAA 5J2AA 3MJWA 1FXTB 1LKYA 2M4NA 4EMIA 4J9NA 2K8AA 2Y08A 3HVDA 4EM3A 2NBVB 4KIKA 2A5UA 2J4XA 5AZFA 1W6TA 4MHVA 2HXUA 4RQNA 2ES6A 3TFRA 2WNMA 3T8QA 5ALUA 5KG6A 2H3VA 4JQ9A 8ICWA 2WP5A 1CJEA 5KFAA 3JPTA 4ECWA 2O6VA 2ZIVA 5AI6A 2PTLA 1BPEA 5KT3A 4PJ0U 1L7MA 4F5QA 4JK1A 5GTHU 1WXSA 4ZRQA 1JW9D 2UVWA 4W9KA 3AEDB 5KFXA 4EQXA 5ALRA 5CJ7A 1GJZA 3THUA 2VH2A 3RF9A 3MP9A 3C2LA 4ECZA 4R8UB 1VRAB 2ZIUB 1FEHA 4MACA 2JYTA 1H6VA 3EUB3 1ZPSA 1ROEA 4MELA 4I6NB 2N1RA 1B43A 4OALA 3V61A 3NUHB 4GXJA 5FMHA 4L23A 1XSLA 1D4BA 1KBUA 5AUIA 1E9MA 4LCDE 4B6WA 3Q8QB 2P6UA 2TPRA 2K8BB 2ZZBA 3BK2A 3NVYB 3D2DA 3KQ4A 1OTRB 3K1GA 5JCNA 1DK3A 4OO1J 5FS8A 3QX1A 5U25A 2XIDA 1N5WA 2P35A 3LYYA 3NZ3A 1ZR6A 3W8WA 3IBEA 2I38A 4GGQA 2EH9A 1NU5A 4GFIA 3TX1A 5DKWA 2XGPA 4RM9A 1WGGA 4KLFA 2IJ0A 2NO5A 3L10B 2ZW0A 4HN8A 3TW9A 3V4BA 4LA1A 8ICEA 3W5VB 3OZYA 2CXYA 3IHQB 2IGGA 3NJTA 4F4YA 3SD5A 1E0ZA 3ES7A 2PPHA 3PO4A 2FPMA 3FC4A 2I5HA 1ZKHA 3PGEA 1Z2MA 3A7AA 4XRHA 3Q45A 1N6ZA 1WGYA 3GD4A 1C79A 2FUG1 5DQHA 5KFPA 3GIIA 4PZNA 4W9DA 2R2OA 2LGIA 2N9PC 2OLAA 4DF8A 2PKEA 1VLBA 3CW2C 3V6CB 1TS4A 4WWPA 5J2RA 2QARA 5DDMA 2W8KA 7ICFA 1QOBA 2MJ3A 3UCCA 1AHVA 2DLBA 3VTVA 3JYUA 4BGDA 1NHSA 2W9NA 1IIPA 4IS7A 1B22A 4P2HA 1DGJA 4DWIA 1XCQL 4A55A 4FADA 3VUWA 4Y2VA 1V85A 3WK6A 1ZP0B 5DG9A 5IDZA 5KFKA 4B0MA 2XH2A 2OAIA 2OEDA 4YTPB 5KFFA 3I9V1 4US8A 4BXOA 2PLSA 4E8GA 2PTXA 2WGSA 4DN1A 2HHSA 5D3DA 2L5YA 1MDRA 3VC6A 2FUHB 4BJQA 4ADWA 3GU3A 2HBKA 4Y2PA 1ED1A 3HT3A 2EZXA 2AGOA 3NRWA 3RNFC 1BPDA 2KIWA 3SMVA 4IOIE 5HFYA 1SE2A 1L6VA 2BKRB 1NK5A 3M9NB 4G50A 3C1ZA 3K9OB 1YJ1A 3L08A 3NGDA 3ZLGA 4EQSA 3Q14C 1ZQBA 2G3QB 4ECSA 1SB3C 3CSTA 3T79A 2HHQA 1MHXA 2ATLA 3J81j 2A4ZA 1U45A 2JVCA 3QE9Y 4XDCA 1WJ4A 1OEPA 3DJGX 3FW7A 1KQQA 1TTNA 3FILA 5KFDA 3DERA 5D94A 3UXPA 3H7SA 2W0HA 2ZXIA 3ZNZB 4NL9A 4BURA 4QNLA 3WK4A 2DPJA 2I9GA 3WANA 3GRTA 2ZUDA 4DSFA 4B9MA 4IWPA 3RJGA 1SSNA 3UMGA 4HCHA 3IAS1 2Q4WA 2LPEA 1DZNA 2RRDA 2L1AA 4XWTA 5AM4A 1D9DA 3T5HA 3AH7A 4J9LA 1FIQB 9ICUA 9ICSA 5FJRA 3A0HU 4FJZA 5G5GA 4UB2A 1C7YA 4G7FA 2UUUA 3ZD8A 2CR5A 2PMVA 4NV0A 1E0YA 1FECA 2J7QB 3KBBA 3IN5A 2KZMA 1DTNA 3VUYA 2B76B 2V4LA 2D11A 2EAOA 5KFYA 5EE9A 4PS7A 2WPCA 1XC9A 2QSDA 5IP4D 4ECYA 3PMNA 4Y2SA 1RYUA 5ALEA 2K8CA 2WXIA 1WJUA 2ONEA 2PP1A 3OTRA 4E0DA 1KLVA 1PK1A 2FCSA 3GC2A 3VXWA 1CK1A 4JN7A 4DYEA 3VFKA 1IP9A 2LXCA 1SWVA 4J9RA 2ZC8A 3DPDA 1YIWA 3BZCA 5BMGA 1I35A 1GO3F 2MQJA 4JLCA 4NAWB 5J2JA 2R8JA 1VAOA 4DQOC 2ZUCA 3Q8MA 4J9SA 3RAXA 4CNQA 3FWAA 3QX7A 5EE3A 4MKSA 3DQ0A 4WJNA 3DBLB 2NVKX 4ED2A 4HJGE 2LVOA 5CHFA 3ZGZA 3VTEA 2W9AA 4PK1A 3SZ2A 4YXJA 4MFAA 8ICJA 2LRWA 4EZ6A 4KLTA 5GXGB 2GOLA 5AM5A 3GFKB 3B08A 3M62B 4C56C 4FJVB 5E6PA 2BVGA 4HCNB 1JRUA 4RU9A 3TAPA 3F5AA 1MFWA 1WZ3A 4ML8A 5KG0A 1JPDX 1WRIA 1Q3UA 1GG3A 2WYQA 4WWMA 1Z4NA 2V4QA 3M8RA 2VIXA 1PQSA 5IA7A 1VQZA 1I42A 4R8UA 2HW3A 3OJ4B 1F5SA 2ZIUA 2B0CA 1ZQNA 2YQUA 1LGRA 4R65A 1TIFA 3M3JA 5ALIA 1DXLA 2OYYA 5AK4A 4UW9A 1KLNA 2IOFK 2AJQA 1T5XD 4F1SA 3H8JA 1QLNA 1J19A 5IN7A 2EAMA 5LXHA 2PP0A 2KICA 1LXDA 4C8OA 4OJLA 4LDTD 3R0KA 3Q3NC 4JWUC 1OFFA 3A4SC 3KUZA 3JPNA 5AEKB 3W8ZA 3MFIA 1MG4A 1SZPA 3NVYA 2K8BA 3OHAA 2FAZA 2MJEA 1GRGA 1YD8U 1DOXA 1SJED 3RTVA 4II2B 1OJTA 4PL2A 1GNUA 2DKZA 3NFUA 1WUDA 3RJAA 3CIRB 1L2NA 4IM0A 5KFBA 2DWQA 5EWFA 2C22A 1J7CA 2GSHA 1K4QA 1HQRD 4EBDA 3IXSA 3ICXA 4RGOS 4QWEA 4GC6A 1C4AA 2WLBA 4IWQA 3SENA 1SV0A 4EENA 4KDLB 3ZDEA 3O0FA 5BYQA 1TE6A 7ICNA 3PWIA 2KG5A 1JQ4A 2CKHB 7ENLA 7ICKA 4C7ZA 5CHVC 1IV8A 2M0NA 1GC6A 2VFUA 1NHPA 3ZLHA 4NLKA 1P48A 3ECIA 3KVFB 2KZ3A 4UAUA 1GETA 2GGGA 2PE9A 1KH0A 2X50A 1R7SA 4EC3A 4AJYB 5J04A 6ENLA 2KHVA 1WH3A 3H9DA 1PUZA 1X9WA 3AUOA 1KFTA 2I1KA 1FCLA 1MNSA 4DXAB 4NJ8A 1KF6B 2WDTB 1TK8A 3U4FA 2G09A 2O6KA 2WB1F 4M04A 4H2HA 2GQUA 2E1FA 1EBHA 2PU0A 5KFMA 4KKJA 3ZYYX 4DBGA 1IYXA 1DOYA 2NV3A 2AL2B 1BPXA 4KZ0A 3BQ1A 2BYTA 1OQRA 4RQMA 4K1WA 4PHEA 4UBCA 5JCIA 4KLIA 4MFCA 5J8YC 4YMOA 1NJYA 4MMWA 1ESFA 2GR3A 1R4NI 3RI7C 3T9LA 1YX5B 4L1BA 4LNKA 1N61C 2A1JB 3GE3C 3AE6B 2L32A 2MSNA 4EBEA 3EZ5A 3ALRA 1XSPA 2LYBA 2BB6A 2XGQA 2C2EA 2JEFA 3DBLI 3DH9A 2QQ6A 4CF4A 5KAIU 2L05A 3A33B 2J53A 4WH4A 1F3PA 2KMCA 2OWOA 2PPGA 1ELSA 1NPXA 1K50A 3RR7A 5G2NA 1V97A 4YQWA 2KT7A 1WWUA 5DPSA 5FJPA 4F3OA 3PVLA 1SJBA 2CFYA 3E56A 4I6PA 2F5ZA 5IKCM 2P8CA 3C28A 4F5PA 3MGVA 3AULA 3DVNU 2QB0B 4E74A 1EO6A 2VFVA 2EANA 4O5EA 5H92C 3EW9A 4CGZA 1PDZA 4F5NA 3DBHI 4LDTB 3Q69A 2FLPA 4YTNB 5D2MB 2QDFA 4DLEA 3AE1B 3R9KA 4LNIA 1HTQA 1JOAA 1WX7A 2RMMA 1NZPA 3C5FA 3WK9A 2RHFA 3I76A 2G0AA 4O3OA 4IRKA 2PVGC 4LK0M 1MN8A 1DOQA 3U9IA 2YAUA 3WALA 3AL0B 3NTUA 4F8RA 2VFSA 1QSSA 3AEFB 2WAQC 3LVVA 1NBFC 2Y4GA 3RNCC 1SJCA 5J2FA 4RQ8A 1F2RC 2DZKA 3SV4A 3DVNV 3R3MA 4G3XB 3CP8A 4XZ4A 1UXYA 2WU2B 3NVZB 4ECVA 2MWSB 1TAUA 3ZDTA 2BVFA 4R66A 4M9NA 4JV2A 4EWJA 1RAXA 3P1MA 3CGEA 3WKCA 1TKYA 2EKIA 2IZVB 2KMMA 4Z17A 3PWGA 4N6EB 1Q46A 3OSPA 4LIIA 4UAZA 2C7HA 3X23A 3UPQA 8ICVA 3PSFA 5J0OA 1T0QC 2WF5A 1AN8A 4TQ0A 2DW6A 3MWCA 4HPPA 2E1EA 4EMWA 2WDWA 2J0MA 3PTFC 2HHUA 3GV7B 2AX5A 3DIPA 2MSED 2KK8A 5AI8A 1S0OA 1HTOA 4JIOU 1N62C 1RQNA 1SXEA 3F2CA 1FEAA 4K8GA 2AQ4A 1XQQA 4DL6A 1Y8RC 3RFZB 3SAGA 3ORYA 4TVYA 4DHZE 1D5ZC 3UQAA 1ZY8A 4EEYA 2K4IA 1P7FA 4M6UA 2LMRA 2WF9A 4FZMA 3HW8A 3RB0A 2LGYA 4I2EA 2WOWA 2X8GA 5ALPA 2KDIA 2B21A 3BQ0A 2KZZA 2MBOA 4OW0A 2AL1A 2KAJA 2PMQA 3RZFA 4C80A 2KLCA 1KKOA 3QHTA 1XPYA 1OEYJ 4I2CA 1HEKA 1W1OA 4QZ9A 1D5MC 1WWTA 2L3ZA 3LDZE 3TJPA 3KUMA 2WXMA 5DDYA 4DCCA 3N97B 1SF0A 2JYEA 1BQGA 2K0PA 5ALYA 3JPRA 2LASA 4RQ2A 2ZVOA 3GSYA 3DDHA 1F77A 4LZDA 3MHSD 1BPYA 3IDWA 4CQNA 1JDFA 8ICHA 4H1ZA 4DOAA 3SD7A 1JROA 2FE9A 5KFVA 5D46A 1V86A 4UB1A 3CYMA 3HKZC 3PW2A 3RH6A 2E6XA 1ZQUA 5DPTA 1E10A 2R9ZA 3R66C 3T3OA 2IY1B 3ZO5B 1N63A 3KYCD 2KEYA 4IL0A 1QQ7A 9ICKA 1UHUA 3MC0B 1WGDA 1TT5B 2PE6B 3JSVB 2PGEA 5JH5C 2PMZF 2BCVA 2CHXA 2FCQA 2KNJA 4ECXA 1L5PA 4UDUC 3UGBB 5KVIA 2F3NA 1NKEA 1PVRA 4OZAA 1SJHD 3CMMB 2QKNA 4DFPA 2LVQA 1TE2A 4NY8A 1QTMA 3DG6A 4YP3A 3DG3A 3E58A 1SL1A 2R2ZA 1EC8A 3ETRB 8ICMA 3ZJTA 3FYYA 4ANUA 2RDBC 2HHWA 1HXYD 2NYVA 4B0EA 1KD0A 3QCAA 3EC8A 3RFAA 4QZGA 1C76A 4K7UA 5E79U 4FS2A 1GRAA 1SE9A 2ZIXB 4GMEA 4OZBA 2Z0DB 4DHJB 2AL2A 4UB5A 3KHGA 9ICXA 1XANA 1TKKA 3HSUA 4GIBA 3R25A 3RCYA 7ICJA 1AHZA 2DNFA 4BUGA 4P1BC 1K5OA 1LKYB 2JZZA 3V05A 3TEZA 2KJ8A 2BDPA 3FVDA 3CT2A 2N7DA 2RR9A 3T8MA 4YFKA 2KVZA 1FM0D 1ZXHA 4LNNA 2IOHA 4EZLA 3QIJA 3LXDA 2A1JA 3AEVA 4W9EA 4DL7A 1JXLA 1I4HA 2MX2A 2J0JA 4GDLB 3N4EA 2YB4A 2HE7A 3B9JB 2UYZB 3EFCA 4ED6A 4DSEA 1S76D 1D6EC 2O6VB 3L16A 4JWSC 3IFWB 5AZGA 2MH7A 2YMLA 3V62A 1FFUC 2GQTA 3SYZA 1DNCA 5KFSA 3POPA 3AQEA 4I6LB 1RXVA 1Q1OA 2F76X 2N9KA 1WWVA 1XU4A 4TKNA 3TEXA 3IP4B 3VCBA 5LNK1 3MABA 5KL8B 4A8EA 1ZUD2 2UU7A 3A4RA 3QLDA 3A7RA 4F91B 3DOWA 3GY1A 4M8NA 4UASA 1F9CA 4A6GA 1TKEA 4JWNA 3WKDA 1XO1A 3BS5B 3V6EB 4I29A 2QB0A 1COOA 3RAQA 2F44A 2VANA 2HVIA 2KOBA 2BF8B 2CPRA 1GESA 1TAMA 1BT0A 3L3FX 3V72A 3M1YA 2GBRA 1GB4A 1TV9A 4W9CA 1T6BX 4TQSA 1W1MA 1MJDA 3I3TB 1GPXA 2L0TA 2X8CA 4AS1A 2HOFA 5AK5A 3U26A 2KVCA 2LHDA 1WXVA 3Q8PB 4DQSA 3ZDDA 1YZ7A 5HQXA 2WBAA 3BY4B 4HDQA 4IQUA 1ZQFA 2R2QA 4YMMA 2UVRA 2NRVA 1Q10A 3ZDMC 3M7DA 4S0RA 2LJIA 4RZRA 2FMPA 8ICYA 3AEEB 4MGIE 4IP4A 1YT3A 2AKZA 1O08A 1JI7A 2F1IA 4FS1A 7ICPA 2IPIA 4JHMA 1BGXT 3F5EA 3VH3B 2QILA 2YLMA 3BQTA 3NASA 2BDUA 4Q45A 2KD1A 1E8XA 9ICPA 3UINB 4RPXA 1ZJMA 2YVJA 2G08A 4FI4A 3TJ4A 4RCOA 3RR1A 1SGHA 1IXRA 4N9F4 3DVGY 1OQYA 1BPBA 3Q8CA 3OW1A 2KOXA 1L7PA 3WK8A 3BDPA 4BFRA 4H4XA 3SI8A 1KRPA 1I7HA 2EDUA 3ZD9A 3DBRI 4ARCA 1LQBA 4ECQA 3BJSA 2KN7A 5KG5A 4NWIA 4MEMA 2WPFA 3QU4A 4OHJA 2DUYA 4NPNA 2GBNA 3RMKC 1ACCA 4ZHOA 3AEGB 2X8HA 3IG8A 4BXOB 4QWDA 3QZ7A 4J57A 2N9XA 2QLTA 1WCLA 2AQ0A 5AIAA 2WF8A 5EBKA 3DHGC 4O3NA 3H7VA 4MH0E 1X42A 7ICGA 1UPHA 7ICIA 2OJRA 2KVSA 3SR6A 1WF9A 5J0TA 2Y3SA 1MHHE 2WDQB 4AP9A 4O3RA 2HNEA 3HPOA 3N20C 4EMJA 3F2BA 1TJEA 4KDIC 2KDBA 3GD3A 1P9DU 2JZ3B 5ALDA 2IHMA 2DYBA 4K7WA 4XWWA 1H2IA 1BNOA 1KL9A 1TY2A 2VZKB 4DNAA 4IZGA 5ALJA 2EZYA 3GB1A 2CRXA 5TSSA 5KFWA 4A3RA 4MLAA 5ALQA 3SJNA 3NOBA 4Q43A 2HBJA 5AM2A 2Y5BB 1NHRA 3URHA 3IVFA 2BCUA 2X99A 4FXCA 4W9LA 2K4PA 3C0RB 5FXPA 1UNSA 8ICLA 7ICLA 3C2KA 3JSVA 4R3DA 1E8GA 1CI4A 4M9GA 2QJJA 1S9FA 4DHGA 3QNMA 2V1YA 4ZA0A 3DQVA 3EFUA 4QZFA 5CB1A 3DHHC 5KT7A 1WFYA 2O3GA 3VRAB 2C9WB 2OQYA 4O0IA 1QKZA 2FYMA 1PGAA 4BBYA 4PVKA 2LWPA 5G5GB 1CUKA 5AE3A 4DFKA 1S10A 1PVPA 2D3CA 4TQRA 2F1HA 3TIXA 2C28A
chains in the Genus database with same CATH topology
5HHZA 2I0KA 1EWCA 4MT5A 2FE8A 2VFRA 1BMLC 4P16A 1SIJA 1YQ4B 4ZOHC 1C4PA 3AE2B 3KJMA 1SSNA 1E8HA 4JAYA 3IAS1 3KWVA 2Q4WA 1XCTL 3ZJVA 1DZNA 4PWBA 2L1AA 4IKGA 1IUEA 3HVZA 4XWTA 1W1RA 2YVSA 3AE4B 4L2YA 3AH7A 1FIQB 1N60C 4RF1A 2P4PA 5G5GA 5FXDA 2CJOA 2UUUA 1YN5A 4USAA 4EE2A 5L6FA 2VZKD 2PMVA 1E0YA 1JWAD 3P4PB 3HRDD 4ZHPA 4JB1A 2J42A 4PZFA 2JSVX 4RF0A 4YSXB 1PDXA 2B76B 4WIPA 1M4VA 1NEKB 2L83A 5EE9A 1WVEA 2QSDA 3B2GA 1A70A 2WDVB 1ZDVA 2WS3B 3B9JA 4TMAB 1KLGD 3BWUD 2WXIA 3P4SB 2QJLA 3O13A 1DOIA 5HG2A 1QT9A 2M56B 1HZ5A 2J52A 2KDMA 3PQBA 1CK1A 1FIQA 2QMTA 3L4PA 5AE1A 3BK1A 1PGXA 2M19A 2AQ2B 1UWMA 2FBWB 5BMGA 3U2SC 5G5HB 5D79A 2N0SB 4NAWB 2GB1A 1RM6B 1X2HA 2NMQA 1VAOA 4OVZA 1SXTA 4DQOC 1FNUA 2ACZB 1YQ3B 3FWAA 1MBTA 2YEPB 5EE3A 3DQ0A 5EE1A 1NYRA 4H2AA 5HI1A 4HJGE 1TS2A 3ZGZA 3VTEA 2HTME 1XLQA 2JWUA 1E0ZA 5GXGB 1T3QA 4C56C 2E3TA 3A7UA 5E6JA 2BVGA 4J3OD 2VFTA 1HZ6A 2KACA 4LTUA 5ADZA 2IGDA 1WRIA 2GRIA 3W9CB 2Y5PA 1JMLA 4WWMA 1VQZA 4RGMA 4HKQA 2UUVA 1W1SA 1FNWA 2K3UA 1T5XD 3W8XA 1F0ZA 4XDDA 4JX1C 4PYTA 1N5XA 2WXLA 1T3QC 3KLSX 2RK5A 1B1ZA 4JWUC 1OFFA 2AQ1B 2LFIA 4P6VF 2RDHA 3W8ZA 3NVYA 1AW7A 1J7BA 2MJEA 1L0XB 2ON8A 2PLPA 1VZ6A 1DOXA 1SJED 3AE7B 1WXQA 3MHZA 2NQWA 2EXRA 5HMRA 1L0VB 2WXRA 1X2GA 3C0PA 2V3NA 4RNAA 3RJAA 3CIRB 1Y56A 3OWEB 1E8FA 3MJ5A 2DWQA 3AB5A 3MFGA 3W2DA 1J7CA 1QILA 4PVEA 1TY0A 3BVGA 1HQRD 4YSZB 1IGDA 5I1WA 2H89B 3IXSA 4RGOS 2NTSA 3WCQA 2ICIA 1W1JA 1C4AA 2WLBA 2WQYB 3V3XA 3S1DA 1XLNA 5BYQA 3ZJUA 1FRRA 5D7GA 1JQ4A 4KGTA 1RFKA 4Q2JA 4C7ZA 1SBBB 1WGKA 2WDRB 1F2RI 5FXFA 2E5AA 2VFUA 2W55A 1MVKA 3TUOA 1KH0A 4EC3A 1R7SA 4A90A 5BMIA 1FCLA 3VQIA 2WU5B 2EELA 4RFBA 4TSSA 2VAOA 1N61A 1QOAA 1KF6B 4ITKA 1JWBD 3IAM1 4GLSC 4OZCA 1VR9A 3U7ZA 2RDGA 3NVWA 3UI3A 2GQUA 1UWXA 4NJCA 4KKIA 2WXJA 3AE9B 4KKJA 3Q8AA 3ZYYX 3S1CA 2NTTA 3NS1B 1DOYA 5H8YE 2BYTA 1OQRA 2ONQA 2H88B 4A9AA 3T3NA 1DIIA 4RGNA 1NYQA 1ESFA 4ARIA 1NENB 2K5PA 4L1BA 1N61C 3AV8A 4RH6A 1W1QA 1ZXIA 3AE6B 3VRBB 2L32A 1QOFA 2HDEA 2BB6A 1FRDA 1IBXB 2CU3A 2J53A 4WH4A 1F0XA 4JPSA 3HRDC 3EUB2 1K50A 1XO3A 2L52A 3I57A 1FFVA 1V97A 3TSJA 4A8XC 3FAHA 2DBYA 4PVHA 4HROA 1ZXIC 3E56A 4ML8A 4A6QA 3AN1A 1JCKB 3AEAB 2VFVA 5H92C 1JALA 2WXPA 5T8IA 3Q69A 4AQ7A 3TSHA 2RPVA 4YTNB 1AWDA 3AE1B 3TSSA 2RMMA 2ZW1A 1V1PB 1E7PB 2JZPA 2KWDA 1FFVC 4TVWA 2LMCA 1W1KA 1STEA 3B2FA 3LB8C 5BYRA 5I1VA 3BVZA 3AE5B 1K51A 1VJKA 2PVGC 4UD8A 4BC9A 2KN4A 4LK0M 2BBCA 4YTMB 2V4IB 5HHDG 1C9FA 2Q85A 2BTEA 3FW9A 3AEFB 1VDVA 5BYSA 2Y4GA 1FXAA 1VZ7A 1F2RC 4M0WA 3TEYA 3IT6B 3NRZB 1UXYA 1N62A 2WU2B 3NVZB 3S1EA 1YN3A 2XNAC 4IDIA 4KX6B 2JU6X 2BVFA 1V1PA 2D5GA 3PZ7A 3P1MA 1PYWD 1TKYA 2EKIA 4GDKB 2KMMA 4KGRA 4N6EB 5G5HA 1BXTA 1EM7A 4TQ0A 1AN8A 4WAFA 1TS3A 4HRSA 2R8DA 1E6EB 3DEDA 1MPEA 2WDWA 2G1EA 2KQ4X 2SEBD 1AHUA 2AX5A 2LEKA 1FNVA 1AYFA 1UUPA 1XEEA 3R2TA 1N62C 5K8EA 3VR8B 3Q8BA 2WXNA 3NRZA 3HUIA 3RFZB 3NVZA 4TVYA 3VR9B 1D5ZC 1KRHA 4O1NA 3PO0A 5I4DA 1P7FA 1I4RA 2WXKA 2Y5CA 1RM6C 2BVHA 1JRPA 3BVMA 2I2YA 1ZE3D 1ZOYB 1HSKA 4OW0A 2KAJA 3ZQ4A 2BT6A 3U52E 4C80A 4KGSA 3I99A 2QPMA 2XN9C 5D3IB 1W1OA 1D5MC 1WWTA 1QLTA 2WXMA 1KTKA 1CQVA 1SF0A 2IGHA 2JYEA 2K0PA 3GSYA 2AXRA 1YJJA 1F77A 3AMZA 2M0AA 4CQNA 3SFDB 1ET9A 1TS5A 4PVJA 3AE3B 5AE2A 3PM9A 1JROA 1L4ZB 1E10A 1WSPA 1YNTE 2E6XA 2JX5A 2MBRA 1WVFA 4MH8A 3LXFA 1HA5A 3DWGC 3T3OA 3URYA 1N63A 1YN4A 2PVOD 1QQRA 3MC0B 2DYOA 1W1LA 3J9CA 3AEBB 3C8YA 3FW8A 3AE8B 4ZOHB 1DIQA 1GB1A 4D2KA 3EGRA 4UDUC 1L5PA 1C78A 4REZA 5FKAC 3NVVB 2OHFA 3P4RB 1L6UA 4OZAA 1SJHD 3GP7A 3LLBA 2QKNA 1XLPA 3FILB 1SEBD 1N63C 2INPE 1GOZA 2R2ZA 3D2JA 1XXGA 3ETRB 3ZJTA 1HXYD 1B9RA 2LHEA 1GAQB 4B0EA 1NI3A 1YMHE 1SE4A 3P42A 3BYYB 1C76A 1C77A 5C2TB 2JXTA 4LLGM 1PUTA 1I4GA 2IPKD 4OZBA 4PT5A 3NS1A 2PKOA 4HKZE 1VZ8A 1EU3A 1FXIA 4RGTA 3N9YC 1HEZE 2CJNA 4DXFA 1L4DB 3HSUA 1P7EA 3GS2A 1XF5L 1FFUA 1AHZA 1BUIC 5C3JB 2G9HD 3V05A 3TEZA 5AUKA 2PW9A 5AWVA 4WURA 3AECB 2MJDA 1FM0D 1ZXHA 3AM9A 3ETRA 5BMHA 3BYTB 5FR3A 1I4HA 2Y3RA 3Q8FA 4GDLB 4WQMA 2INNE 1J7AA 1NVID 2IDYA 2YEPF 3B9JB 1YJIA 1JWMD 1TYGB 2BS3B 3IT4B 1RYJA 1IBXA 1JWSD 4PWCA 1D6EC 3U4EG 4ZYSA 1FMAD 4JWSC 1V8CA 2MH7A 3BW7A 1FFUC 1QF6A 2GQTA 4N59A 4N58A 3POPA 2QIEB 2N9KA 3BZDB 5LNK1 2P13A 3TEXA 4XLOA 1IGCA 1K52A 1ZUD2 2PLIA 1C4CA 3A7RA 1EU4A 1D5XC 1QOGA 3CWIA 2Y08A 1KFYB 3HVDA 1TKEA 2WP9B 2AQ3B 5MPOA 2J4XA 2X38A 2WNMA 2V3PA 1I19A 4C7YA 2DYMA 4US9A 1GB4A 1CJEA 1T6BX 2K9XA 1ET6A 1W1MA 3D2HA 1DYQA 3R8BA 1GPXA 1PFDA 1KLUD 2PTLA 4AS1A 3KWLA 4YSYB 4YWGG 3S1FA 2BW2A 1L0YB 4ZRQA 4O95A 4BC7A 3ABVB 1JW9D 3AEDB 2LHDA 3EA6A 1FCCC 2GI9A 5HQXA 4BCAA 3MP9A 1VRAB 1CZPA 1FEHA 1Q10A 4MACA 2JYTA 2W54A 1JWUD 3EUB3 1ZPSA 1ROEA 4MM3B 2LJIA 1PGBA 4NAMA 2VFSA 2N7JA 3AEEB 3NUHB 2WXHA 1MBBA 4OALA 4L23A 5JXVA 1D4BA 2MEKA 3P63A 4TQ1A 1E9MA 1QLBB 5AUIA 2Z8LA 1I4XA 2IPIA 3D2DA 4HG0A 3BK2A 3NVYB 3KQ4A 1EWYC 2W3RA 2QILA 1I4PA 1UGJA 4YT0B 2WXOA 1ZR6A 1N5WA 3LYYA 3W8WA 3NZ3A 2WXFA 1MI0A 2I38A 3TX1A 4RCOA 2IJ0A 3SR6B 2ZW0A 3Q8CA 1I4QA 3W5VB 2PIAA 1QLUA 2IGGA 1TZOA 1FO4A 3FC4A 1I7HA 4ARCA 3A7AA 3W5UB 1XLOA 1LO5D 2BS2B 1C79A 3PZ8A 2FUG1 1TKGA 4OHJA 4DXGA 3LAEA 1ACCA 4ZHOA 3AEGB 3Q8EA 3TEWA 2LGIA 4NZLB 1N5WC 5FK9C 1OQQA 1SE3A 1SB3B 1VLBA 1TS4A 2SAKA 3P4QB 1QOBA 2MJ3A 1FD6A 2V0GA 5L6GA 1AHVA 2DLBA 3SR6A 3W1SA 2TSSA 1RWSA 3H8HA 3R07C 2Y3SA 1MHHE 2WDQB 1DGJA 3JS8A 3NVWB 1XCQL 1ENFA 2K22A 2QEJC 2W82A 1TJEA 3SFEB 2R61A 4A55A 3SEBA 4ZRPA 2W3SA 4JE3B 1ZP0B 2OAIA 4B0MA 4XWWA 2WXGA 1TY2A 2N9LA 2OEDA 4YTPB 3I9V1 4US8A 2VZKB 4DNSA 2PLSA 2BS4B 3BIID 1K53A 5FXEA 3GB1A 5D3DA 5TSSA 4MLAA 3RJ8A 2Y3AA 4YXDB 3DWMA 2LUMA 4HEA1 5HFYA 4IOIE 3E9SA 1SE2A 1L6VA 4FXCA 5FXPA 1UNSA 4R3DA 3RPFC 1E8GA 4XE0A 1V1OA 2JQRB 1SB3C 1MHXA 2Q5WD 3R2IA 2O3GA 3VRAB 3NVVA 1WYGA 1QKZA 4XDCA 1PGAA 4BBYA 4PVKA 5G5GB 5EE0A 5AE3A 1ZDXA 2P3HA 2BB5A 3FW7A 1N60A 2WXQA 3FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHZ A;  2I0K A;  2VFR A;  1SIJ A;  1YQ4 B;  4ZOH C;  3AE2 B;  3KJM A;  1E8H A;  4JAY A;  2Q4W A;  1DZN A;  1IUE A;  3HVZ A;  1W1R A;  2YVS A;  3AE4 B;  3AH7 A;  1FIQ B;  1N60 C;  2P4P A;  5G5G A;  5FXD A;  2CJO A;  4USA A;  1E0Y A;  1JWA D;  3P4P B;  3HRD D;  4ZHP A;  4JB1 A;  4YSX B;  1PDX A;  2B76 B;  1NEK B;  2L83 A;  5EE9 A;  1WVE A;  3B2G A;  1A70 A;  2WDV B;  2WS3 B;  3B9J A;  3P4S B;  2QJL A;  1DOI A;  1QT9 A;  2M56 B;  1FIQ A;  3L4P A;  5AE1 A;  2M19 A;  1UWM A;  2FBW B;  5G5H B;  2N0S B;  1RM6 B;  1X2H A;  1VAO A;  2ACZ B;  1YQ3 B;  1MBT A;  5EE3 A;  3DQ0 A;  5EE1 A;  1NYR A;  2HTM E;  1XLQ A;  1E0Z A;  5GXG B;  1T3Q A;  2E3T A;  3A7U A;  2BVG A;  2VFT A;  4LTU A;  5ADZ A;  1WRI A;  3W9C B;  4WWM A;  1VQZ A;  1W1S A;  3W8X A;  1F0Z A;  4JX1 C;  4PYT A;  1N5X A;  1T3Q C;  2RK5 A;  4JWU C;  1OFF A;  4P6V F;  3W8Z A;  3NVY A;  1J7B A;  2MJE A;  1DOX A;  3AE7 B;  1WXQ A;  2NQW A;  5HMR A;  2EXR A;  1L0V B;  1X2G A;  3C0P A;  3CIR B;  1E8F A;  2DWQ A;  3AB5 A;  1J7C A;  4YSZ B;  2H89 B;  3WCQ A;  1W1J A;  2WLB A;  2WQY B;  3S1D A;  1XLN A;  1FRR A;  1JQ4 A;  1RFK A;  4C7Z A;  2WDR B;  1WGK A;  5FXF A;  2E5A A;  2VFU A;  2W55 A;  1R7S A;  2WU5 B;  2VAO A;  1N61 A;  1QOA A;  1KF6 B;  4ITK A;  1JWB D;  3NVW A;  2GQU A;  3AE9 B;  3ZYY X;  3S1C A;  3NS1 B;  1DOY A;  5H8Y E;  1OQR A;  2H88 B;  4A9A A;  1DII A;  1NYQ A;  1NEN B;  2K5P A;  1N61 C;  3AV8 A;  1W1Q A;  1ZXI A;  3AE6 B;  3VRB B;  1QOF A;  1FRD A;  2CU3 A;  1F0X A;  3HRD C;  3EUB 2;  1XO3 A;  2L52 A;  1FFV A;  1V97 A;  3FAH A;  2DBY A;  4HRO A;  1ZXI C;  4ML8 A;  3AN1 A;  3AEA B;  2VFV A;  5H92 C;  1JAL A;  4YTN B;  1AWD A;  3AE1 B;  1E7P B;  4TVW A;  1FFV C;  1W1K A;  3B2F A;  3LB8 C;  3AE5 B;  4BC9 A;  1VJK A;  2PVG C;  4YTM B;  2Q85 A;  3AEF B;  1VDV A;  1FXA A;  3NRZ B;  1UXY A;  1N62 A;  2WU2 B;  3NVZ B;  3S1E A;  4IDI A;  4KX6 B;  2BVF A;  3P1M A;  1TKY A;  2EKI A;  2KMM A;  4N6E B;  5G5H A;  4HRS A;  2R8D A;  1E6E B;  3DED A;  2G1E A;  1AHU A;  2AX5 A;  2LEK A;  1AYF A;  1N62 C;  3VR8 B;  3NRZ A;  3HUI A;  3NVZ A;  4TVY A;  3VR9 B;  1KRH A;  3PO0 A;  2Y5C A;  1RM6 C;  2BVH A;  1JRP A;  1ZOY B;  1HSK A;  2KAJ A;  2BT6 A;  4C80 A;  3I99 A;  2QPM A;  1W1O A;  1WWT A;  1QLT A;  1SF0 A;  2AXR A;  1YJJ A;  3AMZ A;  3SFD B;  5AE2 A;  3AE3 B;  3PM9 A;  1JRO A;  1E10 A;  2JX5 A;  2MBR A;  1WVF A;  3LXF A;  3DWG C;  1N63 A;  2PVO D;  1W1L A;  3AEB B;  3AE8 B;  4ZOH B;  1DIQ A;  1L5P A;  3NVV B;  2OHF A;  3P4R B;  1L6U A;  3LLB A;  2QKN A;  1XLP A;  1N63 C;  2R2Z A;  3ETR B;  1B9R A;  1GAQ B;  1NI3 A;  5C2T B;  1PUT A;  3NS1 A;  2PKO A;  1FXI A;  2CJN A;  1FFU A;  1AHZ A;  5C3J B;  5AUK A;  3AEC B;  2MJD A;  1FM0 D;  3AM9 A;  3ETR A;  4WQM A;  1J7A A;  1NVI D;  3B9J B;  1YJI A;  1TYG B;  2BS3 B;  1RYJ A;  1FMA D;  4JWS C;  1V8C A;  2MH7 A;  3BW7 A;  1FFU C;  1QF6 A;  2GQT A;  4N59 A;  4N58 A;  2QIE B;  2P13 A;  4XLO A;  1ZUD 2;  2PLI A;  3A7R A;  1QOG A;  3CWI A;  1KFY B;  1TKE A;  2WP9 B;  5MPO A;  1I19 A;  4C7Y A;  4US9 A;  1CJE A;  1W1M A;  2K9X A;  1GPX A;  1PFD A;  3KWL A;  4YSY B;  3S1F A;  4O95 A;  4BC7 A;  3ABV B;  1JW9 D;  3AED B;  5HQX A;  4BCA A;  1CZP A;  3EUB 3;  2W54 A;  1ROE A;  2VFS A;  4OAL A;  3AEE B;  1MBB A;  3P63 A;  5AUI A;  1E9M A;  1QLB B;  4HG0 A;  3NVY B;  1EWY C;  2W3R A;  4YT0 B;  1ZR6 A;  1N5W A;  3W8W A;  3TX1 A;  3SR6 B;  3W5V B;  2PIA A;  1QLU A;  1FO4 A;  3FC4 A;  1I7H A;  3A7A A;  3W5U B;  1XLO A;  2BS2 B;  3LAE A;  1TKG A;  4ZHO A;  3AEG B;  1N5W C;  1SB3 B;  1OQQ A;  1VLB A;  3P4Q B;  1QOB A;  2MJ3 A;  1AHV A;  3SR6 A;  1RWS A;  3R07 C;  2WDQ B;  1DGJ A;  3JS8 A;  3NVW B;  2K22 A;  3SFE B;  1TJE A;  2W3S A;  1ZP0 B;  2OAI A;  4YTP B;  4US8 A;  2PLS A;  2BS4 B;  3BII D;  5FXE A;  4MLA A;  4YXD B;  3DWM A;  5FXP A;  4FXC A;  1L6V A;  1E8G A;  3RPF C;  2JQR B;  1SB3 C;  2Q5W D;  2O3G A;  3VRA B;  3NVV A;  1WYG A;  4BBY A;  5G5G B;  5EE0 A;  5AE3 A;  2P3H A;  1N60 A; 
#chains in the Genus database with same CATH topology
 2Y0S F;  4FBU A;  2YMP A;  1WR1 A;  4EUT A;  3WKB A;  2FE8 A;  2KWV B;  3M95 A;  3H8W A;  2K4H A;  2V3A A;  4GYP C;  2WF7 A;  2GR0 A;  3EPG A;  3N7S C;  1ZQR A;  9ICQ A;  2GBK A;  4F7Z A;  3KLJ A;  1VCB A;  1RLF A;  3EEC A;  2NRT A;  2YVS A;  2ZIX A;  3ISD A;  1UZX B;  3L13 A;  3ZRF A;  2PCE A;  2ISP A;  5GRT A;  3QC8 B;  3MC8 A;  2BCP A;  2PFQ A;  3GV5 B;  2P4P A;  2R18 A;  4E71 A;  4OJ5 A;  4K81 A;  1WM2 A;  5CX3 A;  4EE2 A;  3AQF A;  2G45 B;  3O65 B;  1JWA D;  3JVA A;  3KW5 B;  4ZHP A;  3N28 A;  1L7O A;  2Y9U A;  1PDX A;  4WIP A;  2LM1 A;  2D6F C;  1M4V A;  1NEK B;  1NI2 A;  4DFJ A;  1WVE A;  2W43 A;  2WOV A;  3WKA A;  1A70 A;  2WDV B;  3RB4 A;  2WS3 B;  3B9J A;  4GDL A;  4TMA B;  3VC8 A;  3SBF A;  2QJL A;  4KLS A;  3O13 A;  4IWO A;  2MCN B;  5HG2 A;  1WJN A;  2EMT A;  4ROP A;  4E4U A;  3PQB A;  2NS5 A;  1WX9 A;  5AKZ A;  2QMT A;  1S1Q B;  4J6I A;  5AE1 A;  2KJ5 A;  1GRT A;  1R6W A;  4RQ0 A;  1PGX A;  1S5L U;  2AQ2 B;  1UWM A;  4H4R A;  5G5H B;  2DZI A;  4FP1 A;  2KD0 A;  3D6J A;  2N0S B;  5J0Y A;  3H0M B;  2IO0 B;  2GB1 A;  3CK5 A;  3NXL A;  2N4F A;  3R7R A;  4OVZ A;  3ZKJ C;  5AKK A;  1SXT A;  1FNU A;  4JWM A;  2NQL A;  3BS5 A;  2MUC A;  1MBT A;  3FCP A;  3IM1 A;  1FEB A;  2POD A;  1UT5 A;  3SEI A;  4DOC A;  2GLS A;  5EE1 A;  3PLU A;  5HI1 A;  4XA5 A;  4GIS A;  1Q5W B;  4E4F A;  2JWU A;  4GC7 A;  1XLQ A;  4KV2 A;  3C5G A;  2BYF A;  8ICB A;  1KW4 A;  1WRD B;  2HHV A;  3M9O B;  1U4B A;  3PRM B;  4JMU A;  3EWA A;  1X2I A;  1H4R A;  4M8M A;  3W9C B;  4GU2 A;  1J2N A;  1JML A;  2LM4 A;  1EC7 A;  4RGM A;  4HKQ A;  4HPM B;  2HI0 A;  1W1S A;  1PZN A;  3SV3 A;  1FNW A;  4MSM B;  2BCQ A;  3IV6 A;  1X9M A;  4DSK A;  2K3U A;  4K4I A;  3D46 A;  2GO7 A;  2GGH A;  3EAO A;  5AKL A;  5A0L A;  5J29 A;  2KQ7 A;  2NR2 A;  4XDD A;  4DXK A;  5GTI U;  5KNI A;  2RK5 A;  3KLS X;  1B1Z A;  4P6V F;  2CN1 A;  3QK0 A;  3PHW B;  5L1K A;  2JRZ A;  3KZI U;  2NQW A;  5HMR A;  2EXR A;  4O3Q A;  1L0V B;  1X2G A;  3NS8 A;  3MC1 A;  1Y56 A;  1JN3 A;  4MEY A;  3PS6 A;  3QUC A;  2BCS A;  4PVE A;  1TY0 A;  2N1V A;  3P93 A;  5AZH A;  2H89 B;  2V9W A;  3CB3 A;  4A20 A;  3IJI A;  2I6X A;  2HBL A;  1V80 A;  5J0R A;  2WQY B;  3V3X A;  4EM4 A;  3S1D A;  1CRX A;  3BJY A;  3RNE C;  1FRR A;  1ONE A;  2YX8 A;  1NK7 A;  5J2I A;  3D32 A;  2EQ8 A;  3RO6 A;  1V38 A;  4RQ5 A;  3MSY A;  2INC C;  2KZR A;  2WDR B;  3ZNI D;  1F2R I;  5LLI A;  1ZET A;  5FXF A;  1XT9 B;  4YVZ A;  1K1Q A;  1K1S A;  3ML8 A;  4C8N A;  1MVK A;  5T14 A;  4J3Z A;  4H4U A;  2JMG A;  1XD3 B;  1RFA A;  4A90 A;  5J8Y A;  4B95 A;  1SKR A;  1ZKQ A;  1GER A;  1TZ1 A;  3HK0 A;  2WU5 B;  4NQL B;  2EAP A;  1KSP A;  2MBH A;  4TSS A;  3NZG A;  1N61 A;  3ZW3 A;  3OP2 A;  4JGH B;  1VR9 A;  2JV3 A;  4KN4 A;  3QUT A;  4DEZ A;  2VA8 A;  2ZZP B;  3RD2 A;  2ESE A;  4KKI A;  1Z4O A;  5DGA A;  3AE9 B;  1P98 A;  3A9J A;  4H4Y A;  2IO3 B;  5H8Y E;  1KFS A;  2AHO B;  3V5C A;  1TKD A;  2JRI B;  3PW7 A;  4MGY E;  5KHQ A;  3UMB A;  1MSW D;  3L0W B;  2HSZ A;  4W9H A;  1NK8 A;  5AHX A;  5AI4 A;  3PSP A;  3N4F A;  1J97 A;  3K4G A;  1NEN B;  2K5P A;  2MW5 A;  2I5Q A;  4KVG B;  1NKB A;  8ICX A;  3VFC A;  3PR5 B;  1QOF A;  3L5K A;  1WM3 A;  2C60 A;  5L9X A;  2D8C A;  2LZ6 A;  5DB9 A;  2HCF A;  4W9J A;  2AEH A;  3ZNG C;  4AUQ C;  5BOF A;  5FS7 A;  4BVU C;  3Q6B A;  4IHC A;  2J6S A;  2CU3 A;  2PI5 A;  1FEZ A;  3H4B A;  5CR0 A;  9ICE A;  2QJM A;  2NVU I;  2RQ5 A;  2ZEQ A;  3EUB 2;  2KWC A;  3HRD C;  5ALF A;  5AIC A;  3N4M B;  1N56 A;  9ICT A;  2PJH A;  4A8X C;  3FAH A;  2DBY A;  4PVH A;  4EX7 A;  2GRT A;  3SQS A;  5KT6 A;  2LGS A;  1X9S A;  4A6Q A;  4QWC A;  1JCK B;  4UAR A;  2KVR A;  2WXP A;  4I2J A;  4A3O A;  3MUC A;  4K2S A;  2PXI A;  4WQO B;  3D2N A;  4IRC A;  1WZ0 A;  3TSH A;  1AWD A;  4PH5 A;  3DGB A;  4DLG A;  2FJ6 A;  2ZW1 A;  2YQE A;  5AK6 A;  4ELV A;  1Z1V A;  2E5S A;  1S77 D;  2JT4 B;  2LMC A;  4G11 A;  1FFV C;  3FG2 P;  4TVW A;  3F2D A;  1AOG A;  3B2F A;  1H8C A;  1ZQX A;  3ONN A;  5CHG A;  3LVW A;  4O3M A;  1UGM A;  5BYR A;  3BVZ A;  1NZB A;  3TQP A;  4P4P A;  2XGZ A;  1VJK A;  2YB1 A;  4UD8 A;  2G06 A;  2KN4 A;  1U47 A;  4MFF A;  2IOF A;  3C21 A;  2BBC A;  3KHH A;  2WWZ A;  3RRH A;  4C4R A;  2V4I B;  1A5R A;  1NK4 A;  1C9F A;  5FJU A;  2Q85 A;  1VD2 A;  1WJ6 A;  5FS6 A;  5C5J A;  3FW9 A;  4JDR A;  3NHE B;  3VCN A;  2JY6 A;  2EQ7 A;  2YMQ A;  5DQI A;  4ACF A;  4DL3 A;  3IG3 A;  4FO6 A;  1ZQO A;  2XEW A;  4PHP A;  1XO0 A;  3QU7 A;  3ZDA A;  1N62 A;  5J2E A;  3IK4 A;  1J8C A;  1QQ5 A;  2XIC A;  1V1P A;  2D5G A;  3CF6 E;  1ZDL A;  3DES A;  3K9P B;  1GEU A;  1S7M A;  2XSX A;  1A6S A;  1PYW D;  4F92 B;  5JCK A;  3AU5 A;  5G5H A;  4I27 A;  1KN5 A;  1ZMD A;  2RDX A;  4WAF A;  1R0M A;  2ZAD A;  4KLQ A;  2QC8 A;  2KFN A;  1QQ6 A;  2R8D A;  5KG1 A;  2NPT B;  1T7P A;  2LHT A;  5D6J B;  4APN A;  1YOV B;  3HP6 A;  4A35 A;  5IIN A;  3ZNH B;  3R2T A;  2OH2 A;  2C3C A;  4F4X A;  4KPL A;  3Q8B A;  4M0X A;  1TFR A;  3Q8L A;  4K7S A;  4J9Q A;  2KFJ A;  3DGZ A;  2BZF A;  3VR9 B;  3OAW A;  3PO0 A;  1BKH A;  5BOL A;  1I4R A;  4OJP A;  1RM6 C;  5L1I A;  4KPR A;  1UA1 A;  3OTQ A;  3ISC A;  1KKR A;  3BVM A;  5B66 U;  1ZOY B;  1E7U A;  1UBI A;  3X0W A;  2I2Y A;  9ICN A;  1MO9 A;  5KFN A;  3L54 A;  1Z5S B;  2N1W A;  4IQT A;  2KAN A;  3PX6 A;  2BT6 A;  3MKC A;  4KGS A;  3H8A A;  2QPM A;  1UCV A;  2XN9 C;  5KHO A;  1ZOL A;  4MGK E;  5D3I B;  4EZK A;  4WJQ A;  2KIV A;  3FV9 A;  4O5C A;  1QLT A;  1ZYQ A;  4ED3 A;  3GIM A;  1T4G A;  4EOY A;  2IGH A;  2LRU A;  2KMD A;  2AXR A;  1YJJ A;  5BO4 B;  1U4A A;  3UJS A;  1T94 A;  1M6Y A;  4XQ8 A;  1D3Z A;  3VHT C;  2MRL A;  5GMV A;  4NM1 A;  3H8S A;  3Q2A C;  1BWC A;  4Q8E A;  1WSP A;  2JX5 A;  4RPZ A;  2MBR A;  2BWE S;  3UIO B;  2CS4 A;  1WVF A;  3LWM A;  2BPC A;  1OEY A;  5CP2 A;  4ANV A;  3DWG C;  3RUI B;  4MF8 A;  3URY A;  4BBN F;  2PVO D;  1YN4 A;  3STP A;  4LJX A;  1Z3E B;  1XDI A;  2DYO A;  3ZXR A;  3SU8 X;  4YMN A;  2VH1 A;  3RH5 A;  3C8Y A;  2XH0 A;  4IRD A;  4GXB A;  3V3W A;  5KFO A;  4F5R A;  3EGR A;  4KLU A;  2BQR A;  1MUC A;  3GQC A;  1C78 A;  3CXO A;  3I6E A;  4REZ A;  1AAR A;  3QFB A;  3TI0 A;  3V6J A;  2FI1 A;  5D4B A;  3P4R B;  1S0N A;  1KJT A;  4JL9 A;  3GP7 A;  5AKG A;  2FIF A;  4RMA A;  1Q1W A;  1WYW B;  3QYP A;  1XLP A;  9ICO A;  4C8M A;  4DSJ A;  3QAQ A;  4GR1 A;  3PML A;  3QU2 A;  3D2J A;  3Q8K A;  1ZD4 A;  4EZ9 A;  3SN4 A;  4KWS A;  3HM6 X;  4C8K A;  3V5F A;  2LHE A;  3H0L B;  1YMH E;  4P4O A;  3BYY B;  4JQW C;  4ENL A;  4I2H A;  2AYO B;  5C2T B;  1Z1B A;  1WE6 A;  8ICU A;  3TAQ A;  3UJ2 A;  4PT5 A;  1KEJ A;  7ICT A;  2IPK D;  2PKO A;  4RNO A;  4FHK A;  2PS2 A;  3N9Y C;  3BQ7 A;  1ISN A;  5J0S A;  3ZTC A;  1FFU A;  5IO9 A;  2DHZ A;  1BUI C;  4O5K A;  2JK6 A;  1SL2 A;  4AOF A;  5AUK A;  2PW9 A;  4C4S A;  2AXT U;  5DB6 A;  2MBE A;  3AEC B;  2GL5 A;  2MJD A;  2ZZ0 A;  4M9L A;  2QKQ A;  1E7V A;  3PW0 A;  2HJ8 A;  2OPJ A;  3H7P B;  3BYT B;  5AKJ A;  2JHD A;  2G07 A;  5CHW A;  1WUE A;  4GGH A;  4HNL A;  4IC9 A;  5L1J A;  1J7A A;  1NVI D;  1SJA A;  2O56 A;  1L7Y A;  5L83 A;  4ELT A;  1TYG B;  2BS3 B;  4PWC A;  4F2R A;  4I2A A;  3AU6 A;  3U4E G;  4ZYS A;  1FMA D;  1V8C A;  2AL3 A;  3BW7 A;  1MDL A;  2GQW A;  1ECW A;  4N59 A;  4N58 A;  4ANW A;  2P13 A;  1ZRM A;  2W11 A;  4GIR A;  3QXG A;  1K52 A;  4XLO A;  2W9B B;  3TTE A;  5KFL A;  3UXO A;  4YR2 A;  1N48 A;  1D5X C;  1EU4 A;  3II4 A;  1Q3V A;  1KFY B;  5J2G A;  2L76 A;  2KDF B;  2WP9 B;  4EX6 A;  1S0V A;  5MPO A;  2MBQ A;  2V3P A;  2JGA A;  1DK2 A;  5DPW A;  1I19 A;  2OEH A;  5BOM A;  3MDC A;  4DS5 A;  3D2H A;  1ET6 A;  5KG4 A;  1XWL A;  3AU2 A;  1DYQ A;  3R8B A;  1PFD A;  3QUB A;  8ICG A;  3CSF A;  1TK5 A;  3PRE A;  2NRZ A;  1ZQE A;  4YSY B;  2A3V A;  3D2S A;  2LD9 A;  4QZ8 A;  4DHJ D;  3RN9 C;  2XCP A;  3TQ1 A;  3K75 D;  4QZC A;  3SDL C;  4H4W A;  2Q0Z X;  3TAD C;  3WIM A;  3OJS A;  2FDR A;  1FCC C;  3B97 A;  2BC0 A;  2GI9 A;  2PU1 A;  2P6R A;  3BIN A;  4BCA A;  9ICF A;  2OX4 A;  3NUQ A;  3TBL D;  4Z1Y A;  4F50 A;  1CZP A;  5JCL A;  2WOI A;  2WB1 C;  2W54 A;  1JWU D;  4W9G A;  4E5T A;  3N7R C;  2POZ A;  4MM3 B;  4HCL A;  1TAQ A;  4ED7 A;  3TAN A;  2WXH A;  5JXV A;  3MR6 A;  3RJH A;  2MEK A;  3P63 A;  4DS4 A;  3GZF A;  4KLG A;  2Z8L A;  4U7C A;  3ZTD A;  5DBB A;  4RQ4 A;  2O6V D;  1IG6 A;  1EWY C;  4K3B A;  4OVV A;  3DK9 A;  3R1Z A;  2LVP A;  1UGJ A;  3WU2 U;  1P3Q U;  4EQR A;  3ALB A;  3N3K B;  1MI0 A;  4QIW F;  3NZU A;  3WAP A;  1JXE A;  5D49 A;  1ZQ1 C;  5J0U A;  4IL6 U;  3G6X A;  2NPT A;  3PZD A;  3VAW A;  1RVK A;  4IL2 A;  3V7K A;  3TL5 A;  3SR6 B;  3TAR A;  2D3D A;  1I4Q A;  3ZVV A;  5KFJ A;  4DQR A;  4J9P A;  2PIA A;  4KT2 A;  4WJ3 B;  3M63 B;  1YQZ A;  2VKQ A;  1NJW A;  2YVC A;  5EU9 A;  4JB3 A;  4WJO A;  3W5U B;  1XLO A;  2BS2 B;  2BYV E;  4CF5 A;  1TKG A;  3LAE A;  1ZQI A;  2D07 B;  3TEW A;  3Q8E A;  1SB3 B;  2XVT A;  2XI9 A;  3DGH A;  1OQQ A;  1SE3 A;  2I1J A;  4FLH A;  3P0W A;  2C5L C;  4YWO A;  3SN0 A;  2SAK A;  5KVH A;  3LWL A;  2ZTC A;  4KN7 A;  1KOT A;  2K1F A;  5L6G A;  1FD6 A;  2V0G A;  4R63 A;  3MFH A;  4FHJ A;  4BOS C;  3Q6J A;  2AGP A;  2TSS A;  4K3C A;  3H8H A;  3R07 C;  3TWA A;  3H0R B;  3A0B U;  1GSN A;  2PP3 A;  3JS8 A;  5J0P A;  2ZNV C;  4KLH A;  8ICN A;  3NVW B;  1ENF A;  3PSI A;  2ZTD A;  2R61 A;  4AYB F;  5JTI A;  3LDA A;  3QWZ B;  4ZRP A;  2BYE A;  4JE3 B;  4B9N A;  5KFQ A;  2J6U A;  2N9L A;  2KE7 A;  4F4Z A;  3PG6 A;  3OC4 A;  3BII D;  1K53 A;  2KC2 A;  2OXO A;  2KKV A;  2NRW A;  3I4K A;  1NJZ A;  4URK A;  1NNL A;  3WK7 A;  2GH1 A;  5ALM A;  4ELU A;  3RJ8 A;  3W1S C;  4B9K A;  2Y3A A;  3O0H A;  3DWM A;  4HYK A;  4WJP A;  2ZJA A;  2LUM A;  2DGZ A;  2MNR A;  2JXX A;  2IO1 B;  1SV4 A;  2L0F A;  1ZK7 A;  4IM2 A;  3UJE A;  4DWD A;  3IJL A;  4GRT A;  4XE0 A;  1V1O A;  4GYP A;  2KTF A;  4QAY A;  5IIL A;  3ZDB A;  3R2I A;  3CAW A;  4F4K A;  1WYG A;  2BKF A;  2GDQ A;  1L3T A;  1FHU A;  4RQ1 A;  5KFE A;  2IBI B;  2W03 A;  4DSI A;  2JWZ A;  2WXQ A;  2MBB B;  2I0K A;  1EWC A;  3D9X A;  4KZC A;  3IG5 A;  2VFR A;  3H12 A;  4P16 A;  2FMQ A;  4EZJ A;  4YWS A;  3MGH A;  3I1Y A;  1E9I A;  4MSQ B;  1C4P A;  3RR8 A;  3AE2 B;  4IQW A;  2HHT A;  3KJM A;  3JPP A;  4M47 A;  3ZJV A;  3CGC A;  3OG5 A;  1IUE A;  3HVZ A;  1W1R A;  4F4W A;  2DEN B;  9ICW A;  3AE4 B;  3RGT A;  2C7M B;  2KQS A;  3VTW A;  2PI4 A;  3RNG C;  4RF1 A;  1N60 C;  1UA0 A;  3H1U A;  5B5E U;  5FXD A;  2CJO A;  2PSN A;  1MC8 A;  1YN5 A;  4M00 A;  3VH4 B;  2VZK D;  3T6C A;  4FBT A;  4X57 B;  5E6O A;  3RBD A;  1NKC A;  4PZO A;  3RH4 A;  1B4F A;  3ZIM A;  1GRH A;  1ZQY A;  1WG8 A;  4GSW A;  5ALV A;  4PZF A;  4RF0 A;  2XK5 B;  2ZTE A;  5IIK A;  3H7P A;  4ZRI A;  3R0U A;  1D8B A;  1A0P A;  5AM1 A;  1JX4 A;  2JUO A;  3DK8 A;  9ICG A;  3B2G A;  4Y2X A;  2LBO A;  1KLG D;  4M0W B;  2KHQ A;  5ALZ A;  1QT9 A;  2M56 B;  1HZ5 A;  2J52 A;  2YTU A;  3JZU A;  4Z6F A;  8ICZ A;  4AJW A;  3L4P A;  3RNM A;  2M19 A;  5DQG A;  1ZD3 A;  3U2S C;  4P7I A;  3MR5 A;  1A76 A;  4NLG A;  4P0P B;  2W9B A;  1RM6 B;  2IY0 B;  2NMQ A;  2R8G A;  3FXG A;  4FZN A;  1HUO A;  1YQ3 B;  2PMZ C;  4UB8 U;  3ZDC A;  4H4Z A;  2YEP B;  4EYI B;  5FP0 A;  4RQ6 A;  2Y1I A;  1V6E A;  4YCX A;  2JRH A;  2VRR B;  2DF4 B;  5KG2 A;  3DVG X;  2KFZ A;  9ICR A;  1E90 A;  1NYR A;  4H2A A;  2ZCB A;  1TS2 A;  1GV4 A;  3MQT A;  3RJK A;  8ICC A;  1KTQ A;  2LI6 A;  5ALO A;  4Z6D A;  3WK5 A;  2ASJ A;  2ZJ5 A;  1CMX B;  3QJZ A;  1C3T A;  2H3I A;  3RNA C;  3A7U A;  2QVH A;  2E8N A;  3RT3 B;  3NO1 A;  3EYZ A;  4LTU A;  2F1J A;  3M9M B;  4LVS A;  2IGD A;  3VVW B;  4I2D A;  5DLG A;  2GBJ A;  2GRI A;  4PYZ A;  5U1O A;  5C1Z A;  5KFT A;  3A1Q B;  4H4S A;  3FYH A;  2DFL A;  2UUV A;  1NHQ A;  5AKI A;  4O9M A;  4MM3 A;  4DK5 A;  1VJ5 A;  5BOE A;  1SWW A;  1ARO P;  2EZZ A;  3Q3J A;  1MQ3 A;  4KLD A;  1F0Z A;  1R4M B;  3V7L A;  4PYT A;  1RDF A;  5TR5 A;  1T3Q C;  2C2D A;  4P4M A;  2LFI A;  2V3B A;  5HR6 A;  2RDH A;  3PLV A;  3JW0 X;  2GWS A;  3RJF A;  1J7B A;  1L0X B;  3UQ2 A;  2FNJ B;  2RDJ A;  1KN0 A;  1VZ6 A;  2N7E A;  4Y2J A;  4QWA A;  3RBE A;  3M6K A;  5H2F U;  2VJ4 A;  1TVA A;  2WXR A;  3C0P A;  1ZQD A;  1QSY A;  1E8Z A;  5KFH A;  2V3N A;  4RNA A;  3SN1 A;  3MJ5 A;  3MFG A;  1P1A A;  3Q3F A;  3BVG A;  5AKX A;  2K89 A;  2P8B A;  3PW4 A;  1HJP A;  4BKT A;  2NTS A;  4II3 B;  3DFH A;  2ICI A;  5HNK A;  1W1J A;  2JXJ A;  1BVS A;  4AP4 C;  4DDG D;  3SHQ A;  4G9B A;  4C4V A;  3EAN A;  1NEL A;  4FFD A;  3PST A;  3ZJU A;  5DPR A;  3E0F A;  2L8J A;  4KGT A;  1RFK A;  4ZYN A;  3A9J B;  1RG6 A;  4Y2Y A;  4R64 A;  1SBB B;  3MGI A;  9ICB A;  3CXB A;  1JMS A;  1ZGU B;  4RQ7 A;  2HOI A;  1DGS A;  4QW9 A;  2V9H A;  1E5W A;  2LGX A;  3U8Z A;  2BVC A;  3TUO A;  3P3B A;  1JUD A;  5BMI A;  3S2A A;  2PEA A;  1V9P A;  3GIL A;  2JH1 A;  2MUT B;  2K4E A;  4RUA A;  4NJ6 A;  4C0Z A;  2EEL A;  3RIT A;  1YZ6 A;  3AU4 A;  1QOA A;  4E3C A;  4YR3 A;  4NM2 A;  3U7Z A;  4OZC A;  3UI3 A;  3NVW A;  1UWX A;  3DHI C;  3RUL A;  3KZX A;  5L1L A;  2CHR A;  2HBM A;  2JZB A;  2NTT A;  5DGB A;  3NS1 B;  1NJX A;  3PVX A;  2E8P A;  3OLM D;  1S8O A;  2Z0E B;  4IT1 A;  4TUR A;  3MC9 A;  3QUQ A;  4A9A A;  3JPQ A;  2W9C B;  2WX1 A;  4NJ7 A;  4KMO B;  5KT5 A;  2JF5 A;  1DII A;  2AGQ A;  4RGN A;  1NYQ A;  4DDI D;  2OM6 A;  4HK2 A;  1WXM A;  5J0X A;  3QTP A;  2K25 A;  3RNB C;  3L8K A;  4QJF B;  2QB1 A;  5J0Q A;  1LV5 A;  5KFU A;  3GIK A;  1T0R C;  4H83 A;  3R10 A;  1D8L A;  4YR0 A;  2HDE A;  2LJ5 A;  4DOB A;  3LYS A;  4PGX A;  1T8E A;  2BQU A;  1FRD A;  1OGW A;  5DCN A;  1WR6 E;  1T0S C;  4Y2R A;  1LFD A;  4HXD A;  2KLG A;  3NG0 A;  4W9I A;  3JPO A;  2GMI C;  2QCZ A;  3KHL A;  5DLF A;  1XO3 A;  2L52 A;  3QN3 A;  1FFV A;  4H50 A;  3TSJ A;  4G0N B;  4Q8F A;  3M8S A;  1JPM A;  1ZQJ A;  1HUZ A;  4I2G A;  1EF1 A;  2PFO A;  1ZQP A;  2LYA A;  1Z19 A;  1UBQ A;  3ONS A;  4YL8 A;  4JV0 A;  8ICS A;  1ZQA A;  4YD1 A;  3NZS A;  1ZXI C;  3GO2 A;  3UGV A;  4NEV A;  4CRX A;  3WKE A;  3KHR A;  1JAL A;  5DBA A;  4PHD A;  3BSM A;  4AQ7 A;  4RT2 A;  9ICI A;  2UVU A;  2RPV A;  1ZD2 P;  4YN4 A;  7ICM A;  3T5J A;  3EF6 A;  1R4M I;  5FS9 A;  4QZE A;  3TCA A;  4BKG A;  5AK3 A;  3RB3 A;  1F1H A;  1E7P B;  2BGW A;  5ALX A;  1V1P B;  2AWT A;  2JZP A;  1G6J A;  4C00 A;  1UEL A;  1ZQC A;  3LB8 C;  4HLE A;  4KSL C;  5I1V A;  4BWM A;  1RPL A;  3AE5 B;  8ICI A;  1NDA A;  2JH7 A;  4ZH4 A;  1MA7 A;  1GRF A;  5HML A;  2PGW A;  9ICA A;  5HHD G;  3L5O A;  2BTE A;  5KAF U;  2XK5 A;  1EUV B;  4M52 A;  1VDV A;  3VCC A;  1KFD A;  9ICV A;  3N1Z C;  2FKP A;  3PY8 A;  7ICQ A;  1FXA A;  4M0W A;  1GRE A;  3QPE A;  1F9J A;  3TEY A;  3IT6 B;  1YN3 A;  4KX6 B;  3G6V A;  2FID A;  3PZ7 A;  3GE8 C;  2MU2 A;  1F52 A;  1J2M A;  1NK0 A;  4TUQ A;  9ICC A;  1RYS A;  4GDK B;  3MR3 A;  1KCZ A;  3DEQ A;  2MRP A;  1X40 A;  2C2R A;  4MJS B;  3TOY A;  1JIH A;  1BXT A;  3TFS A;  1D8Y A;  4OVU A;  4P0P A;  4HPL B;  1SGG A;  2BB5 A;  1TS3 A;  1L6N A;  3IJQ A;  9ICL A;  3UIP B;  4HRS A;  4EFO A;  3CGD A;  5L1M A;  2G1E A;  2KQ4 X;  3SSZ A;  2SEB D;  4QZH A;  2LEK A;  1AYF A;  2OVL A;  3T3F A;  5ER0 A;  4TV3 A;  5AI5 A;  2OZ8 A;  1SXD A;  3KOO A;  3NRZ A;  2G5H B;  5AKE A;  5CEH A;  1XNS A;  1CEZ A;  2ZNV B;  3HUI A;  1ZJN A;  3UF8 A;  2JEG A;  3S5S A;  4O1N A;  1KRH A;  4EEL A;  1EBG A;  2Y0S C;  2IBK A;  2HVH A;  2ZZC A;  4ECU A;  4BKS A;  2Y5C A;  3FKY A;  2GGI A;  3SAF A;  4HCD A;  1ZW7 A;  1N2X A;  1ZE3 D;  1HSK A;  3A1Q A;  3TKA A;  2KC1 A;  5KFC A;  5BPC A;  4KLL A;  3U52 E;  7ICO A;  3OHB A;  5IIJ A;  5HHH A;  2BKE A;  4CCH A;  5J2B A;  3I5J C;  1IPG A;  7ICU A;  3CNH A;  1L8L A;  2MP2 A;  3EHV A;  4FA6 A;  1CQV A;  5KFR A;  5HR7 A;  3SQP A;  3C2M A;  2W9M A;  2PTY A;  4PS3 A;  2CDU A;  2KDE B;  1RYR A;  3QFA A;  2LYH A;  3R11 A;  3DFY A;  4M6W B;  4MDK E;  1TS5 A;  3SFD B;  4ACO A;  4PVJ A;  3PM9 A;  2PFP A;  3UM9 A;  4RNN A;  4Z6C A;  2UWQ A;  4M0A A;  4E6M A;  1YNT E;  4NNJ B;  1TYT A;  4MH8 A;  4CF3 A;  3MZN A;  4W9F A;  3T4W A;  1HA5 A;  4EEW A;  2ZXH A;  1YEY A;  3VC5 A;  4DF4 A;  4BOZ B;  3JW7 A;  4DQP A;  5ALT A;  5EOZ A;  3N30 A;  4XYC A;  3BZK A;  2HHX A;  2FMS A;  3B0A A;  1D7Y A;  3FW8 A;  4KMU A;  1GB1 A;  3VDZ A;  4D2K A;  1MRA A;  2GGJ A;  3PV8 A;  3KKA C;  1EXN A;  8ICQ A;  2BPS A;  4ZRJ A;  5FKA C;  3EEZ A;  2BPG A;  3NVV B;  2BPF A;  5J17 A;  4GGB A;  2XO7 A;  2W7O A;  1RZT A;  1RQL A;  3LLB A;  4UAW A;  2R8H A;  2DL0 A;  2ZG6 A;  1U48 A;  2ZCC A;  4M01 A;  1LB2 B;  3KUC B;  3HHM A;  1SEB D;  3C1Y A;  2INP E;  3F53 A;  4KTQ A;  4HDO A;  3H7I A;  1V5O A;  1XXG A;  2MUT A;  2RSU A;  2OZT A;  5CWR A;  1J0G A;  1ZQQ A;  3N1X C;  4RNM A;  1GAQ B;  3E2E A;  3PR4 A;  2HZG A;  1NI3 A;  2KO3 A;  3P42 A;  1C77 A;  1X6J A;  2JXT A;  3GV8 B;  3UQ0 A;  4K4G A;  1WIA A;  4BZA A;  1I4G A;  2KJ9 A;  3EPI A;  3ENE A;  3NS1 A;  3QU5 A;  3OZM A;  1VZ8 A;  2JEJ A;  1RXW A;  1V2Y A;  4DXF A;  1L4D B;  1P7E A;  3GS2 A;  3VA8 A;  3PX0 A;  3JVZ X;  4UB6 U;  2D3G A;  2H5X A;  2W9C A;  3MDA A;  5C3J B;  2G9H D;  4WUR A;  8ICK A;  3D2Q A;  4FDC B;  4PS8 A;  5FR3 A;  3VTU A;  4K1R B;  1TYP A;  3MTN B;  3TCS A;  2M0X A;  1V59 A;  2Y3R A;  3Q8F A;  3ZVI A;  4G3I A;  2YEP F;  2LI5 A;  5HMM A;  1JWM D;  3IT4 B;  4YG2 A;  1ZQV A;  1JWS D;  2KJ6 A;  3Q3O C;  4HWI B;  5J2H A;  7ICR A;  4J56 A;  1Q0W B;  2K6D B;  4OJ6 A;  1KM7 A;  4F4R A;  4FE3 A;  5EWG A;  4MF2 A;  4X2P A;  1UT8 A;  3ZI4 A;  4DQI A;  4KSK C;  4RM8 A;  4LJP B;  3BZD B;  4GOC A;  1WUF A;  2GR2 A;  1BZL A;  2XC9 A;  1IGC A;  1P43 A;  4HPN A;  2PLI A;  1C4C A;  1ZQZ A;  5JCM A;  1QOG A;  3CWI A;  3TAD A;  3U7D A;  2HD5 B;  4NXZ A;  2AQ3 B;  3Q3M C;  1WI0 A;  3OJU A;  1E8W A;  2X38 A;  1AQ6 A;  1LM8 B;  2REX A;  2ZIW B;  1L3V A;  4C7Y A;  7ICH A;  1WY8 A;  2DYM A;  4US9 A;  1ZD5 A;  5E6N A;  1ZX9 A;  5JRB A;  5HKH A;  3C23 A;  3M6Z A;  2K9X A;  2IMW P;  3WAO A;  5JU5 A;  4UB4 A;  4DO9 A;  1KKX A;  1KLU D;  2JR5 A;  1L8P A;  4HYR A;  3KWL A;  4YWG G;  4I2I A;  4DX3 A;  5KFI A;  2BW2 A;  1L0Y B;  2G4D B;  3S1F A;  2B3A A;  4O95 A;  4BX9 C;  3ABV B;  2C3D A;  2F77 X;  4BC7 A;  1EC9 A;  2RP5 A;  4ED0 A;  2WPE A;  3ETL A;  1R4N B;  3RJI A;  3EA6 A;  5III A;  1E8Y A;  2E8O A;  2MAX A;  1OUQ A;  2V3S A;  2JEI A;  3APC A;  1SKS A;  2P66 A;  2N9E B;  2GH5 A;  1PGB A;  1HIW A;  3N1Y C;  3OSN A;  2CHZ A;  2RLT A;  5KTQ A;  5J0W A;  4KLO A;  2N7J A;  3EKG A;  1MBB A;  4PPX A;  2KN5 A;  4TQ1 A;  2F8K A;  1QLB B;  1F0M A;  2J0K A;  1I4X A;  3IHP C;  3N6H A;  4HG0 A;  4QZB A;  2KNB A;  2W3R A;  5DG7 A;  1I4P A;  2X8X X;  4GDK A;  4MJS A;  2WXO A;  4YT0 B;  4QW8 A;  5ALS A;  2WXF A;  2KV2 A;  3KD3 A;  1NK9 A;  5EWE A;  4FJY A;  3ES8 A;  3HIL A;  2FLN A;  4GB9 A;  8ICO A;  1SJD A;  2EKE C;  1H38 A;  3DBH B;  1QLU A;  5DBC A;  4Y2Q A;  3FM9 A;  1TZO A;  5ALH A;  2IND C;  1FO4 A;  4C4T A;  5J2K A;  2DW7 A;  4TUS A;  3DV9 A;  4NLC A;  2G5I B;  1LO5 D;  4F8C B;  5K4L A;  3PZ8 A;  2KK0 A;  4NLB A;  3QZ8 A;  4DXG A;  5L95 C;  4NEW A;  2NPX A;  2BR0 A;  1N5W C;  4NZL B;  5FK9 C;  5C0Y A;  5IOI A;  4HVB A;  3ZLF A;  3GOE A;  1YX6 B;  2AH5 A;  4DSL A;  3P4Q B;  3ENL A;  2PTZ A;  3FJ4 A;  4M9J A;  4J9K A;  3FDS A;  4JN8 A;  2XCA A;  1OXJ A;  4UAY A;  3W1S A;  3TMP B;  1RWS A;  2Y9T A;  2KMA A;  5JHB A;  2AU0 A;  4KX5 A;  2DZJ A;  2O2V B;  3UQB A;  2ISO A;  1Z00 B;  4PL1 A;  2KHW B;  3UXL A;  2A8X A;  1XS9 D;  2WAQ F;  2K22 A;  2QEJ C;  2W82 A;  3OJ3 A;  3SFE B;  4IUM B;  1UD7 A;  3SEB A;  2W3S A;  4M2Y A;  4XX5 A;  4G8T A;  2QJN A;  2WXG A;  2NBU A;  4MEX A;  2OOB B;  5ALN A;  2HOQ A;  3A9K B;  4M6W A;  1UQV A;  4DNS A;  1MG8 A;  2BS4 B;  4H4V A;  3GZN B;  4GMV A;  5FXE A;  4P0Q B;  7ICV A;  4C8L A;  2ODG A;  4F72 A;  4YXD B;  1GXF A;  2DPI A;  2XBB C;  2VJ5 A;  8ICT A;  4HEA 1;  3ISB A;  3E9S A;  3RPF C;  3PFR A;  1WGR A;  5KT4 A;  4ED1 A;  4ECT A;  2JQR B;  4EBC A;  5ALW A;  4RT3 A;  3QEA Z;  2Q5W D;  4KIT B;  4LZG A;  1IYF A;  3NVV A;  3HIZ A;  2GR1 A;  4GLX A;  4CE6 A;  5EE0 A;  1ZDX A;  2P3H A;  1N60 A;  2ASQ A;  4DL4 A;  2WX0 A;  4B9T A;  1QSL A;  4K4H A;  2BWF A;  1JEH A;  5HHZ A;  4MT5 A;  4XGA B;  2FCN A;  2OKT A;  1L7N A;  1BML C;  3V60 A;  3CGB A;  1TK0 A;  3RJE A;  1SIJ A;  3DEE A;  8ICF A;  1YQ4 B;  4ZOH C;  5AM0 A;  3OPX A;  1E8H A;  3ML9 A;  2L7R A;  3KWV A;  3PNC A;  4JAY A;  1XCT L;  4LJO B;  3R7Q A;  1X1M A;  4PWB A;  4DL5 A;  4IKG A;  2HTH A;  5F9N A;  3NY5 A;  2ZPY A;  4L2Y A;  3I28 A;  2M8S A;  1NOM A;  2UVV A;  1MQ2 A;  1F44 A;  3V6H A;  3I63 C;  3ZRC A;  2OQH A;  4USA A;  2KJH B;  5L6F A;  5ALK A;  1GRB A;  2R8K A;  4A3P A;  4NL9 C;  3P4P B;  3HRD D;  4JB1 A;  2J42 A;  2IYD B;  2JSV X;  1Q8K A;  4YSX B;  4FX9 A;  3HKZ F;  5HHI A;  2L83 A;  4Y2U A;  5LXI B;  1ZDV A;  4GFJ A;  4PHA A;  2XY7 A;  3ED5 A;  4IR1 A;  3BWU D;  3P4S B;  1DOI A;  1FHV A;  1D9F A;  2OZ3 A;  4FUL A;  2AKM A;  3UXK A;  4B9L A;  1V49 A;  2KDM A;  5EDS A;  3AI5 A;  2GOW A;  1FIQ A;  3THV A;  1XS2 A;  1SIF A;  4Z6E A;  3UJF A;  3BK1 A;  4KLJ A;  3T5L A;  2FBW B;  2P3Z A;  3GRS A;  2KTR B;  5D79 A;  3PW5 A;  4FZL A;  3PHX B;  4BBN C;  1ECQ A;  1QCK A;  2NRX A;  1WMH B;  3PT2 B;  1X2H A;  4ICA A;  3B0X A;  2Q4T A;  1GUA B;  1OW5 A;  2ACZ B;  4ZDV A;  3MR2 A;  2AL6 A;  4DFD A;  3GD6 A;  4OCZ A;  2I1Q A;  4BAX A;  1V81 A;  2ZIW A;  3UJR A;  4KLM A;  2JPH A;  3T5K A;  3SQI A;  2HTM E;  3K1Z A;  3H40 A;  4QWB A;  1EBD A;  3TJI A;  1T3Q A;  1X6I A;  2E3T A;  2ASL A;  5E6J A;  2VFT A;  4J3O D;  1NK6 A;  1HZ6 A;  2KAC A;  5TIS U;  4J9M A;  5ADZ A;  4J1O A;  4NLZ A;  3GZN I;  2DQN B;  2ZJD A;  4NAW A;  4BDP A;  2BQ3 A;  2Y5P A;  5J18 A;  4K8D A;  2FPL A;  2A1A A;  1ZRN A;  1WX8 A;  2V6O A;  2HMX A;  3DK4 A;  4DFM A;  4C4V B;  2DX5 B;  2XY5 A;  2W8L A;  1Q1R A;  4UAV A;  3W8X A;  2XH4 A;  4J03 A;  4JX1 C;  1N5X A;  2WXL A;  1C1Y B;  3WAM A;  2AQ1 B;  3ZVH B;  2A19 A;  3UXN A;  4YXM A;  4GXI A;  2MA9 B;  2CU1 A;  4WWN A;  1AW7 A;  2ON8 A;  3PX4 A;  2PLP A;  5AI9 A;  4DQQ A;  3AE7 B;  4CHK A;  1WXQ A;  3MHZ A;  3PV1 A;  3ZUN A;  3WA0 A;  4RQ3 A;  3N32 A;  1KDH A;  3OWE B;  1E8F A;  3KTQ A;  2DZM A;  3AB5 A;  3W2D A;  4IG7 B;  1QIL A;  2KFK B;  3GDX A;  4YSZ B;  2OJW A;  1S97 A;  2VA3 A;  4I28 A;  1IGD A;  4HNC A;  1LPF A;  5I1W A;  3RB6 A;  3WCQ A;  3PSE B;  3HJE A;  4PGY A;  1TBE A;  4CYE A;  1TZZ A;  1SZH A;  4UBB A;  1XLN A;  2BGF A;  5D7G A;  9ICH A;  1X66 A;  3VDG A;  2MHJ A;  4Q2J A;  2JZB B;  5KFG A;  5J2D A;  1WGK A;  1O03 A;  3V7J A;  2E5A A;  3MBY A;  3H6N A;  1M94 A;  2YMM A;  1WGH A;  2W55 A;  3TAC B;  3D47 A;  2P0I A;  4UQG A;  2K6Q A;  3B1L X;  3DJJ A;  2WTF A;  4ZCW A;  5F3X B;  5HP4 A;  2WHE A;  4BKS D;  2QDE A;  4YD2 A;  3V6K A;  2K8H A;  5CA7 A;  3DDM A;  3AXC A;  3RRA A;  3SAH A;  2ZJ8 A;  5DB8 A;  1ONF A;  8ICR A;  3PZP A;  3VQI A;  9ICM A;  4EKU A;  1SV0 C;  3UCD A;  4RFB A;  1F8W A;  2Z59 B;  2VAO A;  4ITK A;  1JWB D;  3IAM 1;  2O2V A;  4GLS C;  4B9S A;  2RDG A;  1Z00 A;  1DXS A;  2KSO B;  4NJC A;  4B6J A;  2WXJ A;  1FPY A;  4IM3 A;  1UH6 A;  4OD0 A;  3Q8A A;  4TUU A;  3OPS A;  3S1C A;  2D10 A;  2DAF A;  5JZE B;  3PO5 A;  2ONQ A;  1SKW A;  2W04 A;  2H88 B;  2HXT A;  3A9K A;  3PPA A;  3T3N A;  4RPY A;  1JCT A;  4P0Q A;  4EQW A;  7ICE A;  4ARI A;  4JUZ A;  2HDO A;  3AV8 A;  4KLE A;  4RH6 A;  1W1Q A;  1ZXI A;  3BOX A;  1B0X A;  4QZD A;  4NLN A;  3VRB B;  4X5V A;  4WAA A;  2NBW B;  3DBR B;  1COK A;  2B6G A;  4S17 A;  1IBX B;  4J9O A;  2M9N A;  1TGZ B;  2H3Z A;  3MY9 A;  3QKE A;  5ALG A;  4F93 B;  3T9P A;  3VUX A;  4TUP A;  4JPS A;  1QH9 A;  2BQQ A;  2YVG A;  1F0X A;  1C20 A;  2XH7 A;  5F9L A;  8ICA A;  4ICU A;  4QIW C;  3I57 A;  2KX3 A;  3ZXV A;  1L3S A;  2EQ9 A;  1ZQG A;  4ED8 A;  4GXK A;  4HRO A;  3LB8 A;  2EQ6 A;  1A77 A;  2C7N B;  5JUM A;  1ZQK A;  3LAD A;  5AKY A;  4KIK B;  3AN1 A;  3AEA B;  3RYT A;  3DG7 A;  2BCR A;  5KT2 A;  4HJK A;  5CTR C;  3QU9 A;  2WP6 A;  3OGU A;  4LNF A;  1M6I A;  5T8I A;  2D2Q A;  1YQB A;  5J2C A;  2R8I A;  1DRG A;  5FR6 A;  2RD0 A;  3RZW C;  3TSS A;  5ALL A;  3C29 A;  4QZI A;  3RJJ A;  1NDD A;  2ZIV B;  4DL2 A;  2G4S A;  2KWD A;  3TWB A;  1W1K A;  3PK7 A;  2EQY A;  1STE A;  1EF5 A;  4UB3 A;  3BQ2 A;  2P88 A;  4XUS A;  1K51 A;  4BC9 A;  4H4T A;  2K60 A;  2E8M A;  1K8R B;  5IIO A;  3DCG A;  4YTM B;  2J3N A;  2L00 B;  3KYD D;  4H4Q A;  5KL1 B;  1WXA A;  4PGQ A;  2ALZ A;  4GN1 A;  5BYS A;  4Q44 A;  4AYB C;  3B0Y A;  1VZ7 A;  3UMC A;  3PRP B;  2J6T A;  3HM3 A;  2ZPN A;  3NRZ B;  5AI0 A;  3S1E A;  2QAE A;  4OJO A;  2XNA C;  4IDI A;  2JU6 X;  1P7D A;  3S6J A;  2WFA A;  4M02 A;  5JRT A;  4H19 A;  2WHI A;  4O3P A;  4KGR A;  3LJ3 A;  4XC2 A;  4F2S A;  1BNP A;  3S47 A;  1L8O A;  1EM7 A;  2KTR A;  1L5U A;  3C19 A;  2KWU B;  1WMH A;  1ZQW A;  1T3N A;  5DG8 A;  4KEM A;  5ENL A;  4I2F A;  1MOK A;  3H4K A;  2YY6 A;  1E6E B;  3DED A;  1MPE A;  5KG3 A;  3RCZ A;  4B9V A;  1AHU A;  5AIB A;  2FCM A;  1FNV A;  1UUP A;  1XEE A;  2DKX A;  5K8E A;  2ZVN A;  2K39 A;  3H8M A;  4I2B A;  4IR9 A;  2MP2 B;  4ASW C;  9ICJ A;  3VR8 B;  2ZUB A;  2QGY A;  4BWJ A;  2CHW A;  2WXN A;  4IC7 B;  3NVZ A;  4GIV A;  2GBM A;  2H3F A;  4MGG A;  1WCN A;  2DAJ A;  2M17 A;  2NCN A;  5TZV A;  5I4D A;  2KXJ A;  1X9X A;  2LUE A;  2WXK A;  3Q4D A;  2BVH A;  1GC7 A;  4ZRK A;  4CO7 A;  2QAR B;  3N7P D;  4LNO A;  2KP7 A;  1JRP A;  3G6Y A;  4NQK E;  2EMS A;  1XSN A;  3ZQ4 A;  2GGE A;  1IM4 A;  1S3S G;  2LKY A;  2F2A B;  2KKP A;  2Y1J A;  1ZQS A;  3DDC B;  3KUD B;  2KKC A;  2BC1 A;  3I99 A;  2F8L A;  3H70 A;  4IP5 A;  1URJ A;  5IAA C;  1KTK A;  3QA8 A;  2KYW A;  2OCE A;  3ZVH A;  4ANX A;  2QHO A;  3AMZ A;  2D3B A;  2M0A A;  4HCP B;  3IRU A;  1ET9 A;  1L3U A;  3AE3 B;  2AAQ A;  5AE2 A;  3KKA A;  1U49 A;  1V5T A;  1T0Y A;  1L4Z B;  2XY6 A;  2KTQ A;  3QQ8 B;  2RAB A;  7ICS A;  3DBS A;  3LXF A;  4MGZ E;  3CRX A;  1BPZ A;  2KFK A;  3ZLZ A;  4FN2 A;  1QQR A;  4DWF A;  4BV6 A;  1SL0 A;  2D3A A;  4U6P A;  3AEB B;  3J9C A;  5C23 A;  1W1L A;  1QZE A;  4CDG A;  1S0M A;  1XHC A;  3AE8 B;  3U30 A;  2RGF A;  4PYU A;  3HPF A;  4ZOH B;  1DIQ A;  4DHZ B;  3BS7 A;  3PRZ A;  4AWJ A;  2IA6 A;  2KJR A;  3QEB Z;  2BHN A;  4FBJ B;  2RPQ A;  1PVQ A;  4HAI A;  5FJO A;  2OHF A;  4RUC A;  1L6U A;  4IW0 A;  2OO6 A;  2HJ1 A;  5TR3 A;  2Z7J A;  2YVF A;  3N6J A;  2H3Q A;  5IIM A;  3FIL B;  3I6T A;  5JHA A;  4NY0 A;  3L17 A;  5KG7 A;  4WWO A;  1GOZ A;  1N63 C;  1STZ A;  1ZMC A;  2OFJ A;  2YN4 A;  2QDD A;  5CRX A;  1P0R A;  5AKH A;  5KFZ A;  1UF0 A;  2MLB A;  2GLE A;  1WE7 A;  2LGD A;  3W1Y A;  4F71 A;  1B9R A;  4KX3 A;  1LVL A;  4F5O A;  3Q8S B;  1SE4 A;  2LXA A;  2VA2 A;  2KSO A;  4M9H A;  4ICV A;  4LLG M;  2OG9 A;  3HWT A;  1PUT A;  1RRB A;  3Q8R B;  4JV1 A;  4HKZ E;  1EU3 A;  1FXI A;  2KX0 A;  4RGT A;  3RRG A;  1HEZ E;  2CJN A;  3APD A;  1XF5 L;  1U9L A;  3JPS A;  2HQM A;  3HW2 A;  2PTW A;  3KFU F;  5AWV A;  2IO2 B;  4H4P A;  3HX0 A;  2NO4 A;  4Y2T A;  3APF A;  3AM9 A;  2WF6 A;  3ETR A;  2V4R A;  1ZQT A;  5BMH A;  2M1M A;  4B9U A;  3LK9 A;  4EEK A;  5G55 A;  3K1R B;  3KH0 A;  4K7Z A;  4IQV A;  2INN E;  1ZQM A;  2IDY A;  2RDI A;  4WQM A;  2PA6 A;  2FPK A;  5AM3 A;  2K8C B;  1V9J A;  1YJI A;  1LVH A;  1RYJ A;  8ICP A;  1IBX A;  1PK1 B;  1PDY A;  5FJT A;  2IHN A;  4EYH B;  1Y88 A;  3P2B A;  2W7P A;  3IC9 A;  1HE8 A;  2PFN A;  3CYJ A;  1ZQL A;  4O3S A;  3GIJ A;  3H4D A;  4UAT A;  1ZQH A;  2FLL A;  3QAR A;  5DB7 A;  2ASD A;  4NAM A;  1QF6 A;  4ECR A;  2QIE B;  4P1C C;  1PK3 A;  2MA1 A;  4QZA A;  5J2A A;  3MJW A;  1FXT B;  1LKY A;  2M4N A;  4EMI A;  4J9N A;  2K8A A;  2Y08 A;  3HVD A;  4EM3 A;  2NBV B;  4KIK A;  2A5U A;  2J4X A;  5AZF A;  1W6T A;  4MHV A;  2HXU A;  4RQN A;  2ES6 A;  3TFR A;  2WNM A;  3T8Q A;  5ALU A;  5KG6 A;  2H3V A;  4JQ9 A;  8ICW A;  2WP5 A;  1CJE A;  5KFA A;  3JPT A;  4ECW A;  2O6V A;  2ZIV A;  5AI6 A;  2PTL A;  1BPE A;  5KT3 A;  4PJ0 U;  1L7M A;  4F5Q A;  4JK1 A;  5GTH U;  1WXS A;  4ZRQ A;  1JW9 D;  2UVW A;  4W9K A;  3AED B;  5KFX A;  4EQX A;  5ALR A;  5CJ7 A;  1GJZ A;  3THU A;  2VH2 A;  3RF9 A;  3MP9 A;  3C2L A;  4ECZ A;  4R8U B;  1VRA B;  2ZIU B;  1FEH A;  4MAC A;  2JYT A;  1H6V A;  3EUB 3;  1ZPS A;  1ROE A;  4MEL A;  4I6N B;  2N1R A;  1B43 A;  4OAL A;  3V61 A;  3NUH B;  4GXJ A;  5FMH A;  4L23 A;  1XSL A;  1D4B A;  1KBU A;  5AUI A;  1E9M A;  4LCD E;  4B6W A;  3Q8Q B;  2P6U A;  2TPR A;  2K8B B;  2ZZB A;  3BK2 A;  3NVY B;  3D2D A;  3KQ4 A;  1OTR B;  3K1G A;  5JCN A;  1DK3 A;  4OO1 J;  5FS8 A;  3QX1 A;  5U25 A;  2XID A;  1N5W A;  2P35 A;  3LYY A;  3NZ3 A;  1ZR6 A;  3W8W A;  3IBE A;  2I38 A;  4GGQ A;  2EH9 A;  1NU5 A;  4GFI A;  3TX1 A;  5DKW A;  2XGP A;  4RM9 A;  1WGG A;  4KLF A;  2IJ0 A;  2NO5 A;  3L10 B;  2ZW0 A;  4HN8 A;  3TW9 A;  3V4B A;  4LA1 A;  8ICE A;  3W5V B;  3OZY A;  2CXY A;  3IHQ B;  2IGG A;  3NJT A;  4F4Y A;  3SD5 A;  1E0Z A;  3ES7 A;  2PPH A;  3PO4 A;  2FPM A;  3FC4 A;  2I5H A;  1ZKH A;  3PGE A;  1Z2M A;  3A7A A;  4XRH A;  3Q45 A;  1N6Z A;  1WGY A;  3GD4 A;  1C79 A;  2FUG 1;  5DQH A;  5KFP A;  3GII A;  4PZN A;  4W9D A;  2R2O A;  2LGI A;  2N9P C;  2OLA A;  4DF8 A;  2PKE A;  1VLB A;  3CW2 C;  3V6C B;  1TS4 A;  4WWP A;  5J2R A;  2QAR A;  5DDM A;  2W8K A;  7ICF A;  1QOB A;  2MJ3 A;  3UCC A;  1AHV A;  2DLB A;  3VTV A;  3JYU A;  4BGD A;  1NHS A;  2W9N A;  1IIP A;  4IS7 A;  1B22 A;  4P2H A;  1DGJ A;  4DWI A;  1XCQ L;  4A55 A;  4FAD A;  3VUW A;  4Y2V A;  1V85 A;  3WK6 A;  1ZP0 B;  5DG9 A;  5IDZ A;  5KFK A;  4B0M A;  2XH2 A;  2OAI A;  2OED A;  4YTP B;  5KFF A;  3I9V 1;  4US8 A;  4BXO A;  2PLS A;  4E8G A;  2PTX A;  2WGS A;  4DN1 A;  2HHS A;  5D3D A;  2L5Y A;  1MDR A;  3VC6 A;  2FUH B;  4BJQ A;  4ADW A;  3GU3 A;  2HBK A;  4Y2P A;  1ED1 A;  3HT3 A;  2EZX A;  2AGO A;  3NRW A;  3RNF C;  1BPD A;  2KIW A;  3SMV A;  4IOI E;  5HFY A;  1SE2 A;  1L6V A;  2BKR B;  1NK5 A;  3M9N B;  4G50 A;  3C1Z A;  3K9O B;  1YJ1 A;  3L08 A;  3NGD A;  3ZLG A;  4EQS A;  3Q14 C;  1ZQB A;  2G3Q B;  4ECS A;  1SB3 C;  3CST A;  3T79 A;  2HHQ A;  1MHX A;  2ATL A;  3J81 j;  2A4Z A;  1U45 A;  2JVC A;  3QE9 Y;  4XDC A;  1WJ4 A;  1OEP A;  3DJG X;  3FW7 A;  1KQQ A;  1TTN A;  3FIL A;  5KFD A;  3DER A;  5D94 A;  3UXP A;  3H7S A;  2W0H A;  2ZXI A;  3ZNZ B;  4NL9 A;  4BUR A;  4QNL A;  3WK4 A;  2DPJ A;  2I9G A;  3WAN A;  3GRT A;  2ZUD A;  4DSF A;  4B9M A;  4IWP A;  3RJG A;  1SSN A;  3UMG A;  4HCH A;  3IAS 1;  2Q4W A;  2LPE A;  1DZN A;  2RRD A;  2L1A A;  4XWT A;  5AM4 A;  1D9D A;  3T5H A;  3AH7 A;  4J9L A;  1FIQ B;  9ICU A;  9ICS A;  5FJR A;  3A0H U;  4FJZ A;  5G5G A;  4UB2 A;  1C7Y A;  4G7F A;  2UUU A;  3ZD8 A;  2CR5 A;  2PMV A;  4NV0 A;  1E0Y A;  1FEC A;  2J7Q B;  3KBB A;  3IN5 A;  2KZM A;  1DTN A;  3VUY A;  2B76 B;  2V4L A;  2D11 A;  2EAO A;  5KFY A;  5EE9 A;  4PS7 A;  2WPC A;  1XC9 A;  2QSD A;  5IP4 D;  4ECY A;  3PMN A;  4Y2S A;  1RYU A;  5ALE A;  2K8C A;  2WXI A;  1WJU A;  2ONE A;  2PP1 A;  3OTR A;  4E0D A;  1KLV A;  1PK1 A;  2FCS A;  3GC2 A;  3VXW A;  1CK1 A;  4JN7 A;  4DYE A;  3VFK A;  1IP9 A;  2LXC A;  1SWV A;  4J9R A;  2ZC8 A;  3DPD A;  1YIW A;  3BZC A;  5BMG A;  1I35 A;  1GO3 F;  2MQJ A;  4JLC A;  4NAW B;  5J2J A;  2R8J A;  1VAO A;  4DQO C;  2ZUC A;  3Q8M A;  4J9S A;  3RAX A;  4CNQ A;  3FWA A;  3QX7 A;  5EE3 A;  4MKS A;  3DQ0 A;  4WJN A;  3DBL B;  2NVK X;  4ED2 A;  4HJG E;  2LVO A;  5CHF A;  3ZGZ A;  3VTE A;  2W9A A;  4PK1 A;  3SZ2 A;  4YXJ A;  4MFA A;  8ICJ A;  2LRW A;  4EZ6 A;  4KLT A;  5GXG B;  2GOL A;  5AM5 A;  3GFK B;  3B08 A;  3M62 B;  4C56 C;  4FJV B;  5E6P A;  2BVG A;  4HCN B;  1JRU A;  4RU9 A;  3TAP A;  3F5A A;  1MFW A;  1WZ3 A;  4ML8 A;  5KG0 A;  1JPD X;  1WRI A;  1Q3U A;  1GG3 A;  2WYQ A;  4WWM A;  1Z4N A;  2V4Q A;  3M8R A;  2VIX A;  1PQS A;  5IA7 A;  1VQZ A;  1I42 A;  4R8U A;  2HW3 A;  3OJ4 B;  1F5S A;  2ZIU A;  2B0C A;  1ZQN A;  2YQU A;  1LGR A;  4R65 A;  1TIF A;  3M3J A;  5ALI A;  1DXL A;  2OYY A;  5AK4 A;  4UW9 A;  1KLN A;  2IOF K;  2AJQ A;  1T5X D;  4F1S A;  3H8J A;  1QLN A;  1J19 A;  5IN7 A;  2EAM A;  5LXH A;  2PP0 A;  2KIC A;  1LXD A;  4C8O A;  4OJL A;  4LDT D;  3R0K A;  3Q3N C;  4JWU C;  1OFF A;  3A4S C;  3KUZ A;  3JPN A;  5AEK B;  3W8Z A;  3MFI A;  1MG4 A;  1SZP A;  3NVY A;  2K8B A;  3OHA A;  2FAZ A;  2MJE A;  1GRG A;  1YD8 U;  1DOX A;  1SJE D;  3RTV A;  4II2 B;  1OJT A;  4PL2 A;  1GNU A;  2DKZ A;  3NFU A;  1WUD A;  3RJA A;  3CIR B;  1L2N A;  4IM0 A;  5KFB A;  2DWQ A;  5EWF A;  2C22 A;  1J7C A;  2GSH A;  1K4Q A;  1HQR D;  4EBD A;  3IXS A;  3ICX A;  4RGO S;  4QWE A;  4GC6 A;  1C4A A;  2WLB A;  4IWQ A;  3SEN A;  1SV0 A;  4EEN A;  4KDL B;  3ZDE A;  3O0F A;  5BYQ A;  1TE6 A;  7ICN A;  3PWI A;  2KG5 A;  1JQ4 A;  2CKH B;  7ENL A;  7ICK A;  4C7Z A;  5CHV C;  1IV8 A;  2M0N A;  1GC6 A;  2VFU A;  1NHP A;  3ZLH A;  4NLK A;  1P48 A;  3ECI A;  3KVF B;  2KZ3 A;  4UAU A;  1GET A;  2GGG A;  2PE9 A;  1KH0 A;  2X50 A;  1R7S A;  4EC3 A;  4AJY B;  5J04 A;  6ENL A;  2KHV A;  1WH3 A;  3H9D A;  1PUZ A;  1X9W A;  3AUO A;  1KFT A;  2I1K A;  1FCL A;  1MNS A;  4DXA B;  4NJ8 A;  1KF6 B;  2WDT B;  1TK8 A;  3U4F A;  2G09 A;  2O6K A;  2WB1 F;  4M04 A;  4H2H A;  2GQU A;  2E1F A;  1EBH A;  2PU0 A;  5KFM A;  4KKJ A;  3ZYY X;  4DBG A;  1IYX A;  1DOY A;  2NV3 A;  2AL2 B;  1BPX A;  4KZ0 A;  3BQ1 A;  2BYT A;  1OQR A;  4RQM A;  4K1W A;  4PHE A;  4UBC A;  5JCI A;  4KLI A;  4MFC A;  5J8Y C;  4YMO A;  1NJY A;  4MMW A;  1ESF A;  2GR3 A;  1R4N I;  3RI7 C;  3T9L A;  1YX5 B;  4L1B A;  4LNK A;  1N61 C;  2A1J B;  3GE3 C;  3AE6 B;  2L32 A;  2MSN A;  4EBE A;  3EZ5 A;  3ALR A;  1XSP A;  2LYB A;  2BB6 A;  2XGQ A;  2C2E A;  2JEF A;  3DBL I;  3DH9 A;  2QQ6 A;  4CF4 A;  5KAI U;  2L05 A;  3A33 B;  2J53 A;  4WH4 A;  1F3P A;  2KMC A;  2OWO A;  2PPG A;  1ELS A;  1NPX A;  1K50 A;  3RR7 A;  5G2N A;  1V97 A;  4YQW A;  2KT7 A;  1WWU A;  5DPS A;  5FJP A;  4F3O A;  3PVL A;  1SJB A;  2CFY A;  3E56 A;  4I6P A;  2F5Z A;  5IKC M;  2P8C A;  3C28 A;  4F5P A;  3MGV A;  3AUL A;  3DVN U;  2QB0 B;  4E74 A;  1EO6 A;  2VFV A;  2EAN A;  4O5E A;  5H92 C;  3EW9 A;  4CGZ A;  1PDZ A;  4F5N A;  3DBH I;  4LDT B;  3Q69 A;  2FLP A;  4YTN B;  5D2M B;  2QDF A;  4DLE A;  3AE1 B;  3R9K A;  4LNI A;  1HTQ A;  1JOA A;  1WX7 A;  2RMM A;  1NZP A;  3C5F A;  3WK9 A;  2RHF A;  3I76 A;  2G0A A;  4O3O A;  4IRK A;  2PVG C;  4LK0 M;  1MN8 A;  1DOQ A;  3U9I A;  2YAU A;  3WAL A;  3AL0 B;  3NTU A;  4F8R A;  2VFS A;  1QSS A;  3AEF B;  2WAQ C;  3LVV A;  1NBF C;  2Y4G A;  3RNC C;  1SJC A;  5J2F A;  4RQ8 A;  1F2R C;  2DZK A;  3SV4 A;  3DVN V;  3R3M A;  4G3X B;  3CP8 A;  4XZ4 A;  1UXY A;  2WU2 B;  3NVZ B;  4ECV A;  2MWS B;  1TAU A;  3ZDT A;  2BVF A;  4R66 A;  4M9N A;  4JV2 A;  4EWJ A;  1RAX A;  3P1M A;  3CGE A;  3WKC A;  1TKY A;  2EKI A;  2IZV B;  2KMM A;  4Z17 A;  3PWG A;  4N6E B;  1Q46 A;  3OSP A;  4LII A;  4UAZ A;  2C7H A;  3X23 A;  3UPQ A;  8ICV A;  3PSF A;  5J0O A;  1T0Q C;  2WF5 A;  1AN8 A;  4TQ0 A;  2DW6 A;  3MWC A;  4HPP A;  2E1E A;  4EMW A;  2WDW A;  2J0M A;  3PTF C;  2HHU A;  3GV7 B;  2AX5 A;  3DIP A;  2MSE D;  2KK8 A;  5AI8 A;  1S0O A;  1HTO A;  4JIO U;  1N62 C;  1RQN A;  1SXE A;  3F2C A;  1FEA A;  4K8G A;  2AQ4 A;  1XQQ A;  4DL6 A;  1Y8R C;  3RFZ B;  3SAG A;  3ORY A;  4TVY A;  4DHZ E;  1D5Z C;  3UQA A;  1ZY8 A;  4EEY A;  2K4I A;  1P7F A;  4M6U A;  2LMR A;  2WF9 A;  4FZM A;  3HW8 A;  3RB0 A;  2LGY A;  4I2E A;  2WOW A;  2X8G A;  5ALP A;  2KDI A;  2B21 A;  3BQ0 A;  2KZZ A;  2MBO A;  4OW0 A;  2AL1 A;  2KAJ A;  2PMQ A;  3RZF A;  4C80 A;  2KLC A;  1KKO A;  3QHT A;  1XPY A;  1OEY J;  4I2C A;  1HEK A;  1W1O A;  4QZ9 A;  1D5M C;  1WWT A;  2L3Z A;  3LDZ E;  3TJP A;  3KUM A;  2WXM A;  5DDY A;  4DCC A;  3N97 B;  1SF0 A;  2JYE A;  1BQG A;  2K0P A;  5ALY A;  3JPR A;  2LAS A;  4RQ2 A;  2ZVO A;  3GSY A;  3DDH A;  1F77 A;  4LZD A;  3MHS D;  1BPY A;  3IDW A;  4CQN A;  1JDF A;  8ICH A;  4H1Z A;  4DOA A;  3SD7 A;  1JRO A;  2FE9 A;  5KFV A;  5D46 A;  1V86 A;  4UB1 A;  3CYM A;  3HKZ C;  3PW2 A;  3RH6 A;  2E6X A;  1ZQU A;  5DPT A;  1E10 A;  2R9Z A;  3R66 C;  3T3O A;  2IY1 B;  3ZO5 B;  1N63 A;  3KYC D;  2KEY A;  4IL0 A;  1QQ7 A;  9ICK A;  1UHU A;  3MC0 B;  1WGD A;  1TT5 B;  2PE6 B;  3JSV B;  2PGE A;  5JH5 C;  2PMZ F;  2BCV A;  2CHX A;  2FCQ A;  2KNJ A;  4ECX A;  1L5P A;  4UDU C;  3UGB B;  5KVI A;  2F3N A;  1NKE A;  1PVR A;  4OZA A;  1SJH D;  3CMM B;  2QKN A;  4DFP A;  2LVQ A;  1TE2 A;  4NY8 A;  1QTM A;  3DG6 A;  4YP3 A;  3DG3 A;  3E58 A;  1SL1 A;  2R2Z A;  1EC8 A;  3ETR B;  8ICM A;  3ZJT A;  3FYY A;  4ANU A;  2RDB C;  2HHW A;  1HXY D;  2NYV A;  4B0E A;  1KD0 A;  3QCA A;  3EC8 A;  3RFA A;  4QZG A;  1C76 A;  4K7U A;  5E79 U;  4FS2 A;  1GRA A;  1SE9 A;  2ZIX B;  4GME A;  4OZB A;  2Z0D B;  4DHJ B;  2AL2 A;  4UB5 A;  3KHG A;  9ICX A;  1XAN A;  1TKK A;  3HSU A;  4GIB A;  3R25 A;  3RCY A;  7ICJ A;  1AHZ A;  2DNF A;  4BUG A;  4P1B C;  1K5O A;  1LKY B;  2JZZ A;  3V05 A;  3TEZ A;  2KJ8 A;  2BDP A;  3FVD A;  3CT2 A;  2N7D A;  2RR9 A;  3T8M A;  4YFK A;  2KVZ A;  1FM0 D;  1ZXH A;  4LNN A;  2IOH A;  4EZL A;  3QIJ A;  3LXD A;  2A1J A;  3AEV A;  4W9E A;  4DL7 A;  1JXL A;  1I4H A;  2MX2 A;  2J0J A;  4GDL B;  3N4E A;  2YB4 A;  2HE7 A;  3B9J B;  2UYZ B;  3EFC A;  4ED6 A;  4DSE A;  1S76 D;  1D6E C;  2O6V B;  3L16 A;  4JWS C;  3IFW B;  5AZG A;  2MH7 A;  2YML A;  3V62 A;  1FFU C;  2GQT A;  3SYZ A;  1DNC A;  5KFS A;  3POP A;  3AQE A;  4I6L B;  1RXV A;  1Q1O A;  2F76 X;  2N9K A;  1WWV A;  1XU4 A;  4TKN A;  3TEX A;  3IP4 B;  3VCB A;  5LNK 1;  3MAB A;  5KL8 B;  4A8E A;  1ZUD 2;  2UU7 A;  3A4R A;  3QLD A;  3A7R A;  4F91 B;  3DOW A;  3GY1 A;  4M8N A;  4UAS A;  1F9C A;  4A6G A;  1TKE A;  4JWN A;  3WKD A;  1XO1 A;  3BS5 B;  3V6E B;  4I29 A;  2QB0 A;  1COO A;  3RAQ A;  2F44 A;  2VAN A;  2HVI A;  2KOB A;  2BF8 B;  2CPR A;  1GES A;  1TAM A;  1BT0 A;  3L3F X;  3V72 A;  3M1Y A;  2GBR A;  1GB4 A;  1TV9 A;  4W9C A;  1T6B X;  4TQS A;  1W1M A;  1MJD A;  3I3T B;  1GPX A;  2L0T A;  2X8C A;  4AS1 A;  2HOF A;  5AK5 A;  3U26 A;  2KVC A;  2LHD A;  1WXV A;  3Q8P B;  4DQS A;  3ZDD A;  1YZ7 A;  5HQX A;  2WBA A;  3BY4 B;  4HDQ A;  4IQU A;  1ZQF A;  2R2Q A;  4YMM A;  2UVR A;  2NRV A;  1Q10 A;  3ZDM C;  3M7D A;  4S0R A;  2LJI A;  4RZR A;  2FMP A;  8ICY A;  3AEE B;  4MGI E;  4IP4 A;  1YT3 A;  2AKZ A;  1O08 A;  1JI7 A;  2F1I A;  4FS1 A;  7ICP A;  2IPI A;  4JHM A;  1BGX T;  3F5E A;  3VH3 B;  2QIL A;  2YLM A;  3BQT A;  3NAS A;  2BDU A;  4Q45 A;  2KD1 A;  1E8X A;  9ICP A;  3UIN B;  4RPX A;  1ZJM A;  2YVJ A;  2G08 A;  4FI4 A;  3TJ4 A;  4RCO A;  3RR1 A;  1SGH A;  1IXR A;  4N9F 4;  3DVG Y;  1OQY A;  1BPB A;  3Q8C A;  3OW1 A;  2KOX A;  1L7P A;  3WK8 A;  3BDP A;  4BFR A;  4H4X A;  3SI8 A;  1KRP A;  1I7H A;  2EDU A;  3ZD9 A;  3DBR I;  4ARC A;  1LQB A;  4ECQ A;  3BJS A;  2KN7 A;  5KG5 A;  4NWI A;  4MEM A;  2WPF A;  3QU4 A;  4OHJ A;  2DUY A;  4NPN A;  2GBN A;  3RMK C;  1ACC A;  4ZHO A;  3AEG B;  2X8H A;  3IG8 A;  4BXO B;  4QWD A;  3QZ7 A;  4J57 A;  2N9X A;  2QLT A;  1WCL A;  2AQ0 A;  5AIA A;  2WF8 A;  5EBK A;  3DHG C;  4O3N A;  3H7V A;  4MH0 E;  1X42 A;  7ICG A;  1UPH A;  7ICI A;  2OJR A;  2KVS A;  3SR6 A;  1WF9 A;  5J0T A;  2Y3S A;  1MHH E;  2WDQ B;  4AP9 A;  4O3R A;  2HNE A;  3HPO A;  3N20 C;  4EMJ A;  3F2B A;  1TJE A;  4KDI C;  2KDB A;  3GD3 A;  1P9D U;  2JZ3 B;  5ALD A;  2IHM A;  2DYB A;  4K7W A;  4XWW A;  1H2I A;  1BNO A;  1KL9 A;  1TY2 A;  2VZK B;  4DNA A;  4IZG A;  5ALJ A;  2EZY A;  3GB1 A;  2CRX A;  5TSS A;  5KFW A;  4A3R A;  4MLA A;  5ALQ A;  3SJN A;  3NOB A;  4Q43 A;  2HBJ A;  5AM2 A;  2Y5B B;  1NHR A;  3URH A;  3IVF A;  2BCU A;  2X99 A;  4FXC A;  4W9L A;  2K4P A;  3C0R B;  5FXP A;  1UNS A;  8ICL A;  7ICL A;  3C2K A;  3JSV A;  4R3D A;  1E8G A;  1CI4 A;  4M9G A;  2QJJ A;  1S9F A;  4DHG A;  3QNM A;  2V1Y A;  4ZA0 A;  3DQV A;  3EFU A;  4QZF A;  5CB1 A;  3DHH C;  5KT7 A;  1WFY A;  2O3G A;  3VRA B;  2C9W B;  2OQY A;  4O0I A;  1QKZ A;  2FYM A;  1PGA A;  4BBY A;  4PVK A;  2LWP A;  5G5G B;  1CUK A;  5AE3 A;  4DFK A;  1S10 A;  1PVP A;  2D3C A;  4TQR A;  2F1H A;  3TIX A;  2C28 A; 
#chains in the Genus database with same CATH homology
 5HHZ A;  2I0K A;  1EWC A;  4MT5 A;  2FE8 A;  2VFR A;  1BML C;  4P16 A;  1SIJ A;  1YQ4 B;  4ZOH C;  1C4P A;  3AE2 B;  3KJM A;  1SSN A;  1E8H A;  4JAY A;  3IAS 1;  3KWV A;  2Q4W A;  1XCT L;  3ZJV A;  1DZN A;  4PWB A;  2L1A A;  4IKG A;  1IUE A;  3HVZ A;  4XWT A;  1W1R A;  2YVS A;  3AE4 B;  4L2Y A;  3AH7 A;  1FIQ B;  1N60 C;  4RF1 A;  2P4P A;  5G5G A;  5FXD A;  2CJO A;  2UUU A;  1YN5 A;  4USA A;  4EE2 A;  5L6F A;  2VZK D;  2PMV A;  1E0Y A;  1JWA D;  3P4P B;  3HRD D;  4ZHP A;  4JB1 A;  2J42 A;  4PZF A;  2JSV X;  4RF0 A;  4YSX B;  1PDX A;  2B76 B;  4WIP A;  1M4V A;  1NEK B;  2L83 A;  5EE9 A;  1WVE A;  2QSD A;  3B2G A;  1A70 A;  2WDV B;  1ZDV A;  2WS3 B;  3B9J A;  4TMA B;  1KLG D;  3BWU D;  2WXI A;  3P4S B;  2QJL A;  3O13 A;  1DOI A;  5HG2 A;  1QT9 A;  2M56 B;  1HZ5 A;  2J52 A;  2KDM A;  3PQB A;  1CK1 A;  1FIQ A;  2QMT A;  3L4P A;  5AE1 A;  3BK1 A;  1PGX A;  2M19 A;  2AQ2 B;  1UWM A;  2FBW B;  5BMG A;  3U2S C;  5G5H B;  5D79 A;  2N0S B;  4NAW B;  2GB1 A;  1RM6 B;  1X2H A;  2NMQ A;  1VAO A;  4OVZ A;  1SXT A;  4DQO C;  1FNU A;  2ACZ B;  1YQ3 B;  3FWA A;  1MBT A;  2YEP B;  5EE3 A;  3DQ0 A;  5EE1 A;  1NYR A;  4H2A A;  5HI1 A;  4HJG E;  1TS2 A;  3ZGZ A;  3VTE A;  2HTM E;  1XLQ A;  2JWU A;  1E0Z A;  5GXG B;  1T3Q A;  4C56 C;  2E3T A;  3A7U A;  5E6J A;  2BVG A;  4J3O D;  2VFT A;  1HZ6 A;  2KAC A;  4LTU A;  5ADZ A;  2IGD A;  1WRI A;  2GRI A;  3W9C B;  2Y5P A;  1JML A;  4WWM A;  1VQZ A;  4RGM A;  4HKQ A;  2UUV A;  1W1S A;  1FNW A;  2K3U A;  1T5X D;  3W8X A;  1F0Z A;  4XDD A;  4JX1 C;  4PYT A;  1N5X A;  2WXL A;  1T3Q C;  3KLS X;  2RK5 A;  1B1Z A;  4JWU C;  1OFF A;  2AQ1 B;  2LFI A;  4P6V F;  2RDH A;  3W8Z A;  3NVY A;  1AW7 A;  1J7B A;  2MJE A;  1L0X B;  2ON8 A;  2PLP A;  1VZ6 A;  1DOX A;  1SJE D;  3AE7 B;  1WXQ A;  3MHZ A;  2NQW A;  2EXR A;  5HMR A;  1L0V B;  2WXR A;  1X2G A;  3C0P A;  2V3N A;  4RNA A;  3RJA A;  3CIR B;  1Y56 A;  3OWE B;  1E8F A;  3MJ5 A;  2DWQ A;  3AB5 A;  3MFG A;  3W2D A;  1J7C A;  1QIL A;  4PVE A;  1TY0 A;  3BVG A;  1HQR D;  4YSZ B;  1IGD A;  5I1W A;  2H89 B;  3IXS A;  4RGO S;  2NTS A;  3WCQ A;  2ICI A;  1W1J A;  1C4A A;  2WLB A;  2WQY B;  3V3X A;  3S1D A;  1XLN A;  5BYQ A;  3ZJU A;  1FRR A;  5D7G A;  1JQ4 A;  4KGT A;  1RFK A;  4Q2J A;  4C7Z A;  1SBB B;  1WGK A;  2WDR B;  1F2R I;  5FXF A;  2E5A A;  2VFU A;  2W55 A;  1MVK A;  3TUO A;  1KH0 A;  4EC3 A;  1R7S A;  4A90 A;  5BMI A;  1FCL A;  3VQI A;  2WU5 B;  2EEL A;  4RFB A;  4TSS A;  2VAO A;  1N61 A;  1QOA A;  1KF6 B;  4ITK A;  1JWB D;  3IAM 1;  4GLS C;  4OZC A;  1VR9 A;  3U7Z A;  2RDG A;  3NVW A;  3UI3 A;  2GQU A;  1UWX A;  4NJC A;  4KKI A;  2WXJ A;  3AE9 B;  4KKJ A;  3Q8A A;  3ZYY X;  3S1C A;  2NTT A;  3NS1 B;  1DOY A;  5H8Y E;  2BYT A;  1OQR A;  2ONQ A;  2H88 B;  4A9A A;  3T3N A;  1DII A;  4RGN A;  1NYQ A;  1ESF A;  4ARI A;  1NEN B;  2K5P A;  4L1B A;  1N61 C;  3AV8 A;  4RH6 A;  1W1Q A;  1ZXI A;  3AE6 B;  3VRB B;  2L32 A;  1QOF A;  2HDE A;  2BB6 A;  1FRD A;  1IBX B;  2CU3 A;  2J53 A;  4WH4 A;  1F0X A;  4JPS A;  3HRD C;  3EUB 2;  1K50 A;  1XO3 A;  2L52 A;  3I57 A;  1FFV A;  1V97 A;  3TSJ A;  4A8X C;  3FAH A;  2DBY A;  4PVH A;  4HRO A;  1ZXI C;  3E56 A;  4ML8 A;  4A6Q A;  3AN1 A;  1JCK B;  3AEA B;  2VFV A;  5H92 C;  1JAL A;  2WXP A;  5T8I A;  3Q69 A;  4AQ7 A;  3TSH A;  2RPV A;  4YTN B;  1AWD A;  3AE1 B;  3TSS A;  2RMM A;  2ZW1 A;  1V1P B;  1E7P B;  2JZP A;  2KWD A;  1FFV C;  4TVW A;  2LMC A;  1W1K A;  1STE A;  3B2F A;  3LB8 C;  5BYR A;  5I1V A;  3BVZ A;  3AE5 B;  1K51 A;  1VJK A;  2PVG C;  4UD8 A;  4BC9 A;  2KN4 A;  4LK0 M;  2BBC A;  4YTM B;  2V4I B;  5HHD G;  1C9F A;  2Q85 A;  2BTE A;  3FW9 A;  3AEF B;  1VDV A;  5BYS A;  2Y4G A;  1FXA A;  1VZ7 A;  1F2R C;  4M0W A;  3TEY A;  3IT6 B;  3NRZ B;  1UXY A;  1N62 A;  2WU2 B;  3NVZ B;  3S1E A;  1YN3 A;  2XNA C;  4IDI A;  4KX6 B;  2JU6 X;  2BVF A;  1V1P A;  2D5G A;  3PZ7 A;  3P1M A;  1PYW D;  1TKY A;  2EKI A;  4GDK B;  2KMM A;  4KGR A;  4N6E B;  5G5H A;  1BXT A;  1EM7 A;  4TQ0 A;  1AN8 A;  4WAF A;  1TS3 A;  4HRS A;  2R8D A;  1E6E B;  3DED A;  1MPE A;  2WDW A;  2G1E A;  2KQ4 X;  2SEB D;  1AHU A;  2AX5 A;  2LEK A;  1FNV A;  1AYF A;  1UUP A;  1XEE A;  3R2T A;  1N62 C;  5K8E A;  3VR8 B;  3Q8B A;  2WXN A;  3NRZ A;  3HUI A;  3RFZ B;  3NVZ A;  4TVY A;  3VR9 B;  1D5Z C;  1KRH A;  4O1N A;  3PO0 A;  5I4D A;  1P7F A;  1I4R A;  2WXK A;  2Y5C A;  1RM6 C;  2BVH A;  1JRP A;  3BVM A;  2I2Y A;  1ZE3 D;  1ZOY B;  1HSK A;  4OW0 A;  2KAJ A;  3ZQ4 A;  2BT6 A;  3U52 E;  4C80 A;  4KGS A;  3I99 A;  2QPM A;  2XN9 C;  5D3I B;  1W1O A;  1D5M C;  1WWT A;  1QLT A;  2WXM A;  1KTK A;  1CQV A;  1SF0 A;  2IGH A;  2JYE A;  2K0P A;  3GSY A;  2AXR A;  1YJJ A;  1F77 A;  3AMZ A;  2M0A A;  4CQN A;  3SFD B;  1ET9 A;  1TS5 A;  4PVJ A;  3AE3 B;  5AE2 A;  3PM9 A;  1JRO A;  1L4Z B;  1E10 A;  1WSP A;  1YNT E;  2E6X A;  2JX5 A;  2MBR A;  1WVF A;  4MH8 A;  3LXF A;  1HA5 A;  3DWG C;  3T3O A;  3URY A;  1N63 A;  1YN4 A;  2PVO D;  1QQR A;  3MC0 B;  2DYO A;  1W1L A;  3J9C A;  3AEB B;  3C8Y A;  3FW8 A;  3AE8 B;  4ZOH B;  1DIQ A;  1GB1 A;  4D2K A;  3EGR A;  4UDU C;  1L5P A;  1C78 A;  4REZ A;  5FKA C;  3NVV B;  2OHF A;  3P4R B;  1L6U A;  4OZA A;  1SJH D;  3GP7 A;  3LLB A;  2QKN A;  1XLP A;  3FIL B;  1SEB D;  1N63 C;  2INP E;  1GOZ A;  2R2Z A;  3D2J A;  1XXG A;  3ETR B;  3ZJT A;  1HXY D;  1B9R A;  2LHE A;  1GAQ B;  4B0E A;  1NI3 A;  1YMH E;  1SE4 A;  3P42 A;  3BYY B;  1C76 A;  1C77 A;  5C2T B;  2JXT A;  4LLG M;  1PUT A;  1I4G A;  2IPK D;  4OZB A;  4PT5 A;  3NS1 A;  2PKO A;  4HKZ E;  1VZ8 A;  1EU3 A;  1FXI A;  4RGT A;  3N9Y C;  1HEZ E;  2CJN A;  4DXF A;  1L4D B;  3HSU A;  1P7E A;  3GS2 A;  1XF5 L;  1FFU A;  1AHZ A;  1BUI C;  5C3J B;  2G9H D;  3V05 A;  3TEZ A;  5AUK A;  2PW9 A;  5AWV A;  4WUR A;  3AEC B;  2MJD A;  1FM0 D;  1ZXH A;  3AM9 A;  3ETR A;  5BMH A;  3BYT B;  5FR3 A;  1I4H A;  2Y3R A;  3Q8F A;  4GDL B;  4WQM A;  2INN E;  1J7A A;  1NVI D;  2IDY A;  2YEP F;  3B9J B;  1YJI A;  1JWM D;  1TYG B;  2BS3 B;  3IT4 B;  1RYJ A;  1IBX A;  1JWS D;  4PWC A;  1D6E C;  3U4E G;  4ZYS A;  1FMA D;  4JWS C;  1V8C A;  2MH7 A;  3BW7 A;  1FFU C;  1QF6 A;  2GQT A;  4N59 A;  4N58 A;  3POP A;  2QIE B;  2N9K A;  3BZD B;  5LNK 1;  2P13 A;  3TEX A;  4XLO A;  1IGC A;  1K52 A;  1ZUD 2;  2PLI A;  1C4C A;  3A7R A;  1EU4 A;  1D5X C;  1QOG A;  3CWI A;  2Y08 A;  1KFY B;  3HVD A;  1TKE A;  2WP9 B;  2AQ3 B;  5MPO A;  2J4X A;  2X38 A;  2WNM A;  2V3P A;  1I19 A;  4C7Y A;  2DYM A;  4US9 A;  1GB4 A;  1CJE A;  1T6B X;  2K9X A;  1ET6 A;  1W1M A;  3D2H A;  1DYQ A;  3R8B A;  1GPX A;  1PFD A;  1KLU D;  2PTL A;  4AS1 A;  3KWL A;  4YSY B;  4YWG G;  3S1F A;  2BW2 A;  1L0Y B;  4ZRQ A;  4O95 A;  4BC7 A;  3ABV B;  1JW9 D;  3AED B;  2LHD A;  3EA6 A;  1FCC C;  2GI9 A;  5HQX A;  4BCA A;  3MP9 A;  1VRA B;  1CZP A;  1FEH A;  1Q10 A;  4MAC A;  2JYT A;  2W54 A;  1JWU D;  3EUB 3;  1ZPS A;  1ROE A;  4MM3 B;  2LJI A;  1PGB A;  4NAM A;  2VFS A;  2N7J A;  3AEE B;  3NUH B;  2WXH A;  1MBB A;  4OAL A;  4L23 A;  5JXV A;  1D4B A;  2MEK A;  3P63 A;  4TQ1 A;  1E9M A;  1QLB B;  5AUI A;  2Z8L A;  1I4X A;  2IPI A;  3D2D A;  4HG0 A;  3BK2 A;  3NVY B;  3KQ4 A;  1EWY C;  2W3R A;  2QIL A;  1I4P A;  1UGJ A;  4YT0 B;  2WXO A;  1ZR6 A;  1N5W A;  3LYY A;  3W8W A;  3NZ3 A;  2WXF A;  1MI0 A;  2I38 A;  3TX1 A;  4RCO A;  2IJ0 A;  3SR6 B;  2ZW0 A;  3Q8C A;  1I4Q A;  3W5V B;  2PIA A;  1QLU A;  2IGG A;  1TZO A;  1FO4 A;  3FC4 A;  1I7H A;  4ARC A;  3A7A A;  3W5U B;  1XLO A;  1LO5 D;  2BS2 B;  1C79 A;  3PZ8 A;  2FUG 1;  1TKG A;  4OHJ A;  4DXG A;  3LAE A;  1ACC A;  4ZHO A;  3AEG B;  3Q8E A;  3TEW A;  2LGI A;  4NZL B;  1N5W C;  5FK9 C;  1OQQ A;  1SE3 A;  1SB3 B;  1VLB A;  1TS4 A;  2SAK A;  3P4Q B;  1QOB A;  2MJ3 A;  1FD6 A;  2V0G A;  5L6G A;  1AHV A;  2DLB A;  3SR6 A;  3W1S A;  2TSS A;  1RWS A;  3H8H A;  3R07 C;  2Y3S A;  1MHH E;  2WDQ B;  1DGJ A;  3JS8 A;  3NVW B;  1XCQ L;  1ENF A;  2K22 A;  2QEJ C;  2W82 A;  1TJE A;  3SFE B;  2R61 A;  4A55 A;  3SEB A;  4ZRP A;  2W3S A;  4JE3 B;  1ZP0 B;  2OAI A;  4B0M A;  4XWW A;  2WXG A;  1TY2 A;  2N9L A;  2OED A;  4YTP B;  3I9V 1;  4US8 A;  2VZK B;  4DNS A;  2PLS A;  2BS4 B;  3BII D;  1K53 A;  5FXE A;  3GB1 A;  5D3D A;  5TSS A;  4MLA A;  3RJ8 A;  2Y3A A;  4YXD B;  3DWM A;  2LUM A;  4HEA 1;  5HFY A;  4IOI E;  3E9S A;  1SE2 A;  1L6V A;  4FXC A;  5FXP A;  1UNS A;  4R3D A;  3RPF C;  1E8G A;  4XE0 A;  1V1O A;  2JQR B;  1SB3 C;  1MHX A;  2Q5W D;  3R2I A;  2O3G A;  3VRA B;  3NVV A;  1WYG A;  1QKZ A;  4XDC A;  1PGA A;  4BBY A;  4PVK A;  5G5G B;  5EE0 A;  5AE3 A;  1ZDX A;  2P3H A;  2BB5 A;  3FW7 A;  1N60 A;  2WXQ A;  3FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...