4PVJA

Phl p 4 i153v variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
b'EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvjA03
3EUB3 1W1JA 3TSHA 4ZOHB 1N62C 3ETRB 3W8XA 1FFUC 1E8GA 3D2HA 3S1FA 5FXDA 3POPA 1FFVC 5FXEA 4MLAA 4PVKA 2VFRA 2WDWA 3S1EA 2QPMA 2Q4WA 1JROA 4JB1A 1ZXIC 3AN1A 2Y3RA 1AHVA 1E8HA 1N63C 1DIQA 4PYTA 5AE3A 1I19A 3W8ZA 5L6GA 2I0KA 3SR6B 4XLOA 3RJ8A 5FXPA 2GQTA 1UXYA 3PM9A 2E3TA 2W3SA 3JS8A 1ZR6A 2W54A 1WVEA 5AWVA 1FIQB 1F0XA 3S1DA 2BVFA 3FW7A 4ML8A 1W1SA 3BW7A 2VFSA 1HSKA 1V97A 4PZFA 1N5WC 4PVJA 2MBRA 5K8EA 5FXFA 2QKNA 3B9JB 4EC3A 4BBYA 5ADZA 3S1CA 2BVGA 3FW8A 4PWCA 3TSJA 2Q85A 1AHUA 1N61C 4BCAA 5HHZA 4BC7A 1WVFA 1N60C 1FO4A 1QLTA 3NS1B 5HMRA 1W1KA 1W1LA 3TX1A 5D79A 5HQXA 3AM9A 1MBTA 2GQUA 3FWAA 2Y08A 3RJAA 1N5XA 3AMZA 1E0YA 1W1RA 3NRZB 5I1VA 1QLUA 4O95A 3GSYA 1DZNA 1MBBA 3KJMA 2IPIA 3HSUA 2VFVA 5L6FA 3W8WA 2VAOA 3I99A 1AHZA 5AE2A 2Y3SA 1W1QA 3D2DA 1W1OA 5AE1A 3FW9A 2EXRA 2W55A 5I1WA 2VFUA 3VTEA 4PVHA 4DNSA 1DIIA 3DQ0A 4PVEA 3PQBA 4UD8A 1WYGA 2AXRA 1VAOA 4BC9A 4JAYA 3C0PA 1T3QC 4PWBA 2VFTA 3D2JA 2W3RA 3NVZB 2BVHA 1VDVA 1W1MA 1E8FA 4OALA 2Y4GA
chains in the Genus database with same CATH superfamily
3EUB3 1W1JA 3TSHA 4ZOHB 1N62C 3ETRB 3W8XA 1FFUC 1E8GA 3EJEB 3LLBA 5G5HB 1RM6B 3D2HA 3S1FA 5FXDA 3POPA 1FFVC 5FXEA 4MLAA 4PVKA 2VFRA 2WDWA 3S1EA 3NVVB 2QPMA 2Q4WA 1JROA 4JB1A 1ZXIC 3AN1A 2Y3RA 1AHVA 1E8HA 1N63C 1DIQA 4PYTA 5AE3A 1I19A 3W8ZA 5L6GA 2I0KA 3SR6B 4XLOA 2P3HA 2RK5A 3RJ8A 5G5GB 5FXPA 1SB3B 2GQTA 1UXYA 3PM9A 2UUVA 2E3TA 2W3SA 3JS8A 1ZR6A 2W54A 3LAEA 1WVEA 5AWVA 1FIQB 1F0XA 3S1DA 2R2ZA 2BVFA 3FW7A 4ML8A 1W1SA 3BW7A 2VFSA 2UUUA 1HSKA 3NVYB 1V97A 4PZFA 1N5WC 4PVJA 2MBRA 5K8EA 5FXFA 2QKNA 3B9JB 4EC3A 4BBYA 5ADZA 3S1CA 2BVGA 3FW8A 4PWCA 3TSJA 2Q85A 1AHUA 1N61C 4BCAA 2O3GA 5HHZA 4BC7A 1WVFA 1N60C 1FO4A 1QLTA 3NS1B 5HMRA 2YVSA 1W1KA 2NQWA 1W1LA 2PLSA 3TX1A 5D79A 5HQXA 3AM9A 1MBTA 2GQUA 3FWAA 2Y08A 2P4PA 3RJAA 1N5XA 3AMZA 3DEDA 1E0YA 1W1RA 3NRZB 5I1VA 1QLUA 4O95A 3GSYA 1DZNA 1MBBA 3KJMA 2IPIA 2R8DA 2VFVA 3HSUA 5L6FA 3NVWB 3W8WA 2VAOA 3I99A 1AHZA 5AE2A 2P13A 2Y3SA 1W1QA 3D2DA 1W1OA 3EJBB 5AE1A 3FW9A 3HRDC 2EXRA 2W55A 1JRPA 5I1WA 3EJDB 2VFUA 3VTEA 4PVHA 4DNSA 1DIIA 3DQ0A 4PVEA 3PQBA 4UD8A 2OAIA 1WYGA 4HG0A 2AXRA 1VAOA 4BC9A 4JAYA 3C0PA 1T3QC 4PWBA 2VFTA 3D2JA 2W3RA 3NVZB 2BVHA 1VDVA 2PLIA 1W1MA 1E8FA 4OALA 2Y4GA
chains in the Genus database with same CATH topology
3EUB3 1W1JA 3TSHA 4ZOHB 1N62C 3ETRB 3W8XA 1FFUC 1E8GA 3LLBA 5G5HB 1RM6B 3D2HA 3S1FA 5FXDA 3POPA 1FFVC 5FXEA 4MLAA 4PVKA 2VFRA 2WDWA 3S1EA 3NVVB 2QPMA 2Q4WA 1JROA 4JB1A 1ZXIC 3AN1A 2Y3RA 1AHVA 1E8HA 1N63C 1DIQA 4PYTA 5AE3A 1I19A 3W8ZA 5L6GA 2I0KA 3SR6B 4XLOA 2P3HA 2RK5A 3RJ8A 5G5GB 5FXPA 1SB3B 2GQTA 1UXYA 3PM9A 2UUVA 2E3TA 2W3SA 3JS8A 1ZR6A 2W54A 3LAEA 1WVEA 5AWVA 1FIQB 1F0XA 3S1DA 2R2ZA 2BVFA 3FW7A 4ML8A 1W1SA 3BW7A 2VFSA 2UUUA 1HSKA 3NVYB 1V97A 4PZFA 1N5WC 4PVJA 2MBRA 5K8EA 5FXFA 2QKNA 3B9JB 4EC3A 4BBYA 5ADZA 3S1CA 2BVGA 3FW8A 4PWCA 3TSJA 2Q85A 1AHUA 1N61C 4BCAA 2O3GA 5HHZA 4BC7A 1WVFA 1N60C 1FO4A 1QLTA 3NS1B 5HMRA 2YVSA 1W1KA 2NQWA 1W1LA 2PLSA 3TX1A 5D79A 5HQXA 3AM9A 1MBTA 2GQUA 3FWAA 2Y08A 2P4PA 3RJAA 1N5XA 3AMZA 3DEDA 1E0YA 1W1RA 3NRZB 5I1VA 1QLUA 4O95A 3GSYA 1DZNA 1MBBA 3KJMA 2IPIA 2R8DA 2VFVA 3HSUA 5L6FA 3NVWB 3W8WA 2VAOA 3I99A 1AHZA 5AE2A 2P13A 2Y3SA 1W1QA 3D2DA 1W1OA 5AE1A 3FW9A 3HRDC 2EXRA 2W55A 1JRPA 5I1WA 2VFUA 3VTEA 4PVHA 4DNSA 1DIIA 3DQ0A 4PVEA 3PQBA 4UD8A 2OAIA 1WYGA 4HG0A 2AXRA 1VAOA 4BC9A 4JAYA 3C0PA 1T3QC 4PWBA 2VFTA 3D2JA 2W3RA 3NVZB 2BVHA 1VDVA 2PLIA 1W1MA 1E8FA 4OALA 2Y4GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUB 3;  1W1J A;  3TSH A;  4ZOH B;  1N62 C;  3ETR B;  3W8X A;  1FFU C;  1E8G A;  3D2H A;  3S1F A;  5FXD A;  3POP A;  1FFV C;  5FXE A;  4MLA A;  4PVK A;  2VFR A;  2WDW A;  3S1E A;  2QPM A;  2Q4W A;  1JRO A;  4JB1 A;  1ZXI C;  3AN1 A;  2Y3R A;  1AHV A;  1E8H A;  1N63 C;  1DIQ A;  4PYT A;  5AE3 A;  1I19 A;  3W8Z A;  5L6G A;  2I0K A;  3SR6 B;  4XLO A;  3RJ8 A;  5FXP A;  2GQT A;  1UXY A;  3PM9 A;  2E3T A;  2W3S A;  3JS8 A;  1ZR6 A;  2W54 A;  1WVE A;  5AWV A;  1FIQ B;  1F0X A;  3S1D A;  2BVF A;  3FW7 A;  4ML8 A;  1W1S A;  3BW7 A;  2VFS A;  1HSK A;  1V97 A;  4PZF A;  1N5W C;  4PVJ A;  2MBR A;  5K8E A;  5FXF A;  2QKN A;  3B9J B;  4EC3 A;  4BBY A;  5ADZ A;  3S1C A;  2BVG A;  3FW8 A;  4PWC A;  3TSJ A;  2Q85 A;  1AHU A;  1N61 C;  4BCA A;  5HHZ A;  4BC7 A;  1WVF A;  1N60 C;  1FO4 A;  1QLT A;  3NS1 B;  5HMR A;  1W1K A;  1W1L A;  3TX1 A;  5D79 A;  5HQX A;  3AM9 A;  1MBT A;  2GQU A;  3FWA A;  2Y08 A;  3RJA A;  1N5X A;  3AMZ A;  1E0Y A;  1W1R A;  3NRZ B;  5I1V A;  1QLU A;  4O95 A;  3GSY A;  1DZN A;  1MBB A;  3KJM A;  2IPI A;  3HSU A;  2VFV A;  5L6F A;  3W8W A;  2VAO A;  3I99 A;  1AHZ A;  5AE2 A;  2Y3S A;  1W1Q A;  3D2D A;  1W1O A;  5AE1 A;  3FW9 A;  2EXR A;  2W55 A;  5I1W A;  2VFU A;  3VTE A;  4PVH A;  4DNS A;  1DII A;  3DQ0 A;  4PVE A;  3PQB A;  4UD8 A;  1WYG A;  2AXR A;  1VAO A;  4BC9 A;  4JAY A;  3C0P A;  1T3Q C;  4PWB A;  2VFT A;  3D2J A;  2W3R A;  3NVZ B;  2BVH A;  1VDV A;  1W1M A;  1E8F A;  4OAL A;  2Y4G A; 
#chains in the Genus database with same CATH topology
 3EUB 3;  1W1J A;  3TSH A;  4ZOH B;  1N62 C;  3ETR B;  3W8X A;  1FFU C;  1E8G A;  3EJE B;  3LLB A;  5G5H B;  1RM6 B;  3D2H A;  3S1F A;  5FXD A;  3POP A;  1FFV C;  5FXE A;  4MLA A;  4PVK A;  2VFR A;  2WDW A;  3S1E A;  3NVV B;  2QPM A;  2Q4W A;  1JRO A;  4JB1 A;  1ZXI C;  3AN1 A;  2Y3R A;  1AHV A;  1E8H A;  1N63 C;  1DIQ A;  4PYT A;  5AE3 A;  1I19 A;  3W8Z A;  5L6G A;  2I0K A;  3SR6 B;  4XLO A;  2P3H A;  2RK5 A;  3RJ8 A;  5G5G B;  5FXP A;  1SB3 B;  2GQT A;  1UXY A;  3PM9 A;  2UUV A;  2E3T A;  2W3S A;  3JS8 A;  1ZR6 A;  2W54 A;  3LAE A;  1WVE A;  5AWV A;  1FIQ B;  1F0X A;  3S1D A;  2R2Z A;  2BVF A;  3FW7 A;  4ML8 A;  1W1S A;  3BW7 A;  2VFS A;  2UUU A;  1HSK A;  3NVY B;  1V97 A;  4PZF A;  1N5W C;  4PVJ A;  2MBR A;  5K8E A;  5FXF A;  2QKN A;  3B9J B;  4EC3 A;  4BBY A;  5ADZ A;  3S1C A;  2BVG A;  3FW8 A;  4PWC A;  3TSJ A;  2Q85 A;  1AHU A;  1N61 C;  4BCA A;  2O3G A;  5HHZ A;  4BC7 A;  1WVF A;  1N60 C;  1FO4 A;  1QLT A;  3NS1 B;  5HMR A;  2YVS A;  1W1K A;  2NQW A;  1W1L A;  2PLS A;  3TX1 A;  5D79 A;  5HQX A;  3AM9 A;  1MBT A;  2GQU A;  3FWA A;  2Y08 A;  2P4P A;  3RJA A;  1N5X A;  3AMZ A;  3DED A;  1E0Y A;  1W1R A;  3NRZ B;  5I1V A;  1QLU A;  4O95 A;  3GSY A;  1DZN A;  1MBB A;  3KJM A;  2IPI A;  2R8D A;  2VFV A;  3HSU A;  5L6F A;  3NVW B;  3W8W A;  2VAO A;  3I99 A;  1AHZ A;  5AE2 A;  2P13 A;  2Y3S A;  1W1Q A;  3D2D A;  1W1O A;  3EJB B;  5AE1 A;  3FW9 A;  3HRD C;  2EXR A;  2W55 A;  1JRP A;  5I1W A;  3EJD B;  2VFU A;  3VTE A;  4PVH A;  4DNS A;  1DII A;  3DQ0 A;  4PVE A;  3PQB A;  4UD8 A;  2OAI A;  1WYG A;  4HG0 A;  2AXR A;  1VAO A;  4BC9 A;  4JAY A;  3C0P A;  1T3Q C;  4PWB A;  2VFT A;  3D2J A;  2W3R A;  3NVZ B;  2BVH A;  1VDV A;  2PLI A;  1W1M A;  1E8F A;  4OAL A;  2Y4G A; 
#chains in the Genus database with same CATH homology
 3EUB 3;  1W1J A;  3TSH A;  4ZOH B;  1N62 C;  3ETR B;  3W8X A;  1FFU C;  1E8G A;  3LLB A;  5G5H B;  1RM6 B;  3D2H A;  3S1F A;  5FXD A;  3POP A;  1FFV C;  5FXE A;  4MLA A;  4PVK A;  2VFR A;  2WDW A;  3S1E A;  3NVV B;  2QPM A;  2Q4W A;  1JRO A;  4JB1 A;  1ZXI C;  3AN1 A;  2Y3R A;  1AHV A;  1E8H A;  1N63 C;  1DIQ A;  4PYT A;  5AE3 A;  1I19 A;  3W8Z A;  5L6G A;  2I0K A;  3SR6 B;  4XLO A;  2P3H A;  2RK5 A;  3RJ8 A;  5G5G B;  5FXP A;  1SB3 B;  2GQT A;  1UXY A;  3PM9 A;  2UUV A;  2E3T A;  2W3S A;  3JS8 A;  1ZR6 A;  2W54 A;  3LAE A;  1WVE A;  5AWV A;  1FIQ B;  1F0X A;  3S1D A;  2R2Z A;  2BVF A;  3FW7 A;  4ML8 A;  1W1S A;  3BW7 A;  2VFS A;  2UUU A;  1HSK A;  3NVY B;  1V97 A;  4PZF A;  1N5W C;  4PVJ A;  2MBR A;  5K8E A;  5FXF A;  2QKN A;  3B9J B;  4EC3 A;  4BBY A;  5ADZ A;  3S1C A;  2BVG A;  3FW8 A;  4PWC A;  3TSJ A;  2Q85 A;  1AHU A;  1N61 C;  4BCA A;  2O3G A;  5HHZ A;  4BC7 A;  1WVF A;  1N60 C;  1FO4 A;  1QLT A;  3NS1 B;  5HMR A;  2YVS A;  1W1K A;  2NQW A;  1W1L A;  2PLS A;  3TX1 A;  5D79 A;  5HQX A;  3AM9 A;  1MBT A;  2GQU A;  3FWA A;  2Y08 A;  2P4P A;  3RJA A;  1N5X A;  3AMZ A;  3DED A;  1E0Y A;  1W1R A;  3NRZ B;  5I1V A;  1QLU A;  4O95 A;  3GSY A;  1DZN A;  1MBB A;  3KJM A;  2IPI A;  2R8D A;  2VFV A;  3HSU A;  5L6F A;  3NVW B;  3W8W A;  2VAO A;  3I99 A;  1AHZ A;  5AE2 A;  2P13 A;  2Y3S A;  1W1Q A;  3D2D A;  1W1O A;  5AE1 A;  3FW9 A;  3HRD C;  2EXR A;  2W55 A;  1JRP A;  5I1W A;  2VFU A;  3VTE A;  4PVH A;  4DNS A;  1DII A;  3DQ0 A;  4PVE A;  3PQB A;  4UD8 A;  2OAI A;  1WYG A;  4HG0 A;  2AXR A;  1VAO A;  4BC9 A;  4JAY A;  3C0P A;  1T3Q C;  4PWB A;  2VFT A;  3D2J A;  2W3R A;  3NVZ B;  2BVH A;  1VDV A;  2PLI A;  1W1M A;  1E8F A;  4OAL A;  2Y4G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...