4PVJA

Phl p 4 i153v variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvjA03
3SR6B 3ETRB 1DIIA 1HSKA 4O95A 2VFUA 3PQBA 3FWAA 1FFUC 3FW7A 3S1CA 1N62C 2Y3SA 4UD8A 3AN1A 1N61C 1DIQA 1F0XA 5K8EA 4PVEA 3NVZB 1FFVC 5AE1A 3GSYA 3W8ZA 2MBRA 1WVFA 2QPMA 2Y4GA 1E8FA 1WYGA 4PWCA 3RJ8A 5L6FA 1E8GA 5I1VA 4BBYA 2Y08A 3JS8A 3S1DA 4PYTA 2I0KA 5FXEA 3RJAA 5L6GA 1JROA 4EC3A 5FXFA 2GQTA 4PWBA 2E3TA 3EUB3 1QLTA 4PVKA 2BVGA 3NS1B 5D79A 3W8WA 1N63C 2W3SA 1FO4A 2VFSA 5FXDA 4BC7A 1FIQB 1VDVA 2Q85A 3PM9A 4ZOHB 2QKNA 1W1RA 1AHZA 1MBTA 2Q4WA 3NRZB 4PVHA 1W1SA 1T3QC 3D2HA 1E0YA 4PVJA 5HMRA 3W8XA 1W1KA 3D2DA 1I19A 3AM9A 2VFTA 1W1QA 2AXRA 4JB1A 4JAYA 3S1FA 3DQ0A 1QLUA 1N5WC 1W1JA 1ZXIC 4BCAA 1DZNA 5AWVA 3BW7A 1UXYA 2BVHA 3KJMA 5FXPA 3HSUA 1MBBA 1N60C 3TSJA 1W1LA 4XLOA 3TSHA 2W54A 5AE3A 1V97A 5AE2A 5HHZA 4OALA 3AMZA 2EXRA 4ML8A 3I99A 2IPIA 1E8HA 2W3RA 2BVFA 2Y3RA 1ZR6A 1W1OA 4DNSA 1W1MA 5I1WA 3FW9A 2VFVA 4PZFA 1AHVA 4MLAA 1N5XA 4BC9A 2W55A 3TX1A 5ADZA 5HQXA 2WDWA 3FW8A 3D2JA 2VAOA 2VFRA 1WVEA 1AHUA 1VAOA 3S1EA 3C0PA 2GQUA 3VTEA 3POPA 3B9JB
chains in the Genus database with same CATH superfamily
3SR6B 3ETRB 1DIIA 1HSKA 4O95A 2VFUA 3PQBA 3FWAA 3NVVB 1RM6B 1FFUC 3FW7A 3S1CA 1N62C 2Y3SA 4UD8A 3AN1A 1N61C 1DIQA 1F0XA 5K8EA 2NQWA 4PVEA 3NVZB 1FFVC 5AE1A 3GSYA 3W8ZA 2MBRA 1WVFA 2QPMA 2Y4GA 1E8FA 1WYGA 2P4PA 4PWCA 3RJ8A 5L6FA 1E8GA 2OAIA 5I1VA 4BBYA 1JRPA 2Y08A 3JS8A 3S1DA 4PYTA 2I0KA 5FXEA 3RJAA 5L6GA 3EJEB 1JROA 4EC3A 5FXFA 2GQTA 4PWBA 2E3TA 3EUB3 1QLTA 4PVKA 2BVGA 3NS1B 5D79A 3W8WA 1N63C 2W3SA 1FO4A 2VFSA 5FXDA 4BC7A 1FIQB 1VDVA 2Q85A 3PM9A 4ZOHB 2QKNA 1W1RA 3EJBB 1AHZA 1MBTA 2Q4WA 3NRZB 4PVHA 4HG0A 3DEDA 1W1SA 1T3QC 2UUVA 3D2HA 1E0YA 4PVJA 5HMRA 3W8XA 2R2ZA 1W1KA 3D2DA 3NVYB 1I19A 3AM9A 2VFTA 2P13A 1W1QA 2AXRA 3LAEA 4JB1A 4JAYA 3S1FA 3DQ0A 1QLUA 1N5WC 1W1JA 1ZXIC 4BCAA 1DZNA 5AWVA 3BW7A 1UXYA 2BVHA 3KJMA 5FXPA 3HSUA 3LLBA 1MBBA 1N60C 2UUUA 3TSJA 1W1LA 4XLOA 3TSHA 2W54A 5AE3A 1V97A 5AE2A 3NVWB 2P3HA 2RK5A 5G5GB 5HHZA 4OALA 3AMZA 2EXRA 4ML8A 3I99A 2IPIA 1E8HA 2W3RA 2BVFA 2Y3RA 1ZR6A 2YVSA 2PLSA 1W1OA 4DNSA 1W1MA 5I1WA 3FW9A 2VFVA 4PZFA 3HRDC 2R8DA 1AHVA 4MLAA 1SB3B 3EJDB 5G5HB 1N5XA 4BC9A 2W55A 3TX1A 5ADZA 5HQXA 2WDWA 3FW8A 3D2JA 2VAOA 2VFRA 1WVEA 1AHUA 1VAOA 3S1EA 3C0PA 2PLIA 2O3GA 2GQUA 3VTEA 3POPA 3B9JB
chains in the Genus database with same CATH topology
3SR6B 3ETRB 1DIIA 1HSKA 4O95A 2VFUA 3PQBA 3FWAA 3NVVB 1RM6B 1FFUC 3FW7A 3S1CA 1N62C 2Y3SA 4UD8A 3AN1A 1N61C 1DIQA 1F0XA 5K8EA 2NQWA 4PVEA 3NVZB 1FFVC 5AE1A 3GSYA 3W8ZA 2MBRA 1WVFA 2QPMA 2Y4GA 1E8FA 1WYGA 2P4PA 4PWCA 3RJ8A 5L6FA 1E8GA 2OAIA 5I1VA 4BBYA 1JRPA 2Y08A 3JS8A 3S1DA 4PYTA 2I0KA 5FXEA 3RJAA 5L6GA 1JROA 4EC3A 5FXFA 2GQTA 4PWBA 2E3TA 3EUB3 1QLTA 4PVKA 2BVGA 3NS1B 5D79A 3W8WA 1N63C 2W3SA 1FO4A 2VFSA 5FXDA 4BC7A 1FIQB 1VDVA 2Q85A 3PM9A 4ZOHB 2QKNA 1W1RA 1AHZA 1MBTA 2Q4WA 3NRZB 4PVHA 4HG0A 3DEDA 1W1SA 1T3QC 2UUVA 3D2HA 1E0YA 4PVJA 5HMRA 3W8XA 2R2ZA 1W1KA 3D2DA 3NVYB 1I19A 3AM9A 2VFTA 2P13A 1W1QA 2AXRA 3LAEA 4JB1A 4JAYA 3S1FA 3DQ0A 1QLUA 1N5WC 1W1JA 1ZXIC 4BCAA 1DZNA 5AWVA 3BW7A 1UXYA 2BVHA 3KJMA 5FXPA 3HSUA 3LLBA 1MBBA 1N60C 2UUUA 3TSJA 1W1LA 4XLOA 3TSHA 2W54A 5AE3A 1V97A 5AE2A 3NVWB 2P3HA 2RK5A 5G5GB 5HHZA 4OALA 3AMZA 2EXRA 4ML8A 3I99A 2IPIA 1E8HA 2W3RA 2BVFA 2Y3RA 1ZR6A 2YVSA 2PLSA 1W1OA 4DNSA 1W1MA 5I1WA 3FW9A 2VFVA 4PZFA 3HRDC 2R8DA 1AHVA 4MLAA 1SB3B 5G5HB 1N5XA 4BC9A 2W55A 3TX1A 5ADZA 5HQXA 2WDWA 3FW8A 3D2JA 2VAOA 2VFRA 1WVEA 1AHUA 1VAOA 3S1EA 3C0PA 2PLIA 2O3GA 2GQUA 3VTEA 3POPA 3B9JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 B;  3ETR B;  1DII A;  1HSK A;  4O95 A;  2VFU A;  3PQB A;  3FWA A;  1FFU C;  3FW7 A;  3S1C A;  1N62 C;  2Y3S A;  4UD8 A;  3AN1 A;  1N61 C;  1DIQ A;  1F0X A;  5K8E A;  4PVE A;  3NVZ B;  1FFV C;  5AE1 A;  3GSY A;  3W8Z A;  2MBR A;  1WVF A;  2QPM A;  2Y4G A;  1E8F A;  1WYG A;  4PWC A;  3RJ8 A;  5L6F A;  1E8G A;  5I1V A;  4BBY A;  2Y08 A;  3JS8 A;  3S1D A;  4PYT A;  2I0K A;  5FXE A;  3RJA A;  5L6G A;  1JRO A;  4EC3 A;  5FXF A;  2GQT A;  4PWB A;  2E3T A;  3EUB 3;  1QLT A;  4PVK A;  2BVG A;  3NS1 B;  5D79 A;  3W8W A;  1N63 C;  2W3S A;  1FO4 A;  2VFS A;  5FXD A;  4BC7 A;  1FIQ B;  1VDV A;  2Q85 A;  3PM9 A;  4ZOH B;  2QKN A;  1W1R A;  1AHZ A;  1MBT A;  2Q4W A;  3NRZ B;  4PVH A;  1W1S A;  1T3Q C;  3D2H A;  1E0Y A;  4PVJ A;  5HMR A;  3W8X A;  1W1K A;  3D2D A;  1I19 A;  3AM9 A;  2VFT A;  1W1Q A;  2AXR A;  4JB1 A;  4JAY A;  3S1F A;  3DQ0 A;  1QLU A;  1N5W C;  1W1J A;  1ZXI C;  4BCA A;  1DZN A;  5AWV A;  3BW7 A;  1UXY A;  2BVH A;  3KJM A;  5FXP A;  3HSU A;  1MBB A;  1N60 C;  3TSJ A;  1W1L A;  4XLO A;  3TSH A;  2W54 A;  5AE3 A;  1V97 A;  5AE2 A;  5HHZ A;  4OAL A;  3AMZ A;  2EXR A;  4ML8 A;  3I99 A;  2IPI A;  1E8H A;  2W3R A;  2BVF A;  2Y3R A;  1ZR6 A;  1W1O A;  4DNS A;  1W1M A;  5I1W A;  3FW9 A;  2VFV A;  4PZF A;  1AHV A;  4MLA A;  1N5X A;  4BC9 A;  2W55 A;  3TX1 A;  5ADZ A;  5HQX A;  2WDW A;  3FW8 A;  3D2J A;  2VAO A;  2VFR A;  1WVE A;  1AHU A;  1VAO A;  3S1E A;  3C0P A;  2GQU A;  3VTE A;  3POP A;  3B9J B; 
#chains in the Genus database with same CATH topology
 3SR6 B;  3ETR B;  1DII A;  1HSK A;  4O95 A;  2VFU A;  3PQB A;  3FWA A;  3NVV B;  1RM6 B;  1FFU C;  3FW7 A;  3S1C A;  1N62 C;  2Y3S A;  4UD8 A;  3AN1 A;  1N61 C;  1DIQ A;  1F0X A;  5K8E A;  2NQW A;  4PVE A;  3NVZ B;  1FFV C;  5AE1 A;  3GSY A;  3W8Z A;  2MBR A;  1WVF A;  2QPM A;  2Y4G A;  1E8F A;  1WYG A;  2P4P A;  4PWC A;  3RJ8 A;  5L6F A;  1E8G A;  2OAI A;  5I1V A;  4BBY A;  1JRP A;  2Y08 A;  3JS8 A;  3S1D A;  4PYT A;  2I0K A;  5FXE A;  3RJA A;  5L6G A;  3EJE B;  1JRO A;  4EC3 A;  5FXF A;  2GQT A;  4PWB A;  2E3T A;  3EUB 3;  1QLT A;  4PVK A;  2BVG A;  3NS1 B;  5D79 A;  3W8W A;  1N63 C;  2W3S A;  1FO4 A;  2VFS A;  5FXD A;  4BC7 A;  1FIQ B;  1VDV A;  2Q85 A;  3PM9 A;  4ZOH B;  2QKN A;  1W1R A;  3EJB B;  1AHZ A;  1MBT A;  2Q4W A;  3NRZ B;  4PVH A;  4HG0 A;  3DED A;  1W1S A;  1T3Q C;  2UUV A;  3D2H A;  1E0Y A;  4PVJ A;  5HMR A;  3W8X A;  2R2Z A;  1W1K A;  3D2D A;  3NVY B;  1I19 A;  3AM9 A;  2VFT A;  2P13 A;  1W1Q A;  2AXR A;  3LAE A;  4JB1 A;  4JAY A;  3S1F A;  3DQ0 A;  1QLU A;  1N5W C;  1W1J A;  1ZXI C;  4BCA A;  1DZN A;  5AWV A;  3BW7 A;  1UXY A;  2BVH A;  3KJM A;  5FXP A;  3HSU A;  3LLB A;  1MBB A;  1N60 C;  2UUU A;  3TSJ A;  1W1L A;  4XLO A;  3TSH A;  2W54 A;  5AE3 A;  1V97 A;  5AE2 A;  3NVW B;  2P3H A;  2RK5 A;  5G5G B;  5HHZ A;  4OAL A;  3AMZ A;  2EXR A;  4ML8 A;  3I99 A;  2IPI A;  1E8H A;  2W3R A;  2BVF A;  2Y3R A;  1ZR6 A;  2YVS A;  2PLS A;  1W1O A;  4DNS A;  1W1M A;  5I1W A;  3FW9 A;  2VFV A;  4PZF A;  3HRD C;  2R8D A;  1AHV A;  4MLA A;  1SB3 B;  3EJD B;  5G5H B;  1N5X A;  4BC9 A;  2W55 A;  3TX1 A;  5ADZ A;  5HQX A;  2WDW A;  3FW8 A;  3D2J A;  2VAO A;  2VFR A;  1WVE A;  1AHU A;  1VAO A;  3S1E A;  3C0P A;  2PLI A;  2O3G A;  2GQU A;  3VTE A;  3POP A;  3B9J B; 
#chains in the Genus database with same CATH homology
 3SR6 B;  3ETR B;  1DII A;  1HSK A;  4O95 A;  2VFU A;  3PQB A;  3FWA A;  3NVV B;  1RM6 B;  1FFU C;  3FW7 A;  3S1C A;  1N62 C;  2Y3S A;  4UD8 A;  3AN1 A;  1N61 C;  1DIQ A;  1F0X A;  5K8E A;  2NQW A;  4PVE A;  3NVZ B;  1FFV C;  5AE1 A;  3GSY A;  3W8Z A;  2MBR A;  1WVF A;  2QPM A;  2Y4G A;  1E8F A;  1WYG A;  2P4P A;  4PWC A;  3RJ8 A;  5L6F A;  1E8G A;  2OAI A;  5I1V A;  4BBY A;  1JRP A;  2Y08 A;  3JS8 A;  3S1D A;  4PYT A;  2I0K A;  5FXE A;  3RJA A;  5L6G A;  1JRO A;  4EC3 A;  5FXF A;  2GQT A;  4PWB A;  2E3T A;  3EUB 3;  1QLT A;  4PVK A;  2BVG A;  3NS1 B;  5D79 A;  3W8W A;  1N63 C;  2W3S A;  1FO4 A;  2VFS A;  5FXD A;  4BC7 A;  1FIQ B;  1VDV A;  2Q85 A;  3PM9 A;  4ZOH B;  2QKN A;  1W1R A;  1AHZ A;  1MBT A;  2Q4W A;  3NRZ B;  4PVH A;  4HG0 A;  3DED A;  1W1S A;  1T3Q C;  2UUV A;  3D2H A;  1E0Y A;  4PVJ A;  5HMR A;  3W8X A;  2R2Z A;  1W1K A;  3D2D A;  3NVY B;  1I19 A;  3AM9 A;  2VFT A;  2P13 A;  1W1Q A;  2AXR A;  3LAE A;  4JB1 A;  4JAY A;  3S1F A;  3DQ0 A;  1QLU A;  1N5W C;  1W1J A;  1ZXI C;  4BCA A;  1DZN A;  5AWV A;  3BW7 A;  1UXY A;  2BVH A;  3KJM A;  5FXP A;  3HSU A;  3LLB A;  1MBB A;  1N60 C;  2UUU A;  3TSJ A;  1W1L A;  4XLO A;  3TSH A;  2W54 A;  5AE3 A;  1V97 A;  5AE2 A;  3NVW B;  2P3H A;  2RK5 A;  5G5G B;  5HHZ A;  4OAL A;  3AMZ A;  2EXR A;  4ML8 A;  3I99 A;  2IPI A;  1E8H A;  2W3R A;  2BVF A;  2Y3R A;  1ZR6 A;  2YVS A;  2PLS A;  1W1O A;  4DNS A;  1W1M A;  5I1W A;  3FW9 A;  2VFV A;  4PZF A;  3HRD C;  2R8D A;  1AHV A;  4MLA A;  1SB3 B;  5G5H B;  1N5X A;  4BC9 A;  2W55 A;  3TX1 A;  5ADZ A;  5HQX A;  2WDW A;  3FW8 A;  3D2J A;  2VAO A;  2VFR A;  1WVE A;  1AHU A;  1VAO A;  3S1E A;  3C0P A;  2PLI A;  2O3G A;  2GQU A;  3VTE A;  3POP A;  3B9J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...