4PVJA

Phl p 4 i153v variant, a glucose oxidase
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
total genus 160
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pvjA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pvjA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pvjA03
4PVKA 2VFSA 4OALA 4XLOA 1W1JA 1UXYA 3S1DA 2Y3SA 1QLTA 1I19A 3D2JA 1E0YA 3AMZA 2Q4WA 1F0XA 5FXDA 2WDWA 1DZNA 4JAYA 3S1CA 3POPA 1WVEA 3AN1A 1ZXIC 3FW8A 3D2HA 3EUB3 1W1MA 1VAOA 3RJAA 5AE1A 1E8GA 1ZR6A 3W8XA 2GQTA 3C0PA 5FXPA 4PWCA 5AE3A 2VFRA 5ADZA 4PVHA 2Q85A 1V97A 1VDVA 3PM9A 3DQ0A 4PYTA 4ML8A 2E3TA 2BVFA 2MBRA 3AM9A 4JB1A 1DIQA 1AHZA 1N62C 3D2DA 3JS8A 2W55A 4PZFA 3RJ8A 4BC9A 1AHUA 3KJMA 3NS1B 3TSJA 3I99A 3W8WA 1E8FA 2BVGA 2QPMA 3NRZB 4PVJA 3TX1A 2IPIA 2VFVA 5HMRA 5I1VA 3B9JB 3ETRB 3FWAA 3FW7A 1W1SA 1FFVC 3NVZB 5L6FA 2W3RA 1W1KA 3GSYA 4PWBA 5L6GA 5HQXA 1N5XA 2GQUA 2W3SA 1FFUC 1QLUA 4EC3A 2Y4GA 3W8ZA 1E8HA 1MBTA 1W1RA 1W1LA 2VFTA 1WYGA 2VFUA 3BW7A 4DNSA 2Y08A 1N61C 2I0KA 3S1FA 1T3QC 4BCAA 4MLAA 1N60C 3SR6B 1AHVA 4O95A 1MBBA 1DIIA 3FW9A 3PQBA 4UD8A 1W1OA 5FXEA 2VAOA 5I1WA 1FIQB 1N63C 4BC7A 1JROA 1W1QA 4PVEA 3S1EA 5AE2A 2EXRA 5K8EA 3VTEA 2QKNA 4ZOHB 1N5WC 5AWVA 5FXFA 4BBYA 2AXRA 2BVHA 2W54A 5D79A 1WVFA 3TSHA 1FO4A 1HSKA 5HHZA 2Y3RA 3HSUA
chains in the Genus database with same CATH superfamily
4PVKA 2VFSA 4OALA 4XLOA 1W1JA 2O3GA 1UXYA 2YVSA 3S1DA 2Y3SA 3DEDA 1QLTA 1I19A 3LLBA 3D2JA 1E0YA 3AMZA 2Q4WA 1JRPA 1F0XA 5FXDA 2WDWA 1DZNA 2PLSA 4JAYA 3S1CA 3POPA 1WVEA 3AN1A 2OAIA 1ZXIC 3FW8A 3D2HA 3EUB3 1W1MA 3NVWB 1VAOA 3RJAA 5AE1A 1E8GA 1ZR6A 3W8XA 2GQTA 3C0PA 5FXPA 4PWCA 2UUUA 5AE3A 2R2ZA 2VFRA 5ADZA 4PVHA 2Q85A 1V97A 1VDVA 3NVVB 3PM9A 3DQ0A 2P4PA 4PYTA 4ML8A 2E3TA 3EJBB 3EJEB 2BVFA 2MBRA 4HG0A 3AM9A 2NQWA 4JB1A 1DIQA 1AHZA 1N62C 3D2DA 3JS8A 2W55A 4PZFA 3RJ8A 4BC9A 1AHUA 3KJMA 3NS1B 3TSJA 3I99A 3W8WA 1E8FA 2BVGA 2QPMA 3HRDC 3NRZB 4PVJA 3TX1A 2IPIA 2VFVA 5HMRA 5I1VA 3B9JB 3ETRB 3FWAA 3FW7A 1W1SA 1FFVC 3NVZB 2R8DA 5L6FA 2W3RA 3NVYB 1W1KA 3GSYA 4PWBA 1RM6B 5L6GA 5HQXA 1N5XA 2GQUA 2W3SA 1FFUC 1QLUA 3LAEA 4EC3A 2Y4GA 3W8ZA 1E8HA 1MBTA 1W1RA 1W1LA 2VFTA 1WYGA 2VFUA 3BW7A 4DNSA 2Y08A 1N61C 2I0KA 3S1FA 1T3QC 4BCAA 4MLAA 2P3HA 1N60C 3SR6B 1AHVA 2RK5A 4O95A 1MBBA 1DIIA 3FW9A 3PQBA 4UD8A 1W1OA 2P13A 5FXEA 2VAOA 5I1WA 2UUVA 1FIQB 1N63C 4BC7A 1JROA 1W1QA 4PVEA 3S1EA 5G5HB 5AE2A 2EXRA 5K8EA 3VTEA 2QKNA 4ZOHB 1N5WC 5G5GB 5AWVA 5FXFA 3EJDB 4BBYA 2AXRA 2BVHA 2W54A 5D79A 1SB3B 1WVFA 2PLIA 3TSHA 1FO4A 1HSKA 5HHZA 2Y3RA 3HSUA
chains in the Genus database with same CATH topology
4PVKA 2VFSA 4OALA 4XLOA 1W1JA 2O3GA 1UXYA 2YVSA 3S1DA 2Y3SA 3DEDA 1QLTA 1I19A 3LLBA 3D2JA 1E0YA 3AMZA 2Q4WA 1JRPA 1F0XA 5FXDA 2WDWA 1DZNA 2PLSA 4JAYA 3S1CA 3POPA 1WVEA 3AN1A 2OAIA 1ZXIC 3FW8A 3D2HA 3EUB3 1W1MA 3NVWB 1VAOA 3RJAA 5AE1A 1E8GA 1ZR6A 3W8XA 2GQTA 3C0PA 5FXPA 4PWCA 2UUUA 5AE3A 2R2ZA 2VFRA 5ADZA 4PVHA 2Q85A 1V97A 1VDVA 3PM9A 3NVVB 3DQ0A 2P4PA 4PYTA 4ML8A 2E3TA 2BVFA 2MBRA 4HG0A 3AM9A 2NQWA 4JB1A 1DIQA 1AHZA 1N62C 3D2DA 3JS8A 2W55A 4PZFA 3RJ8A 4BC9A 1AHUA 3KJMA 3NS1B 3TSJA 3I99A 3W8WA 1E8FA 2BVGA 2QPMA 3HRDC 3NRZB 4PVJA 3TX1A 2IPIA 2VFVA 5HMRA 5I1VA 3B9JB 3ETRB 3FWAA 3FW7A 1W1SA 1FFVC 3NVZB 2R8DA 5L6FA 2W3RA 1RM6B 1W1KA 3GSYA 4PWBA 3NVYB 5L6GA 5HQXA 1N5XA 2GQUA 2W3SA 1FFUC 1QLUA 3LAEA 4EC3A 2Y4GA 3W8ZA 1E8HA 1MBTA 1W1RA 1W1LA 2VFTA 1WYGA 2VFUA 3BW7A 4DNSA 2Y08A 1N61C 2I0KA 3S1FA 1T3QC 4BCAA 4MLAA 2P3HA 1N60C 3SR6B 1AHVA 2RK5A 4O95A 1MBBA 1DIIA 3FW9A 3PQBA 4UD8A 1W1OA 2P13A 5FXEA 2VAOA 5I1WA 2UUVA 1FIQB 1N63C 4BC7A 1JROA 1W1QA 4PVEA 3S1EA 5G5HB 5AE2A 2EXRA 5K8EA 3VTEA 2QKNA 4ZOHB 1N5WC 5G5GB 5AWVA 5FXFA 4BBYA 2AXRA 2BVHA 2W54A 5D79A 1SB3B 1WVFA 2PLIA 3TSHA 1FO4A 1HSKA 5HHZA 2Y3RA 3HSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVK A;  2VFS A;  4OAL A;  4XLO A;  1W1J A;  1UXY A;  3S1D A;  2Y3S A;  1QLT A;  1I19 A;  3D2J A;  1E0Y A;  3AMZ A;  2Q4W A;  1F0X A;  5FXD A;  2WDW A;  1DZN A;  4JAY A;  3S1C A;  3POP A;  1WVE A;  3AN1 A;  1ZXI C;  3FW8 A;  3D2H A;  3EUB 3;  1W1M A;  1VAO A;  3RJA A;  5AE1 A;  1E8G A;  1ZR6 A;  3W8X A;  2GQT A;  3C0P A;  5FXP A;  4PWC A;  5AE3 A;  2VFR A;  5ADZ A;  4PVH A;  2Q85 A;  1V97 A;  1VDV A;  3PM9 A;  3DQ0 A;  4PYT A;  4ML8 A;  2E3T A;  2BVF A;  2MBR A;  3AM9 A;  4JB1 A;  1DIQ A;  1AHZ A;  1N62 C;  3D2D A;  3JS8 A;  2W55 A;  4PZF A;  3RJ8 A;  4BC9 A;  1AHU A;  3KJM A;  3NS1 B;  3TSJ A;  3I99 A;  3W8W A;  1E8F A;  2BVG A;  2QPM A;  3NRZ B;  4PVJ A;  3TX1 A;  2IPI A;  2VFV A;  5HMR A;  5I1V A;  3B9J B;  3ETR B;  3FWA A;  3FW7 A;  1W1S A;  1FFV C;  3NVZ B;  5L6F A;  2W3R A;  1W1K A;  3GSY A;  4PWB A;  5L6G A;  5HQX A;  1N5X A;  2GQU A;  2W3S A;  1FFU C;  1QLU A;  4EC3 A;  2Y4G A;  3W8Z A;  1E8H A;  1MBT A;  1W1R A;  1W1L A;  2VFT A;  1WYG A;  2VFU A;  3BW7 A;  4DNS A;  2Y08 A;  1N61 C;  2I0K A;  3S1F A;  1T3Q C;  4BCA A;  4MLA A;  1N60 C;  3SR6 B;  1AHV A;  4O95 A;  1MBB A;  1DII A;  3FW9 A;  3PQB A;  4UD8 A;  1W1O A;  5FXE A;  2VAO A;  5I1W A;  1FIQ B;  1N63 C;  4BC7 A;  1JRO A;  1W1Q A;  4PVE A;  3S1E A;  5AE2 A;  2EXR A;  5K8E A;  3VTE A;  2QKN A;  4ZOH B;  1N5W C;  5AWV A;  5FXF A;  4BBY A;  2AXR A;  2BVH A;  2W54 A;  5D79 A;  1WVF A;  3TSH A;  1FO4 A;  1HSK A;  5HHZ A;  2Y3R A;  3HSU A; 
#chains in the Genus database with same CATH topology
 4PVK A;  2VFS A;  4OAL A;  4XLO A;  1W1J A;  2O3G A;  1UXY A;  2YVS A;  3S1D A;  2Y3S A;  3DED A;  1QLT A;  1I19 A;  3LLB A;  3D2J A;  1E0Y A;  3AMZ A;  2Q4W A;  1JRP A;  1F0X A;  5FXD A;  2WDW A;  1DZN A;  2PLS A;  4JAY A;  3S1C A;  3POP A;  1WVE A;  3AN1 A;  2OAI A;  1ZXI C;  3FW8 A;  3D2H A;  3EUB 3;  1W1M A;  3NVW B;  1VAO A;  3RJA A;  5AE1 A;  1E8G A;  1ZR6 A;  3W8X A;  2GQT A;  3C0P A;  5FXP A;  4PWC A;  2UUU A;  5AE3 A;  2R2Z A;  2VFR A;  5ADZ A;  4PVH A;  2Q85 A;  1V97 A;  1VDV A;  3NVV B;  3PM9 A;  3DQ0 A;  2P4P A;  4PYT A;  4ML8 A;  2E3T A;  3EJB B;  3EJE B;  2BVF A;  2MBR A;  4HG0 A;  3AM9 A;  2NQW A;  4JB1 A;  1DIQ A;  1AHZ A;  1N62 C;  3D2D A;  3JS8 A;  2W55 A;  4PZF A;  3RJ8 A;  4BC9 A;  1AHU A;  3KJM A;  3NS1 B;  3TSJ A;  3I99 A;  3W8W A;  1E8F A;  2BVG A;  2QPM A;  3HRD C;  3NRZ B;  4PVJ A;  3TX1 A;  2IPI A;  2VFV A;  5HMR A;  5I1V A;  3B9J B;  3ETR B;  3FWA A;  3FW7 A;  1W1S A;  1FFV C;  3NVZ B;  2R8D A;  5L6F A;  2W3R A;  3NVY B;  1W1K A;  3GSY A;  4PWB A;  1RM6 B;  5L6G A;  5HQX A;  1N5X A;  2GQU A;  2W3S A;  1FFU C;  1QLU A;  3LAE A;  4EC3 A;  2Y4G A;  3W8Z A;  1E8H A;  1MBT A;  1W1R A;  1W1L A;  2VFT A;  1WYG A;  2VFU A;  3BW7 A;  4DNS A;  2Y08 A;  1N61 C;  2I0K A;  3S1F A;  1T3Q C;  4BCA A;  4MLA A;  2P3H A;  1N60 C;  3SR6 B;  1AHV A;  2RK5 A;  4O95 A;  1MBB A;  1DII A;  3FW9 A;  3PQB A;  4UD8 A;  1W1O A;  2P13 A;  5FXE A;  2VAO A;  5I1W A;  2UUV A;  1FIQ B;  1N63 C;  4BC7 A;  1JRO A;  1W1Q A;  4PVE A;  3S1E A;  5G5H B;  5AE2 A;  2EXR A;  5K8E A;  3VTE A;  2QKN A;  4ZOH B;  1N5W C;  5G5G B;  5AWV A;  5FXF A;  3EJD B;  4BBY A;  2AXR A;  2BVH A;  2W54 A;  5D79 A;  1SB3 B;  1WVF A;  2PLI A;  3TSH A;  1FO4 A;  1HSK A;  5HHZ A;  2Y3R A;  3HSU A; 
#chains in the Genus database with same CATH homology
 4PVK A;  2VFS A;  4OAL A;  4XLO A;  1W1J A;  2O3G A;  1UXY A;  2YVS A;  3S1D A;  2Y3S A;  3DED A;  1QLT A;  1I19 A;  3LLB A;  3D2J A;  1E0Y A;  3AMZ A;  2Q4W A;  1JRP A;  1F0X A;  5FXD A;  2WDW A;  1DZN A;  2PLS A;  4JAY A;  3S1C A;  3POP A;  1WVE A;  3AN1 A;  2OAI A;  1ZXI C;  3FW8 A;  3D2H A;  3EUB 3;  1W1M A;  3NVW B;  1VAO A;  3RJA A;  5AE1 A;  1E8G A;  1ZR6 A;  3W8X A;  2GQT A;  3C0P A;  5FXP A;  4PWC A;  2UUU A;  5AE3 A;  2R2Z A;  2VFR A;  5ADZ A;  4PVH A;  2Q85 A;  1V97 A;  1VDV A;  3PM9 A;  3NVV B;  3DQ0 A;  2P4P A;  4PYT A;  4ML8 A;  2E3T A;  2BVF A;  2MBR A;  4HG0 A;  3AM9 A;  2NQW A;  4JB1 A;  1DIQ A;  1AHZ A;  1N62 C;  3D2D A;  3JS8 A;  2W55 A;  4PZF A;  3RJ8 A;  4BC9 A;  1AHU A;  3KJM A;  3NS1 B;  3TSJ A;  3I99 A;  3W8W A;  1E8F A;  2BVG A;  2QPM A;  3HRD C;  3NRZ B;  4PVJ A;  3TX1 A;  2IPI A;  2VFV A;  5HMR A;  5I1V A;  3B9J B;  3ETR B;  3FWA A;  3FW7 A;  1W1S A;  1FFV C;  3NVZ B;  2R8D A;  5L6F A;  2W3R A;  1RM6 B;  1W1K A;  3GSY A;  4PWB A;  3NVY B;  5L6G A;  5HQX A;  1N5X A;  2GQU A;  2W3S A;  1FFU C;  1QLU A;  3LAE A;  4EC3 A;  2Y4G A;  3W8Z A;  1E8H A;  1MBT A;  1W1R A;  1W1L A;  2VFT A;  1WYG A;  2VFU A;  3BW7 A;  4DNS A;  2Y08 A;  1N61 C;  2I0K A;  3S1F A;  1T3Q C;  4BCA A;  4MLA A;  2P3H A;  1N60 C;  3SR6 B;  1AHV A;  2RK5 A;  4O95 A;  1MBB A;  1DII A;  3FW9 A;  3PQB A;  4UD8 A;  1W1O A;  2P13 A;  5FXE A;  2VAO A;  5I1W A;  2UUV A;  1FIQ B;  1N63 C;  4BC7 A;  1JRO A;  1W1Q A;  4PVE A;  3S1E A;  5G5H B;  5AE2 A;  2EXR A;  5K8E A;  3VTE A;  2QKN A;  4ZOH B;  1N5W C;  5G5G B;  5AWV A;  5FXF A;  4BBY A;  2AXR A;  2BVH A;  2W54 A;  5D79 A;  1SB3 B;  1WVF A;  2PLI A;  3TSH A;  1FO4 A;  1HSK A;  5HHZ A;  2Y3R A;  3HSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...