1FFUC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAAGTGWAYEKLKRKTGDWATAGCAVVMRKSGGTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
total genus 83
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffuC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffuC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffuC03
3AM9A 2R2ZA 2EXRA 1WVFA 4PWBA 2I0KA 1JRPA 1AHZA 1W1OA 4OALA 2VFVA 2BVHA 1RM6B 3NRZB 3A7UA 4DNSA 4PVKA 4JAYA 2AXRA 3FW9A 2QKNA 1E8GA 5AE2A 3PM9A 4PVHA 1N5XA 1HSKA 1W1KA 1WYGA 1FO4A 3DEDA 3ETRB 3SR6B 3DQ0A 1W1LA 3TSJA 4TVYA 5HQXA 4PYTA 2GQUA 3NVZB 4PVEA 5HHZA 3LAEA 1W1JA 3C0PA 4JB1A 3S1CA 2VFUA 4TVWA 3AN1A 3W8XA 1ZR6A 3D2DA 1E8FA 2VFRA 3FW8A 1ZXIC 1VDVA 3TSHA 1W1SA 1FFVC 1X2GA 2BVFA 2Q85A 5FXEA 5G5GB 2RK5A 1N63C 2P3HA 1AHVA 1W1RA 5D79A 3EUB3 3GSYA 5ADZA 3S1EA 2E5AA 1VQZA 3I99A 1V97A 4BC7A 5G5HB 2GQTA 2QPMA 3FW7A 4PZFA 1I19A 1DIIA 1W1MA 3W8ZA 5FXPA 1N5WC 2BVGA 1UXYA 3KJMA 3NVVB 3D2HA 5FXDA 1FIQB 4ML8A 3A7RA 3W8WA 1FFUC 5AE1A 5HMRA 3NVWB 1E8HA 2NQWA 3HRDC 3VTEA 2O3GA 3R07C 4BCAA 3LLBA 2PLSA 4PWCA 2R8DA 3NS1B 3D2JA 1W1QA 1WVEA 1N61C 1QLUA 4MLAA 1N62C 2P13A 2W3SA 3JS8A 4HG0A 1AHUA 3BW7A 1MBBA 1T3QC 1E0YA 2PLIA 1JROA 1F0XA 1QLTA 5AE3A 2W3RA 3S1DA 2W54A 4EC3A 1X2HA 1DZNA 1VAOA 2VAOA 2P4PA 2E3TA 3AMZA 3NVYB 3B9JB 3S1FA 2OAIA 3A7AA 2YVSA 4O95A 3FWAA 4ZOHB 1MBTA 2Q4WA 4UD8A 3TX1A 1N60C 2MBRA 4PVJA 2VFSA 2VFTA 1DIQA 4XLOA 2W55A 1SB3B 4BBYA 5FXFA 4BC9A
chains in the Genus database with same CATH superfamily
2OG9A 3AM9A 1E9IA 1KN0A 3KLJA 3V5FA 4APNA 2TPRA 2I0KA 5FJPA 3FG2P 3OP2A 1GRHA 3NRZB 2GH5A 1F8WA 4DNSA 3PWGA 1WUFA 4JAYA 5IDZA 2P3ZA 4GYPC 5AE2A 4PVHA 2V3BA 3IC9A 1DXLA 3O0HA 4YWSA 1RVKA 3CAWA 3VDGA 5FS6A 3FCPA 3OZMA 4FP1A 1FO4A 3DEDA 1IYXA 2CHRA 1LVLA 3DQ0A 1XANA 2FYMA 2PTXA 5HQXA 5U1OA 4PYTA 4PVEA 4E4UA 1TYTA 2GDQA 3S1CA 1GEUA 1M6IA 1JOAA 4K1WA 4TVWA 3AN1A 3H70A 3QFAA 1ZK7A 3EJDB 2BC1A 1VDVA 3THUA 1JPDX 4DX3A 2P88A 4Z1YA 1FFVC 1ZY8A 2PP1A 3EEZA 2BVFA 1JPMA 3HPFA 1ZKQA 3OTRA 2RK5A 2WDWA 4M6UA 1FEAA 1JCTA 2GR1A 3CXBA 3GC2A 2AKMA 2YAUA 5ADZA 1VQZA 3ES8A 1L8PA 3T9PA 1MDRA 1SJAA 2OQYA 2QPMA 3FYYA 4HCHA 3GY1A 4EQRA 2GGIA 2Y3SA 1GERA 2HXTA 4DNAA 2X99A 3NVVB 4GIRA 4IZGA 2POZA 3D2HA 2BC0A 3MQTA 3L8KA 2GR2A 4ML8A 2MUCA 2PTZA 2AL2A 3W8WA 2XH4A 5AE1A 1E8HA 4EMWA 3HRDC 3DK4A 4H4YA 4JDRA 3R07C 2QQ6A 2AL2B 3GRTA 4J56A 3STPA 2WOWA 2OZ8A 3R11A 1STZA 2HXUA 1W1QA 3MSYA 1N61C 3II4A 2OLAA 4J1OA 2P13A 4HCDA 4E6MA 3D47A 3R10A 3DEQA 1SJBA 3DK8A 4H4UA 4EMJA 2RDXA 1Q1WA 1E0YA 2AL1A 4JN7A 3VCNA 4EC3A 2GR0A 4H4XA 2P0IA 2X50A 4MMWA 5FJUA 3VA8A 3S1FA 1SJDA 3A7AA 2ZC8A 4GGHA 2QGYA 2X8HA 3FWAA 4ZOHB 3P3BA 3NZGA 2Q4WA 3TX1A 1ZMCA 2MBRA 2NQLA 2PU1A 1AOGA 3EJEB 4XLOA 1SB3B 2FKPA 3TOYA 4ADWA 3PG6A 4M0XA 2NPXA 3ZVHA 1GV4A 3JW7A 3FVDA 4EM3A 1ZX9A 3DGHA 4IL2A 1H6VA 1W6TA 3D9XA 3N4EA 4PWBA 3H7VA 1JRPA 3QFBA 3ZVHB 4X2PA 2PS2A 2QJNA 4E5TA 3T6CA 4PVKA 1ONEA 5FMHA 3N6HA 2DW7A 3QTPA 2QKNA 3PM9A 2NVKX 4H4WA 3SQPA 1Q1RA 1WUEA 2IPIA 5ER0A 2YVFA 5JCMA 1WYGA 1GRGA 2PSNA 3NFUA 3LB8A 1TKKA 3UJSA 4DYEA 4DHGA 2ZZBA 4TVYA 3UJEA 2GQUA 2PGWA 4Z17A 3NXLA 1W1JA 4FI4A 2QJJA 2OX4A 3Q45A 2VFUA 3CB3A 5BOEA 4NEWA 1ELSA 3DG3A 1JDFA 3FW8A 2GGJA 4IT1A 4GR1A 3BSMA 3K1GA 3DFYA 3FV9A 2Q85A 2XH2A 5FXEA 3DG7A 5FJRA 2P3HA 1LPFA 4LIIA 3L5OA 3R0KA 1W1RA 3EUB3 1EBDA 3I99A 3IJQA 3OC4A 2WPCA 4MGGA 4BC7A 1K4QA 2PCEA 2YVGA 3TQPA 1D7YA 5L6FA 1ECQA 1EBHA 4PZFA 1NDAA 3DH9A 1W1MA 4ZCWA 3I4KA 2AKZA 4H4ZA 3ZLHA 3CT2A 3KJMA 1UXYA 3DIPA 3ZLGA 3PK7A 1XS2A 3B97A 4FX9A 5FXDA 3DGBA 6ENLA 2CFYA 3HW2A 3UCCA 5AWVA 2QJMA 3A7RA 4EQWA 4HYRA 3NVWB 3EKGA 3SN1A 3PWIA 4EM4A 2Y3RA 4EMIA 2O3GA 4J57A 3D2JA 3DGZA 4G8TA 1BQGA 4LA1A 1N62C 1YQZA 4YWOA 4KWSA 3MY9A 2C3CA 4GGBA 4K8GA 3VCCA 3ES7A 4JHMA 5I1VA 1ZDLA 3CGBA 3EAOA 5EBKA 2PU0A 3GO2A 5KVHA 1KKOA 4A3RA 1MOKA 4HCLA 4IP4A 1JROA 1F0XA 3EF6A 1QLTA 3P0WA 2XH0A 1GRBA 1X2HA 1DZNA 1VAOA 3UXKA 3AMZA 3JVAA 4HPNA 2WP6A 3DESA 3V5CA 2OAIA 2UUUA 1NELA 1R6WA 3MWCA 2YVJA 2PPGA 5K8EA 4ROPA 2PMQA 1N60C 4GFIA 3H12A 2PP0A 1PDZA 4BBYA 2ZADA 4E4FA 2C3DA 1NHSA 1GREA 4KPRA 2EXRA 4A35A 3S5SA 3VFCA 1FEBA 3DG6A 3RCYA 2OZ3A 3R1ZA 3H8AA 3GRSA 4OALA 2VFVA 2BVHA 3U4FA 4EWJA 1FECA 2EQ9A 3OZYA 3LXDA 4EQXA 3FW9A 1NHPA 1BWCA 2V6OA 3SSZA 1E8GA 3BOXA 1MO9A 2WPFA 3UJFA 4DWDA 4HNCA 4H50A 1W1KA 2XH7A 3ZLFA 3BJSA 2HNEA 3ETRB 4EQSA 1W1LA 1MNSA 2X8GA 2WOVA 3D46A 4HNLA 3LAEA 2A8XA 1NHRA 3C0PA 4JB1A 3TTEA 3UCDA 3V4BA 3N6JA 1XPYA 3IK4A 5JRBA 3DERA 3D2DA 2DW6A 3SN0A 1E8FA 2VFRA 4BURA 1XHCA 3URHA 4H2HA 1W1SA 3DJJA 1DTNA 3UJRA 2WPEA 5ENLA 4KEMA 1AHVA 3ZVIA 2PODA 5D79A 2PP3A 4H4QA 3GSYA 3UGVA 2PA6A 3Q4DA 2E5AA 1NHQA 1ZMDA 2OZTA 3LADA 1V97A 1BKHA 4K7ZA 4IHCA 3OPSA 3POPA 2GQTA 3FW7A 1DNCA 1PDYA 3QPEA 1EC8A 2MNRA 2OQHA 4M52A 5U25A 1DIIA 1MUCA 3IJLA 3R25A 5FXPA 1BZLA 3T8QA 2QVHA 2WP5A 4H4RA 3Q6JA 1FIQB 1H2IA 1FFUC 1GRFA 3IJIA 4IL0A 5HMRA 1TYPA 2GSHA 3RGTA 3JZUA 2NQWA 3VTEA 3DFHA 4BCAA 1GRAA 4DXKA 1EC9A 4GISA 3NS1B 4H83A 2EQ7A 1GXFA 2XGZA 4KT2A 4HN8A 1WVEA 2I5QA 1QLUA 4MLAA 3PFRA 1GETA 3MKCA 1NPXA 3GD6A 3S47A 3RNMA 1OJTA 2WBAA 3MUCA 3UXLA 1MBBA 1T3QC 4GMEA 1V59A 4H4SA 2PLIA 5I1WA 3UJ2A 2PGEA 2EQ6A 2W3RA 3S1DA 3KUMA 3CGEA 2VAOA 2P4PA 5KVIA 3H4KA 3EANA 3QLDA 5J04A 1MBTA 3VC5A 4UD8A 4PVJA 2VFTA 1DIQA 2W0HA 3EJBB 3I6EA 5FS8A 4G7FA 2W55A 4BC9A 2R2ZA 5TR3A 5GRTA 1WVFA 4NEVA 4H1ZA 1AHZA 4JN8A 1W1OA 2RABA 2CDUA 2ZZ0A 1RM6B 3QKEA 3CK5A 3A7UA 2OO6A 2AXRA 3CXOA 3QN3A 1SJCA 4F4RA 5JCLA 3HSUA 1MRAA 3TCSA 1N5XA 2OFJA 2OKTA 1GESA 1HSKA 2J3NA 2O56A 3P93A 2WOIA 3TJ4A 2JK6A 3FXGA 4DN1A 5L6GA 1F9CA 5FS9A 1JEHA 3RITA 3DDMA 4H19A 3SR6B 3MZNA 4ZA0A 3TSJA 3U9IA 3NVZB 3SQSA 3RJAA 5HHZA 1OEPA 4ENLA 3SN4A 1YEYA 1F3PA 3W8XA 3GD4A 1ZR6A 3TWBA 2BCPA 5EU9A 2ZZCA 1KKRA 1ONFA 1ZXIC 2QAEA 3T4WA 3TSHA 1S7MA 3V3WA 1X2GA 2HQMA 1P43A 2P8BA 1N63C 5FJOA 5G5GB 3RR1A 3GD3A 4H4PA 1KCZA 2P8CA 2UUVA 2Y08A 2Y4GA 2GR3A 4E8GA 2R9ZA 4H4VA 4GYPA 3NO1A 3S1EA 2AAQA 3TJIA 2PTWA 2QDDA 5G5HB 1R0MA 5JCNA 3CGDA 2ONEA 3ENLA 1EC7A 4J3ZA 5JCKA 1I19A 4KPLA 3W8ZA 3FJ4A 1N5WC 2BVGA 3OW1A 2XSXA 5FS7A 1GSNA 1NU5A 3DK9A 3R0UA 4K2SA 2GQWA 3DJGX 2F5ZA 1XDIA 4FDCB 3LLBA 2PLSA 4PWCA 3SBFA 2EQ8A 3VC6A 5BOFA 2R8DA 3RO6A 3N4FA 3SJNA 4K8DA 2GGEA 2QDEA 2HZGA 3PQBA 2GGHA 2W3SA 3JS8A 4MKSA 4HG0A 1AHUA 5FJTA 3BW7A 3CYJA 3TW9A 7ENLA 1TZZA 4BV6A 4JQ9A 5AE3A 2X8CA 2PTYA 3I6TA 2W54A 4IP5A 4GRTA 2YQUA 3RRAA 4H4TA 2E3TA 1FHUA 2GRTA 2OPJA 2V3AA 4A6GA 3NVYB 3B9JB 1FHVA 2GGGA 3RJ8A 2YVSA 4O95A 1EBGA 2GL5A 3CGCA 3TWAA 2VFSA 2OVLA 5JCIA 1MDLA 1P48A 1TE6A 5FXFA 1GRTA 1KD0A
chains in the Genus database with same CATH topology
3AM9A 2R2ZA 2EXRA 1WVFA 4PWBA 2I0KA 1JRPA 1AHZA 1W1OA 4OALA 2VFVA 2BVHA 1RM6B 3NRZB 3A7UA 4DNSA 4PVKA 4JAYA 2AXRA 3FW9A 2QKNA 3HSUA 1E8GA 5AE2A 3PM9A 4PVHA 1N5XA 1HSKA 2IPIA 1W1KA 1WYGA 1FO4A 5L6GA 3DEDA 3ETRB 3SR6B 3DQ0A 1W1LA 3TSJA 4TVYA 5HQXA 4PYTA 2GQUA 3NVZB 4PVEA 3RJAA 5HHZA 3LAEA 1W1JA 3C0PA 4JB1A 3S1CA 2VFUA 4TVWA 3AN1A 3W8XA 1ZR6A 3D2DA 1E8FA 2VFRA 3FW8A 1ZXIC 1VDVA 3TSHA 1W1SA 1FFVC 1X2GA 2BVFA 2Q85A 5FXEA 5G5GB 2RK5A 1N63C 2P3HA 1AHVA 2WDWA 2UUVA 2Y08A 2Y4GA 1W1RA 5D79A 3EUB3 3GSYA 5ADZA 3S1EA 2E5AA 1VQZA 3I99A 1V97A 4BC7A 5G5HB 5L6FA 3POPA 2GQTA 2QPMA 3FW7A 4PZFA 2Y3SA 1I19A 1DIIA 1W1MA 3W8ZA 5FXPA 1N5WC 2BVGA 1UXYA 3KJMA 3NVVB 3D2HA 5FXDA 1FIQB 5AWVA 4ML8A 3A7RA 3W8WA 1FFUC 5AE1A 5HMRA 3NVWB 1E8HA 2Y3RA 2NQWA 3HRDC 3VTEA 2O3GA 3R07C 4BCAA 3LLBA 2PLSA 4PWCA 2R8DA 3NS1B 3D2JA 1W1QA 1WVEA 1N61C 1QLUA 4MLAA 3PQBA 1N62C 2P13A 2W3SA 3JS8A 4HG0A 1AHUA 5I1VA 3BW7A 1MBBA 1T3QC 1E0YA 2PLIA 5I1WA 1JROA 1F0XA 1QLTA 5AE3A 2W3RA 3S1DA 2W54A 4EC3A 1X2HA 1DZNA 1VAOA 2VAOA 2P4PA 2E3TA 3AMZA 3NVYB 3B9JB 3S1FA 2OAIA 2UUUA 3RJ8A 3A7AA 2YVSA 4O95A 3FWAA 4ZOHB 5K8EA 1MBTA 2Q4WA 4UD8A 3TX1A 1N60C 2MBRA 4PVJA 2VFSA 2VFTA 1DIQA 4XLOA 2W55A 1SB3B 4BBYA 5FXFA 4BC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AM9 A;  2R2Z A;  2EXR A;  1WVF A;  4PWB A;  2I0K A;  1JRP A;  1AHZ A;  1W1O A;  4OAL A;  2VFV A;  2BVH A;  1RM6 B;  3NRZ B;  3A7U A;  4DNS A;  4PVK A;  4JAY A;  2AXR A;  3FW9 A;  2QKN A;  1E8G A;  5AE2 A;  3PM9 A;  4PVH A;  1N5X A;  1HSK A;  1W1K A;  1WYG A;  1FO4 A;  3DED A;  3ETR B;  3SR6 B;  3DQ0 A;  1W1L A;  3TSJ A;  4TVY A;  5HQX A;  4PYT A;  2GQU A;  3NVZ B;  4PVE A;  5HHZ A;  3LAE A;  1W1J A;  3C0P A;  4JB1 A;  3S1C A;  2VFU A;  4TVW A;  3AN1 A;  3W8X A;  1ZR6 A;  3D2D A;  1E8F A;  2VFR A;  3FW8 A;  1ZXI C;  1VDV A;  3TSH A;  1W1S A;  1FFV C;  1X2G A;  2BVF A;  2Q85 A;  5FXE A;  5G5G B;  2RK5 A;  1N63 C;  2P3H A;  1AHV A;  1W1R A;  5D79 A;  3EUB 3;  3GSY A;  5ADZ A;  3S1E A;  2E5A A;  1VQZ A;  3I99 A;  1V97 A;  4BC7 A;  5G5H B;  2GQT A;  2QPM A;  3FW7 A;  4PZF A;  1I19 A;  1DII A;  1W1M A;  3W8Z A;  5FXP A;  1N5W C;  2BVG A;  1UXY A;  3KJM A;  3NVV B;  3D2H A;  5FXD A;  1FIQ B;  4ML8 A;  3A7R A;  3W8W A;  1FFU C;  5AE1 A;  5HMR A;  3NVW B;  1E8H A;  2NQW A;  3HRD C;  3VTE A;  2O3G A;  3R07 C;  4BCA A;  3LLB A;  2PLS A;  4PWC A;  2R8D A;  3NS1 B;  3D2J A;  1W1Q A;  1WVE A;  1N61 C;  1QLU A;  4MLA A;  1N62 C;  2P13 A;  2W3S A;  3JS8 A;  4HG0 A;  1AHU A;  3BW7 A;  1MBB A;  1T3Q C;  1E0Y A;  2PLI A;  1JRO A;  1F0X A;  1QLT A;  5AE3 A;  2W3R A;  3S1D A;  2W54 A;  4EC3 A;  1X2H A;  1DZN A;  1VAO A;  2VAO A;  2P4P A;  2E3T A;  3AMZ A;  3NVY B;  3B9J B;  3S1F A;  2OAI A;  3A7A A;  2YVS A;  4O95 A;  3FWA A;  4ZOH B;  1MBT A;  2Q4W A;  4UD8 A;  3TX1 A;  1N60 C;  2MBR A;  4PVJ A;  2VFS A;  2VFT A;  1DIQ A;  4XLO A;  2W55 A;  1SB3 B;  4BBY A;  5FXF A;  4BC9 A; 
#chains in the Genus database with same CATH topology
 2OG9 A;  3AM9 A;  1E9I A;  1KN0 A;  3KLJ A;  3V5F A;  4APN A;  2TPR A;  2I0K A;  5FJP A;  3FG2 P;  3OP2 A;  1GRH A;  3NRZ B;  2GH5 A;  1F8W A;  4DNS A;  3PWG A;  1WUF A;  4JAY A;  5IDZ A;  2P3Z A;  4GYP C;  5AE2 A;  4PVH A;  2V3B A;  3IC9 A;  1DXL A;  3O0H A;  4YWS A;  1RVK A;  3CAW A;  3VDG A;  5FS6 A;  3FCP A;  3OZM A;  4FP1 A;  1FO4 A;  3DED A;  1IYX A;  2CHR A;  1LVL A;  3DQ0 A;  1XAN A;  2FYM A;  2PTX A;  5HQX A;  5U1O A;  4PYT A;  4PVE A;  4E4U A;  1TYT A;  2GDQ A;  3S1C A;  1GEU A;  1M6I A;  1JOA A;  4K1W A;  4TVW A;  3AN1 A;  3H70 A;  3QFA A;  1ZK7 A;  3EJD B;  2BC1 A;  1VDV A;  3THU A;  1JPD X;  4DX3 A;  2P88 A;  4Z1Y A;  1FFV C;  1ZY8 A;  2PP1 A;  3EEZ A;  2BVF A;  1JPM A;  3HPF A;  1ZKQ A;  3OTR A;  2RK5 A;  2WDW A;  4M6U A;  1FEA A;  1JCT A;  2GR1 A;  3CXB A;  3GC2 A;  2AKM A;  2YAU A;  5ADZ A;  1VQZ A;  3ES8 A;  1L8P A;  3T9P A;  1MDR A;  1SJA A;  2OQY A;  2QPM A;  3FYY A;  4HCH A;  3GY1 A;  4EQR A;  2GGI A;  2Y3S A;  1GER A;  2HXT A;  4DNA A;  2X99 A;  3NVV B;  4GIR A;  4IZG A;  2POZ A;  3D2H A;  2BC0 A;  3MQT A;  3L8K A;  2GR2 A;  4ML8 A;  2MUC A;  2PTZ A;  2AL2 A;  3W8W A;  2XH4 A;  5AE1 A;  1E8H A;  4EMW A;  3HRD C;  3DK4 A;  4H4Y A;  4JDR A;  3R07 C;  2QQ6 A;  2AL2 B;  3GRT A;  4J56 A;  3STP A;  2WOW A;  2OZ8 A;  3R11 A;  1STZ A;  2HXU A;  1W1Q A;  3MSY A;  1N61 C;  3II4 A;  2OLA A;  4J1O A;  2P13 A;  4HCD A;  4E6M A;  3D47 A;  3R10 A;  3DEQ A;  1SJB A;  3DK8 A;  4H4U A;  4EMJ A;  2RDX A;  1Q1W A;  1E0Y A;  2AL1 A;  4JN7 A;  3VCN A;  4EC3 A;  2GR0 A;  4H4X A;  2P0I A;  2X50 A;  4MMW A;  5FJU A;  3VA8 A;  3S1F A;  1SJD A;  3A7A A;  2ZC8 A;  4GGH A;  2QGY A;  2X8H A;  3FWA A;  4ZOH B;  3P3B A;  3NZG A;  2Q4W A;  3TX1 A;  1ZMC A;  2MBR A;  2NQL A;  2PU1 A;  1AOG A;  3EJE B;  4XLO A;  1SB3 B;  2FKP A;  3TOY A;  4ADW A;  3PG6 A;  4M0X A;  2NPX A;  3ZVH A;  1GV4 A;  3JW7 A;  3FVD A;  4EM3 A;  1ZX9 A;  3DGH A;  4IL2 A;  1H6V A;  1W6T A;  3D9X A;  3N4E A;  4PWB A;  3H7V A;  1JRP A;  3QFB A;  3ZVH B;  4X2P A;  2PS2 A;  2QJN A;  4E5T A;  3T6C A;  4PVK A;  1ONE A;  5FMH A;  3N6H A;  2DW7 A;  3QTP A;  2QKN A;  3PM9 A;  2NVK X;  4H4W A;  3SQP A;  1Q1R A;  1WUE A;  2IPI A;  5ER0 A;  2YVF A;  5JCM A;  1WYG A;  1GRG A;  2PSN A;  3NFU A;  3LB8 A;  1TKK A;  3UJS A;  4DYE A;  4DHG A;  2ZZB A;  4TVY A;  3UJE A;  2GQU A;  2PGW A;  4Z17 A;  3NXL A;  1W1J A;  4FI4 A;  2QJJ A;  2OX4 A;  3Q45 A;  2VFU A;  3CB3 A;  5BOE A;  4NEW A;  1ELS A;  3DG3 A;  1JDF A;  3FW8 A;  2GGJ A;  4IT1 A;  4GR1 A;  3BSM A;  3K1G A;  3DFY A;  3FV9 A;  2Q85 A;  2XH2 A;  5FXE A;  3DG7 A;  5FJR A;  2P3H A;  1LPF A;  4LII A;  3L5O A;  3R0K A;  1W1R A;  3EUB 3;  1EBD A;  3I99 A;  3IJQ A;  3OC4 A;  2WPC A;  4MGG A;  4BC7 A;  1K4Q A;  2PCE A;  2YVG A;  3TQP A;  1D7Y A;  5L6F A;  1ECQ A;  1EBH A;  4PZF A;  1NDA A;  3DH9 A;  1W1M A;  4ZCW A;  3I4K A;  2AKZ A;  4H4Z A;  3ZLH A;  3CT2 A;  3KJM A;  1UXY A;  3DIP A;  3ZLG A;  3PK7 A;  1XS2 A;  3B97 A;  4FX9 A;  5FXD A;  3DGB A;  6ENL A;  2CFY A;  3HW2 A;  3UCC A;  5AWV A;  2QJM A;  3A7R A;  4EQW A;  4HYR A;  3NVW B;  3EKG A;  3SN1 A;  3PWI A;  4EM4 A;  2Y3R A;  4EMI A;  2O3G A;  4J57 A;  3D2J A;  3DGZ A;  4G8T A;  1BQG A;  4LA1 A;  1N62 C;  1YQZ A;  4YWO A;  4KWS A;  3MY9 A;  2C3C A;  4GGB A;  4K8G A;  3VCC A;  3ES7 A;  4JHM A;  5I1V A;  1ZDL A;  3CGB A;  3EAO A;  5EBK A;  2PU0 A;  3GO2 A;  5KVH A;  1KKO A;  4A3R A;  1MOK A;  4HCL A;  4IP4 A;  1JRO A;  1F0X A;  3EF6 A;  1QLT A;  3P0W A;  2XH0 A;  1GRB A;  1X2H A;  1DZN A;  1VAO A;  3UXK A;  3AMZ A;  3JVA A;  4HPN A;  2WP6 A;  3DES A;  3V5C A;  2OAI A;  2UUU A;  1NEL A;  1R6W A;  3MWC A;  2YVJ A;  2PPG A;  5K8E A;  4ROP A;  2PMQ A;  1N60 C;  4GFI A;  3H12 A;  2PP0 A;  1PDZ A;  4BBY A;  2ZAD A;  4E4F A;  2C3D A;  1NHS A;  1GRE A;  4KPR A;  2EXR A;  4A35 A;  3S5S A;  3VFC A;  1FEB A;  3DG6 A;  3RCY A;  2OZ3 A;  3R1Z A;  3H8A A;  3GRS A;  4OAL A;  2VFV A;  2BVH A;  3U4F A;  4EWJ A;  1FEC A;  2EQ9 A;  3OZY A;  3LXD A;  4EQX A;  3FW9 A;  1NHP A;  1BWC A;  2V6O A;  3SSZ A;  1E8G A;  3BOX A;  1MO9 A;  2WPF A;  3UJF A;  4DWD A;  4HNC A;  4H50 A;  1W1K A;  2XH7 A;  3ZLF A;  3BJS A;  2HNE A;  3ETR B;  4EQS A;  1W1L A;  1MNS A;  2X8G A;  2WOV A;  3D46 A;  4HNL A;  3LAE A;  2A8X A;  1NHR A;  3C0P A;  4JB1 A;  3TTE A;  3UCD A;  3V4B A;  3N6J A;  1XPY A;  3IK4 A;  5JRB A;  3DER A;  3D2D A;  2DW6 A;  3SN0 A;  1E8F A;  2VFR A;  4BUR A;  1XHC A;  3URH A;  4H2H A;  1W1S A;  3DJJ A;  1DTN A;  3UJR A;  2WPE A;  5ENL A;  4KEM A;  1AHV A;  3ZVI A;  2POD A;  5D79 A;  2PP3 A;  4H4Q A;  3GSY A;  3UGV A;  2PA6 A;  3Q4D A;  2E5A A;  1NHQ A;  1ZMD A;  2OZT A;  3LAD A;  1V97 A;  1BKH A;  4K7Z A;  4IHC A;  3OPS A;  3POP A;  2GQT A;  3FW7 A;  1DNC A;  1PDY A;  3QPE A;  1EC8 A;  2MNR A;  2OQH A;  4M52 A;  5U25 A;  1DII A;  1MUC A;  3IJL A;  3R25 A;  5FXP A;  1BZL A;  3T8Q A;  2QVH A;  2WP5 A;  4H4R A;  3Q6J A;  1FIQ B;  1H2I A;  1FFU C;  1GRF A;  3IJI A;  4IL0 A;  5HMR A;  1TYP A;  2GSH A;  3RGT A;  3JZU A;  2NQW A;  3VTE A;  3DFH A;  4BCA A;  1GRA A;  4DXK A;  1EC9 A;  4GIS A;  3NS1 B;  4H83 A;  2EQ7 A;  1GXF A;  2XGZ A;  4KT2 A;  4HN8 A;  1WVE A;  2I5Q A;  1QLU A;  4MLA A;  3PFR A;  1GET A;  3MKC A;  1NPX A;  3GD6 A;  3S47 A;  3RNM A;  1OJT A;  2WBA A;  3MUC A;  3UXL A;  1MBB A;  1T3Q C;  4GME A;  1V59 A;  4H4S A;  2PLI A;  5I1W A;  3UJ2 A;  2PGE A;  2EQ6 A;  2W3R A;  3S1D A;  3KUM A;  3CGE A;  2VAO A;  2P4P A;  5KVI A;  3H4K A;  3EAN A;  3QLD A;  5J04 A;  1MBT A;  3VC5 A;  4UD8 A;  4PVJ A;  2VFT A;  1DIQ A;  2W0H A;  3EJB B;  3I6E A;  5FS8 A;  4G7F A;  2W55 A;  4BC9 A;  2R2Z A;  5TR3 A;  5GRT A;  1WVF A;  4NEV A;  4H1Z A;  1AHZ A;  4JN8 A;  1W1O A;  2RAB A;  2CDU A;  2ZZ0 A;  1RM6 B;  3QKE A;  3CK5 A;  3A7U A;  2OO6 A;  2AXR A;  3CXO A;  3QN3 A;  1SJC A;  4F4R A;  5JCL A;  3HSU A;  1MRA A;  3TCS A;  1N5X A;  2OFJ A;  2OKT A;  1GES A;  1HSK A;  2J3N A;  2O56 A;  3P93 A;  2WOI A;  3TJ4 A;  2JK6 A;  3FXG A;  4DN1 A;  5L6G A;  1F9C A;  5FS9 A;  1JEH A;  3RIT A;  3DDM A;  4H19 A;  3SR6 B;  3MZN A;  4ZA0 A;  3TSJ A;  3U9I A;  3NVZ B;  3SQS A;  3RJA A;  5HHZ A;  1OEP A;  4ENL A;  3SN4 A;  1YEY A;  1F3P A;  3W8X A;  3GD4 A;  1ZR6 A;  3TWB A;  2BCP A;  5EU9 A;  2ZZC A;  1KKR A;  1ONF A;  1ZXI C;  2QAE A;  3T4W A;  3TSH A;  1S7M A;  3V3W A;  1X2G A;  2HQM A;  1P43 A;  2P8B A;  1N63 C;  5FJO A;  5G5G B;  3RR1 A;  3GD3 A;  4H4P A;  1KCZ A;  2P8C A;  2UUV A;  2Y08 A;  2Y4G A;  2GR3 A;  4E8G A;  2R9Z A;  4H4V A;  4GYP A;  3NO1 A;  3S1E A;  2AAQ A;  3TJI A;  2PTW A;  2QDD A;  5G5H B;  1R0M A;  5JCN A;  3CGD A;  2ONE A;  3ENL A;  1EC7 A;  4J3Z A;  5JCK A;  1I19 A;  4KPL A;  3W8Z A;  3FJ4 A;  1N5W C;  2BVG A;  3OW1 A;  2XSX A;  5FS7 A;  1GSN A;  1NU5 A;  3DK9 A;  3R0U A;  4K2S A;  2GQW A;  3DJG X;  2F5Z A;  1XDI A;  4FDC B;  3LLB A;  2PLS A;  4PWC A;  3SBF A;  2EQ8 A;  3VC6 A;  5BOF A;  2R8D A;  3RO6 A;  3N4F A;  3SJN A;  4K8D A;  2GGE A;  2QDE A;  2HZG A;  3PQB A;  2GGH A;  2W3S A;  3JS8 A;  4MKS A;  4HG0 A;  1AHU A;  5FJT A;  3BW7 A;  3CYJ A;  3TW9 A;  7ENL A;  1TZZ A;  4BV6 A;  4JQ9 A;  5AE3 A;  2X8C A;  2PTY A;  3I6T A;  2W54 A;  4IP5 A;  4GRT A;  2YQU A;  3RRA A;  4H4T A;  2E3T A;  1FHU A;  2GRT A;  2OPJ A;  2V3A A;  4A6G A;  3NVY B;  3B9J B;  1FHV A;  2GGG A;  3RJ8 A;  2YVS A;  4O95 A;  1EBG A;  2GL5 A;  3CGC A;  3TWA A;  2VFS A;  2OVL A;  5JCI A;  1MDL A;  1P48 A;  1TE6 A;  5FXF A;  1GRT A;  1KD0 A; 
#chains in the Genus database with same CATH homology
 3AM9 A;  2R2Z A;  2EXR A;  1WVF A;  4PWB A;  2I0K A;  1JRP A;  1AHZ A;  1W1O A;  4OAL A;  2VFV A;  2BVH A;  1RM6 B;  3NRZ B;  3A7U A;  4DNS A;  4PVK A;  4JAY A;  2AXR A;  3FW9 A;  2QKN A;  3HSU A;  1E8G A;  5AE2 A;  3PM9 A;  4PVH A;  1N5X A;  1HSK A;  2IPI A;  1W1K A;  1WYG A;  1FO4 A;  5L6G A;  3DED A;  3ETR B;  3SR6 B;  3DQ0 A;  1W1L A;  3TSJ A;  4TVY A;  5HQX A;  4PYT A;  2GQU A;  3NVZ B;  4PVE A;  3RJA A;  5HHZ A;  3LAE A;  1W1J A;  3C0P A;  4JB1 A;  3S1C A;  2VFU A;  4TVW A;  3AN1 A;  3W8X A;  1ZR6 A;  3D2D A;  1E8F A;  2VFR A;  3FW8 A;  1ZXI C;  1VDV A;  3TSH A;  1W1S A;  1FFV C;  1X2G A;  2BVF A;  2Q85 A;  5FXE A;  5G5G B;  2RK5 A;  1N63 C;  2P3H A;  1AHV A;  2WDW A;  2UUV A;  2Y08 A;  2Y4G A;  1W1R A;  5D79 A;  3EUB 3;  3GSY A;  5ADZ A;  3S1E A;  2E5A A;  1VQZ A;  3I99 A;  1V97 A;  4BC7 A;  5G5H B;  5L6F A;  3POP A;  2GQT A;  2QPM A;  3FW7 A;  4PZF A;  2Y3S A;  1I19 A;  1DII A;  1W1M A;  3W8Z A;  5FXP A;  1N5W C;  2BVG A;  1UXY A;  3KJM A;  3NVV B;  3D2H A;  5FXD A;  1FIQ B;  5AWV A;  4ML8 A;  3A7R A;  3W8W A;  1FFU C;  5AE1 A;  5HMR A;  3NVW B;  1E8H A;  2Y3R A;  2NQW A;  3HRD C;  3VTE A;  2O3G A;  3R07 C;  4BCA A;  3LLB A;  2PLS A;  4PWC A;  2R8D A;  3NS1 B;  3D2J A;  1W1Q A;  1WVE A;  1N61 C;  1QLU A;  4MLA A;  3PQB A;  1N62 C;  2P13 A;  2W3S A;  3JS8 A;  4HG0 A;  1AHU A;  5I1V A;  3BW7 A;  1MBB A;  1T3Q C;  1E0Y A;  2PLI A;  5I1W A;  1JRO A;  1F0X A;  1QLT A;  5AE3 A;  2W3R A;  3S1D A;  2W54 A;  4EC3 A;  1X2H A;  1DZN A;  1VAO A;  2VAO A;  2P4P A;  2E3T A;  3AMZ A;  3NVY B;  3B9J B;  3S1F A;  2OAI A;  2UUU A;  3RJ8 A;  3A7A A;  2YVS A;  4O95 A;  3FWA A;  4ZOH B;  5K8E A;  1MBT A;  2Q4W A;  4UD8 A;  3TX1 A;  1N60 C;  2MBR A;  4PVJ A;  2VFS A;  2VFT A;  1DIQ A;  4XLO A;  2W55 A;  1SB3 B;  4BBY A;  5FXF A;  4BC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...