1FFUC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
287
Chain Sequence
b'MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAAGTGWAYEKLKRKTGDWATAGCAVVMRKSGGTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 83
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffuC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffuC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffuC03
1N62C 2VFSA 3AMZA 1ZXIC 3A7UA 1W1OA 3TSHA 1VDVA 3HRDC 1W1KA 3JS8A 3AN1A 3R07C 1E8FA 2MBRA 4JAYA 2YVSA 3NVVB 3D2JA 2OAIA 4PWCA 2W3RA 4ML8A 5HHZA 3LAEA 1I19A 1MBBA 2BVGA 2BVHA 4PWBA 3TSJA 2P13A 1DIQA 3NVWB 4O95A 2O3GA 2QPMA 2GQTA 1HSKA 1E8GA 1ZR6A 2PLIA 1W1SA 2P4PA 2BVFA 4MLAA 1F0XA 3KJMA 3S1CA 3I99A 1QLTA 1N5XA 3W8ZA 1FO4A 2QKNA 4UD8A 2VFUA 1AHZA 5FXDA 3W8XA 1VAOA 4JB1A 3B9JB 3A7RA 1AHVA 1N5WC 3NRZB 4ZOHB 2NQWA 3SR6B 3NVYB 1V97A 1FFUC 3W8WA 3LLBA 2Q85A 3D2DA 1N63C 3PM9A 2AXRA 2VFTA 4EC3A 3TX1A 5FXEA 2E5AA 5HMRA 2GQUA 1UXYA 2Q4WA 2VAOA 1AHUA 1MBTA 3D2HA 1E8HA 4BBYA 2R8DA 2E3TA 3FWAA 3GSYA 3S1FA 5AE1A 1N61C 2RK5A 5AE2A 3EUB3 1N60C 1WVFA 4PYTA 1X2GA 4OALA 2R2ZA 3FW7A 1JRPA 4HG0A 1RM6B 3NS1B 2EXRA 4PZFA 3S1DA 3DQ0A 1FIQB 1W1MA 1VQZA 5D79A 3ETRB 1W1JA 4BC9A 5G5GB 2W55A 2PLSA 1X2HA 4PVHA 1WYGA 3VTEA 5ADZA 5HQXA 3C0PA 1SB3B 5AE3A 2P3HA 5FXFA 1T3QC 2VFRA 3A7AA 4TVWA 3AM9A 3FW8A 1DIIA 1FFVC 3NVZB 2VFVA 2W54A 4XLOA 3FW9A 4TVYA 2W3SA 4PVKA 1DZNA 4PVEA 1WVEA 4BCAA 4DNSA 1E0YA 1JROA 5G5HB 5FXPA 2I0KA 3BW7A 1W1QA 1QLUA 3DEDA 1W1LA 3S1EA 4BC7A 4PVJA 1W1RA
chains in the Genus database with same CATH superfamily
1N62C 2QJMA 4IZGA 1H2IA 1TYTA 3L5OA 3GD6A 1W1KA 3CAWA 3TWAA 1KKOA 3H70A 1SJCA 4JN7A 3BOXA 1E8FA 4JAYA 2YVSA 3Q6JA 4K2SA 2OAIA 4PWCA 4ML8A 3CXOA 3D47A 7ENLA 1MBBA 2BVGA 2JK6A 3TSJA 3UCDA 1P43A 1IYXA 4APNA 2YQUA 2GQTA 5U25A 1E8GA 1TE6A 3KJMA 3S1CA 4BURA 2PGEA 2FYMA 4DX3A 3DJGX 3JW7A 1BWCA 1FO4A 2OX4A 4UD8A 2HZGA 3UXKA 2QDDA 2NQLA 2GR1A 2AL2B 2GH5A 1FEAA 6ENLA 4EQSA 1JCTA 1M6IA 2QQ6A 3NXLA 1N5WC 3UJSA 2QGYA 4H4RA 3CGCA 4MKSA 4JQ9A 4M52A 2AXRA 2PP3A 3CYJA 4ROPA 2MNRA 3TX1A 5HMRA 4ENLA 2IPIA 2PU1A 3T4WA 1MOKA 3I6EA 1MBTA 1E8HA 1KKRA 1NHSA 4IL0A 1K4QA 3V5CA 3FWAA 1BZLA 3GSYA 1FEBA 2GR2A 1YQZA 4EQXA 4GMEA 3OP2A 3N6HA 1ZX9A 3DG3A 1MO9A 4G8TA 4H4QA 3GD3A 3OPSA 3OZMA 4M0XA 3K1GA 3NS1B 3S1DA 3QPEA 4H50A 3EEZA 1FIQB 4J56A 3IK4A 3ZLHA 5D79A 1JDFA 5G5GB 3TJIA 3MQTA 4EMIA 4NEWA 1EBGA 1STZA 3PWIA 4LA1A 5I1VA 3SSZA 2PTXA 3C0PA 3IJQA 3RITA 4Z1YA 3TCSA 5FXFA 3TW9A 2VFRA 3A7AA 3QKEA 3EJDB 4TVWA 2Y4GA 4GGBA 3IJLA 5L6GA 1DIIA 1FFVC 2AKMA 2W54A 3CB3A 4E4UA 3EAOA 1AOGA 2OKTA 4TVYA 3SN4A 2W3SA 4PVKA 2QJJA 3CT2A 1W6TA 5JCNA 2GL5A 2OVLA 2J3NA 4EQWA 1W1QA 1DTNA 3DEDA 3H12A 5AWVA 1SJDA 2TPRA 4BC7A 3EJEB 5ER0A 1GERA 2HXUA 3TWBA 3RJ8A 3II4A 1FECA 5I1WA 3R1ZA 1FHUA 1R0MA 4MMWA 5JCKA 5FJTA 1E9IA 3PFRA 1ZKQA 3DGBA 4M6UA 4EMWA 3QTPA 4DWDA 2W0HA 3NVVB 1KCZA 4HPNA 3LAEA 4A35A 4GYPC 2BVHA 2PCEA 1DIQA 4BV6A 2O3GA 3VDGA 2OQHA 5FS6A 1HSKA 1ZR6A 3IJIA 3EANA 2P4PA 3DJJA 1QLTA 3R10A 5FS9A 4DYEA 3JVAA 2GSHA 2QKNA 3S47A 2QVHA 2PS2A 3EJBB 5FXDA 3W8XA 1VAOA 3B9JB 3GO2A 1NPXA 1P48A 3VC6A 3I4KA 2OZTA 4GFIA 1F9CA 3KUMA 3ZVHA 3LLBA 3VCCA 3D2DA 2RDXA 2A8XA 3GRTA 2VFTA 1EC9A 4FP1A 3VFCA 5FXEA 4JDRA 3HW2A 2NVKX 2RABA 1ZMCA 2VAOA 4J3ZA 3PQBA 2WOIA 2E3TA 3ZLFA 2I5QA 3Q45A 4H19A 4NEVA 2P3ZA 3S1FA 5AE1A 4A6GA 3UXLA 3OC4A 4FDCB 2RK5A 1DXLA 3EUB3 3CGBA 1WVFA 3UJEA 3RCYA 2ZC8A 4EQRA 4OALA 3OW1A 3H7VA 1ZMDA 1SJBA 2HNEA 3P0WA 4GGHA 3TJ4A 2WPFA 2P8BA 3CGEA 3HSUA 1NHRA 2UUUA 2V3BA 3V5FA 4J57A 2X8CA 3DESA 4HCLA 5BOFA 2POZA 2EXRA 4KEMA 1D7YA 1VQZA 2ZADA 5FJOA 4K8DA 5TR3A 4HCDA 4HNCA 3QFAA 3R25A 2PU0A 3DERA 2CDUA 1JEHA 2XH2A 2HQMA 5FJPA 1NDAA 5FJUA 1GEUA 2GGEA 3ENLA 4EM4A 4EM3A 4YWSA 3DFHA 2P8CA 3NVZB 2VFVA 3DK9A 3TOYA 2OO6A 3SN1A 3QN3A 2XH0A 4ADWA 3FYYA 1SJAA 1XPYA 1JROA 3P93A 2I0KA 3BW7A 1BQGA 2ZZCA 4H4XA 3U4FA 4H4ZA 3L8KA 4ZA0A 4KPRA 3AMZA 2VFSA 3H4KA 3A7UA 1S7MA 4K7ZA 1W1OA 3UCCA 3V4BA 4IP4A 2WDWA 4JN8A 4LIIA 3JS8A 4H4PA 1KD0A 3AN1A 3DFYA 2YVJA 3PK7A 4HYRA 2MBRA 4EWJA 3GY1A 1TKKA 4H4TA 2W3RA 4E6MA 3DEQA 5HHZA 5L6FA 1I19A 1H6VA 4PWBA 3DIPA 3D46A 4JHMA 3NVWB 2P13A 4HCHA 3BJSA 3RNMA 3R0KA 1DNCA 5EBKA 1JPMA 3N4EA 2BVFA 4MLAA 1GETA 2AL1A 2V3AA 2PSNA 5JCIA 3O0HA 2EQ6A 1L8PA 3T8QA 2ZZBA 2VFUA 1RVKA 2X50A 3HPFA 5GRTA 4HNLA 2X8HA 4JB1A 4EMJA 1XDIA 2DW6A 1WUEA 3A7RA 1AHVA 2OPJA 3NRZB 2R9ZA 2XGZA 3VA8A 4ZOHB 2NQWA 3NVYB 3SR6B 4ZCWA 2EQ7A 1MDLA 1V97A 1FFUC 3N6JA 3LB8A 2YAUA 2Q85A 3POPA 2GDQA 1N63C 2UUVA 2PTZA 2PMQA 3OZYA 4EC3A 1Q1WA 2QDEA 3ES7A 1ONEA 1AHUA 2AAQA 3D2HA 4BBYA 3ES8A 1GRHA 2WPCA 4H4YA 3FXGA 3SQSA 2AL2A 3SN0A 1N61C 1JOAA 2BCPA 3SBFA 2PTWA 4PYTA 1FHVA 2GGGA 2BC1A 1X2GA 2V6OA 4H1ZA 3EF6A 3STPA 3T6CA 2R2ZA 2DW7A 3MSYA 3FW7A 1JRPA 3KLJA 1GREA 1MDRA 1EBDA 2HXTA 1OJTA 1F3PA 4G7FA 2QJNA 3D9XA 1GRFA 3UJRA 2OLAA 4GISA 4H4SA 3NZGA 4H4WA 1Q1RA 3QLDA 4FI4A 1NELA 2PP0A 2PLSA 1ONFA 1X2HA 4X2PA 2BC0A 1JPDX 2GRTA 3H8AA 3VTEA 2OZ8A 3FV9A 3RO6A 2NPXA 1XANA 3DK8A 2Y08A 1SB3B 4DN1A 4E4FA 5AE3A 4FX9A 2P3HA 5FMHA 2WBAA 1T3QC 3CGDA 2EQ8A 5BOEA 3AM9A 4J1OA 3SQPA 1NHPA 1NU5A 3MY9A 4K8GA 2XSXA 3FW9A 4H83A 2ONEA 1OEPA 2PTYA 4BCAA 2GGJA 2P0IA 1BKHA 3QFBA 1E0YA 3T9PA 3DK4A 5G5HB 5FXPA 1MRAA 4GYPA 1GRGA 1QLUA 2XH7A 3VCNA 1ELSA 4YWOA 1EBHA 3S5SA 1W1LA 3S1EA 3FG2P 1TZZA 2FKPA 3I6TA 1F8WA 2GQWA 1ZXIC 4HN8A 3TSHA 1VDVA 3HRDC 4E8GA 1GSNA 3B97A 3R07C 2F5ZA 3Q4DA 3U9IA 3FVDA 2X8GA 3GRSA 3JZUA 3D2JA 2YVFA 1PDZA 3ZVHB 3DGZA 3RGTA 4GIRA 2OQYA 2WP6A 4O95A 2QPMA 1MUCA 2YVGA 2PLIA 1W1SA 1LPFA 2ZZ0A 3VC5A 1F0XA 3DG6A 4F4RA 3I99A 1R6WA 1NHQA 4KWSA 1N5XA 3DG7A 5K8EA 3W8ZA 1AHZA 2XH4A 3R11A 4KPLA 3LXDA 3NFUA 1PDYA 3CK5A 1GRBA 1XHCA 1YEYA 3BSMA 2CFYA 3TTEA 2PGWA 3UGVA 1ZDLA 1EC7A 1MNSA 2EQ9A 3NO1A 4IT1A 3MUCA 2PODA 3W8WA 2WOWA 3RRAA 3ZLGA 1EC8A 3UJ2A 1GXFA 5U1OA 3PM9A 2O56A 5KVIA 1TYPA 1ZY8A 1V59A 2E5AA 2OZ3A 2QAEA 2OFJA 2GQUA 1UXYA 4H4VA 2Q4WA 2X99A 5ENLA 5JRBA 3RJAA 1GESA 4H4UA 3TQPA 2R8DA 3SJNA 5JCLA 3DH9A 2OG9A 5EU9A 2C3CA 4KT2A 5AE2A 1N60C 2GGHA 3PG6A 4GRTA 2Y3RA 3DGHA 4E5TA 3LADA 4GR1A 4HG0A 3PWGA 3GD4A 1RM6B 2P88A 3IC9A 2GR0A 2PA6A 2GGIA 4DHGA 5FS7A 4PZFA 3MWCA 3DDMA 3V3WA 3DQ0A 1W1MA 2GR3A 2PPGA 3ETRB 1W1JA 4BC9A 1ZK7A 3N4FA 2W55A 5KVHA 2WP5A 4PVHA 3FCPA 3ZVIA 1WYGA 5J04A 2MUCA 3RR1A 2C3DA 4A3RA 5ADZA 1GRTA 5FJRA 2AKZA 5HQXA 4H2HA 4IP5A 3GC2A 2PP1A 3THUA 1GRAA 2Y3SA 1LVLA 3MZNA 2CHRA 4MGGA 2WPEA 3CXBA 3P3BA 1WUFA 4IL2A 3FW8A 1GV4A 4Z17A 3EKGA 3MKCA 4XLOA 3R0UA 4IHCA 3OTRA 1XS2A 1DZNA 4PVEA 1WVEA 3UJFA 4DNSA 4DNAA 3URHA 5FS8A 3FJ4A 4K1WA 5JCMA 4DXKA 1KN0A 1ECQA 5IDZA 2WOVA 4PVJA 1W1RA
chains in the Genus database with same CATH topology
1N62C 2VFSA 3AMZA 1ZXIC 3A7UA 5I1WA 1W1OA 3TSHA 1VDVA 2WDWA 3HRDC 1W1KA 3JS8A 3AN1A 3R07C 1E8FA 2MBRA 4JAYA 2YVSA 3NVVB 3D2JA 2OAIA 4PWCA 2W3RA 4ML8A 5L6FA 5HHZA 3LAEA 1I19A 1MBBA 2BVGA 2BVHA 4PWBA 3TSJA 2P13A 1DIQA 3NVWB 4O95A 2O3GA 2QPMA 2GQTA 1HSKA 1E8GA 1ZR6A 2PLIA 1W1SA 2P4PA 2BVFA 4MLAA 1F0XA 3KJMA 3S1CA 3I99A 1QLTA 1N5XA 5K8EA 3W8ZA 1FO4A 2QKNA 4UD8A 2VFUA 1AHZA 5FXDA 3W8XA 1VAOA 4JB1A 3B9JB 3A7RA 1AHVA 1N5WC 3NRZB 4ZOHB 2NQWA 3SR6B 3NVYB 1V97A 1FFUC 3W8WA 3LLBA 2Q85A 3D2DA 3POPA 1N63C 2UUVA 3PM9A 2AXRA 2VFTA 4EC3A 3TX1A 5FXEA 2E5AA 5HMRA 2GQUA 1UXYA 2IPIA 2Q4WA 2VAOA 3RJAA 3PQBA 1AHUA 1MBTA 3D2HA 1E8HA 4BBYA 2R8DA 2E3TA 3FWAA 3GSYA 3S1FA 5AE1A 1N61C 2RK5A 5AE2A 3EUB3 1N60C 1WVFA 4PYTA 2Y3RA 1X2GA 4OALA 2R2ZA 3FW7A 1JRPA 4HG0A 3HSUA 1RM6B 2UUUA 3NS1B 2EXRA 4PZFA 3S1DA 3DQ0A 1FIQB 1W1MA 1VQZA 5D79A 3ETRB 1W1JA 4BC9A 5G5GB 2W55A 2PLSA 1X2HA 4PVHA 1WYGA 3VTEA 5I1VA 5ADZA 2Y08A 5HQXA 3C0PA 1SB3B 2Y3SA 5AE3A 2P3HA 5FXFA 1T3QC 2VFRA 3A7AA 4TVWA 2Y4GA 3AM9A 5L6GA 3FW8A 1DIIA 1FFVC 3NVZB 2VFVA 2W54A 4XLOA 3FW9A 4TVYA 2W3SA 4PVKA 1DZNA 4PVEA 1WVEA 4BCAA 4DNSA 1E0YA 1JROA 5G5HB 5FXPA 2I0KA 3BW7A 1W1QA 1QLUA 3DEDA 5AWVA 1W1LA 3S1EA 4BC7A 4PVJA 3RJ8A 1W1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N62 C;  2VFS A;  3AMZ A;  1ZXI C;  3A7U A;  1W1O A;  3TSH A;  1VDV A;  3HRD C;  1W1K A;  3JS8 A;  3AN1 A;  3R07 C;  1E8F A;  2MBR A;  4JAY A;  2YVS A;  3NVV B;  3D2J A;  2OAI A;  4PWC A;  2W3R A;  4ML8 A;  5HHZ A;  3LAE A;  1I19 A;  1MBB A;  2BVG A;  2BVH A;  4PWB A;  3TSJ A;  2P13 A;  1DIQ A;  3NVW B;  4O95 A;  2O3G A;  2QPM A;  2GQT A;  1HSK A;  1E8G A;  1ZR6 A;  2PLI A;  1W1S A;  2P4P A;  2BVF A;  4MLA A;  1F0X A;  3KJM A;  3S1C A;  3I99 A;  1QLT A;  1N5X A;  3W8Z A;  1FO4 A;  2QKN A;  4UD8 A;  2VFU A;  1AHZ A;  5FXD A;  3W8X A;  1VAO A;  4JB1 A;  3B9J B;  3A7R A;  1AHV A;  1N5W C;  3NRZ B;  4ZOH B;  2NQW A;  3SR6 B;  3NVY B;  1V97 A;  1FFU C;  3W8W A;  3LLB A;  2Q85 A;  3D2D A;  1N63 C;  3PM9 A;  2AXR A;  2VFT A;  4EC3 A;  3TX1 A;  5FXE A;  2E5A A;  5HMR A;  2GQU A;  1UXY A;  2Q4W A;  2VAO A;  1AHU A;  1MBT A;  3D2H A;  1E8H A;  4BBY A;  2R8D A;  2E3T A;  3FWA A;  3GSY A;  3S1F A;  5AE1 A;  1N61 C;  2RK5 A;  5AE2 A;  3EUB 3;  1N60 C;  1WVF A;  4PYT A;  1X2G A;  4OAL A;  2R2Z A;  3FW7 A;  1JRP A;  4HG0 A;  1RM6 B;  3NS1 B;  2EXR A;  4PZF A;  3S1D A;  3DQ0 A;  1FIQ B;  1W1M A;  1VQZ A;  5D79 A;  3ETR B;  1W1J A;  4BC9 A;  5G5G B;  2W55 A;  2PLS A;  1X2H A;  4PVH A;  1WYG A;  3VTE A;  5ADZ A;  5HQX A;  3C0P A;  1SB3 B;  5AE3 A;  2P3H A;  5FXF A;  1T3Q C;  2VFR A;  3A7A A;  4TVW A;  3AM9 A;  3FW8 A;  1DII A;  1FFV C;  3NVZ B;  2VFV A;  2W54 A;  4XLO A;  3FW9 A;  4TVY A;  2W3S A;  4PVK A;  1DZN A;  4PVE A;  1WVE A;  4BCA A;  4DNS A;  1E0Y A;  1JRO A;  5G5H B;  5FXP A;  2I0K A;  3BW7 A;  1W1Q A;  1QLU A;  3DED A;  1W1L A;  3S1E A;  4BC7 A;  4PVJ A;  1W1R A; 
#chains in the Genus database with same CATH topology
 1N62 C;  2QJM A;  4IZG A;  1H2I A;  1TYT A;  3L5O A;  3GD6 A;  1W1K A;  3CAW A;  3TWA A;  1KKO A;  3H70 A;  1SJC A;  4JN7 A;  3BOX A;  1E8F A;  4JAY A;  2YVS A;  3Q6J A;  4K2S A;  2OAI A;  4PWC A;  4ML8 A;  3CXO A;  3D47 A;  7ENL A;  1MBB A;  2BVG A;  2JK6 A;  3TSJ A;  3UCD A;  1P43 A;  1IYX A;  4APN A;  2YQU A;  2GQT A;  5U25 A;  1E8G A;  1TE6 A;  3KJM A;  3S1C A;  4BUR A;  2PGE A;  2FYM A;  4DX3 A;  3DJG X;  3JW7 A;  1BWC A;  1FO4 A;  2OX4 A;  4UD8 A;  2HZG A;  3UXK A;  2QDD A;  2NQL A;  2GR1 A;  2AL2 B;  2GH5 A;  1FEA A;  6ENL A;  4EQS A;  1JCT A;  1M6I A;  2QQ6 A;  3NXL A;  1N5W C;  3UJS A;  2QGY A;  4H4R A;  3CGC A;  4MKS A;  4JQ9 A;  4M52 A;  2AXR A;  2PP3 A;  3CYJ A;  4ROP A;  2MNR A;  3TX1 A;  5HMR A;  4ENL A;  2IPI A;  2PU1 A;  3T4W A;  1MOK A;  3I6E A;  1MBT A;  1E8H A;  1KKR A;  1NHS A;  4IL0 A;  1K4Q A;  3V5C A;  3FWA A;  1BZL A;  3GSY A;  1FEB A;  2GR2 A;  1YQZ A;  4EQX A;  4GME A;  3OP2 A;  3N6H A;  1ZX9 A;  3DG3 A;  1MO9 A;  4G8T A;  4H4Q A;  3GD3 A;  3OPS A;  3OZM A;  4M0X A;  3K1G A;  3NS1 B;  3S1D A;  3QPE A;  4H50 A;  3EEZ A;  1FIQ B;  4J56 A;  3IK4 A;  3ZLH A;  5D79 A;  1JDF A;  5G5G B;  3TJI A;  3MQT A;  4EMI A;  4NEW A;  1EBG A;  1STZ A;  3PWI A;  4LA1 A;  5I1V A;  3SSZ A;  2PTX A;  3C0P A;  3IJQ A;  3RIT A;  4Z1Y A;  3TCS A;  5FXF A;  3TW9 A;  2VFR A;  3A7A A;  3QKE A;  3EJD B;  4TVW A;  2Y4G A;  4GGB A;  3IJL A;  5L6G A;  1DII A;  1FFV C;  2AKM A;  2W54 A;  3CB3 A;  4E4U A;  3EAO A;  1AOG A;  2OKT A;  4TVY A;  3SN4 A;  2W3S A;  4PVK A;  2QJJ A;  3CT2 A;  1W6T A;  5JCN A;  2GL5 A;  2OVL A;  2J3N A;  4EQW A;  1W1Q A;  1DTN A;  3DED A;  3H12 A;  5AWV A;  1SJD A;  2TPR A;  4BC7 A;  3EJE B;  5ER0 A;  1GER A;  2HXU A;  3TWB A;  3RJ8 A;  3II4 A;  1FEC A;  5I1W A;  3R1Z A;  1FHU A;  1R0M A;  4MMW A;  5JCK A;  5FJT A;  1E9I A;  3PFR A;  1ZKQ A;  3DGB A;  4M6U A;  4EMW A;  3QTP A;  4DWD A;  2W0H A;  3NVV B;  1KCZ A;  4HPN A;  3LAE A;  4A35 A;  4GYP C;  2BVH A;  2PCE A;  1DIQ A;  4BV6 A;  2O3G A;  3VDG A;  2OQH A;  5FS6 A;  1HSK A;  1ZR6 A;  3IJI A;  3EAN A;  2P4P A;  3DJJ A;  1QLT A;  3R10 A;  5FS9 A;  4DYE A;  3JVA A;  2GSH A;  2QKN A;  3S47 A;  2QVH A;  2PS2 A;  3EJB B;  5FXD A;  3W8X A;  1VAO A;  3B9J B;  3GO2 A;  1NPX A;  1P48 A;  3VC6 A;  3I4K A;  2OZT A;  4GFI A;  1F9C A;  3KUM A;  3ZVH A;  3LLB A;  3VCC A;  3D2D A;  2RDX A;  2A8X A;  3GRT A;  2VFT A;  1EC9 A;  4FP1 A;  3VFC A;  5FXE A;  4JDR A;  3HW2 A;  2NVK X;  2RAB A;  1ZMC A;  2VAO A;  4J3Z A;  3PQB A;  2WOI A;  2E3T A;  3ZLF A;  2I5Q A;  3Q45 A;  4H19 A;  4NEV A;  2P3Z A;  3S1F A;  5AE1 A;  4A6G A;  3UXL A;  3OC4 A;  4FDC B;  2RK5 A;  1DXL A;  3EUB 3;  3CGB A;  1WVF A;  3UJE A;  3RCY A;  2ZC8 A;  4EQR A;  4OAL A;  3OW1 A;  3H7V A;  1ZMD A;  1SJB A;  2HNE A;  3P0W A;  4GGH A;  3TJ4 A;  2WPF A;  2P8B A;  3CGE A;  3HSU A;  1NHR A;  2UUU A;  2V3B A;  3V5F A;  4J57 A;  2X8C A;  3DES A;  4HCL A;  5BOF A;  2POZ A;  2EXR A;  4KEM A;  1D7Y A;  1VQZ A;  2ZAD A;  5FJO A;  4K8D A;  5TR3 A;  4HCD A;  4HNC A;  3QFA A;  3R25 A;  2PU0 A;  3DER A;  2CDU A;  1JEH A;  2XH2 A;  2HQM A;  5FJP A;  1NDA A;  5FJU A;  1GEU A;  2GGE A;  3ENL A;  4EM4 A;  4EM3 A;  4YWS A;  3DFH A;  2P8C A;  3NVZ B;  2VFV A;  3DK9 A;  3TOY A;  2OO6 A;  3SN1 A;  3QN3 A;  2XH0 A;  4ADW A;  3FYY A;  1SJA A;  1XPY A;  1JRO A;  3P93 A;  2I0K A;  3BW7 A;  1BQG A;  2ZZC A;  4H4X A;  3U4F A;  4H4Z A;  3L8K A;  4ZA0 A;  4KPR A;  3AMZ A;  2VFS A;  3H4K A;  3A7U A;  1S7M A;  4K7Z A;  1W1O A;  3UCC A;  3V4B A;  4IP4 A;  2WDW A;  4JN8 A;  4LII A;  3JS8 A;  4H4P A;  1KD0 A;  3AN1 A;  3DFY A;  2YVJ A;  3PK7 A;  4HYR A;  2MBR A;  4EWJ A;  3GY1 A;  1TKK A;  4H4T A;  2W3R A;  4E6M A;  3DEQ A;  5HHZ A;  5L6F A;  1I19 A;  1H6V A;  4PWB A;  3DIP A;  3D46 A;  4JHM A;  3NVW B;  2P13 A;  4HCH A;  3BJS A;  3RNM A;  3R0K A;  1DNC A;  5EBK A;  1JPM A;  3N4E A;  2BVF A;  4MLA A;  1GET A;  2AL1 A;  2V3A A;  2PSN A;  5JCI A;  3O0H A;  2EQ6 A;  1L8P A;  3T8Q A;  2ZZB A;  2VFU A;  1RVK A;  2X50 A;  3HPF A;  5GRT A;  4HNL A;  2X8H A;  4JB1 A;  4EMJ A;  1XDI A;  2DW6 A;  1WUE A;  3A7R A;  1AHV A;  2OPJ A;  3NRZ B;  2R9Z A;  2XGZ A;  3VA8 A;  4ZOH B;  2NQW A;  3NVY B;  3SR6 B;  4ZCW A;  2EQ7 A;  1MDL A;  1V97 A;  1FFU C;  3N6J A;  3LB8 A;  2YAU A;  2Q85 A;  3POP A;  2GDQ A;  1N63 C;  2UUV A;  2PTZ A;  2PMQ A;  3OZY A;  4EC3 A;  1Q1W A;  2QDE A;  3ES7 A;  1ONE A;  1AHU A;  2AAQ A;  3D2H A;  4BBY A;  3ES8 A;  1GRH A;  2WPC A;  4H4Y A;  3FXG A;  3SQS A;  2AL2 A;  3SN0 A;  1N61 C;  1JOA A;  2BCP A;  3SBF A;  2PTW A;  4PYT A;  1FHV A;  2GGG A;  2BC1 A;  1X2G A;  2V6O A;  4H1Z A;  3EF6 A;  3STP A;  3T6C A;  2R2Z A;  2DW7 A;  3MSY A;  3FW7 A;  1JRP A;  3KLJ A;  1GRE A;  1MDR A;  1EBD A;  2HXT A;  1OJT A;  1F3P A;  4G7F A;  2QJN A;  3D9X A;  1GRF A;  3UJR A;  2OLA A;  4GIS A;  4H4S A;  3NZG A;  4H4W A;  1Q1R A;  3QLD A;  4FI4 A;  1NEL A;  2PP0 A;  2PLS A;  1ONF A;  1X2H A;  4X2P A;  2BC0 A;  1JPD X;  2GRT A;  3H8A A;  3VTE A;  2OZ8 A;  3FV9 A;  3RO6 A;  2NPX A;  1XAN A;  3DK8 A;  2Y08 A;  1SB3 B;  4DN1 A;  4E4F A;  5AE3 A;  4FX9 A;  2P3H A;  5FMH A;  2WBA A;  1T3Q C;  3CGD A;  2EQ8 A;  5BOE A;  3AM9 A;  4J1O A;  3SQP A;  1NHP A;  1NU5 A;  3MY9 A;  4K8G A;  2XSX A;  3FW9 A;  4H83 A;  2ONE A;  1OEP A;  2PTY A;  4BCA A;  2GGJ A;  2P0I A;  1BKH A;  3QFB A;  1E0Y A;  3T9P A;  3DK4 A;  5G5H B;  5FXP A;  1MRA A;  4GYP A;  1GRG A;  1QLU A;  2XH7 A;  3VCN A;  1ELS A;  4YWO A;  1EBH A;  3S5S A;  1W1L A;  3S1E A;  3FG2 P;  1TZZ A;  2FKP A;  3I6T A;  1F8W A;  2GQW A;  1ZXI C;  4HN8 A;  3TSH A;  1VDV A;  3HRD C;  4E8G A;  1GSN A;  3B97 A;  3R07 C;  2F5Z A;  3Q4D A;  3U9I A;  3FVD A;  2X8G A;  3GRS A;  3JZU A;  3D2J A;  2YVF A;  1PDZ A;  3ZVH B;  3DGZ A;  3RGT A;  4GIR A;  2OQY A;  2WP6 A;  4O95 A;  2QPM A;  1MUC A;  2YVG A;  2PLI A;  1W1S A;  1LPF A;  2ZZ0 A;  3VC5 A;  1F0X A;  3DG6 A;  4F4R A;  3I99 A;  1R6W A;  1NHQ A;  4KWS A;  1N5X A;  3DG7 A;  5K8E A;  3W8Z A;  1AHZ A;  2XH4 A;  3R11 A;  4KPL A;  3LXD A;  3NFU A;  1PDY A;  3CK5 A;  1GRB A;  1XHC A;  1YEY A;  3BSM A;  2CFY A;  3TTE A;  2PGW A;  3UGV A;  1ZDL A;  1EC7 A;  1MNS A;  2EQ9 A;  3NO1 A;  4IT1 A;  3MUC A;  2POD A;  3W8W A;  2WOW A;  3RRA A;  3ZLG A;  1EC8 A;  3UJ2 A;  1GXF A;  5U1O A;  3PM9 A;  2O56 A;  5KVI A;  1TYP A;  1ZY8 A;  1V59 A;  2E5A A;  2OZ3 A;  2QAE A;  2OFJ A;  2GQU A;  1UXY A;  4H4V A;  2Q4W A;  2X99 A;  5ENL A;  5JRB A;  3RJA A;  1GES A;  4H4U A;  3TQP A;  2R8D A;  3SJN A;  5JCL A;  3DH9 A;  2OG9 A;  5EU9 A;  2C3C A;  4KT2 A;  5AE2 A;  1N60 C;  2GGH A;  3PG6 A;  4GRT A;  2Y3R A;  3DGH A;  4E5T A;  3LAD A;  4GR1 A;  4HG0 A;  3PWG A;  3GD4 A;  1RM6 B;  2P88 A;  3IC9 A;  2GR0 A;  2PA6 A;  2GGI A;  4DHG A;  5FS7 A;  4PZF A;  3MWC A;  3DDM A;  3V3W A;  3DQ0 A;  1W1M A;  2GR3 A;  2PPG A;  3ETR B;  1W1J A;  4BC9 A;  1ZK7 A;  3N4F A;  2W55 A;  5KVH A;  2WP5 A;  4PVH A;  3FCP A;  3ZVI A;  1WYG A;  5J04 A;  2MUC A;  3RR1 A;  2C3D A;  4A3R A;  5ADZ A;  1GRT A;  5FJR A;  2AKZ A;  5HQX A;  4H2H A;  4IP5 A;  3GC2 A;  2PP1 A;  3THU A;  1GRA A;  2Y3S A;  1LVL A;  3MZN A;  2CHR A;  4MGG A;  2WPE A;  3CXB A;  3P3B A;  1WUF A;  4IL2 A;  3FW8 A;  1GV4 A;  4Z17 A;  3EKG A;  3MKC A;  4XLO A;  3R0U A;  4IHC A;  3OTR A;  1XS2 A;  1DZN A;  4PVE A;  1WVE A;  3UJF A;  4DNS A;  4DNA A;  3URH A;  5FS8 A;  3FJ4 A;  4K1W A;  5JCM A;  4DXK A;  1KN0 A;  1ECQ A;  5IDZ A;  2WOV A;  4PVJ A;  1W1R A; 
#chains in the Genus database with same CATH homology
 1N62 C;  2VFS A;  3AMZ A;  1ZXI C;  3A7U A;  5I1W A;  1W1O A;  3TSH A;  1VDV A;  2WDW A;  3HRD C;  1W1K A;  3JS8 A;  3AN1 A;  3R07 C;  1E8F A;  2MBR A;  4JAY A;  2YVS A;  3NVV B;  3D2J A;  2OAI A;  4PWC A;  2W3R A;  4ML8 A;  5L6F A;  5HHZ A;  3LAE A;  1I19 A;  1MBB A;  2BVG A;  2BVH A;  4PWB A;  3TSJ A;  2P13 A;  1DIQ A;  3NVW B;  4O95 A;  2O3G A;  2QPM A;  2GQT A;  1HSK A;  1E8G A;  1ZR6 A;  2PLI A;  1W1S A;  2P4P A;  2BVF A;  4MLA A;  1F0X A;  3KJM A;  3S1C A;  3I99 A;  1QLT A;  1N5X A;  5K8E A;  3W8Z A;  1FO4 A;  2QKN A;  4UD8 A;  2VFU A;  1AHZ A;  5FXD A;  3W8X A;  1VAO A;  4JB1 A;  3B9J B;  3A7R A;  1AHV A;  1N5W C;  3NRZ B;  4ZOH B;  2NQW A;  3SR6 B;  3NVY B;  1V97 A;  1FFU C;  3W8W A;  3LLB A;  2Q85 A;  3D2D A;  3POP A;  1N63 C;  2UUV A;  3PM9 A;  2AXR A;  2VFT A;  4EC3 A;  3TX1 A;  5FXE A;  2E5A A;  5HMR A;  2GQU A;  1UXY A;  2IPI A;  2Q4W A;  2VAO A;  3RJA A;  3PQB A;  1AHU A;  1MBT A;  3D2H A;  1E8H A;  4BBY A;  2R8D A;  2E3T A;  3FWA A;  3GSY A;  3S1F A;  5AE1 A;  1N61 C;  2RK5 A;  5AE2 A;  3EUB 3;  1N60 C;  1WVF A;  4PYT A;  2Y3R A;  1X2G A;  4OAL A;  2R2Z A;  3FW7 A;  1JRP A;  4HG0 A;  3HSU A;  1RM6 B;  2UUU A;  3NS1 B;  2EXR A;  4PZF A;  3S1D A;  3DQ0 A;  1FIQ B;  1W1M A;  1VQZ A;  5D79 A;  3ETR B;  1W1J A;  4BC9 A;  5G5G B;  2W55 A;  2PLS A;  1X2H A;  4PVH A;  1WYG A;  3VTE A;  5I1V A;  5ADZ A;  2Y08 A;  5HQX A;  3C0P A;  1SB3 B;  2Y3S A;  5AE3 A;  2P3H A;  5FXF A;  1T3Q C;  2VFR A;  3A7A A;  4TVW A;  2Y4G A;  3AM9 A;  5L6G A;  3FW8 A;  1DII A;  1FFV C;  3NVZ B;  2VFV A;  2W54 A;  4XLO A;  3FW9 A;  4TVY A;  2W3S A;  4PVK A;  1DZN A;  4PVE A;  1WVE A;  4BCA A;  4DNS A;  1E0Y A;  1JRO A;  5G5H B;  5FXP A;  2I0K A;  3BW7 A;  1W1Q A;  1QLU A;  3DED A;  5AWV A;  1W1L A;  3S1E A;  4BC7 A;  4PVJ A;  3RJ8 A;  1W1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...