1FFUC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAAGTGWAYEKLKRKTGDWATAGCAVVMRKSGGTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 83
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffuC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffuC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffuC03
3DQ0A 1JRPA 2BVHA 3R07C 4HG0A 3A7UA 1UXYA 1ZR6A 3TSJA 1ZXIC 2QKNA 3D2JA 4PVEA 4BBYA 1SB3B 2VFUA 2OAIA 1V97A 1W1MA 2RK5A 1MBTA 1W1OA 1VQZA 3FW7A 1QLUA 5AE2A 4XLOA 1W1QA 2P13A 1W1SA 1E0YA 2R8DA 3JS8A 3C0PA 5FXEA 2W3SA 2VFVA 4PVKA 4PVJA 2Q85A 1DIIA 4O95A 3SR6B 1FO4A 1I19A 2GQTA 2NQWA 2AXRA 3AN1A 5HQXA 3S1EA 3LAEA 1AHVA 4MLAA 1VDVA 1WYGA 4ML8A 4BC7A 3W8XA 2Q4WA 1E8FA 4TVWA 1MBBA 1N60C 3DEDA 4ZOHB 2I0KA 2W54A 2P3HA 2PLIA 2VFSA 3LLBA 2W3RA 1DIQA 3FW8A 4JB1A 3W8ZA 1W1RA 4JAYA 3NVVB 1E8GA 2W55A 1VAOA 1FFVC 3BW7A 2P4PA 1WVFA 1N62C 3S1CA 3ETRB 1X2HA 2VFTA 3NVZB 3S1DA 4DNSA 3KJMA 3AMZA 3FWAA 4PYTA 3NS1B 4EC3A 3A7AA 5FXFA 5ADZA 3GSYA 5FXDA 2R2ZA 1AHUA 1T3QC 3I99A 1FIQB 1W1KA 1FFUC 4PVHA 1AHZA 5AE1A 3FW9A 4PWBA 2BVGA 3HRDC 5FXPA 3EUB3 1N63C 1N5XA 4UD8A 1W1LA 4BC9A 2VFRA 3NRZB 3NVYB 5HHZA 5HMRA 4TVYA 2E5AA 1JROA 1WVEA 2E3TA 2QPMA 3S1FA 3W8WA 5G5HB 3PM9A 2YVSA 3TX1A 4PZFA 1N5WC 2PLSA 2O3GA 2BVFA 1F0XA 1X2GA 4PWCA 3A7RA 4OALA 3D2DA 4BCAA 2VAOA 1QLTA 1HSKA 5D79A 3AM9A 1DZNA 5G5GB 2MBRA 3TSHA 1N61C 3D2HA 3NVWB 5AE3A 1E8HA 1W1JA 3B9JB 3VTEA 1RM6B 2GQUA 2EXRA
chains in the Genus database with same CATH superfamily
3L5OA 3DQ0A 2Y4GA 3ZLHA 2GGGA 1ZDLA 2HQMA 2PTZA 3URHA 3IC9A 3ZVIA 1FHVA 1P48A 2PU1A 3TCSA 3Q45A 3UGVA 3D2JA 2DW6A 3EAOA 5KVIA 2OPJA 2GR2A 3VCNA 4E8GA 1V59A 2PTYA 5FJRA 3V5CA 4F4RA 2P8CA 4J3ZA 4GFIA 1ZY8A 1BKHA 4HN8A 1AOGA 3DFYA 1W1OA 3UCDA 2OVLA 3CGDA 3UCCA 1W1QA 4DWDA 3U9IA 2UUVA 3T8QA 3DK8A 1PDZA 4H1ZA 3DESA 3EJEB 2OG9A 3R0UA 4PVKA 2Q85A 1DIIA 3QFBA 2UUUA 1FO4A 5JCKA 1I19A 4GR1A 2GQTA 3TWAA 2AXRA 3LAEA 5HQXA 2OLAA 2PTXA 3ZVHB 3W8XA 1ZKQA 4H50A 4K1WA 3PWIA 2YVFA 1MBBA 2OKTA 4GMEA 2I0KA 2VFSA 2PS2A 4H2HA 2WPFA 2W3RA 2GGJA 2QDDA 3IJQA 3P0WA 3V3WA 1TE6A 4JB1A 3FJ4A 3P3BA 3B97A 2GQWA 1VAOA 5FS6A 3POPA 2BCPA 3CT2A 1N62C 3ETRB 1X2HA 2WP6A 2VFTA 3NVZB 2OO6A 3SQSA 3ZLGA 2MNRA 2DW7A 4DNSA 3KJMA 3AMZA 2GSHA 3N4FA 3TWBA 4EC3A 2GGEA 2NVKX 3D46A 4GGBA 1H2IA 1P43A 5ADZA 3CXOA 4DXKA 3MY9A 2R2ZA 4IT1A 3NFUA 2ZADA 1T3QC 3I99A 2PPGA 1W1KA 2YVJA 2JK6A 2X50A 1S7MA 4PWBA 3DGZA 3HRDC 1BWCA 3EUB3 3DJJA 2Y3SA 3DG6A 3S47A 1N63C 1N5XA 2WOWA 3NVYB 2RDXA 1NDAA 1PDYA 1SJCA 2ZZBA 2E3TA 2HNEA 4FX9A 1XPYA 3W8WA 3MWCA 3VC6A 4E4FA 2YVSA 2AL1A 4KWSA 3SSZA 2GL5A 2WOVA 1N5WC 4H4TA 2AKZA 3UJFA 2QDEA 2BVFA 3N4EA 5FJTA 5U25A 4H4SA 4EQRA 4PWCA 3FG2P 4M0XA 1K4QA 3TQPA 4BCAA 3PK7A 1TYPA 1HSKA 3EJBB 2GH5A 4ROPA 3AM9A 4YWOA 5G5GB 2YQUA 2MBRA 4H4ZA 3I6EA 1EC7A 4M52A 3I4KA 2FKPA 4EM3A 1E8HA 3GD6A 3PG6A 3VTEA 2P8BA 3ES7A 1RM6B 2MUCA 1JRPA 2WDWA 4A3RA 3VDGA 3OZMA 4GYPC 1DTNA 1UXYA 1ZXIC 1ONEA 2EQ7A 3DEQA 4DHGA 4PVEA 1GESA 1GRFA 2C3CA 1KKOA 1SB3B 4DX3A 1GEUA 1GRAA 3IJLA 1W1MA 4GRTA 1MUCA 5TR3A 3FW7A 4HPNA 3Q4DA 4XLOA 4K7ZA 3OTRA 1EBHA 3R11A 3SN1A 2XGZA 1E0YA 3I6TA 5JCIA 2R8DA 1STZA 3C0PA 2GR0A 4G7FA 2V3AA 5FXEA 3SQPA 2CHRA 1LVLA 3H8AA 3R1ZA 3CYJA 1OEPA 4O95A 3AN1A 3S1EA 2PCEA 4E4UA 1SJBA 2YVGA 4ML8A 4BC7A 4KPLA 3MKCA 4EQWA 2Q4WA 3VCCA 5FS7A 2HZGA 3DK4A 4ADWA 1N60C 3QN3A 4ZOHB 2W54A 3LLBA 3FW8A 2ZC8A 3W8ZA 2POZA 2XH4A 4JAYA 3FYYA 4HNLA 3DG3A 1JDFA 1FFVC 4H4UA 5FS9A 1GV4A 2Y3RA 3S1CA 4KPRA 4E5TA 3LADA 3S5SA 4Z1YA 3TTEA 1MRAA 3QPEA 2QJMA 4EQXA 3GO2A 3NO1A 4H4XA 2OQHA 3RJAA 2X99A 3UJEA 3FVDA 4ENLA 1MDRA 2V6OA 4LA1A 1FIQB 2R9ZA 2OFJA 4EWJA 2PA6A 2BVGA 3BOXA 3V4BA 4IP4A 3DIPA 3FXGA 3RR1A 3PWGA 1W1LA 4EMWA 3NRZB 4MKSA 2E5AA 3EJDB 3JVAA 3OP2A 2AAQA 1L8PA 2X8CA 3S1FA 3R0KA 5G5HB 2OX4A 3U4FA 4EQSA 2IPIA 3DG7A 1NHQA 3HSUA 2WPCA 1F0XA 1X2GA 3VFCA 5K8EA 3HW2A 3RO6A 3H12A 2PGEA 5D79A 4K8GA 4J57A 4JQ9A 1E9IA 4E6MA 2GR3A 4IZGA 3TJ4A 2ZZCA 3TSHA 3CGEA 2F5ZA 4H4RA 4FP1A 3NVWB 1W1JA 3SJNA 4K2SA 4Z17A 3KLJA 3LB8A 1RVKA 5GRTA 3TOYA 1GRGA 2BVHA 3CK5A 3NXLA 3MQTA 2OQYA 3CGBA 1ZR6A 3TSJA 4BURA 2XH0A 4MMWA 1KKRA 5ENLA 2XH2A 4BBYA 2OAIA 3OPSA 4EM4A 2GGHA 3SN0A 2RK5A 1MBTA 5FJUA 1EC9A 2XSXA 3R25A 1SJAA 1MO9A 4H19A 1MNSA 3QKEA 1W1SA 2XH7A 4JN8A 3RITA 3JS8A 3CGCA 2PP3A 1W6TA 3DK9A 4DNAA 4PVJA 2YAUA 3EF6A 3RCYA 4IL2A 3T6CA 3ZLFA 2TPRA 2HXTA 3ES8A 2NPXA 5FS8A 1XS2A 1WUFA 3L8KA 1E8FA 4TVWA 2QJNA 3DGBA 3GRSA 2C3DA 3D47A 3NZGA 1JCTA 3DH9A 4HCHA 3NVVB 2W55A 4IP5A 1ECQA 2CDUA 1KN0A 3BW7A 4NEWA 4HYRA 1WVFA 2A8XA 4DN1A 4IHCA 1ZMDA 3FWAA 4PYTA 1XANA 6ENLA 3N6JA 3OW1A 1IYXA 7ENLA 3GSYA 5FXDA 1LPFA 3FCPA 3GRTA 3SN4A 2PODA 2WOIA 4GIRA 1AHUA 2BC0A 3R10A 3N6HA 1FFUC 4PVHA 1D7YA 1AHZA 5AE1A 3FW9A 3UJSA 2W0HA 4MGGA 5FXPA 4GGHA 1OJTA 1M6IA 4ZA0A 2ONEA 2VFRA 2PMQA 1GRBA 4TVYA 3TJIA 1BQGA 2QVHA 1JROA 4H4QA 2WP5A 3V5FA 3CAWA 2OZTA 2QPMA 4JDRA 1EBDA 4FI4A 4BV6A 3MSYA 3PM9A 4HNCA 5EBKA 3H70A 3TX1A 3QLDA 3HPFA 2PLSA 3RNMA 2O3GA 1NHSA 4EMIA 3DJGX 4K8DA 4JHMA 1JOAA 3A7RA 4OALA 3D2DA 4H4WA 2VAOA 5JCLA 2QAEA 1FHUA 1GRTA 3LXDA 1DZNA 1TYTA 5L6GA 4DYEA 4KT2A 1FECA 1ELSA 1F9CA 2I5QA 2ZZ0A 4J56A 5AE3A 2HXUA 3BJSA 5I1VA 1R0MA 3B9JB 5FMHA 4A6GA 2GQUA 2Y08A 3Q6JA 3R07C 4HG0A 2AKMA 2PTWA 3OC4A 3A7UA 3VA8A 2CFYA 3II4A 2GDQA 4EMJA 2QKNA 4HCDA 2J3NA 1TZZA 2VFUA 3O0HA 2PU0A 5FJPA 1V97A 2O56A 5J04A 2GR1A 4H4YA 1VQZA 1QLUA 5AE2A 1JEHA 1GREA 3ZVHA 2P13A 1MDLA 3T4WA 1KCZA 3RRAA 1DNCA 2PGWA 1Q1WA 3JW7A 3UXLA 4LIIA 2W3SA 2EQ8A 2FYMA 1NELA 3DDMA 1XHCA 2QJJA 3RJ8A 2VFVA 1ZMCA 2OZ8A 3D9XA 3SR6B 5AWVA 1KD0A 3MUCA 2WPEA 2NQWA 1H6VA 1AHVA 3UJ2A 4MLAA 1NU5A 3UJRA 5BOEA 3IJIA 1VDVA 2EQ6A 5IDZA 1WYGA 1JPMA 3GC2A 3IK4A 3GD4A 2EQ9A 4APNA 4FDCB 1GETA 3DEDA 1Q1RA 1NHRA 2P3HA 2PLIA 2BC1A 1TKKA 5ER0A 3BSMA 1DIQA 5EU9A 3DFHA 4X2PA 3GY1A 4IL0A 1W1RA 1E8GA 3ENLA 2P4PA 1EBGA 2QGYA 2QQ6A 3QTPA 3S1DA 1MOKA 5FJOA 1GXFA 1F3PA 3A7AA 3K1GA 5FXFA 1GERA 2RABA 1WUEA 1YEYA 2PSNA 2X8GA 3MZNA 2OZ3A 5JCMA 1NHPA 3DERA 4YWSA 1R6WA 3DGHA 3CXBA 3PQBA 4KEMA 3EKGA 4H4VA 1GRHA 3EANA 3H7VA 5JRBA 4H4PA 4HCLA 1FEAA 1DXLA 1JPDX 3P93A 4UD8A 4G8TA 3FV9A 4BC9A 2AL2B 2PP0A 3SBFA 1BZLA 5HHZA 5HMRA 3QFAA 3THUA 3T9PA 4A35A 2X8HA 1WVEA 2PP1A 3EEZA 3CB3A 3JZUA 4GYPA 1EC8A 3VC5A 4M6UA 1ONFA 3RGTA 4ZCWA 1NPXA 5KVHA 2V3BA 4PZFA 1FEBA 5L6FA 1ZX9A 5I1WA 2P3ZA 3GD3A 4JN7A 2GRTA 5BOFA 3TW9A 3STPA 1QLTA 1ZK7A 1F8WA 2AL2A 5JCNA 2NQLA 4GISA 5U1OA 1YQZA 4H83A 4NEVA 1GSNA 3KUMA 1N61C 3UXKA 2WBAA 2P0IA 3D2HA 4J1OA 2P88A 3PFRA 3H4KA 1XDIA 3NS1B 1SJDA 2GGIA 3OZYA 2EXRA
chains in the Genus database with same CATH topology
2Y08A 3DQ0A 1JRPA 2BVHA 3R07C 2WDWA 2Y4GA 4HG0A 3A7UA 1UXYA 1ZR6A 3TSJA 1ZXIC 2QKNA 3D2JA 4PVEA 4BBYA 1SB3B 2VFUA 2OAIA 1V97A 1W1MA 2RK5A 1MBTA 1W1OA 1VQZA 3FW7A 1QLUA 5AE2A 4XLOA 1W1QA 2P13A 1W1SA 1E0YA 2R8DA 3JS8A 2UUVA 3C0PA 5FXEA 2W3SA 3RJ8A 2VFVA 4PVKA 4PVJA 2Q85A 1DIIA 2UUUA 4O95A 3SR6B 1FO4A 5AWVA 1I19A 2GQTA 2NQWA 2AXRA 3AN1A 5HQXA 3S1EA 3LAEA 1AHVA 4MLAA 1VDVA 1WYGA 4ML8A 4BC7A 3W8XA 2Q4WA 1E8FA 4TVWA 1MBBA 1N60C 3DEDA 4ZOHB 2I0KA 2W54A 2P3HA 2PLIA 2VFSA 3LLBA 2W3RA 1DIQA 3FW8A 4JB1A 3W8ZA 1W1RA 4JAYA 3NVVB 1E8GA 2W55A 1VAOA 1FFVC 3POPA 3BW7A 2P4PA 2Y3RA 1WVFA 1N62C 3S1CA 3ETRB 1X2HA 2VFTA 3NVZB 3S1DA 4DNSA 3KJMA 3AMZA 3FWAA 4PYTA 3NS1B 4EC3A 3A7AA 5FXFA 5ADZA 3RJAA 3GSYA 5FXDA 2R2ZA 1AHUA 1T3QC 3I99A 1FIQB 1W1KA 1FFUC 4PVHA 3PQBA 1AHZA 5AE1A 3FW9A 4PWBA 2BVGA 3HRDC 5FXPA 3EUB3 2Y3SA 1N63C 1N5XA 4UD8A 1W1LA 4BC9A 2VFRA 3NRZB 3NVYB 5HHZA 5HMRA 4TVYA 2E5AA 1JROA 1WVEA 2E3TA 2QPMA 3S1FA 3W8WA 5G5HB 3PM9A 2YVSA 3TX1A 2IPIA 4PZFA 1N5WC 3HSUA 5L6FA 2PLSA 2O3GA 5I1WA 2BVFA 1F0XA 1X2GA 5K8EA 4PWCA 3A7RA 4OALA 3D2DA 4BCAA 2VAOA 1QLTA 1HSKA 5D79A 3AM9A 1DZNA 5G5GB 2MBRA 3TSHA 1N61C 5L6GA 3D2HA 3NVWB 5AE3A 1E8HA 1W1JA 5I1VA 3B9JB 3VTEA 1RM6B 2GQUA 2EXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ0 A;  1JRP A;  2BVH A;  3R07 C;  4HG0 A;  3A7U A;  1UXY A;  1ZR6 A;  3TSJ A;  1ZXI C;  2QKN A;  3D2J A;  4PVE A;  4BBY A;  1SB3 B;  2VFU A;  2OAI A;  1V97 A;  1W1M A;  2RK5 A;  1MBT A;  1W1O A;  1VQZ A;  3FW7 A;  1QLU A;  5AE2 A;  4XLO A;  1W1Q A;  2P13 A;  1W1S A;  1E0Y A;  2R8D A;  3JS8 A;  3C0P A;  5FXE A;  2W3S A;  2VFV A;  4PVK A;  4PVJ A;  2Q85 A;  1DII A;  4O95 A;  3SR6 B;  1FO4 A;  1I19 A;  2GQT A;  2NQW A;  2AXR A;  3AN1 A;  5HQX A;  3S1E A;  3LAE A;  1AHV A;  4MLA A;  1VDV A;  1WYG A;  4ML8 A;  4BC7 A;  3W8X A;  2Q4W A;  1E8F A;  4TVW A;  1MBB A;  1N60 C;  3DED A;  4ZOH B;  2I0K A;  2W54 A;  2P3H A;  2PLI A;  2VFS A;  3LLB A;  2W3R A;  1DIQ A;  3FW8 A;  4JB1 A;  3W8Z A;  1W1R A;  4JAY A;  3NVV B;  1E8G A;  2W55 A;  1VAO A;  1FFV C;  3BW7 A;  2P4P A;  1WVF A;  1N62 C;  3S1C A;  3ETR B;  1X2H A;  2VFT A;  3NVZ B;  3S1D A;  4DNS A;  3KJM A;  3AMZ A;  3FWA A;  4PYT A;  3NS1 B;  4EC3 A;  3A7A A;  5FXF A;  5ADZ A;  3GSY A;  5FXD A;  2R2Z A;  1AHU A;  1T3Q C;  3I99 A;  1FIQ B;  1W1K A;  1FFU C;  4PVH A;  1AHZ A;  5AE1 A;  3FW9 A;  4PWB A;  2BVG A;  3HRD C;  5FXP A;  3EUB 3;  1N63 C;  1N5X A;  4UD8 A;  1W1L A;  4BC9 A;  2VFR A;  3NRZ B;  3NVY B;  5HHZ A;  5HMR A;  4TVY A;  2E5A A;  1JRO A;  1WVE A;  2E3T A;  2QPM A;  3S1F A;  3W8W A;  5G5H B;  3PM9 A;  2YVS A;  3TX1 A;  4PZF A;  1N5W C;  2PLS A;  2O3G A;  2BVF A;  1F0X A;  1X2G A;  4PWC A;  3A7R A;  4OAL A;  3D2D A;  4BCA A;  2VAO A;  1QLT A;  1HSK A;  5D79 A;  3AM9 A;  1DZN A;  5G5G B;  2MBR A;  3TSH A;  1N61 C;  3D2H A;  3NVW B;  5AE3 A;  1E8H A;  1W1J A;  3B9J B;  3VTE A;  1RM6 B;  2GQU A;  2EXR A; 
#chains in the Genus database with same CATH topology
 3L5O A;  3DQ0 A;  2Y4G A;  3ZLH A;  2GGG A;  1ZDL A;  2HQM A;  2PTZ A;  3URH A;  3IC9 A;  3ZVI A;  1FHV A;  1P48 A;  2PU1 A;  3TCS A;  3Q45 A;  3UGV A;  3D2J A;  2DW6 A;  3EAO A;  5KVI A;  2OPJ A;  2GR2 A;  3VCN A;  4E8G A;  1V59 A;  2PTY A;  5FJR A;  3V5C A;  4F4R A;  2P8C A;  4J3Z A;  4GFI A;  1ZY8 A;  1BKH A;  4HN8 A;  1AOG A;  3DFY A;  1W1O A;  3UCD A;  2OVL A;  3CGD A;  3UCC A;  1W1Q A;  4DWD A;  3U9I A;  2UUV A;  3T8Q A;  3DK8 A;  1PDZ A;  4H1Z A;  3DES A;  3EJE B;  2OG9 A;  3R0U A;  4PVK A;  2Q85 A;  1DII A;  3QFB A;  2UUU A;  1FO4 A;  5JCK A;  1I19 A;  4GR1 A;  2GQT A;  3TWA A;  2AXR A;  3LAE A;  5HQX A;  2OLA A;  2PTX A;  3ZVH B;  3W8X A;  1ZKQ A;  4H50 A;  4K1W A;  3PWI A;  2YVF A;  1MBB A;  2OKT A;  4GME A;  2I0K A;  2VFS A;  2PS2 A;  4H2H A;  2WPF A;  2W3R A;  2GGJ A;  2QDD A;  3IJQ A;  3P0W A;  3V3W A;  1TE6 A;  4JB1 A;  3FJ4 A;  3P3B A;  3B97 A;  2GQW A;  1VAO A;  5FS6 A;  3POP A;  2BCP A;  3CT2 A;  1N62 C;  3ETR B;  1X2H A;  2WP6 A;  2VFT A;  3NVZ B;  2OO6 A;  3SQS A;  3ZLG A;  2MNR A;  2DW7 A;  4DNS A;  3KJM A;  3AMZ A;  2GSH A;  3N4F A;  3TWB A;  4EC3 A;  2GGE A;  2NVK X;  3D46 A;  4GGB A;  1H2I A;  1P43 A;  5ADZ A;  3CXO A;  4DXK A;  3MY9 A;  2R2Z A;  4IT1 A;  3NFU A;  2ZAD A;  1T3Q C;  3I99 A;  2PPG A;  1W1K A;  2YVJ A;  2JK6 A;  2X50 A;  1S7M A;  4PWB A;  3DGZ A;  3HRD C;  1BWC A;  3EUB 3;  3DJJ A;  2Y3S A;  3DG6 A;  3S47 A;  1N63 C;  1N5X A;  2WOW A;  3NVY B;  2RDX A;  1NDA A;  1PDY A;  1SJC A;  2ZZB A;  2E3T A;  2HNE A;  4FX9 A;  1XPY A;  3W8W A;  3MWC A;  3VC6 A;  4E4F A;  2YVS A;  2AL1 A;  4KWS A;  3SSZ A;  2GL5 A;  2WOV A;  1N5W C;  4H4T A;  2AKZ A;  3UJF A;  2QDE A;  2BVF A;  3N4E A;  5FJT A;  5U25 A;  4H4S A;  4EQR A;  4PWC A;  3FG2 P;  4M0X A;  1K4Q A;  3TQP A;  4BCA A;  3PK7 A;  1TYP A;  1HSK A;  3EJB B;  2GH5 A;  4ROP A;  3AM9 A;  4YWO A;  5G5G B;  2YQU A;  2MBR A;  4H4Z A;  3I6E A;  1EC7 A;  4M52 A;  3I4K A;  2FKP A;  4EM3 A;  1E8H A;  3GD6 A;  3PG6 A;  3VTE A;  2P8B A;  3ES7 A;  1RM6 B;  2MUC A;  1JRP A;  2WDW A;  4A3R A;  3VDG A;  3OZM A;  4GYP C;  1DTN A;  1UXY A;  1ZXI C;  1ONE A;  2EQ7 A;  3DEQ A;  4DHG A;  4PVE A;  1GES A;  1GRF A;  2C3C A;  1KKO A;  1SB3 B;  4DX3 A;  1GEU A;  1GRA A;  3IJL A;  1W1M A;  4GRT A;  1MUC A;  5TR3 A;  3FW7 A;  4HPN A;  3Q4D A;  4XLO A;  4K7Z A;  3OTR A;  1EBH A;  3R11 A;  3SN1 A;  2XGZ A;  1E0Y A;  3I6T A;  5JCI A;  2R8D A;  1STZ A;  3C0P A;  2GR0 A;  4G7F A;  2V3A A;  5FXE A;  3SQP A;  2CHR A;  1LVL A;  3H8A A;  3R1Z A;  3CYJ A;  1OEP A;  4O95 A;  3AN1 A;  3S1E A;  2PCE A;  4E4U A;  1SJB A;  2YVG A;  4ML8 A;  4BC7 A;  4KPL A;  3MKC A;  4EQW A;  2Q4W A;  3VCC A;  5FS7 A;  2HZG A;  3DK4 A;  4ADW A;  1N60 C;  3QN3 A;  4ZOH B;  2W54 A;  3LLB A;  3FW8 A;  2ZC8 A;  3W8Z A;  2POZ A;  2XH4 A;  4JAY A;  3FYY A;  4HNL A;  3DG3 A;  1JDF A;  1FFV C;  4H4U A;  5FS9 A;  1GV4 A;  2Y3R A;  3S1C A;  4KPR A;  4E5T A;  3LAD A;  3S5S A;  4Z1Y A;  3TTE A;  1MRA A;  3QPE A;  2QJM A;  4EQX A;  3GO2 A;  3NO1 A;  4H4X A;  2OQH A;  3RJA A;  2X99 A;  3UJE A;  3FVD A;  4ENL A;  1MDR A;  2V6O A;  4LA1 A;  1FIQ B;  2R9Z A;  2OFJ A;  4EWJ A;  2PA6 A;  2BVG A;  3BOX A;  3V4B A;  4IP4 A;  3DIP A;  3FXG A;  3RR1 A;  3PWG A;  1W1L A;  4EMW A;  3NRZ B;  4MKS A;  2E5A A;  3EJD B;  3JVA A;  3OP2 A;  2AAQ A;  1L8P A;  2X8C A;  3S1F A;  3R0K A;  5G5H B;  2OX4 A;  3U4F A;  4EQS A;  2IPI A;  3DG7 A;  1NHQ A;  3HSU A;  2WPC A;  1F0X A;  1X2G A;  3VFC A;  5K8E A;  3HW2 A;  3RO6 A;  3H12 A;  2PGE A;  5D79 A;  4K8G A;  4J57 A;  4JQ9 A;  1E9I A;  4E6M A;  2GR3 A;  4IZG A;  3TJ4 A;  2ZZC A;  3TSH A;  3CGE A;  2F5Z A;  4H4R A;  4FP1 A;  3NVW B;  1W1J A;  3SJN A;  4K2S A;  4Z17 A;  3KLJ A;  3LB8 A;  1RVK A;  5GRT A;  3TOY A;  1GRG A;  2BVH A;  3CK5 A;  3NXL A;  3MQT A;  2OQY A;  3CGB A;  1ZR6 A;  3TSJ A;  4BUR A;  2XH0 A;  4MMW A;  1KKR A;  5ENL A;  2XH2 A;  4BBY A;  2OAI A;  3OPS A;  4EM4 A;  2GGH A;  3SN0 A;  2RK5 A;  1MBT A;  5FJU A;  1EC9 A;  2XSX A;  3R25 A;  1SJA A;  1MO9 A;  4H19 A;  1MNS A;  3QKE A;  1W1S A;  2XH7 A;  4JN8 A;  3RIT A;  3JS8 A;  3CGC A;  2PP3 A;  1W6T A;  3DK9 A;  4DNA A;  4PVJ A;  2YAU A;  3EF6 A;  3RCY A;  4IL2 A;  3T6C A;  3ZLF A;  2TPR A;  2HXT A;  3ES8 A;  2NPX A;  5FS8 A;  1XS2 A;  1WUF A;  3L8K A;  1E8F A;  4TVW A;  2QJN A;  3DGB A;  3GRS A;  2C3D A;  3D47 A;  3NZG A;  1JCT A;  3DH9 A;  4HCH A;  3NVV B;  2W55 A;  4IP5 A;  1ECQ A;  2CDU A;  1KN0 A;  3BW7 A;  4NEW A;  4HYR A;  1WVF A;  2A8X A;  4DN1 A;  4IHC A;  1ZMD A;  3FWA A;  4PYT A;  1XAN A;  6ENL A;  3N6J A;  3OW1 A;  1IYX A;  7ENL A;  3GSY A;  5FXD A;  1LPF A;  3FCP A;  3GRT A;  3SN4 A;  2POD A;  2WOI A;  4GIR A;  1AHU A;  2BC0 A;  3R10 A;  3N6H A;  1FFU C;  4PVH A;  1D7Y A;  1AHZ A;  5AE1 A;  3FW9 A;  3UJS A;  2W0H A;  4MGG A;  5FXP A;  4GGH A;  1OJT A;  1M6I A;  4ZA0 A;  2ONE A;  2VFR A;  2PMQ A;  1GRB A;  4TVY A;  3TJI A;  1BQG A;  2QVH A;  1JRO A;  4H4Q A;  2WP5 A;  3V5F A;  3CAW A;  2OZT A;  2QPM A;  4JDR A;  1EBD A;  4FI4 A;  4BV6 A;  3MSY A;  3PM9 A;  4HNC A;  5EBK A;  3H70 A;  3TX1 A;  3QLD A;  3HPF A;  2PLS A;  3RNM A;  2O3G A;  1NHS A;  4EMI A;  3DJG X;  4K8D A;  4JHM A;  1JOA A;  3A7R A;  4OAL A;  3D2D A;  4H4W A;  2VAO A;  5JCL A;  2QAE A;  1FHU A;  1GRT A;  3LXD A;  1DZN A;  1TYT A;  5L6G A;  4DYE A;  4KT2 A;  1FEC A;  1ELS A;  1F9C A;  2I5Q A;  2ZZ0 A;  4J56 A;  5AE3 A;  2HXU A;  3BJS A;  5I1V A;  1R0M A;  3B9J B;  5FMH A;  4A6G A;  2GQU A;  2Y08 A;  3Q6J A;  3R07 C;  4HG0 A;  2AKM A;  2PTW A;  3OC4 A;  3A7U A;  3VA8 A;  2CFY A;  3II4 A;  2GDQ A;  4EMJ A;  2QKN A;  4HCD A;  2J3N A;  1TZZ A;  2VFU A;  3O0H A;  2PU0 A;  5FJP A;  1V97 A;  2O56 A;  5J04 A;  2GR1 A;  4H4Y A;  1VQZ A;  1QLU A;  5AE2 A;  1JEH A;  1GRE A;  3ZVH A;  2P13 A;  1MDL A;  3T4W A;  1KCZ A;  3RRA A;  1DNC A;  2PGW A;  1Q1W A;  3JW7 A;  3UXL A;  4LII A;  2W3S A;  2EQ8 A;  2FYM A;  1NEL A;  3DDM A;  1XHC A;  2QJJ A;  3RJ8 A;  2VFV A;  1ZMC A;  2OZ8 A;  3D9X A;  3SR6 B;  5AWV A;  1KD0 A;  3MUC A;  2WPE A;  2NQW A;  1H6V A;  1AHV A;  3UJ2 A;  4MLA A;  1NU5 A;  3UJR A;  5BOE A;  3IJI A;  1VDV A;  2EQ6 A;  5IDZ A;  1WYG A;  1JPM A;  3GC2 A;  3IK4 A;  3GD4 A;  2EQ9 A;  4APN A;  4FDC B;  1GET A;  3DED A;  1Q1R A;  1NHR A;  2P3H A;  2PLI A;  2BC1 A;  1TKK A;  5ER0 A;  3BSM A;  1DIQ A;  5EU9 A;  3DFH A;  4X2P A;  3GY1 A;  4IL0 A;  1W1R A;  1E8G A;  3ENL A;  2P4P A;  1EBG A;  2QGY A;  2QQ6 A;  3QTP A;  3S1D A;  1MOK A;  5FJO A;  1GXF A;  1F3P A;  3A7A A;  3K1G A;  5FXF A;  1GER A;  2RAB A;  1WUE A;  1YEY A;  2PSN A;  2X8G A;  3MZN A;  2OZ3 A;  5JCM A;  1NHP A;  3DER A;  4YWS A;  1R6W A;  3DGH A;  3CXB A;  3PQB A;  4KEM A;  3EKG A;  4H4V A;  1GRH A;  3EAN A;  3H7V A;  5JRB A;  4H4P A;  4HCL A;  1FEA A;  1DXL A;  1JPD X;  3P93 A;  4UD8 A;  4G8T A;  3FV9 A;  4BC9 A;  2AL2 B;  2PP0 A;  3SBF A;  1BZL A;  5HHZ A;  5HMR A;  3QFA A;  3THU A;  3T9P A;  4A35 A;  2X8H A;  1WVE A;  2PP1 A;  3EEZ A;  3CB3 A;  3JZU A;  4GYP A;  1EC8 A;  3VC5 A;  4M6U A;  1ONF A;  3RGT A;  4ZCW A;  1NPX A;  5KVH A;  2V3B A;  4PZF A;  1FEB A;  5L6F A;  1ZX9 A;  5I1W A;  2P3Z A;  3GD3 A;  4JN7 A;  2GRT A;  5BOF A;  3TW9 A;  3STP A;  1QLT A;  1ZK7 A;  1F8W A;  2AL2 A;  5JCN A;  2NQL A;  4GIS A;  5U1O A;  1YQZ A;  4H83 A;  4NEV A;  1GSN A;  3KUM A;  1N61 C;  3UXK A;  2WBA A;  2P0I A;  3D2H A;  4J1O A;  2P88 A;  3PFR A;  3H4K A;  1XDI A;  3NS1 B;  1SJD A;  2GGI A;  3OZY A;  2EXR A; 
#chains in the Genus database with same CATH homology
 2Y08 A;  3DQ0 A;  1JRP A;  2BVH A;  3R07 C;  2WDW A;  2Y4G A;  4HG0 A;  3A7U A;  1UXY A;  1ZR6 A;  3TSJ A;  1ZXI C;  2QKN A;  3D2J A;  4PVE A;  4BBY A;  1SB3 B;  2VFU A;  2OAI A;  1V97 A;  1W1M A;  2RK5 A;  1MBT A;  1W1O A;  1VQZ A;  3FW7 A;  1QLU A;  5AE2 A;  4XLO A;  1W1Q A;  2P13 A;  1W1S A;  1E0Y A;  2R8D A;  3JS8 A;  2UUV A;  3C0P A;  5FXE A;  2W3S A;  3RJ8 A;  2VFV A;  4PVK A;  4PVJ A;  2Q85 A;  1DII A;  2UUU A;  4O95 A;  3SR6 B;  1FO4 A;  5AWV A;  1I19 A;  2GQT A;  2NQW A;  2AXR A;  3AN1 A;  5HQX A;  3S1E A;  3LAE A;  1AHV A;  4MLA A;  1VDV A;  1WYG A;  4ML8 A;  4BC7 A;  3W8X A;  2Q4W A;  1E8F A;  4TVW A;  1MBB A;  1N60 C;  3DED A;  4ZOH B;  2I0K A;  2W54 A;  2P3H A;  2PLI A;  2VFS A;  3LLB A;  2W3R A;  1DIQ A;  3FW8 A;  4JB1 A;  3W8Z A;  1W1R A;  4JAY A;  3NVV B;  1E8G A;  2W55 A;  1VAO A;  1FFV C;  3POP A;  3BW7 A;  2P4P A;  2Y3R A;  1WVF A;  1N62 C;  3S1C A;  3ETR B;  1X2H A;  2VFT A;  3NVZ B;  3S1D A;  4DNS A;  3KJM A;  3AMZ A;  3FWA A;  4PYT A;  3NS1 B;  4EC3 A;  3A7A A;  5FXF A;  5ADZ A;  3RJA A;  3GSY A;  5FXD A;  2R2Z A;  1AHU A;  1T3Q C;  3I99 A;  1FIQ B;  1W1K A;  1FFU C;  4PVH A;  3PQB A;  1AHZ A;  5AE1 A;  3FW9 A;  4PWB A;  2BVG A;  3HRD C;  5FXP A;  3EUB 3;  2Y3S A;  1N63 C;  1N5X A;  4UD8 A;  1W1L A;  4BC9 A;  2VFR A;  3NRZ B;  3NVY B;  5HHZ A;  5HMR A;  4TVY A;  2E5A A;  1JRO A;  1WVE A;  2E3T A;  2QPM A;  3S1F A;  3W8W A;  5G5H B;  3PM9 A;  2YVS A;  3TX1 A;  2IPI A;  4PZF A;  1N5W C;  3HSU A;  5L6F A;  2PLS A;  2O3G A;  5I1W A;  2BVF A;  1F0X A;  1X2G A;  5K8E A;  4PWC A;  3A7R A;  4OAL A;  3D2D A;  4BCA A;  2VAO A;  1QLT A;  1HSK A;  5D79 A;  3AM9 A;  1DZN A;  5G5G B;  2MBR A;  3TSH A;  1N61 C;  5L6G A;  3D2H A;  3NVW B;  5AE3 A;  1E8H A;  1W1J A;  5I1V A;  3B9J B;  3VTE A;  1RM6 B;  2GQU A;  2EXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...