1FFUC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAAGTGWAYEKLKRKTGDWATAGCAVVMRKSGGTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 83
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffuC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffuC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffuC03
1W1SA 2W3SA 1V97A 1N5WC 1N62C 2VAOA 1UXYA 2RK5A 1ZR6A 5FXDA 3FW9A 3S1EA 2OAIA 2P3HA 2GQTA 3AMZA 4JAYA 2W54A 5D79A 5FXEA 2BVHA 2QPMA 3ETRB 3SR6B 3PM9A 5AE2A 2Q85A 4XLOA 5AE3A 3NRZB 3NVVB 4BC7A 2R8DA 1VAOA 1W1LA 3D2JA 3D2DA 4MLAA 4O95A 1JROA 2W3RA 4BBYA 4PVHA 1W1QA 1W1JA 3C0PA 1FFUC 2NQWA 4PYTA 4EC3A 5ADZA 1JRPA 1DZNA 3R07C 4JB1A 1T3QC 2BVFA 2W55A 4ML8A 4PWBA 2QKNA 4DNSA 2VFVA 3A7UA 5HQXA 1DIQA 2BVGA 2MBRA 1AHZA 3S1DA 3LAEA 4PVEA 5FXFA 2Q4WA 1MBTA 3FWAA 3TSHA 4OALA 1FFVC 5AE1A 1E0YA 5G5GB 3KJMA 1N61C 1FIQB 4UD8A 3W8ZA 2P13A 2GQUA 4HG0A 1E8FA 4PVJA 3VTEA 5HHZA 1N5XA 1I19A 2YVSA 1E8HA 4ZOHB 3AM9A 1AHVA 1AHUA 2EXRA 3NS1B 1WVFA 4PVKA 3I99A 5FXPA 1N60C 3S1FA 1VDVA 1N63C 4BCAA 2P4PA 4BC9A 2PLSA 3HRDC 3GSYA 5HMRA 2VFRA 3LLBA 4TVWA 3NVWB 1DIIA 2VFSA 3W8XA 3AN1A 1HSKA 1MBBA 1FO4A 1W1RA 4PWCA 3NVZB 1QLUA 1ZXIC 2E3TA 4TVYA 1E8GA 5G5HB 1X2HA 2R2ZA 1QLTA 2AXRA 3W8WA 3TX1A 1VQZA 3TSJA 3S1CA 1WYGA 3DEDA 1W1OA 3A7RA 1W1MA 1F0XA 3JS8A 3DQ0A 1X2GA 2O3GA 4PZFA 2VFUA 1WVEA 3B9JB 1SB3B 3D2HA 1RM6B 2E5AA 2PLIA 1W1KA 3FW8A 3NVYB 3BW7A 3EUB3 3A7AA 2VFTA 3FW7A 2I0KA
chains in the Genus database with same CATH superfamily
2PTWA 2AAQA 3KUMA 1SJBA 2VAOA 2HQMA 3FXGA 2OFJA 3DH9A 4IL0A 2DW7A 1ELSA 2FKPA 5FXDA 2BCPA 2OAIA 4Z17A 3I4KA 1FECA 1ZKQA 3TJ4A 3ETRB 1AOGA 3K1GA 1ONFA 4MKSA 1BQGA 1KCZA 3GO2A 3IJQA 4E6MA 4EQWA 3H8AA 4K2SA 3CAWA 3I6EA 1XANA 4K8GA 3UXLA 3D2JA 1STZA 1MNSA 4O95A 2OZTA 1GV4A 3QKEA 3UXKA 1JROA 4BBYA 3GD6A 3DIPA 1W1JA 3EANA 3BJSA 3RO6A 3PWGA 2EQ9A 2RDXA 1TYPA 4GMEA 4JN7A 4EC3A 2YVJA 5JCNA 3R07C 3GRSA 3FVDA 2QKNA 4IP5A 4J57A 2MBRA 5JCMA 5JCLA 1AHZA 3LAEA 2I5QA 3CK5A 3MWCA 3OW1A 2Q4WA 1GERA 3NXLA 3FWAA 3R10A 1FFVC 1E0YA 3KJMA 1ZX9A 3RCYA 1BZLA 3SQSA 1JDFA 1DXLA 2ZZ0A 2X8CA 3VTEA 5HHZA 1GESA 1JPMA 1D7YA 3U4FA 3AM9A 2HXTA 1AHUA 1WVFA 3GD3A 4IL2A 2WPCA 3RR1A 2ZZBA 3NZGA 4DNAA 3S1FA 4K8DA 3ENLA 2AKMA 2P88A 2WPEA 3DK4A 3DG3A 1XDIA 3MKCA 2GL5A 2P8CA 3EEZA 4EM4A 3GSYA 1TYTA 2QQ6A 3L8KA 3DJJA 5JRBA 4J3ZA 4NEVA 3IK4A 2WOIA 4G7FA 3OTRA 2A8XA 2RABA 1ZMDA 2PA6A 4IHCA 3UCDA 2QDDA 5G5HB 1L8PA 3JW7A 4A6GA 3QTPA 2R2ZA 1BWCA 4HN8A 1QLTA 2AXRA 3SQPA 2XSXA 1YEYA 3DEDA 4JQ9A 3STPA 2PU0A 2EQ7A 3L5OA 1XPYA 3JS8A 3Q4DA 3EAOA 4HNLA 1K4QA 4PZFA 3P0WA 3Q45A 1MUCA 2P8BA 4M52A 1KKOA 3RGTA 2PLIA 1W1KA 2MUCA 2OPJA 3MSYA 4H1ZA 5ER0A 3KLJA 3T6CA 2NPXA 3CGEA 2GR3A 1MO9A 2PTXA 1PDYA 3VCCA 5FJOA 2CDUA 2GQWA 1MOKA 3ZLFA 4YWSA 3N6HA 4GR1A 2P3HA 2UUVA 2W0HA 2X8GA 5TR3A 5FXEA 4IZGA 2OZ3A 1DNCA 1E9IA 1JOAA 3PM9A 3LADA 3BOXA 2GGHA 1ZK7A 4EWJA 2EQ6A 3H12A 4EMIA 4MLAA 3DFHA 2QJNA 3SBFA 2W3RA 3TJIA 2MNRA 2NVKX 3DK8A 4GISA 4PVHA 4ROPA 1XS2A 5I1VA 2OVLA 4A3RA 1F9CA 4EQRA 4PYTA 5ADZA 2POZA 3LXDA 5FS6A 4Z1YA 4JB1A 1T3QC 3HSUA 3DJGX 5KVIA 1PDZA 4DNSA 1EBHA 3A7UA 5HQXA 1GRTA 2ZZCA 4X2PA 3OZYA 1KN0A 3DERA 3EJDB 3GC2A 1MDRA 3FV9A 3ZVIA 1BKHA 3TSHA 1NPXA 4OALA 3DG7A 3SSZA 1EBGA 1P43A 1N61C 3RNMA 4E5TA 2GSHA 1ZDLA 2P13A 4PVJA 3ZLHA 1N5XA 2YVSA 4H4QA 1E8HA 4ZOHB 4JN8A 5IDZA 1AHVA 1DTNA 4EQSA 2EXRA 1GREA 3GD4A 4EM3A 4PVKA 3PFRA 5FJRA 3I99A 3PG6A 3EF6A 4BV6A 2J3NA 3EJEB 4KPRA 5BOFA 4BCAA 5ENLA 3IC9A 3VA8A 3P3BA 2BC1A 1ECQA 2GH5A 4ENLA 3PQBA 2PPGA 3DFYA 4HNCA 3PWIA 1DIIA 3SN0A 3W8XA 4HYRA 3RITA 5FS7A 2PS2A 3DEQA 1MBBA 3FG2P 1NELA 3IJLA 2GR0A 3HW2A 1H2IA 3THUA 2P0IA 2E3TA 1E8GA 1TZZA 2PTZA 4APNA 3OPSA 3FJ4A 2WP5A 3VC5A 1W1OA 3A7RA 1F0XA 3DK9A 3TCSA 3VCNA 1GETA 2AL2A 4H4PA 2VFUA 4H4TA 4DHGA 3RRAA 3BSMA 2DW6A 3B9JB 1MRAA 1GRBA 3BW7A 3A7AA 2VFTA 2Y3SA 3VDGA 2I0KA 2Y3RA 2AKZA 2O56A 2PSNA 1P48A 4GIRA 2RK5A 1N62C 1UXYA 1ZR6A 4GGBA 2X8HA 3H70A 1V59A 2F5ZA 3D9XA 1FHUA 3CB3A 2PGWA 1GXFA 3DDMA 4ZCWA 4GYPA 2XH0A 2GQTA 2EQ8A 3AMZA 4H50A 3V3WA 1OJTA 2OQHA 2ONEA 5BOEA 4G8TA 2QPMA 3SR6B 4LA1A 3VFCA 2PP3A 1JEHA 2GGGA 5AE2A 4KWSA 2ZADA 4ADWA 2Q85A 3JZUA 4BURA 4DN1A 5AE3A 1ZY8A 2GR2A 2WBAA 2R8DA 2PGEA 1W1LA 3ES7A 3LB8A 2YAUA 3QPEA 1NHQA 4H4ZA 3ZLGA 4DYEA 2GRTA 3C0PA 3CGCA 3Q6JA 1TKKA 1JRPA 2HZGA 4J56A 1FEAA 2BVFA 4ML8A 4PWBA 4H4YA 2OKTA 1H6VA 2VFVA 3S47A 2YQUA 1DIQA 2BVGA 3UJ2A 3NO1A 2GGEA 3S1DA 6ENLA 2AL2B 4LIIA 3CGBA 4PVEA 2PTYA 2OO6A 1MBTA 3SN4A 1ONEA 5AE1A 1GSNA 1R6WA 5FS9A 2Y4GA 2OX4A 2C3CA 1WUFA 2QDEA 3W8ZA 4H2HA 2GQUA 4E4FA 4HG0A 5L6GA 1E8FA 4NEWA 2XGZA 2GR1A 3TTEA 4FI4A 5FMHA 1TE6A 1Q1WA 2R9ZA 3NS1B 2YVFA 3UJSA 3RJAA 3MQTA 1NHSA 2OZ8A 2PP0A 5FXPA 1F8WA 1N60C 1S7MA 3HPFA 4H83A 4BC9A 3CXOA 4E4UA 2PLSA 3TWAA 1LVLA 3HRDC 3EKGA 4KPLA 5FJPA 2WPFA 5HMRA 2VFRA 3QFBA 3UJEA 3LLBA 4TVWA 5L6FA 3NVWB 1IYXA 2GDQA 3DG6A 3OP2A 5EBKA 4FDCB 1FO4A 1EC9A 3B97A 1W1RA 3NVZB 1ZXIC 2XH4A 2OG9A 4IT1A 5K8EA 3TSJA 1WYGA 1LPFA 1W1MA 4GYPC 2WP6A 4F4RA 2PMQA 3CGDA 3DQ0A 2QJMA 1GRAA 1X2GA 1KKRA 2OLAA 2QGYA 1WVEA 3ZVHB 1NHRA 4HCDA 2WDWA 3PK7A 1SB3B 3D2HA 1RM6B 2E5AA 3R1ZA 3FW8A 3NVYB 3T9PA 3EUB3 5FJTA 3U9IA 2CFYA 3TWBA 3V4BA 3FW7A 1FHVA 4GFIA 4ZA0A 5I1WA 2XH7A 4E8GA 1W1SA 2W3SA 1V97A 1N5WC 3H7VA 2XH2A 2WOWA 3DESA 4MGGA 3FCPA 3UJRA 5JCIA 3OZMA 4HPNA 3FW9A 3O0HA 3UCCA 1NHPA 3S1EA 1W6TA 2P3ZA 2QAEA 1KD0A 4JAYA 4H4SA 2W54A 5D79A 3R25A 3N6JA 2BVHA 1EBDA 4DXKA 3T4WA 4KEMA 2Y08A 4FX9A 1M6IA 3MY9A 4XLOA 4MMWA 5FS8A 3NRZB 1GEUA 3SJNA 3NVVB 3VC6A 5AWVA 3DGHA 1VAOA 1Q1RA 3D2DA 1SJCA 1EC7A 1GRHA 1EC8A 2GGJA 2JK6A 5EU9A 1W1QA 4EMWA 2PCEA 2YVGA 4IP4A 3V5FA 3RJ8A 1FEBA 5JCKA 1FFUC 2NQWA 1DZNA 1JCTA 3CYJA 4HCLA 4DX3A 2W55A 3EJBB 3TOYA 1SJAA 1XHCA 1NDAA 1NU5A 2V3AA 4A35A 4H4UA 5U1OA 3SN1A 3MZNA 2ZC8A 5FXFA 1OEPA 3R11A 3TQPA 5G5GB 2HXUA 4FP1A 3T8QA 1FIQB 4UD8A 5J04A 3P93A 3CXBA 4KT2A 4M6UA 3H4KA 2NQLA 1I19A 3ES8A 5U25A 2V3BA 4HCHA 1F3PA 3DGZA 2X50A 1MDLA 4H4RA 4YWOA 2QJJA 3URHA 3GY1A 3FYYA 3MUCA 1VDVA 1R0MA 3OC4A 1WUEA 2FYMA 4J1OA 1N63C 2P4PA 2PODA 3GRTA 2TPRA 1SJDA 2WOVA 4GGHA 3DGBA 4M0XA 3UGVA 3V5CA 3ZVHA 3N4FA 3II4A 1RVKA 4JHMA 4H4XA 2VFSA 4DWDA 3AN1A 1HSKA 2GGIA 2X99A 2OQYA 3I6TA 2QVHA 1GRGA 1YQZA 3JVAA 3R0UA 3TW9A 2BC0A 2UUUA 4K1WA 3N4EA 4GRTA 4PWCA 3QN3A 1QLUA 4TVYA 3NFUA 2C3DA 5GRTA 1X2HA 4EQXA 2IPIA 4H19A 2V6OA 3D46A 5KVHA 3W8WA 3TX1A 1VQZA 4K7ZA 3S1CA 7ENLA 1GRFA 4JDRA 3QFAA 4H4VA 2CHRA 3D47A 2AL1A 4H4WA 3QLDA 2HNEA 2PP1A 2PU1A 2O3GA 1ZMCA 3S5SA 3POPA 3IJIA 5FJUA 3R0KA 3CT2A 1JPDX 3UJFA 4BC7A 4EMJA
chains in the Genus database with same CATH topology
1W1SA 2W3SA 1V97A 1N5WC 1N62C 2VAOA 1UXYA 2RK5A 1ZR6A 5FXDA 3FW9A 2UUVA 3S1EA 2OAIA 2P3HA 2GQTA 3AMZA 4JAYA 2W54A 5D79A 5FXEA 2BVHA 2QPMA 3ETRB 3SR6B 2Y08A 3PM9A 5AE2A 2Q85A 4XLOA 5AE3A 3NRZB 5AWVA 3NVVB 4BC7A 2R8DA 1VAOA 1W1LA 3D2JA 3D2DA 4MLAA 4O95A 1JROA 2W3RA 4BBYA 4PVHA 1W1QA 1W1JA 3RJ8A 5I1VA 3C0PA 1FFUC 2NQWA 4PYTA 4EC3A 5ADZA 1JRPA 1DZNA 3R07C 4JB1A 1T3QC 2BVFA 2W55A 4ML8A 4PWBA 3HSUA 2QKNA 4DNSA 2VFVA 3A7UA 5HQXA 1DIQA 2BVGA 2MBRA 1AHZA 3S1DA 3LAEA 4PVEA 5FXFA 2Q4WA 1MBTA 3FWAA 3TSHA 4OALA 1FFVC 5AE1A 1E0YA 5G5GB 2Y4GA 3KJMA 1N61C 1FIQB 4UD8A 3W8ZA 2P13A 2GQUA 4HG0A 5L6GA 1E8FA 4PVJA 3VTEA 5HHZA 1N5XA 1I19A 2YVSA 1E8HA 4ZOHB 3AM9A 1AHVA 1AHUA 2EXRA 3NS1B 3RJAA 1WVFA 4PVKA 3I99A 5FXPA 1N60C 3S1FA 1VDVA 1N63C 4BCAA 2P4PA 4BC9A 2PLSA 3HRDC 3PQBA 3GSYA 5HMRA 2VFRA 3LLBA 4TVWA 5L6FA 3NVWB 1DIIA 2VFSA 3W8XA 3AN1A 1HSKA 1MBBA 1FO4A 2UUUA 1W1RA 4PWCA 3NVZB 1QLUA 1ZXIC 2E3TA 4TVYA 1E8GA 5G5HB 1X2HA 2IPIA 2R2ZA 1QLTA 2AXRA 3W8WA 3TX1A 1VQZA 3TSJA 3S1CA 1WYGA 3DEDA 5K8EA 1W1OA 3A7RA 1W1MA 1F0XA 3JS8A 3DQ0A 1X2GA 2O3GA 4PZFA 2VFUA 3POPA 1WVEA 3B9JB 2WDWA 1SB3B 3D2HA 1RM6B 2E5AA 2PLIA 1W1KA 3FW8A 3NVYB 3BW7A 3EUB3 3A7AA 2VFTA 3FW7A 2Y3RA 2I0KA 5I1WA 2Y3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1S A;  2W3S A;  1V97 A;  1N5W C;  1N62 C;  2VAO A;  1UXY A;  2RK5 A;  1ZR6 A;  5FXD A;  3FW9 A;  3S1E A;  2OAI A;  2P3H A;  2GQT A;  3AMZ A;  4JAY A;  2W54 A;  5D79 A;  5FXE A;  2BVH A;  2QPM A;  3ETR B;  3SR6 B;  3PM9 A;  5AE2 A;  2Q85 A;  4XLO A;  5AE3 A;  3NRZ B;  3NVV B;  4BC7 A;  2R8D A;  1VAO A;  1W1L A;  3D2J A;  3D2D A;  4MLA A;  4O95 A;  1JRO A;  2W3R A;  4BBY A;  4PVH A;  1W1Q A;  1W1J A;  3C0P A;  1FFU C;  2NQW A;  4PYT A;  4EC3 A;  5ADZ A;  1JRP A;  1DZN A;  3R07 C;  4JB1 A;  1T3Q C;  2BVF A;  2W55 A;  4ML8 A;  4PWB A;  2QKN A;  4DNS A;  2VFV A;  3A7U A;  5HQX A;  1DIQ A;  2BVG A;  2MBR A;  1AHZ A;  3S1D A;  3LAE A;  4PVE A;  5FXF A;  2Q4W A;  1MBT A;  3FWA A;  3TSH A;  4OAL A;  1FFV C;  5AE1 A;  1E0Y A;  5G5G B;  3KJM A;  1N61 C;  1FIQ B;  4UD8 A;  3W8Z A;  2P13 A;  2GQU A;  4HG0 A;  1E8F A;  4PVJ A;  3VTE A;  5HHZ A;  1N5X A;  1I19 A;  2YVS A;  1E8H A;  4ZOH B;  3AM9 A;  1AHV A;  1AHU A;  2EXR A;  3NS1 B;  1WVF A;  4PVK A;  3I99 A;  5FXP A;  1N60 C;  3S1F A;  1VDV A;  1N63 C;  4BCA A;  2P4P A;  4BC9 A;  2PLS A;  3HRD C;  3GSY A;  5HMR A;  2VFR A;  3LLB A;  4TVW A;  3NVW B;  1DII A;  2VFS A;  3W8X A;  3AN1 A;  1HSK A;  1MBB A;  1FO4 A;  1W1R A;  4PWC A;  3NVZ B;  1QLU A;  1ZXI C;  2E3T A;  4TVY A;  1E8G A;  5G5H B;  1X2H A;  2R2Z A;  1QLT A;  2AXR A;  3W8W A;  3TX1 A;  1VQZ A;  3TSJ A;  3S1C A;  1WYG A;  3DED A;  1W1O A;  3A7R A;  1W1M A;  1F0X A;  3JS8 A;  3DQ0 A;  1X2G A;  2O3G A;  4PZF A;  2VFU A;  1WVE A;  3B9J B;  1SB3 B;  3D2H A;  1RM6 B;  2E5A A;  2PLI A;  1W1K A;  3FW8 A;  3NVY B;  3BW7 A;  3EUB 3;  3A7A A;  2VFT A;  3FW7 A;  2I0K A; 
#chains in the Genus database with same CATH topology
 2PTW A;  2AAQ A;  3KUM A;  1SJB A;  2VAO A;  2HQM A;  3FXG A;  2OFJ A;  3DH9 A;  4IL0 A;  2DW7 A;  1ELS A;  2FKP A;  5FXD A;  2BCP A;  2OAI A;  4Z17 A;  3I4K A;  1FEC A;  1ZKQ A;  3TJ4 A;  3ETR B;  1AOG A;  3K1G A;  1ONF A;  4MKS A;  1BQG A;  1KCZ A;  3GO2 A;  3IJQ A;  4E6M A;  4EQW A;  3H8A A;  4K2S A;  3CAW A;  3I6E A;  1XAN A;  4K8G A;  3UXL A;  3D2J A;  1STZ A;  1MNS A;  4O95 A;  2OZT A;  1GV4 A;  3QKE A;  3UXK A;  1JRO A;  4BBY A;  3GD6 A;  3DIP A;  1W1J A;  3EAN A;  3BJS A;  3RO6 A;  3PWG A;  2EQ9 A;  2RDX A;  1TYP A;  4GME A;  4JN7 A;  4EC3 A;  2YVJ A;  5JCN A;  3R07 C;  3GRS A;  3FVD A;  2QKN A;  4IP5 A;  4J57 A;  2MBR A;  5JCM A;  5JCL A;  1AHZ A;  3LAE A;  2I5Q A;  3CK5 A;  3MWC A;  3OW1 A;  2Q4W A;  1GER A;  3NXL A;  3FWA A;  3R10 A;  1FFV C;  1E0Y A;  3KJM A;  1ZX9 A;  3RCY A;  1BZL A;  3SQS A;  1JDF A;  1DXL A;  2ZZ0 A;  2X8C A;  3VTE A;  5HHZ A;  1GES A;  1JPM A;  1D7Y A;  3U4F A;  3AM9 A;  2HXT A;  1AHU A;  1WVF A;  3GD3 A;  4IL2 A;  2WPC A;  3RR1 A;  2ZZB A;  3NZG A;  4DNA A;  3S1F A;  4K8D A;  3ENL A;  2AKM A;  2P88 A;  2WPE A;  3DK4 A;  3DG3 A;  1XDI A;  3MKC A;  2GL5 A;  2P8C A;  3EEZ A;  4EM4 A;  3GSY A;  1TYT A;  2QQ6 A;  3L8K A;  3DJJ A;  5JRB A;  4J3Z A;  4NEV A;  3IK4 A;  2WOI A;  4G7F A;  3OTR A;  2A8X A;  2RAB A;  1ZMD A;  2PA6 A;  4IHC A;  3UCD A;  2QDD A;  5G5H B;  1L8P A;  3JW7 A;  4A6G A;  3QTP A;  2R2Z A;  1BWC A;  4HN8 A;  1QLT A;  2AXR A;  3SQP A;  2XSX A;  1YEY A;  3DED A;  4JQ9 A;  3STP A;  2PU0 A;  2EQ7 A;  3L5O A;  1XPY A;  3JS8 A;  3Q4D A;  3EAO A;  4HNL A;  1K4Q A;  4PZF A;  3P0W A;  3Q45 A;  1MUC A;  2P8B A;  4M52 A;  1KKO A;  3RGT A;  2PLI A;  1W1K A;  2MUC A;  2OPJ A;  3MSY A;  4H1Z A;  5ER0 A;  3KLJ A;  3T6C A;  2NPX A;  3CGE A;  2GR3 A;  1MO9 A;  2PTX A;  1PDY A;  3VCC A;  5FJO A;  2CDU A;  2GQW A;  1MOK A;  3ZLF A;  4YWS A;  3N6H A;  4GR1 A;  2P3H A;  2UUV A;  2W0H A;  2X8G A;  5TR3 A;  5FXE A;  4IZG A;  2OZ3 A;  1DNC A;  1E9I A;  1JOA A;  3PM9 A;  3LAD A;  3BOX A;  2GGH A;  1ZK7 A;  4EWJ A;  2EQ6 A;  3H12 A;  4EMI A;  4MLA A;  3DFH A;  2QJN A;  3SBF A;  2W3R A;  3TJI A;  2MNR A;  2NVK X;  3DK8 A;  4GIS A;  4PVH A;  4ROP A;  1XS2 A;  5I1V A;  2OVL A;  4A3R A;  1F9C A;  4EQR A;  4PYT A;  5ADZ A;  2POZ A;  3LXD A;  5FS6 A;  4Z1Y A;  4JB1 A;  1T3Q C;  3HSU A;  3DJG X;  5KVI A;  1PDZ A;  4DNS A;  1EBH A;  3A7U A;  5HQX A;  1GRT A;  2ZZC A;  4X2P A;  3OZY A;  1KN0 A;  3DER A;  3EJD B;  3GC2 A;  1MDR A;  3FV9 A;  3ZVI A;  1BKH A;  3TSH A;  1NPX A;  4OAL A;  3DG7 A;  3SSZ A;  1EBG A;  1P43 A;  1N61 C;  3RNM A;  4E5T A;  2GSH A;  1ZDL A;  2P13 A;  4PVJ A;  3ZLH A;  1N5X A;  2YVS A;  4H4Q A;  1E8H A;  4ZOH B;  4JN8 A;  5IDZ A;  1AHV A;  1DTN A;  4EQS A;  2EXR A;  1GRE A;  3GD4 A;  4EM3 A;  4PVK A;  3PFR A;  5FJR A;  3I99 A;  3PG6 A;  3EF6 A;  4BV6 A;  2J3N A;  3EJE B;  4KPR A;  5BOF A;  4BCA A;  5ENL A;  3IC9 A;  3VA8 A;  3P3B A;  2BC1 A;  1ECQ A;  2GH5 A;  4ENL A;  3PQB A;  2PPG A;  3DFY A;  4HNC A;  3PWI A;  1DII A;  3SN0 A;  3W8X A;  4HYR A;  3RIT A;  5FS7 A;  2PS2 A;  3DEQ A;  1MBB A;  3FG2 P;  1NEL A;  3IJL A;  2GR0 A;  3HW2 A;  1H2I A;  3THU A;  2P0I A;  2E3T A;  1E8G A;  1TZZ A;  2PTZ A;  4APN A;  3OPS A;  3FJ4 A;  2WP5 A;  3VC5 A;  1W1O A;  3A7R A;  1F0X A;  3DK9 A;  3TCS A;  3VCN A;  1GET A;  2AL2 A;  4H4P A;  2VFU A;  4H4T A;  4DHG A;  3RRA A;  3BSM A;  2DW6 A;  3B9J B;  1MRA A;  1GRB A;  3BW7 A;  3A7A A;  2VFT A;  2Y3S A;  3VDG A;  2I0K A;  2Y3R A;  2AKZ A;  2O56 A;  2PSN A;  1P48 A;  4GIR A;  2RK5 A;  1N62 C;  1UXY A;  1ZR6 A;  4GGB A;  2X8H A;  3H70 A;  1V59 A;  2F5Z A;  3D9X A;  1FHU A;  3CB3 A;  2PGW A;  1GXF A;  3DDM A;  4ZCW A;  4GYP A;  2XH0 A;  2GQT A;  2EQ8 A;  3AMZ A;  4H50 A;  3V3W A;  1OJT A;  2OQH A;  2ONE A;  5BOE A;  4G8T A;  2QPM A;  3SR6 B;  4LA1 A;  3VFC A;  2PP3 A;  1JEH A;  2GGG A;  5AE2 A;  4KWS A;  2ZAD A;  4ADW A;  2Q85 A;  3JZU A;  4BUR A;  4DN1 A;  5AE3 A;  1ZY8 A;  2GR2 A;  2WBA A;  2R8D A;  2PGE A;  1W1L A;  3ES7 A;  3LB8 A;  2YAU A;  3QPE A;  1NHQ A;  4H4Z A;  3ZLG A;  4DYE A;  2GRT A;  3C0P A;  3CGC A;  3Q6J A;  1TKK A;  1JRP A;  2HZG A;  4J56 A;  1FEA A;  2BVF A;  4ML8 A;  4PWB A;  4H4Y A;  2OKT A;  1H6V A;  2VFV A;  3S47 A;  2YQU A;  1DIQ A;  2BVG A;  3UJ2 A;  3NO1 A;  2GGE A;  3S1D A;  6ENL A;  2AL2 B;  4LII A;  3CGB A;  4PVE A;  2PTY A;  2OO6 A;  1MBT A;  3SN4 A;  1ONE A;  5AE1 A;  1GSN A;  1R6W A;  5FS9 A;  2Y4G A;  2OX4 A;  2C3C A;  1WUF A;  2QDE A;  3W8Z A;  4H2H A;  2GQU A;  4E4F A;  4HG0 A;  5L6G A;  1E8F A;  4NEW A;  2XGZ A;  2GR1 A;  3TTE A;  4FI4 A;  5FMH A;  1TE6 A;  1Q1W A;  2R9Z A;  3NS1 B;  2YVF A;  3UJS A;  3RJA A;  3MQT A;  1NHS A;  2OZ8 A;  2PP0 A;  5FXP A;  1F8W A;  1N60 C;  1S7M A;  3HPF A;  4H83 A;  4BC9 A;  3CXO A;  4E4U A;  2PLS A;  3TWA A;  1LVL A;  3HRD C;  3EKG A;  4KPL A;  5FJP A;  2WPF A;  5HMR A;  2VFR A;  3QFB A;  3UJE A;  3LLB A;  4TVW A;  5L6F A;  3NVW B;  1IYX A;  2GDQ A;  3DG6 A;  3OP2 A;  5EBK A;  4FDC B;  1FO4 A;  1EC9 A;  3B97 A;  1W1R A;  3NVZ B;  1ZXI C;  2XH4 A;  2OG9 A;  4IT1 A;  5K8E A;  3TSJ A;  1WYG A;  1LPF A;  1W1M A;  4GYP C;  2WP6 A;  4F4R A;  2PMQ A;  3CGD A;  3DQ0 A;  2QJM A;  1GRA A;  1X2G A;  1KKR A;  2OLA A;  2QGY A;  1WVE A;  3ZVH B;  1NHR A;  4HCD A;  2WDW A;  3PK7 A;  1SB3 B;  3D2H A;  1RM6 B;  2E5A A;  3R1Z A;  3FW8 A;  3NVY B;  3T9P A;  3EUB 3;  5FJT A;  3U9I A;  2CFY A;  3TWB A;  3V4B A;  3FW7 A;  1FHV A;  4GFI A;  4ZA0 A;  5I1W A;  2XH7 A;  4E8G A;  1W1S A;  2W3S A;  1V97 A;  1N5W C;  3H7V A;  2XH2 A;  2WOW A;  3DES A;  4MGG A;  3FCP A;  3UJR A;  5JCI A;  3OZM A;  4HPN A;  3FW9 A;  3O0H A;  3UCC A;  1NHP A;  3S1E A;  1W6T A;  2P3Z A;  2QAE A;  1KD0 A;  4JAY A;  4H4S A;  2W54 A;  5D79 A;  3R25 A;  3N6J A;  2BVH A;  1EBD A;  4DXK A;  3T4W A;  4KEM A;  2Y08 A;  4FX9 A;  1M6I A;  3MY9 A;  4XLO A;  4MMW A;  5FS8 A;  3NRZ B;  1GEU A;  3SJN A;  3NVV B;  3VC6 A;  5AWV A;  3DGH A;  1VAO A;  1Q1R A;  3D2D A;  1SJC A;  1EC7 A;  1GRH A;  1EC8 A;  2GGJ A;  2JK6 A;  5EU9 A;  1W1Q A;  4EMW A;  2PCE A;  2YVG A;  4IP4 A;  3V5F A;  3RJ8 A;  1FEB A;  5JCK A;  1FFU C;  2NQW A;  1DZN A;  1JCT A;  3CYJ A;  4HCL A;  4DX3 A;  2W55 A;  3EJB B;  3TOY A;  1SJA A;  1XHC A;  1NDA A;  1NU5 A;  2V3A A;  4A35 A;  4H4U A;  5U1O A;  3SN1 A;  3MZN A;  2ZC8 A;  5FXF A;  1OEP A;  3R11 A;  3TQP A;  5G5G B;  2HXU A;  4FP1 A;  3T8Q A;  1FIQ B;  4UD8 A;  5J04 A;  3P93 A;  3CXB A;  4KT2 A;  4M6U A;  3H4K A;  2NQL A;  1I19 A;  3ES8 A;  5U25 A;  2V3B A;  4HCH A;  1F3P A;  3DGZ A;  2X50 A;  1MDL A;  4H4R A;  4YWO A;  2QJJ A;  3URH A;  3GY1 A;  3FYY A;  3MUC A;  1VDV A;  1R0M A;  3OC4 A;  1WUE A;  2FYM A;  4J1O A;  1N63 C;  2P4P A;  2POD A;  3GRT A;  2TPR A;  1SJD A;  2WOV A;  4GGH A;  3DGB A;  4M0X A;  3UGV A;  3V5C A;  3ZVH A;  3N4F A;  3II4 A;  1RVK A;  4JHM A;  4H4X A;  2VFS A;  4DWD A;  3AN1 A;  1HSK A;  2GGI A;  2X99 A;  2OQY A;  3I6T A;  2QVH A;  1GRG A;  1YQZ A;  3JVA A;  3R0U A;  3TW9 A;  2BC0 A;  2UUU A;  4K1W A;  3N4E A;  4GRT A;  4PWC A;  3QN3 A;  1QLU A;  4TVY A;  3NFU A;  2C3D A;  5GRT A;  1X2H A;  4EQX A;  2IPI A;  4H19 A;  2V6O A;  3D46 A;  5KVH A;  3W8W A;  3TX1 A;  1VQZ A;  4K7Z A;  3S1C A;  7ENL A;  1GRF A;  4JDR A;  3QFA A;  4H4V A;  2CHR A;  3D47 A;  2AL1 A;  4H4W A;  3QLD A;  2HNE A;  2PP1 A;  2PU1 A;  2O3G A;  1ZMC A;  3S5S A;  3POP A;  3IJI A;  5FJU A;  3R0K A;  3CT2 A;  1JPD X;  3UJF A;  4BC7 A;  4EMJ A; 
#chains in the Genus database with same CATH homology
 1W1S A;  2W3S A;  1V97 A;  1N5W C;  1N62 C;  2VAO A;  1UXY A;  2RK5 A;  1ZR6 A;  5FXD A;  3FW9 A;  2UUV A;  3S1E A;  2OAI A;  2P3H A;  2GQT A;  3AMZ A;  4JAY A;  2W54 A;  5D79 A;  5FXE A;  2BVH A;  2QPM A;  3ETR B;  3SR6 B;  2Y08 A;  3PM9 A;  5AE2 A;  2Q85 A;  4XLO A;  5AE3 A;  3NRZ B;  5AWV A;  3NVV B;  4BC7 A;  2R8D A;  1VAO A;  1W1L A;  3D2J A;  3D2D A;  4MLA A;  4O95 A;  1JRO A;  2W3R A;  4BBY A;  4PVH A;  1W1Q A;  1W1J A;  3RJ8 A;  5I1V A;  3C0P A;  1FFU C;  2NQW A;  4PYT A;  4EC3 A;  5ADZ A;  1JRP A;  1DZN A;  3R07 C;  4JB1 A;  1T3Q C;  2BVF A;  2W55 A;  4ML8 A;  4PWB A;  3HSU A;  2QKN A;  4DNS A;  2VFV A;  3A7U A;  5HQX A;  1DIQ A;  2BVG A;  2MBR A;  1AHZ A;  3S1D A;  3LAE A;  4PVE A;  5FXF A;  2Q4W A;  1MBT A;  3FWA A;  3TSH A;  4OAL A;  1FFV C;  5AE1 A;  1E0Y A;  5G5G B;  2Y4G A;  3KJM A;  1N61 C;  1FIQ B;  4UD8 A;  3W8Z A;  2P13 A;  2GQU A;  4HG0 A;  5L6G A;  1E8F A;  4PVJ A;  3VTE A;  5HHZ A;  1N5X A;  1I19 A;  2YVS A;  1E8H A;  4ZOH B;  3AM9 A;  1AHV A;  1AHU A;  2EXR A;  3NS1 B;  3RJA A;  1WVF A;  4PVK A;  3I99 A;  5FXP A;  1N60 C;  3S1F A;  1VDV A;  1N63 C;  4BCA A;  2P4P A;  4BC9 A;  2PLS A;  3HRD C;  3PQB A;  3GSY A;  5HMR A;  2VFR A;  3LLB A;  4TVW A;  5L6F A;  3NVW B;  1DII A;  2VFS A;  3W8X A;  3AN1 A;  1HSK A;  1MBB A;  1FO4 A;  2UUU A;  1W1R A;  4PWC A;  3NVZ B;  1QLU A;  1ZXI C;  2E3T A;  4TVY A;  1E8G A;  5G5H B;  1X2H A;  2IPI A;  2R2Z A;  1QLT A;  2AXR A;  3W8W A;  3TX1 A;  1VQZ A;  3TSJ A;  3S1C A;  1WYG A;  3DED A;  5K8E A;  1W1O A;  3A7R A;  1W1M A;  1F0X A;  3JS8 A;  3DQ0 A;  1X2G A;  2O3G A;  4PZF A;  2VFU A;  3POP A;  1WVE A;  3B9J B;  2WDW A;  1SB3 B;  3D2H A;  1RM6 B;  2E5A A;  2PLI A;  1W1K A;  3FW8 A;  3NVY B;  3BW7 A;  3EUB 3;  3A7A A;  2VFT A;  3FW7 A;  2Y3R A;  2I0K A;  5I1W A;  2Y3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...