2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
1FIQA 1TKGA 3P4PB 3ETRB 1TYGB 5MPOA 3A7RA 1AHUA 1DOIA 2BS3B 4UD8A 3AE9B 3AE7B 4DNSA 1RM6C 4JX1C 1QLUA 1A70A 3TSJA 3NVYB 3B2GA 1IUEA 1PFDA 3HUIA 2W3SA 3EUB2 4N6EB 3AE4B 3JS8A 4YTNB 1N60A 2PIAA 1OFFA 1W1QA 3SFEB 2R8DA 1DOYA 1NENB 2E3TA 1W1OA 3PM9A 3P1MA 3VRAB 3A7AA 3FC4A 1V8CA 1FFVA 1JWBD 3AMZA 1XLOA 3HVZA 1NYQA 3B2FA 3L4PA 1X2GA 2K5PA 3AM9A 1KF6B 1I7HA 3VR9B 3TSHA 3BW7A 3NVYA 2AXRA 5AE3A 3P63A 2PLIA 1RWSA 1XLPA 1VLBA 2BVHA 2P4PA 2KMMA 4ZHPA 1WVEA 1SF0A 2BVGA 1J7BA 3S1DA 1NYRA 4ZOHC 1VQZA 2RK5A 4ML8A 4MLAA 1L0VB 1PDXA 4YSYB 1QLTA 1XO3A 1AHVA 1ZP0B 2MJ3A 3W5VB 4EC3A 3W8WA 3HRDC 1RYJA 4US8A 3NVWB 3AV8A 1KFYB 3DEDA 1YJIA 2W55A 3P4SB 4YTPB 1TJEA 2JX5A 5AE2A 3FW8A 1JRPA 1RM6B 3AECB 4A9AA 2NQWA 3ZYYX 2O3GA 2Q85A 4TVYA 2FBWB 2Q4WA 2K22A 3S1EA 2YVSA 4ZOHB 1OQRA 1ZOYB 5EE9A 3I99A 2Q5WD 1WGKA 2B76B 3NVZB 3AN1A 4HRSA 2W54A 1EWYC 1UXYA 1FIQB 3ETRA 1FM0D 2L52A 3AEDB 3NVZA 1FFUA 1QOAA 4LTUA 2WDVB 2CJOA 5FXPA 3NS1A 1N62C 5C3JB 1L6VA 3AE1B 1FMAD 2EKIA 3D2DA 3VR8B 1E10A 3CWIA 4US9A 2WDRB 4BC7A 3VRBB 1MBTA 1W1RA 1W1JA 4PWCA 3CIRB 1JW9D 2BS2B 2MBRA 4PWBA 1N5WA 2KAJA 3LLBA 4JWUC 3BIID 3LAEA 3FWAA 4BCAA 1SB3C 1YJJA 2DWQA 1NVID 1QOBA 2VFSA 5AE1A 5FXFA 3VTEA 3NS1B 2CJNA 4WQMA 1N61C 4FXCA 3AE5B 4JB1A 3FW9A 1HSKA 2BS4B 4YTMB 3S1FA 3DWGC 1JQ4A 1NEKB 4PVJA 3KWLA 1WWTA 2VFVA 2BVFA 1YQ3B 1YQ4B 2M19A 2W3RA 3AE3B 1L5PA 1X2HA 5G5HB 1FO4A 1J7CA 4OALA 4PVEA 1V97A 2QJLA 3PO0A 2GQUA 5G5GB 1FFVC 3AE6B 1ZXIA 1T3QA 1GPXA 2LEKA 2P3HA 3LB8C 3AB5A 3W5UB 5H8YE 3AH7A 3C0PA 2BT6A 4USAA 1KRHA 4P6VF 3WCQA 3TX1A 4WWMA 1CJEA 3B9JB 4ITKA 4N58A 1UWMA 1JALA 2WS3B 4C7ZA 4TVWA 2WU5B 5G5GA 1FXIA 2PVGC 5AUIA 1L6UA 1R7SA 1QOGA 2ACZB 4JWSC 3AEAB 1WVFA 3A7UA 3W8ZA 3P4QB 1QT9A 2E5AA 1FXAA 1N5WC 1T3QC 2MJDA 1MBBA 1ZXIC 1DIQA 1DGJA 1CZPA 2VFUA 1XLNA 1QF6A 3DQ0A 3AEGB 1DZNA 2QPMA 1AHZA 2GQTA 4BC9A 1OQQA 1I19A 2QIEB 1E8FA 1W1KA 4XLOA 1TKEA 3EUB3 2K9XA 1E0YA 4C80A 1E0ZA 1B9RA 5C2TB 5FXEA 1DIIA 2N0SB 1SB3B 2OAIA 1FRDA 3NRZA 4PVKA 1N5XA 1E7PB 1TKYA 1F0ZA 3W8XA 1ROEA 3AE2B 2OHFA 3NVVA 5G5HA 2PLSA 5ADZA 1W1MA 2JQRB 1W1SA 3AEEB 1QOFA 2M56B 1N60C 4KX6B 4N59A 4O95A 2VFTA 3HRDD 2VAOA 2H89B 1VJKA 5HMRA 3S1CA 4YXDB 3SR6B 1WYGA 4YSXB 3SR6A 5EE0A 3AE8B 1AWDA 2MJEA 4IDIA 2EXRA 2P13A 2WU2B 1FFUC 3D2HA 3AEFB 2H88B 4JAYA 1PUTA 2VFRA 3DWMA 3SFDB 4YSZB 1N63C 3FW7A 5AUKA 3GSYA 1E9MA 2WP9B 4C7YA 4BBYA 3RPFC 2PKOA 2MH7A 1N61A 2DBYA 2L83A 5GXGB 3B9JA 4PYTA 3NRZB 1FRRA 2PVOD 1ZUD2 1RFKA 1AYFA 2R2ZA 5HHZA 2QKNA 3R07C 4PZFA 5EE1A 3AEBB 3KJMA 1J7AA 1XLQA 1W1LA 2CU3A 1SIJA 1QLBB 3NVWA 3D2JA 2WQYB 3W9CB 2G1EA 2I0KA 3ABVB 1N62A 1JWAD 2HTME 5HQXA 3P4RB 4HG0A 5D79A 2WLBA 4ZHOA 1GAQB 1JROA 5EE3A 1N63A 3LXFA 4HROA 1DOXA 1E8GA 2Y5CA 1F0XA 1VAOA 1WXQA 1E8HA 1VDVA 5FXDA 1NI3A 5H92C 3FAHA 2WDQB 1ZR6A 4YT0B 4PVHA 2AX5A 3NVVB 1WRIA 1E6EB
chains in the Genus database with same CATH superfamily
1TKGA 4F72A 3ETRB 2JZBA 4Y2YA 2YMLA 1DOIA 1I35A 2BS3B 2OX4A 4XWWA 3BZCA 4TKNA 9ICMA 1LVHA 1SL1A 1P43A 3RYTA 5J2HA 2ZJ8A 4O1NA 1RM6C 4F7ZA 4DNSA 2JHDA 2WAQF 1YJ1A 2KDEB 3TL5A 4FLHA 2MHJA 2L3ZA 1NDAA 3LJ3A 2VRRB 3EANA 1ZQOA 4KLMA 4I29A 2WOWA 1PFDA 5FJOA 3GIKA 5ALZA 2ZW1A 2H3QA 2YX8A 1ZQKA 4A8XC 4N6EB 1V5TA 2YQUA 4YQWA 5CRXA 4C8KA 4YTNB 1N60A 3PHXB 3MY9A 2JUOA 1S8OA 2OWOA 2ZIVA 1GNUA 4PL2A 4XRHA 4FBTA 1STEA 1DOYA 3VCBA 2HHWA 2NYVA 3NZUA 2XO7A 1UZXB 2VJ4A 4CE6A 1W1OA 3PM9A 3DESA 4IRDA 3GD6A 4ECRA 4EQWA 3A7AA 2KO3A 1Y88A 1ECQA 1L4DB 2N1WA 3LWMA 2EAMA 3AMZA 1NJWA 2WB1C 1ET6A 5IKCM 1PGXA 3PFRA 3DGZA 4J9LA 5JCKA 3RJIA 4YXMA 2HHXA 2JZ3B 4NQKE 2C9WB 5J0WA 2QSDA 4WWNA 1ZPSA 5BYQA 2CHRA 5ALNA 2UVWA 5KG0A 4PYZA 4IHCA 2WDTB 2BB6A 3T8MA 1D7YA 1RYSA 4M2YA 2P6RA 2KTFA 2V1YA 4FHKA 4AWJA 4PGXA 1T8EA 1RZTA 2WPFA 2GH1A 2H3ZA 1KF6B 2W0HA 3BW7A 1T0RC 2XH0A 1RQNA 3H0RB 5AI0A 1SKSA 3PS6A 2ESEA 5AM5A 5DPRA 1XLPA 1J2NA 1VLBA 1FPYA 1ZQGA 1CK1A 2XBBC 2GGHA 5L6FA 3RCZA 1WVEA 9ICKA 3HW8A 4MJSA 3RF9A 8ICOA 1JIHA 3TANA 4JHMA 1L3VA 1Z1VA 4YVZA 3Q45A 3BYTB 4XGAB 3UJEA 3VUWA 5L1IA 4ML8A 5AKKA 4ECUA 4I2CA 2XY7A 4BVUC 3CT2A 3MSYA 4YSYB 8ICJA 1MRAA 4GISA 3P42A 1JX4A 3BOXA 2MP2A 1TFRA 2NPTA 1ZP0B 5AM3A 2MJ3A 1SJDA 3SENA 3RBDA 3W5VB 3RAXA 2EELA 1MO9A 1A76A 3W8WA 3G6YA 1RYJA 3MHSD 4FBJB 4EZLA 4KLLA 3HRDC 3JSVB 3NVWB 3BQ0A 4NY8A 4MM3A 5ALGA 1MHHE 4HPPA 2FLNA 2ZG6A 1T4GA 3UJ2A 3DEDA 7ICGA 3MC0B 1UQVA 3IXSA 4YTPB 2WGSA 4EZJA 2JEGA 4TURA 2SEBD 2X8HA 7ICHA 4MF8A 2RDHA 4C8OA 1BT0A 2C2EA 3PG6A 1EBHA 2KVCA 2KV2A 4XUSA 2HJ1A 2QMTA 4C56C 1RM6B 4C8NA 4ECSA 1WJNA 3AL0B 9ICXA 1RRBA 4EEWA 4GMEA 4DF8A 9ICVA 3PK7A 1ACCA 1GG3A 4RPYA 2F1JA 2MSNA 4KSKC 3VA8A 2YVSA 1OQRA 4FDCB 4TUUA 4FS1A 1NHRA 2N4FA 4K1WA 4RQ4A 2P6UA 2YVCA 2B76B 5KAIU 2INCC 1OJTA 5IIIA 3WAOA 4J9QA 4PS7A 2LVOA 1Q0WB 5IIKA 1PVQA 1KCZA 4O3MA 2ZUBA 2J42A 2KC2A 1FFUA 1TE2A 1ZQZA 4RPZA 2R8IA 2R8KA 5AKYA 1XEEA 3Q3JA 1AOGA 2P66A 1TIFA 4F2RA 1YIWA 4MSQB 2KHQA 3CB3A 3SAHA 1HUOA 5IDZA 2OJWA 3VDGA 2WF5A 2D3GA 3WK7A 3WAPA 3AE1B 4GB9A 5ALDA 4P0PB 3H8HA 3HPOA 1FMAD 2MRPA 3MC9A 4ZYNA 3V7KA 4K1RB 2HNEA 3Q8EA 2ZTCA 2BCSA 1Z19A 8ICMA 4OJPA 1TT5B 4HDOA 1JPMA 3IAM1 4H83A 4EQRA 1RQLA 1C79A 4GLXA 4OHJA 4ZRIA 4PZOA 1T7PA 2KMDA 1CUKA 1ZDXA 7ICTA 4HCNB 4FFDA 4NJ7A 1R4MB 5D49A 2D3CA 1L3SA 5CEHA 2KFKB 1S3SG 3DVGY 4WJPA 3N4EA 2KQ4X 5GTHU 3QX1A 5J2JA 3TACB 1W1JA 3PZ8A 4ED8A 5J8YC 3T6CA 3KHLA 4F71A 4RQ7A 2KFKA 4M6WB 4KGSA 2JGAA 4KVGB 2MBRA 2WXOA 3QUQA 3RNMA 4IL0A 1P3QU 1WXSA 2Y5PA 1XO0A 3VH3B 4JL9A 3FYYA 3BVGA 3TJ4A 4F1SA 1T3NA 3QU4A 5KFMA 2DYBA 3Q2AC 1QOBA 4WURA 5D94A 2CPRA 5J8YA 1FNVA 3VTEA 3NS1B 3C5FA 4NM1A 2KACA 2XICA 1SJED 4WQMA 2V4IB 1EU3A 3TCAA 2GQWA 4FXCA 3RNGC 4P2HA 3MFHA 3SDLC 4O5EA 4O9MA 3NHEB 3LXDA 2LJ5A 4YR3A 5JRTA 5J0XA 4ZYSA 4JB1A 4JWNA 3H4KA 4KGTA 1ZQWA 1OEPA 3MQTA 4K4GA 4AOFA 1ZQUA 1C76A 1WGHA 1F1HA 2M8SA 4WJQA 1DNCA 3FJ4A 1NHPA 1Q1WA 3DK8A 1NEKB 3RNBC 3PWIA 3VC8A 1TK5A 1GUAB 3FXGA 3TFRA 1YD8U 2PSNA 1XSLA 2K8AA 4TV3A 3QLDA 3T5JA 5G5HB 4NEWA 4P1BC 2ZCBA 3OTQA 2AKZA 3SSZA 8ICTA 2ZTDA 5TSSA 5KFTA 3I63C 2K8CA 2MX2A 2LPEA 5AKHA 4OALA 4ZH4A 5BPCA 2QJLA 1EF5A 3R0KA 1MFWA 3R25A 4YD2A 2XGPA 1FEHA 5E6JA 1ZKQA 2AL1A 1XF5L 1Z5SB 5G5GB 3BINA 3BVZA 5IA7A 2L32A 5L6GA 2DF4B 3O0HA 4ED3A 5HR6A 1ZXIA 1P98A 2GGEA 3WU2U 1KFTA 2RABA 2KJ8A 2WBAA 3AU5A 5F9LA 1M94A 5IP4D 1C3TA 2GLEA 3AH7A 2JV3A 2EZYA 2ZC8A 2KTRA 2BT6A 3ZRCA 2GR1A 3QHTA 2PP3A 1U48A 3AQEA 3DHIC 3KUDB 5KFOA 4KX3A 4PS8A 3TX1A 1EC9A 1L8PA 2D2QA 2GH5A 4H4WA 3ZLFA 5FS6A 3DGHA 4M01A 5DBBA 5J2CA 4IC7B 1I4RA 1ZX9A 2MUTA 3EF6A 2E1FA 4IOIE 4NJ6A 1TYTA 4EX6A 4MF2A 1HXYD 1FHVA 2FCNA 2ASLA 2C3CA 2VZKD 2CN1A 2OM6A 7ICPA 3URYA 4YCXA 4N58A 2HW3A 1GB1A 4KLHA 1JALA 3OGUA 2N1RA 2M0NA 3RITA 5ALMA 5KFNA 1KFSA 4O3OA 4KDIC 3H7SA 3PO4A 1IP9A 1SV4A 3OTRA 2RDJA 3T5LA 2BZFA 2ZEQA 9ICFA 1Z3EB 2V9WA 2K1FA 2IA6A 4CQNA 2K25A 3GV7B 1R7SA 5FJPA 1TTNA 4I27A 4U7CA 9ICQA 4JWSC 4PHAA 1HUZA 5AK6A 3W8ZA 2FCSA 2KKVA 4E8GA 2FMPA 3U30A 3TADA 4UDUC 2M17A 2GBNA 2NR2A 2QJJA 3GRSA 1TS3A 2MJDA 3PX6A 2RPQA 1MBBA 2P88A 4OVUA 2YQEA 3RT3B 4EX7A 2CHWA 2BCRA 4PHPA 4LNOA 3R2IA 2F5ZA 3UJSA 1K5OA 1TZZA 2KNJA 4WJ3B 5CHVC 1NBFC 4Y2PA 1DZNA 2Y3SA 3NRWA 2C7HA 1IYFA 2GQTA 1LO5D 1KTQA 2KK0A 4GYPA 1QLNA 3C8YA 4GYPC 1H8CA 1GRHA 2PI5A 2FIDA 3MJ5A 3C2LA 3BJYA 3O0FA 5KFVA 2GB1A 2DNFA 4JLCA 3EEZA 3P2BA 1ZK7A 2AQ0A 2K89A 4KEMA 2HHSA 4Q8FA 2WXLA 3KH0A 2W9CA 1T0SC 3MWCA 4HAIA 3N1YC 3CYJA 5C0YA 1S0NA 3LAEA 2LM4A 1GV4A 4IZGA 1ZQCA 2N0SB 1WRDB 2MEKA 4EQSA 1FRDA 2BHNA 4E3CA 5L1JA 1FNWA 2KZ3A 2N9KA 2W9CB 1E7PB 4LJOB 4M0AA 2AJQA 4XX5A 4DXKA 4I2DA 3A33B 1IXRA 3UPQA 4M47A 4HPNA 5KNIA 1LV5A 3JW7A 3CF6E 5J0QA 3TSSA 2F3NA 5IIOA 4J9NA 4NPNA 2JQRB 2EQ9A 4BJQA 5J0SA 1YQZA 2A4ZA 2VIXA 1DXSA 1TZOA 2M56B 4F91B 5CHGA 1L0XB 3ZLZA 2AU0A 2BDPA 3V60A 4EUTA 2L00B 5AZFA 1V1OA 3BJSA 2QQ6A 2W43A 3KHRA 8ICUA 3FG2P 1E8ZA 3RZWC 3LWLA 1NK9A 5DDYA 4KSLC 3WKAA 2HOQA 2HHTA 2HXTA 2Q0ZX 2G06A 4HXDA 4YXDB 2PGWA 4RQMA 4RQ0A 4M02A 1QILA 2MCNB 3V6HA 4UB1A 5B5EU 1F44A 3SR6A 3F53A 4LNIA 3V72A 3PW0A 1ZYQA 2KMCA 1ET9A 2LFIA 5D6JB 3CAWA 2WXGA 2G08A 4DDGD 2GR3A 2NQLA 4CF4A 1TBEA 1U47A 3D32A 3Q3MC 4A6GA 4Z6FA 3QIJA 4WWOA 1DXLA 1KD0A 2KOBA 5TZVA 4IDIA 2EXRA 1EC8A 4RQ5A 4NWIA 1SWWA 1TVAA 3WAMA 4TMAB 3V3WA 3AEFB 3RNCC 2WOIA 3AUOA 4Q8EA 4HWIB 2VFRA 3NS8A 2K6QA 5BYSA 5JXVA 4QIWC 1FHUA 2BC0A 2NRTA 4NEVA 1OTRB 4YSZB 3IN5A 3V7JA 4WQOB 1GOZA 1MI0A 1LKYB 4HCPB 4MGGA 3NY5A 2W9BB 3GSYA 3IG3A 4P7IA 4JIOU 2WP9B 4C7YA 5G2NA 2KG5A 3MFGA 2OZ8A 4GC7A 2NVUI 4BBYA 4EEKA 4GRTA 1EO6A 2KX3A 2X38A 2YVFA 2MP2B 3RR7A 3K4GA 5GXGB 2L83A 2K8CB 1L3UA 1Y8RC 2FMSA 2X99A 5I4DA 1FRRA 1ZUD2 1MDLA 3ZXRA 1Q46A 1AYFA 2IO0B 1X9SA 2GR0A 1NKEA 1KN5A 3MR5A 3NUQA 2QKNA 3WKDA 5J2IA 5EE1A 2QVHA 4LA1A 3GQCA 2IOFK 2PI4A 2ZIXA 3F2BA 8ICXA 2WX1A 3M8SA 2ZCCA 3AEBB 4YMNA 3Q69A 5KG7A 4KIKB 3KJMA 4C00A 1Q1RA 5BOLA 3QEAZ 1MQ3A 1JRUA 4M04A 1OEYJ 5J2AA 2XN9C 3BVMA 3UI3A 4M9LA 2V0GA 3T9LA 4I6PA 4B9SA 8ICIA 4DEZA 3SAGA 3MR6A 4Y2UA 1WR6E 4IC9A 4KN4A 4YR0A 1PDZA 2DW6A 1R6WA 5KL1B 4BURA 4H4UA 1UUPA 3D2JA 2KMAA 4IG7B 3ISCA 2KFZA 1BQGA 1QCKA 2G5HB 2G1EA 2I0KA 3A9JA 2PU1A 2BYVE 2X8CA 3KZIU 4ECVA 4JB3A 2HCFA 4ELTA 5IIJA 5J2GA 1L4ZB 4ICVA 5HQXA 3P4RB 2F44A 2R8HA 1SE2A 1MA7A 2KNBA 2BPGA 1EM7A 3A4SC 3PLVA 4ZHOA 1X9WA 1JROA 3PX4A 3ZTDA 2MBBB 3WKCA 2OCEA 7ICRA 1DOXA 4ZDVA 1F0XA 2MQJA 1V1PB 4FULA 2I1JA 2FKPA 3WK6A 4ENLA 3PVXA 5FXDA 3CW2C 2Y1IA 5D3IB 2NO4A 4YL8A 3TADC 4I6NB 4B9MA 4KZ0A 2AX5A 3SN4A 3V7LA 1FIQA 1EC7A 5MPOA 1AHUA 3HJEA 3OPXA 4PL1A 3UQ0A 5DQGA 1XD3B 1XU4A 2CRXA 2HD5B 2Y4GA 1R4NI 3EW9A 3RTVA 2HHQA 1COOA 4F4ZA 4QWBA 3KZXA 2EH9A 1A70A 2KSOA 2L76A 4P4OA 3GE8C 3MJWA 3ZNHB 3D2NA 1GRAA 3B2GA 1D6EC 1QSYA 1IUEA 1TS5A 2DUYA 3PV1A 3HUIA 2W3SA 4CYEA 3L5OA 4MHVA 3UGVA 4C4TA 1EU4A 4RMAA 4KLOA 1ONFA 2KICA 1XCTL 2JK6A 2QAEA 3AE4B 2ONEA 2AXTU 3N32A 4HCLA 3KQ4A 2NRZA 1L2NA 2RHFA 2OFJA 1S9FA 2XIDA 3RJEA 3HPFA 4FA6A 2HOIA 2MU2A 5KFRA 2E3TA 1C4CA 1WIAA 1WSPA 2LKYA 3THUA 1QKZA 3P1MA 3VRAB 1Z00B 3ED5A 4QZAA 1JWBD 4MGIE 4ED7A 3SD7A 3RJKA 8ICWA 1SV0C 1ONEA 5I1VA 2HBKA 2JXXA 4MELA 1V86A 1T5XD 5J0RA 3RR8A 5CHFA 2QB0A 1NYQA 1OGWA 1WF9A 5AI5A 1YQBA 4II2B 3IHPC 2P0IA 1R4NB 2IGDA 2W8LA 4J3ZA 2EZXA 4ZRJA 4LJXA 3C2MA 3LK9A 3NG0A 3OHAA 2ON8A 3ZDCA 4TUPA 1E8YA 4W9LA 3U2SC 5LXIB 3H8AA 3IJQA 1L7PA 3NVYA 3CSFA 3FM9A 3J9CA 4K7ZA 5J0TA 4EM3A 1BXTA 1RWSA 3CSTA 4JN7A 2RDIA 4FZLA 2BVHA 1WWVA 1UPHA 1VJ5A 4JV0A 1Q3UA 2K39A 2LUEA 4Q2JA 3DK4A 3TKAA 3TFSA 4DSKA 3V6KA 1SBBB 2POZA 1PQSA 4WIPA 2O6KA 2EQYA 2BQQA 3S1DA 5CP2A 3VVWB 1NYRA 3DCGA 3VUXA 5C1ZA 4EYIB 2V3PA 4LCDE 3OG5A 3PSTA 2DHZA 4IRCA 4G7FA 1K50A 4GR1A 3PW2A 4QJFB 3M1YA 2E8NA 3M8RA 4KLDA 5KFJA 2ASDA 4PT5A 5I1WA 3ZD9A 4G3IA 4K2SA 1L0VB 5KVHA 1XS9D 2QLTA 1PGBA 2KWVB 4JGHB 1PDYA 1AW7A 2PE6B 5K4LA 3GZFA 9ICUA 2F8KA 3I5JC 4LDTB 2PTXA 1TY0A 1S0MA 4H4VA 1LPFA 3N3KB 2A8XA 2MBEA 2BQRA 3LYYA 4YWGG 1R0MA 1ZDLA 2W55A 4TQRA 5CTRC 1BZLA 1PVPA 9ICIA 2FCMA 2LVPA 3P4SB 3U52E 3LYSA 2KKCA 1U4AA 4P0PA 1U49A 4DOAA 3QKEA 1BPBA 1TJEA 2JX5A 3IT6B 1BNPA 2ZVNA 1WR1A 4NNJB 5AE2A 1JRPA 1UWXA 4OVZA 5J0OA 4F8CB 2PTYA 4DOBA 2NQWA 3RB4A 2ASJA 3CK5A 1HA5A 4TVYA 2FBWB 5BMIA 2Q4WA 1FCLA 3APFA 2KKPA 5EE9A 4F5QA 8ICGA 3DOWA 4TSSA 3I99A 2J3NA 2HBMA 4OCZA 1ZQNA 7ICQA 1KOTA 1OW5A 5ALJA 4IW0A 4DFJA 4IKGA 1C77A 1YZ7A 4DQSA 2J6TA 3PR4A 1WGDA 2FIFA 5J2EA 5AKXA 3V6CB 5IN7A 8ICFA 3Q8SB 2P35A 1FM0D 4ED1A 4A8EA 1WE6A 1QQ6A 2BF8B 1L5UA 2N1VA 3KYDD 1ZQPA 1I4XA 3UF8A 1QOAA 3PVLA 2K8BA 1ZQ1C 3SAFA 2XCAA 4Q43A 2KDFB 1MPEA 2NTSA 3Q8PB 2AQ3B 3FCPA 5J17A 2ATLA 3SZ2A 2N7JA 2C22A 4U6PA 1U45A 5FR6A 1L6VA 1B0XA 3BQ7A 4RGMA 4B9TA 3NXLA 1URJA 2V4LA 2EKIA 2K4PA 1NK4A 2JRIB 3VR8B 1KH0A 4BWMA 2PU0A 3ZVHA 3PLUA 4DQPA 4EZ9A 3UCCA 4QZBA 3G6VA 2N9PC 3PRPB 1MBTA 3GZNI 3V62A 1W1RA 2EMTA 3PQBA 2RP5A 5LLIA 3OJSA 5AK5A 3RJAA 4Y2VA 3HM3A 2PPHA 3QARA 3C1ZA 2ZUCA 4UAZA 5LXHA 3QCAA 2ZADA 3OHBA 2KAJA 5L1KA 3A1QB 3UXKA 2L5YA 4H2AA 2A19A 2MBOA 1XC9A 3BIID 2KWUB 2MWSB 2OVLA 4MEYA 4P16A 4QZ8A 3F2DA 3RJHA 4BCAA 1RXVA 4EBDA 3KUCB 2DWQA 2ZVOA 4WWPA 5FXFA 2CS4A 5KG2A 1NJXA 2GSHA 2PE9A 3EGRA 1N61C 4I6LB 2KFJA 3R66C 4FI4A 3AE5B 2NBVB 1F9JA 1YMHE 3N1ZC 2AQ2B 3VC5A 2HBLA 1SZHA 3N28A 1ZQEA 3KKAA 3S1FA 4J3OD 1JQ4A 2WF7A 3E0FA 2VFVA 4F4YA 3G6XA 4ZCWA 2DAJA 1K8RB 3EHVA 1YQ4B 4Y2SA 2HDOA 2M19A 1X2HA 4EQXA 1UGJA 1FO4A 3SN1A 4JWMA 3IM1A 2DZKA 1ELSA 2WX0A 5DGAA 5L83A 5JH5C 3ALBA 4L1BA 4Z6EA 4UAYA 1BMLC 4H50A 5FKAC 1NZPA 5CX3A 5AWVA 2J6SA 4PVEA 9ICHA 5FK9C 4B9NA 2JZBB 2Y3RA 4M0WB 4FADA 2HHVA 2QDDA 1K51A 2HJ8A 3FILA 3BK1A 2UVRA 2YN4A 7ICSA 2D3AA 3IJIA 2BPCA 1BPDA 5FR3A 3AU6A 2GOLA 3TAQA 4HYKA 1NU5A 1Q1OA 4IQUA 5BOMA 4DFMA 4F8RA 2GDQA 1GPXA 3PX0A 1S76D 3R7RA 5KTQA 2UU7A 3QUCA 2PP1A 2IPIA 5H8YE 4NY0A 4YMOA 2AYOB 3RD2A 4MMWA 4YR2A 9ICEA 3UMGA 1PK1B 4OZAA 4P6VF 3DK9A 2PLPA 3PZDA 4AJYB 3T3FA 4F4XA 4BX9C 4DXGA 4H4ZA 2CR5A 4ED2A 5AI4A 1UH6A 3PNCA 3B97A 2DX5B 2KANA 4ITKA 3LVVA 4IM3A 1ZMCA 1M6YA 5CHWA 1NK8A 3T4WA 4DQIA 2BKEA 4M9GA 3M62B 3MP9A 1YN3A 1JCTA 1MN8A 1YT3A 4GLSC 1C4PA 2M1MA 3U7ZA 4TVWA 2W9MA 1B4FA 1ED1A 3Q8FA 3N30A 2K6DB 2WU5B 4MGKE 4LIIA 2PVGC 4BGDA 4L23A 4J9RA 1ZW7A 5AUIA 2QILA 4KLUA 3RNEC 1DK2A 2JEFA 3GZNB 1X9XA 3Q8CA 5IOIA 5TISU 1F2RC 5DG7A 9ICCA 3DIPA 4PHDA 4KITB 1UELA 2WF8A 2F1HA 2KJ5A 5CB1A 5J2DA 5J2BA 3PO5A 2FI1A 4QZEA 3P4QB 2B3AA 3CGBA 4KZCA 1QT9A 1K4QA 4GDLA 1SSNA 2H3IA 1FXAA 2F8LA 5KAFU 4LNKA 1HE8A 1ZXIC 2XEWA 3RNAC 1CZPA 2WB1F 3HK0A 2W03A 3UINB 4AP4C 1XLNA 3DV9A 1QF6A 1TV9A 4FZMA 2LHDA 3DQ0A 1D5MC 3AEGB 4MFFA 5HR7A 1XSPA 1AHZA 5HHIA 2KVRA 1F52A 2W7PA 1JPDX 3JW0X 2VH2A 3T3NA 2YMMA 3VCCA 3TJPA 2XY6A 1SGGA 5HI1A 2IHMA 3SQPA 3GD3A 1BNOA 1I19A 5D4BA 5FMHA 2QIEB 3R1ZA 1E8FA 1SL2A 3GV5B 2CU1A 2DPJA 4XLOA 2WXFA 4DK5A 3EUB3 4LZDA 2RMMA 4FX9A 2L7RA 1L8LA 3AU2A 3I28A 8ICEA 4MACA 2KHVA 2GMIC 3DG3A 2ICIA 4WJNA 3RB0A 1P1AA 1L7NA 4I2IA 3PV8A 1TAUA 4R63A 1F2RI 1YX5B 2KWDA 2N9LA 1B9RA 3ZXVA 1ZDVA 1DIIA 3W1SA 4MH8A 2G45B 4RNNA 3SQIA 4EZKA 1TYPA 2ZZ0A 4PGYA 2YTUA 2OAIA 2WXRA 3R7QA 4RNOA 5ALYA 1N5XA 2FMQA 4LLGM 1OQYA 3KW5B 2BYFA 3F5AA 3ZJUA 3OZMA 2Y08A 2D07B 2YMQA 4UB3A 2OHFA 1Z4NA 3NVVA 4DSFA 1GREA 3QU2A 4YD1A 1GXFA 5ADZA 4DLEA 4ECXA 2AQ4A 4F5OA 2C60A 1SJBA 2KFNA 4GMVA 3OZYA 2ZIVB 3C1YA 4H4SA 3OLMD 3ZVHB 2PMZF 3PRMB 3RZFA 4DHJB 4MGYE 1F8WA 3VDZA 1UGMA 1N60C 3JZUA 4IWQA 1I4PA 4KT2A 2PCEA 4OZCA 4DS4A 5IAAC 2IDYA 4E5TA 4BDPA 2C28A 4PS3A 5JZEB 8ICKA 3PR5B 4B0EA 3Q14C 3JYUA 3ENLA 4IL6U 4J03A 2WHEA 5KFKA 3RBEA 2N9XA 2VAOA 4O5CA 1HZ5A 3EFUA 2PODA 2BPSA 3JVZX 4DN1A 2DPIA 4DL2A 3DBLI 1J19A 3Q6BA 4OD0A 9ICGA 2PFOA 2KTRB 3QJZA 4EBEA 3EYZA 4LDTD 1KKRA 2REXA 2JH1A 4J9KA 3ZDDA 5TR5A 3V3XA 2GLSA 4G9BA 4KIKA 1AARA 4AS1A 2Z0DB 2EANA 2PKEA 1C4AA 3CXBA 4FJZA 1V59A 3UJRA 3GILA 2P13A 4R65A 4I2AA 2WU2B 4BKSA 1FFUC 2VANA 3DBHI 2HQMA 3H70A 2Y9TA 1K53A 5EBKA 3JVAA 5J29A 2H88B 1Z1BA 1PUTA 4JAYA 5TR3A 3MZNA 2W9BA 3SFDB 2JMGA 3VXWA 1RDFA 3R2TA 1N63C 3KKAC 3FW7A 4IL2A 5AUKA 1UHUA 5DG9A 3IHQB 3H4DA 4K7WA 5KHQA 2WTFA 4MSMB 2ALZA 5BOEA 2ZJAA 7ICMA 5BOFA 1XWLA 2PKOA 2MH7A 2LZ6A 5ENLA 4M9NA 2DZJA 9ICPA 1LFDA 4HYRA 1MQ2A 3K9OB 4UASA 3NRZB 4IQTA 4ASWC 4W9FA 3ZDMC 4O3SA 4RNAA 5AICA 8ICSA 2D10A 4RFBA 4ADWA 1LXDA 2UYZB 4IM0A 1IGCA 4GIRA 1V80A 3OJ4B 3K1GA 5HHZA 3UCDA 2YLMA 4PZFA 2V3BA 2QCZA 3GFKB 1TAMA 4E74A 2X8GA 4DHZB 4IP4A 2BKFA 3TWAA 1Z2MA 4PGQA 3RJGA 3M95A 1IPGA 3GO2A 1J7AA 1EF1A 2CKHB 4PJ0U 2DL0A 1VD2A 4MDKE 2AH5A 4DNAA 3OSNA 3L0WB 1W1LA 3II4A 3PGEA 3D47A 2R2OA 4DL3A 4GIVA 1I42A 4BXOA 5JU5A 4H4QA 2Z0EB 1U9LA 4RT3A 2ZJ5A 1NK6A 1BKHA 5ALSA 1F9CA 2EQ7A 1N6ZA 5CA7A 2WQYB 3V6EB 2I38A 3NTUA 3W9CB 1TZ1A 1W6TA 2KJRA 4ACOA 1PGAA 1RFAA 2KVZA 5FS8A 2FAZA 1WH3A 3IBEA 3ISBA 2J0KA 5D79A 2PXIA 2LYHA 1H6VA 2Y0SF 4IQVA 4DFKA 1GAQB 3TQPA 3RGTA 2R9ZA 1N63A 4PZNA 4CRXA 3LXFA 5G55A 4E71A 3IC9A 5T14A 1E8GA 2Y5CA 1XT9B 1MSWD 3N20C 3ZVIA 1H2IA 3PRZA 4CHKA 2PPGA 1TAQA 5DBCA 1JCKB 1VDVA 1SE3A 5H92C 2W9NA 5HKHA 1OUQA 7ICEA 1JN3A 2E8OA 2G3QB 3KWVA 3O65B 3PPAA 3BS5A 1ZR6A 4LZGA 4YT0B 3VHTC 2HZGA 3P4PB 2EZZA 3DHGC 3A7RA 4BWJA 1NHQA 4O3NA 2O6VA 2KIVA 4UD8A 5J2KA 2EQ8A 5AZHA 2QB1A 3AE9B 1L7OA 2DFLA 3L13A 3VFKA 4E4FA 4JX1C 1QLUA 1MHXA 1F3PA 1KDHA 2QGYA 2LBOA 4GXBA 4AQ7A 1TS4A 3TSJA 5AM0A 1EXNA 1UA1A 3UM9A 1ZD4A 2AGQA 4E0DA 5ALQA 8ICVA 1STZA 3QU5A 5KL8B 3ZJVA 4DHGA 5KHOA 1WMHA 5KFUA 4RCOA 2I5QA 5KFCA 3B0AA 3Q8MA 4CO7A 2GR2A 5DCNA 1V38A 1PK1A 3L8KA 2LHEA 1W1QA 2JT4B 4FHJA 1JEHA 3KLSX 1RXWA 4KLJA 5JCNA 3S6JA 1I4HA 2NBUA 3UXOA 3U26A 3KHHA 3L17A 1D8BA 4K8GA 1V8CA 2RDBC 1XLOA 4IS7A 2WWZA 3HVZA 4L2YA 2J53A 4C4RA 1WZ0A 2L1AA 2UUVA 3AI5A 4WH4A 3TUOA 2K60A 5ALIA 3A0HU 4Y2TA 4G0NB 4EYHB 3L4PA 4JE3B 1X2GA 1MJDA 4FN2A 3AM9A 5AK3A 1HZ6A 5AKEA 1JWSD 4EEYA 4R64A 2MW5A 3VTVA 2RLTA 2KZRA 1I7HA 3VR9B 3TSHA 9ICOA 2V6OA 1D3ZA 1PK3A 2RD0A 4HVBA 1E8XA 4DXFA 4DO9A 2BCQA 1QZEA 5AE3A 1D8LA 4UAVA 1O03A 3P63A 4A3PA 1LVLA 2PLIA 1SWVA 2CXYA 3HILA 5D46A 4GXIA 2JWZA 4B9LA 2KTQA 3M6KA 3Q8LA 2KMMA 5HHHA 2FPMA 3AU4A 2BWFA 2JY6A 3SI8A 5D2MB 1C1YB 5KFPA 3D2QA 1SF0A 2BVGA 3FDSA 1S97A 4G11A 1NKCA 4F93B 3UXPA 3SQSA 4PHEA 1ZQVA 4LK0M 3N4MB 2BCVA 2LYAA 2MUTB 2OYYA 3VQIA 3PHWB 1VQZA 2IO1B 1JXEA 5L95C 2E8PA 5KFIA 1T6BX 1XXGA 2L05A 2G9HD 3KHGA 4DF4A 2GWSA 4HNCA 1SIFA 2C2RA 1XO3A 2ZZPB 1AHVA 7ICOA 4GN1A 1EWCA 3IRUA 4B6WA 4BKSD 5AI8A 3IAS1 2JEIA 2MA9B 3MUCA 1VCBA 3IP4B 4C0ZA 3PW4A 2LXCA 1ZQXA 3IFWB 2KLGA 2BQUA 3L08A 2AGPA 3KFUF 4UARA 1YJIA 2OEDA 4HN8A 3S5SA 4Z1YA 1SE4A 3DVNV 5IO9A 3DFYA 5FP0A 2JF5A 3VFCA 3GRTA 1ZQBA 2LXAA 2ZNVC 4GXKA 3Q8QB 3I9V1 3FW8A 2A1JB 1TKDA 2Y3AA 4J9OA 3FYHA 3I57A 2HI0A 4OO1J 1P9DU 3KUZA 2W7OA 2INNE 4A9AA 3B0YA 3QZ7A 1GESA 1GERA 3M7DA 4QZFA 1KFDA 1M6IA 3D2SA 1L7MA 4IQWA 4ACFA 4DFPA 5J04A 2WOVA 1YX6B 1ZOYB 4RQ6A 5T8IA 4BKTA 1WUEA 4RUAA 2IGGA 3MABA 2Q5WD 4UBCA 6ENLA 1C20A 4CGZA 3QU9A 1K52A 7ICIA 3RB3A 2DZMA 3NVZB 3AN1A 3Q4DA 1IIPA 3GIMA 4HRSA 4DXAB 5ER0A 1EWYC 2O2VA 3N6HA 2WFAA 1VZ8A 3IK4A 1X66A 3UQBA 1UXYA 2LGSA 3ETRA 2L52A 5DB7A 5JCIA 3Q3FA 3NVZA 2LYBA 4HCHA 3RN9C 1MUCA 3GP7A 3N1XC 4MGZE 5FXPA 4E6MA 2G4DB 3NS1A 1LKYA 4GFJA 4EZ6A 2JWUA 2LGYA 1X6IA 4BFRA 1N62C 3DDCB 1KEJA 4YWOA 5E6NA 4F4WA 1NDDA 3A9KB 2F76X 4NLKA 1SJAA 1IM4A 3D2DA 4F2SA 3DDMA 3KUMA 4RNMA 3MDCA 4X5VA 4RF0A 3CWIA 4DHJD 4RQ8A 2AL3A 4FJYA 4ANWA 3OC4A 3PSPA 5DKWA 3VRBB 3TJIA 4H2HA 3EKGA 4PH5A 5EWFA 3FKYA 4RF1A 2OXOA 2IMWP 3OJ3A 3WK5A 1BPXA 3CGDA 4GDKA 2KDIA 2WYQA 4PWCA 1HEZE 2BTEA 1NELA 3CIRB 4DL7A 1NJYA 1JW9D 3WALA 4DHZE 2RQ5A 2E6XA 4PWBA 4O3QA 2OPJA 1WX8A 4LJPB 3TMPB 5GMVA 3H0LB 4W9GA 4JWUC 1X9MA 2JVCA 2J4XA 8ICPA 1COKA 5KFZA 1S0OA 4P4PA 3IG5A 2N9EB 4GU2A 3FWAA 1IG6A 1SB3C 2KN7A 2VFSA 4BXOB 5CJ7A 2JXTA 2OEHA 5ALVA 3ZW3A 4J1OA 1WFYA 2LGDA 2H5XA 3ZO5B 2XH7A 4JV1A 4QZ9A 4BUGA 1BPEA 2F1IA 3NUHB 1ZQSA 4HPLB 3KOOA 4A6QA 2ZPYA 1NNLA 1BGXT 4ED0A 3ENEA 2QKQA 3HHMA 3L54A 3RMKC 3I1YA 3ZDEA 3DQVA 3FW9A 3DBRB 3PY8A 1HSKA 2DQNB 4AYBC 2AWTA 2XGQA 4QWCA 2R8JA 1S77D 2NS5A 1WWTA 3D6JA 1NZBA 1LB2B 3KWLA 4PVJA 4KPRA 1YQ3B 3GY1A 3I6EA 2W3RA 3AE3B 1L5PA 3DGBA 2DYOA 4B9KA 5H2FU 2KQ7A 2YMPA 3U4EG 5F9NA 1QQ5A 8ICBA 3H7PB 4YN4A 3WANA 4JQWC 4FS2A 1GC7A 2C7NB 1V97A 2G5IB 2KC1A 3PREA 4DL5A 3AQFA 2OH2A 3ML8A 3PO0A 3W2DA 4M0XA 2NPTB 4HPMB 5HMLA 3MTNB 2GQUA 3O13A 1KM7A 7ICFA 4NZLB 2WPCA 2KEYA 2MRLA 4G8TA 4JK1A 4HEA1 3N7RC 4CF3A 2KX0A 2ZTEA 3RFAA 2LVQA 3AE6B 3V61A 1T3QA 2IY0B 7ICKA 4M8NA 1LQBA 2P3HA 3LB8A 2I1KA 3LB8C 5D7GA 3AB5A 3W5UB 1GETA 4K4IA 3SMVA 4QWDA 2LRUA 3C21A 2OG9A 2ES6A 2AGOA 3SEBA 3NFUA 5E6OA 4DQQA 4Y2RA 3L3FX 2D11A 4X2PA 5ALEA 1TY2A 2RR9A 5KT5A 1LGRA 3WCQA 5FJRA 1TK8A 3V05A 2HXUA 4F4RA 3IT4B 3GU3A 4J9MA 3B9JB 5KVIA 4EENA 3NO1A 1V5OA 3VTUA 2NRWA 2QDEA 3Q8AA 1YN4A 3ICXA 2LRWA 5AI6A 3R10A 2YAUA 1UWMA 1TS2A 1KLNA 4QZDA 2WS3B 2PFNA 3EA6A 1ZQMA 4C7ZA 5AM2A 4EM4A 2BVCA 5JCMA 5KFGA 4QWAA 5AKZA 1B43A 3X0WA 2BR0A 3APCA 4QZGA 1E7UA 1MNSA 3C29A 5ALRA 2IGHA 2XCPA 2PEAA 5FJTA 2QARB 1HTQA 4JUZA 3PT2B 1QOGA 1EBDA 2H3FA 2FDRA 2ACZB 3UMBA 4Q45A 2UWQA 3DJJA 9ICSA 1L6NA 7ICUA 5HG2A 4EWJA 2FE9A 5DB8A 1N48A 1WVFA 4R66A 3S2AA 3ZRFA 2IBIB 2DKZA 3W1SC 2TPRA 4WAFA 3ONNA 4A3RA 2RDGA 1GJZA 1ZD2P 3Q8BA 2YB4A 4KLFA 3AEVA 2AAQA 2MNRA 3H7PA 2G4SA 2DGZA 1YNTE 2D8CA 1KSPA 3QUTA 4OVVA 1ISNA 1Q3VA 3QXGA 4Y2QA 2QPMA 3PTFC 2EAOA 2LMCA 2KN5A 2BGFA 2YEPF 2WXNA 1D4BA 2D3BA 2Z7JA 4PYUA 3R3MA 1WI0A 2PMVA 3ALRA 1A5RA 3D46A 3DHHC 2Z8LA 4PPXA 2X8XX 3OW1A 2PMZC 3T3OA 1W1KA 3A1QA 4QIWF 1AN8A 2IJ0A 4A90A 1MOKA 3ZI4A 1BPYA 1X6JA 5E79U 1ZJNA 2K9XA 2M4NA 2ONQA 4XWTA 5DPWA 1WGGA 3WK4A 4F5RA 1FECA 2C3DA 2NPXA 2YVJA 2A1AA 2F2AB 3WA0A 4R8UA 2V4QA 5KG4A 3KD3A 1HTOA 2IHNA 9ICTA 1S10A 5KFEA 5KG3A 3TEWA 5FXEA 3ZDAA 1S0VA 3UXNA 2R2QA 2HMXA 2VKQA 3OSPA 4NQLB 1XNSA 5KG1A 3CRXA 3NRZA 4A35A 4PVKA 5EU9A 4NAWB 5HFYA 4YG2A 3HX0A 3C23A 3EZ5A 2XNAC 3W8XA 1ROEA 3JPTA 3QFBA 4QZIA 3FV9A 1VZ6A 2PLSA 4W9KA 4IR9A 1A77A 1JWMD 4XC2A 1W1SA 3GIJA 1UF0A 2DLBA 1ZJMA 3MC1A 4KKIA 3AEEB 3NJTA 1QOFA 2RGFA 2QARA 2KD0A 4XYCA 1E8WA 1ZRMA 4EKUA 3QFAA 3VUYA 1KLVA 5KFBA 2OOBB 4KN7A 1WXAA 4KX5A 3M9OB 9ICJA 4HJGE 2KWCA 3QX7A 5EDSA 4KLGA 3SV3A 1MVKA 2O2VB 3R8BA 2PS2A 3JPQA 4GIBA 3H1UA 4EMWA 4Z6CA 1VJKA 4M6WA 4ECWA 2JYEA 5HMRA 2PGEA 1GO3F 3UQ2A 3S1CA 2FYMA 1P7EA 3SR6B 1P7DA 5KFLA 2LGIA 1CMXB 1QQRA 4K4HA 4YSXB 5KFHA 1I4QA 2FUG1 2CDUA 3QPEA 2PP0A 1ECWA 1X42A 3GDXA 4RGTA 4LNNA 3FVDA 2JRZA 2KVSA 2HHUA 2HSZA 3AE8B 4K3CA 1KN0A 1ZQYA 2IBKA 1AWDA 2WXIA 1ZMDA 2BCPA 1WUFA 1SXEA 3DVNU 4KTQA 4XQ8A 3OAWA 4JN8A 2I1QA 4RUCA 5KT2A 2FLPA 3RO6A 1S1QB 4K8DA 3BS7A 3K9PB 4ANUA 1KW4A 2GRIA 3DG7A 4ECTA 4C4SA 3N97B 3DWMA 2QJMA 3ZNGC 2E8MA 2B21A 4W9JA 1FEZA 1IYXA 1M4VA 1R4MI 2BGWA 4F92B 3TAPA 1EBGA 1JWUD 1E9MA 2DAFA 4GDKB 2R61A 4M9JA 1V9JA 4P0QA 4J56A 5J0PA 3SJNA 4CF5A 2WXJA 2I2YA 4ECQA 1QSSA 2P3ZA 1XQQA 3RFZB 2I9GA 3IJLA 4NLNA 3QYPA 2DBYA 4AP9A 2ISPA 3B9JA 3PMNA 3MC8A 3TEYA 4XZ4A 4KLIA 1TKKA 3VH4B 4XDDA 3BDPA 1RFKA 4IR1A 4OJ6A 5E6PA 2R2ZA 3M9MB 4P4MA 5BYRA 1XPYA 2L0FA 3R07C 3BZDB 4HCDA 4KPLA 2X50A 5IINA 3N7SC 1NI2A 4UW9A 2CHXA 1MG8A 3RJ8A 8ICLA 2Q4TA 4MEXA 2BC1A 2VJ5A 4JQ9A 3CGEA 3ZNZB 3GE3C 3RI7C 2K4HA 8ICRA 2XK5A 4KLEA 4C8MA 4K7SA 4DWIA 5AEKB 2XY5A 3LVWA 2N7DA 3H0MB 4G3XB 1GRFA 2ZIXB 3B08A 2HBJA 1E9IA 1RVKA 3PZPA 3THVA 3B1LX 1FXTB 5DGBA 2I5HA 2KN4A 1X40A 3NVWA 3JSVA 5K8EA 3DEEA 3IDWA 4KMOB 4DQRA 1WJ6A 2I6XA 2OQHA 4DLGA 1RG6A 4DFDA 2LJIA 2VZKB 3MGIA 2HVIA 4NLBA 2N7EA 4NV0A 4KLTA 1N62A 1JWAD 1JMLA 1XANA 3EC8A 3MKCA 2GL5A 3Q8KA 4GC6A 4H4XA 1E90A 4CCHA 2GI9A 3H40A 2EKEC 5BO4B 1P48A 4HG0A 2PFPA 1YN5A 2V3SA 1NPXA 3TWBA 1NKBA 2BCUA 2G0AA 4K81A 3GD4A 4ED6A 3IV6A 1K1QA 5AM4A 3MGHA 2ODGA 4B9UA 4KWSA 4A55A 1MC8A 1WX7A 3GS2A 3DFHA 5GRTA 3TTEA 2QEJC 5BMHA 4GSWA 2GGIA 1PYWD 4RGOS 2J6UA 4O3RA 3C19A 1NI3A 1V1PA 2JEJA 1U4BA 4DBGA 4JDRA 2M0XA 1D9FA 1ZKHA 4QZCA 1SXDA 3NVVB 4PVHA 2XK5B 3I3TB 2H3VA 2INDC 5DLFA 7ICVA 3HT3A 1TYGB 1Z4OA 1GB4A 1SL0A 2VA2A 2K4IA 3F2CA 4H4PA 2KSOB 1Y56A 2IYDB 5ALHA 2Z59B 4Q44A 7ICNA 1WMHB 3X23A 3AE7B 4F5PA 1P0RA 3I76A 5HMMA 5B66U 4DDID 3A9JB 4II3B 3NVYB 2GGJA 2XH4A 3EWAA 4HDQA 3R0UA 2LUMA 3GOEA 2WXKA 3EUB2 1RPLA 3EJEB 1SJHD 1AROP 5KG6A 2LGXA 2KZMA 3JS8A 3WK9A 4GGHA 4FO6A 3DDHA 2PIAA 5DG8A 4EBCA 1OFFA 2NO5A 1NHSA 3V5CA 3KVFB 3SFEB 1YEYA 2R8DA 5AM1A 2KDBA 2AL6A 3RR1A 1E7VA 1NENB 4MEMA 5KFWA 2L0TA 4S0RA 4BOZB 4BZAA 2AL2A 5F3XB 3FC4A 3N7PD 4B6JA 1FFVA 4J9SA 5DLGA 1GSNA 2JPHA 2D6FC 3RH6A 3DG6A 1B22A 4I2EA 5BMGA 2XGZA 5KT6A 4DSJA 4OJ5A 2C7MB 1HQRD 3B2FA 4M0WA 3VC6A 2NTTA 4B9VA 3L5KA 3EAOA 2LI5A 4ROPA 5GTIU 2PFQA 2KZZA 5ALOA 1TE6A 4DCCA 4RZRA 2K5PA 5DPSA 3SU8X 2GGGA 2NVKX 5HP4A 2WXHA 4ZA0A 4OW0A 3NZSA 3BSMA 4Z6DA 3DBSA 1V2YA 2RPVA 4DOCA 3MR3A 2AXRA 2PTZA 2E1EA 1WXMA 2FNJB 3I4KA 4EE2A 4UAWA 3OWEB 3UXLA 9ICLA 5KFSA 3LADA 1X1MA 4K7UA 2P4PA 1L3TA 1SKRA 3TCSA 4ELVA 3DBLB 4UB4A 1WJ4A 4ZHPA 2P8BA 1DGSA 1ZRNA 2EAPA 2IOHA 2QDFA 1J7BA 4MH0E 4TQ0A 1V81A 4EFOA 1T0YA 4CDGA 2EQ6A 1XO1A 2RRDA 3IG8A 4ZOHC 2ZXHA 5JUMA 4QWEA 1XHCA 2OZTA 4IP5A 2RDXA 3N6JA 2RK5A 3HKZC 2ZIWA 2BB5A 1GEUA 4MLAA 1GRTA 2VA3A 1SXTA 3BYYB 1PDXA 4KV2A 3QTPA 5J2RA 1ZETA 3APDA 1QLTA 2BDUA 2MA1A 3ETLA 4BOSC 4W9EA 3JPPA 3BQ2A 3TOYA 5ALUA 1JUDA 5AIBA 2FPLA 2V3NA 2K0PA 2B0CA 2FPKA 2JR5A 3QE9Y 1KJTA 4M8MA 4EC3A 3H8MA 2NRVA 3PSFA 2PMQA 4US8A 4UATA 3NOBA 3AV8A 4I2FA 4RU9A 3ML9A 8ICNA 4HJKA 4J6IA 3V6JA 1KFYB 1MDRA 3PW5A 5IILA 2KK8A 4NXZA 2GOWA 4W9CA 4DSEA 3BQ1A 3ZDBA 4UB5A 1WGRA 5AZGA 1SKWA 4R8UB 1ESFA 3PMLA 3U9IA 1V9PA 3MBYA 3TARA 2VH1A 2ZJDA 4RQNA 4RQ3A 3JPOA 1IBXB 3WK8A 1WM3A 3AECB 4NAWA 1V85A 4MKSA 2WP5A 5JTIA 2J52A 5DQHA 4TUQA 3ZYYX 4D2KA 2O3GA 1D8YA 4URKA 1UD7A 2AQ1B 2BYTA 4NAMA 1H38A 3OJUA 4DSIA 2Q85A 5KT7A 2Y9UA 3ZGZA 1WWUA 4M6UA 3LDZE 4NJ8A 1ZXHA 2YY6A 2K22A 4ZOHB 5CR0A 2ZXIA 3S1EA 5KT3A 1SJCA 2C5LC 3H7IA 1KLGD 5HHDG 4C8LA 4IM2A 3AXCA 3MGVA 1WGKA 3M6ZA 1ZD5A 3SV4A 5EOZA 4QAYA 2W54A 1WUDA 2PTLA 4ICAA 3ISDA 4M52A 4G50A 4QNLA 1FIQB 3K1RB 1J8CA 3AEDB 1E5WA 5JHBA 3L10B 4TUSA 3MDAA 3C5GA 4A20A 2P8CA 4MJSB 4UBBA 4EELA 2R8GA 2WDVB 3BWUD 2CJOA 4LTUA 3ZNID 4AJWA 5EWEA 1QTMA 2O6VB 2GRTA 4O5KA 5L1LA 3WKEA 5AKGA 3M9NB 3D9XA 5C3JB 3JPSA 5J2FA 4H19A 3RAQA 1FD6A 1FEAA 4KKJA 5KFYA 3OP2A 4DYEA 2FLLA 5KFAA 2KJHB 1A0PA 4H1ZA 1E10A 2F77X 3EPGA 5AK4A 4O0IA 3HKZF 2W04A 1NJZA 2UVVA 4US9A 3M3JA 2WDRB 4BC7A 2MAXA 4DX3A 4RQ1A 4ARCA 4ANXA 1SE9A 1WCNA 1LM8B 3DEQA 2J0MA 3E58A 4FJVB 4DL6A 2IO2B 4MM3B 4FP1A 2OZ3A 3CP8A 4N9F4 4A3OA 1JOAA 2WP6A 3PSIA 1L7YA 2HOFA 2QC8A 3ZDTA 1V6EA 2UVUA 3B0XA 4OJOA 2BS2B 2LWPA 3BQTA 4RGNA 1N5WA 1OXJA 2PTWA 4ECYA 1J2MA 4W9HA 4DS5A 3UQAA 1XSNA 3LLBA 2SAKA 1HIWA 4HK2A 3F5EA 3DPDA 4GOCA 1Q5WB 1YJJA 5AE1A 1NVID 2ZIUB 4M00A 3TW9A 1NOMA 3RRHA 1C7YA 4B0MA 2CJNA 4XA5A 3M63B 4RPXA 2V4RA 1WGYA 4EOYA 4LVSA 7ICJA 2R18A 4JV2A 2QHOA 2IPKD 3PSEB 3Q6JA 1XCQL 3NASA 3E2EA 3CMMB 3PW7A 8ICZA 2A5UA 1ZQFA 1KQQA 5DB9A 2BS4B 3DWGC 4YTMB 2GBJA 2MUCA 3TEZA 5JHAA 2KYWA 4H4RA 3TBLD 2WNMA 2BVFA 4S17A 1YOVB 3ZKJC 3UIPB 5KFQA 4AUQC 5AI9A 1DRGA 1WYWB 5AKLA 2OO6A 4REZA 4W9IA 4FBUA 1L8OA 1J0GA 3RJFA 1J7CA 1NK5A 1ZQTA 1WY8A 1B1ZA 1WG8A 1ENFA 2BWES 4J9PA 5AKJA 2TSSA 4GDLB 4R3DA 5AKIA 4BV6A 2MSED 3C28A 2HVHA 1VR9A 3TEXA 3P3BA 3VCNA 1TK0A 5J0YA 3A9KA 5AHXA 4OZBA 3T8QA 2ZNVB 2AKMA 2WXMA 3POPA 5HNKA 1FFVC 3PZ7A 2XVTA 4MFCA 4JMUA 2V3AA 1FCCC 4FZNA 1BVSA 1O08A 2LEKA 4ELUA 4I2BA 2WXQA 3SN0A 8ICAA 3HVDA 1BWCA 3HW2A 4MFAA 3C0PA 3ZUNA 1ZY8A 5ALWA 1RLFA 1WZ3A 2GBMA 3KYCD 3ORYA 3RNFC 2G09A 3EPIA 4IWPA 4USAA 1KRHA 1UCVA 1GRBA 3QEBZ 3ECIA 3NZGA 4DL4A 2HTHA 2MBQA 1WM2A 1VRAB 4WWMA 3EECA 1CJEA 4QW9A 3RRGA 2O56A 1F77A 1PVRA 9ICWA 4XE0A 1ZOLA 3VAWA 3H8SA 3DH9A 3GC2A 1K1SA 5LNK1 3QAQA 1ZQRA 3ZJTA 2IZVB 2NMQA 1KRPA 3ZIMA 3CYMA 1WX9A 5ALFA 4BBNF 5KT4A 2GBRA 3BS5B 4RM9A 1XDIA 3QUBA 4B95A 2FUHB 3P0WA 1CQVA 1Z00A 1N2XA 3SHQA 2WXPA 2KD1A 3NGDA 1AQ6A 2KIWA 4YXJA 7ICLA 1UT8A 1ZQDA 2JSVX 5DDMA 2KXJA 2A3VA 3RCYA 3T79A 3DBRI 1BPZA 4E4UA 5G5GA 2VA8A 2YB1A 4M9HA 1KKXA 1FXIA 4HLEA 1L6UA 4APNA 1WE7A 3H12A 4Z17A 3ZD8A 2Y5BB 1QQ7A 4KLQA 2BYEA 3ZLGA 2PW9A 1T94A 5DB6A 4FE3A 1N56A 3AEAB 3MR2A 3AULA 3EJDB 5JRBA 2V9HA 3A7UA 3TI0A 2JZZA 2NCNA 4I2JA 4HNLA 1UT5A 3T5HA 2E5AA 2ZZBA 1N5WC 2Y0SC 2O6VD 5C23A 3S47A 1T3QC 3RB6A 5JCLA 4NLCA 1DIQA 1DGJA 5ALKA 2EDUA 7ENLA 5C5JA 2KJ9A 1V49A 2VFUA 1D5XC 1ZQJA 2M9NA 4KMUA 1UA0A 2DYMA 5D3DA 1G6JA 2LHTA 4QZHA 1HJPA 2BPFA 3C0RB 3QQ8B 2D5GA 3U8ZA 4KDLB 4J57A 2LD9A 4ANVA 5J18A 4I2GA 4YP3A 5J0UA 4Y2XA 1WJUA 4IT1A 4BC9A 1JI7A 4UAUA 3RH4A 2FE8A 3QU7A 4GXJA 1Q10A 3BK2A 3HWTA 1OQQA 2XH2A 2XC9A 1L0YB 3VTWA 1OEYA 3W1YA 2WDWA 4EMJA 2G07A 5ALLA 5DQIA 2INPE 4ZRQA 2FCQA 3QA8A 4HKQA 1TKEA 3ZTCA 2ISOA 2BBCA 3H8JA 4TQ1A 3HSUA 2ZIUA 4AYBF 1EUVB 3P93A 4DQOC 9ICAA 4NLZA 2HDEA 1T0QC 2JU6X 3EFCA 1E0YA 5FJUA 4DWDA 3OPSA 3ZQ4A 3H6NA 8ICHA 4C80A 3A4RA 2WF9A 1ZQIA 4NLGA 2LMRA 2M0AA 2FJ6A 2NV3A 3HIZA 4XDCA 5C2TB 1KTKA 2B6GA 2GBKA 5KG5A 5CWRA 3QC8B 4BBNC 3ONSA 1SB3B 3ES7A 4WJOA 4P0QB 4K3BA 2OQYA 3SBFA 1SGHA 2W8KA 4KGRA 4UB8U 3UMCA 1A6SA 4YFKA 3CNHA 4H4TA 1CEZA 2PJHA 1TKYA 1RAXA 1F0ZA 1KL9A 1QSLA 4NJCA 4H4YA 2A1JA 3RH5A 3AE2B 2DKXA 3T9PA 2JH7A 3HP6A 2D3DA 5G5HA 1PZNA 1XS2A 4Y2JA 1W1MA 1DYQA 1UBIA 1FEBA 1F5SA 1QH9A 3KTQA 3R9KA 2CHZA 4F3OA 4WAAA 4ARIA 2OJRA 1HEKA 3T5KA 1S7MA 3CXOA 5KFXA 2NRXA 1X2IA 3RUIB 4NL9A 4NL9C 4KX6B 5ALPA 4N59A 4DWFA 2KP7A 2PA6A 2E5SA 3V5FA 4O95A 2K8BB 2VFTA 3QN3A 2WHIA 2BQ3A 3HRDD 1SEBD 2DENB 9ICRA 4ZRKA 2MBHA 4BAXA 2JZPA 2JYTA 2OKTA 1JXLA 2KDMA 2LM1A 1WXVA 2QJNA 3Q3NC 3I6TA 4EMIA 2H89B 4UB6U 5KFFA 1Q8KA 1CI4A 1F0MA 4PK1A 4JPSA 2YVGA 1ZQQA 2XI9A 2IOFA 1KLUD 3Q8RB 2MLBA 3KLJA 1SV0A 2GO7A 1WYGA 4OJLA 2IY1B 4GFIA 2KT7A 3UGBB 4QW8A 5L9XA 4I28A 5EE0A 1NK7A 3H7VA 4YMMA 1RYRA 2MJEA 5L1MA 1ZD3A 2OLAA 3KBBA 3BZKA 3D2HA 3H9DA 4YWSA 3V4BA 5AIAA 1P7FA 2L8JA 2J7QB 4NM2A 3U7DA 1SZPA 5A0LA 5FS9A 2IO3B 2Y1JA 2K3UA 8ICCA 1NK0A 2W82A 2AEHA 2W9AA 3SYZA 1IBXA 3PWGA 4RT2A 1E0ZA 2JXJA 1GRGA 3WIMA 2CFYA 3C2KA 1GC6A 3RPFC 3E56A 1DK3A 2UUUA 1N61A 3BY4B 1KKOA 5DBAA 3DERA 5IIMA 1ZQLA 4ECZA 3SD5A 3LDAA 4PYTA 5EWGA 4GGBA 3DBHB 3ZVVA 4UB2A 1S5LU 4RM8A 4CNQA 2PVOD 5U1OA 2EMSA 3R11A 4W9DA 2LASA 4I2HA 1J97A 2DW7A 3U4FA 3DVGX 4P1CC 1WCLA 4UQGA 4RH6A 1H4RA 3H8WA 3MHZA 1TGZB 3WKBA 1DOQA 2KE7A 4F5NA 1BUIC 1D5ZC 1VZ7A 4IUMB 2BW2A 1CRXA 2AHOB 2ZIWB 3RULA 2KJ6A 2KLCA 4LNFA 1FNUA 3STPA 3TQ1A 3K1ZA 3QZ8A 3H4BA 2HE7A 3N4FA 3URHA 2NBWB 4C4VA 5ALTA 3QNMA 3MFIA 1JDFA 1C78A 3GB1A 2RSUA 3UJFA 1XLQA 2ZPNA 2J0JA 3QK0A 4F4KA 4O3PA 1IGDA 1RYUA 1KBUA 3N9YC 4GGQA 4C4VB 2JRHA 1MG4A 3FILB 5KFDA 3L16A 3RRAA 2CU3A 4BKGA 1SIJA 1QLBB 3UIOB 2C2DA 3ZLHA 4RQ2A 3GV8B 3E9SA 3Q3OC 4IWOA 2LI6A 4TQSA 1UBQA 3ES8A 2BKRB 2QB0B 1I4GA 5DPTA 3ABVB 9ICNA 2WF6A 3QWZB 3RJJA 1ZE3D 4MT5A 2ZUDA 2WPEA 2HTME 1C9FA 9ICBA 2DZIA 3HM6X 4ICUA 2WLBA 3SEIA 4DSLA 3CGCA 2KHWB 5EE3A 4X57B 2K8HA 2K4EA 3JPRA 1ZGUB 3IVFA 1D9DA 2W11A 3NZ3A 4HROA 1JMSA 1ZQHA 3J81j 5ALXA 3TIXA 4IRKA 1VAOA 1UNSA 2ZZCA 2YEPB 5FS7A 1DTNA 5U25A 3GIIA 3EJBB 2AL2B 4F50A 8ICYA 1WXQA 1E8HA 2KOXA 1PUZA 3JPNA 4KLSA 2KQSA 3DJGX 4ZRPA 2ZW0A 3FAHA 3A0BU 2WDQB 3K75D 2ASQA 2WAQC 4HKZE 1IV8A 1YZ6A 8ICQA 1ZQAA 1WRIA 2XSXA 1E6EB
chains in the Genus database with same CATH topology
1FIQA 1TKGA 3P4PB 3ETRB 1TYGB 5MPOA 3A7RA 1GB4A 1AHUA 1DOIA 2BS3B 4UD8A 1Y56A 4XWWA 3AE9B 2Y4GA 3AE7B 4O1NA 1RM6C 4DNSA 4JX1C 1QLUA 1MHXA 1A70A 4AQ7A 1TS4A 3TSJA 3NVYB 3B2GA 1D6EC 1TS5A 1IUEA 1PFDA 2LUMA 3ZJVA 3HUIA 2W3SA 2WXKA 2ZW1A 1EU4A 4A8XC 3EUB2 4N6EB 1XCTL 1SJHD 4RCOA 3AE4B 3JS8A 4YTNB 1N60A 2PIAA 3KQ4A 1OFFA 2LHEA 1W1QA 3SFEB 3KLSX 2R8DA 1STEA 1DOYA 1NENB 2E3TA 1C4CA 1I4HA 1WSPA 1W1OA 3PM9A 1QKZA 3P1MA 3VRAB 3A7AA 1L4DB 3FC4A 1V8CA 1FFVA 1JWBD 3AMZA 1ET6A 1XLOA 3HVZA 5BMGA 1PGXA 4L2YA 2J53A 2L1AA 2UUVA 5I1VA 1T5XD 4WH4A 5BYQA 2QSDA 3TUOA 1HQRD 1ZPSA 1NYQA 3B2FA 4M0WA 2NTTA 2IGDA 2BB6A 3L4PA 4JE3B 1X2GA 2K5PA 3AM9A 1HZ6A 2ON8A 1JWSD 2WXHA 4OW0A 1KF6B 3U2SC 1I7HA 3VR9B 3TSHA 3BW7A 3NVYA 2RPVA 2AXRA 4DXFA 5AE3A 4EE2A 3J9CA 3P63A 3OWEB 1BXTA 1RWSA 1XLPA 2PLIA 1VLBA 2BVHA 2P4PA 1CK1A 4Q2JA 2KMMA 5L6FA 4ZHPA 1WVEA 1SBBB 1SF0A 2BVGA 4WIPA 1J7BA 4TQ0A 3S1DA 1NYRA 2V3PA 3BYTB 4ZOHC 4LK0M 1K50A 1VQZA 3VQIA 2RK5A 2BB5A 4ML8A 4MLAA 5I1WA 4PT5A 1T6BX 1SXTA 1XXGA 1L0VB 1PDXA 2G9HD 3BYYB 4YSYB 3P42A 1PGBA 1QLTA 1AW7A 1XO3A 1AHVA 1ZP0B 2MJ3A 1EWCA 3W5VB 2V3NA 2K0PA 2EELA 1TY0A 3IAS1 3W8WA 4EC3A 1RYJA 3HRDC 4US8A 3LYYA 3NVWB 3AV8A 4YWGG 1MHHE 1KFYB 3DEDA 1YJIA 2W55A 2OEDA 1SE4A 3MC0B 3U52E 3IXSA 3P4SB 4YTPB 2SEBD 1ESFA 1TJEA 2JX5A 2RDHA 3IT6B 3I9V1 1IBXB 3FW8A 5AE2A 1JRPA 1UWXA 2Y3AA 2QMTA 3I57A 4OVZA 3AECB 4C56C 1RM6B 2INNE 4A9AA 2NQWA 2J52A 3ZYYX 2O3GA 4D2KA 2BYTA 2AQ1B 4NAMA 1HA5A 2Q85A 4TVYA 1ACCA 2FBWB 5BMIA 3ZGZA 2Q4WA 1FCLA 1ZXHA 2K22A 3S1EA 2YVSA 4ZOHB 1OQRA 1ZOYB 4TSSA 5EE9A 5T8IA 5HHDG 3I99A 1KLGD 2IGGA 2Q5WD 1WGKA 1K52A 2B76B 3NVZB 3AN1A 4IKGA 1C77A 4HRSA 2W54A 1EWYC 2PTLA 1VZ8A 1UXYA 1FIQB 3ETRA 1FM0D 2L52A 3AEDB 3NVZA 2J42A 1FFUA 1I4XA 1QOAA 1XEEA 4LTUA 2WDVB 3BWUD 3GP7A 1MPEA 2CJOA 5FXPA 2NTSA 3NS1A 2AQ3B 2JWUA 1N62C 2N7JA 5C3JB 1L6VA 1FD6A 3AE1B 4RGMA 4KKJA 3H8HA 1FMAD 2EKIA 3D2DA 3VR8B 3Q8EA 4RF0A 1E10A 1KH0A 3CWIA 3IAM1 1C79A 4OHJA 4US9A 2WDRB 4BC7A 3VRBB 4ARCA 1ZDXA 1MBTA 1W1RA 3PQBA 4RF1A 3RJAA 4MM3B 2KQ4X 1W1JA 1HEZE 3PZ8A 2BTEA 4PWCA 3CIRB 1JW9D 2BS2B 4KGSA 2E6XA 4RGNA 1N5WA 2KAJA 2WXOA 2MBRA 4PWBA 3LLBA 4H2AA 4JWUC 2Y5PA 2SAKA 3BIID 2J4XA 3LAEA 3BVGA 4P16A 3FWAA 4BCAA 1SB3C 4WURA 1YJJA 2DWQA 1NVID 1QOBA 2VFSA 5AE1A 5FXFA 1FNVA 3VTEA 2JXTA 3NS1B 4B0MA 2CJNA 2KACA 4WQMA 1SJED 3EGRA 1N61C 2V4IB 1EU3A 4FXCA 4A6QA 3AE5B 3NUHB 1YMHE 2IPKD 4ZYSA 1XCQL 4JB1A 4KGTA 2AQ2B 1C76A 3FW9A 1HSKA 2BS4B 4YTMB 3S1FA 3DWGC 4J3OD 1NEKB 1JQ4A 3TEZA 4PVJA 3KWLA 1WWTA 2WNMA 2VFVA 2BVFA 1YQ3B 1YQ4B 2M19A 2W3RA 3AE3B 1L5PA 1X2HA 5G5HB 1UGJA 1FO4A 2DYOA 3U4EG 4REZA 1J7CA 5TSSA 4L1BA 5AWVA 1BMLC 1B1ZA 5FKAC 1ENFA 2TSSA 4OALA 4PVEA 5FK9C 4GDLB 1V97A 4R3DA 2Y3RA 2QJLA 1K51A 3W2DA 3PO0A 3FILA 3BK1A 1VR9A 1FEHA 5E6JA 3TEXA 2GQUA 3O13A 1XF5L 5G5GB 4OZBA 4NZLB 5FR3A 3BVZA 2WXMA 3POPA 4HEA1 1FFVC 3PZ7A 3AE6B 2L32A 5L6GA 1FCCC 1ZXIA 1T3QA 1GPXA 2LEKA 2P3HA 3LB8C 5D7GA 2WXQA 3AB5A 3W5UB 3HVDA 2IPIA 5H8YE 3AH7A 3SEBA 3C0PA 2BT6A 4USAA 1KRHA 4OZAA 4P6VF 2PLPA 1TY2A 3WCQA 3TX1A 3V05A 4DXGA 1VRAB 4WWMA 3IT4B 1CJEA 3B9JB 1I4RA 4ITKA 1F77A 4XE0A 4IOIE 1HXYD 3MP9A 5LNK1 3Q8AA 3ZJTA 1YN4A 2NMQA 2VZKD 1YN3A 3URYA 1GB1A 4N58A 1UWMA 1TS2A 1JALA 2WS3B 3EA6A 1CQVA 4GLSC 4C7ZA 1C4PA 3U7ZA 2WXPA 4TVWA 2JSVX 3Q8FA 2WU5B 5G5GA 1FXIA 2PVGC 4L23A 2IGHA 5AUIA 1L6UA 2QILA 4CQNA 1R7SA 1QOGA 3Q8CA 1F2RC 2ACZB 2PW9A 4JWSC 3AEAB 5HG2A 1WVFA 3A7UA 3W8ZA 3P4QB 4WAFA 1QT9A 2E5AA 4UDUC 1SSNA 2RDGA 1FXAA 3Q8BA 1N5WC 1TS3A 1T3QC 2MJDA 1MBBA 1ZXIC 1DIQA 1DGJA 1CZPA 1YNTE 2VFUA 1D5XC 1XLNA 3R2IA 2DYMA 5D3DA 1QF6A 2LHDA 3DQ0A 1D5MC 3AEGB 1DZNA 2QPMA 2Y3SA 1AHZA 2D5GA 2LMCA 2YEPF 2WXNA 3T3NA 1D4BA 2GQTA 4BC9A 1LO5D 3C8YA 2FE8A 1Q10A 3BK2A 5HI1A 2PMVA 1OQQA 1L0YB 3MJ5A 1I19A 2WDWA 2Z8LA 2GB1A 2QIEB 2INPE 4ZRQA 3T3OA 1E8FA 1W1KA 4XLOA 3HSUA 4HKQA 1AN8A 1TKEA 2BBCA 2IJ0A 2WXFA 2K9XA 4TQ1A 4A90A 2ONQA 2RMMA 4XWTA 3EUB3 4DQOC 2HDEA 2JU6X 1E0YA 2WXLA 4MACA 3ZQ4A 2ICIA 4C80A 1E0ZA 2M0AA 1B9RA 1F2RI 2N9LA 4XDCA 2KWDA 5C2TB 3TEWA 1KTKA 5FXEA 1ZDVA 1DIIA 3W1SA 2N0SB 4MH8A 1SB3B 2MEKA 2OAIA 1FRDA 3NRZA 2WXRA 4KGRA 1FNWA 4PVKA 1N5XA 2N9KA 4LLGM 1E7PB 4NAWB 5HFYA 1TKYA 1F0ZA 4NJCA 3ZJUA 2XNAC 3W8XA 1ROEA 2Y08A 3AE2B 2OHFA 1VZ6A 3NVVA 5G5HA 3TSSA 2PLSA 5ADZA 1W1MA 1DYQA 1JWMD 2JQRB 1W1SA 2DLBA 4ARIA 4KKIA 3AEEB 1QOFA 1TZOA 2M56B 1N60C 4KX6B 4N59A 1I4PA 4O95A 4OZCA 1L0XB 2VFTA 2IDYA 4HJGE 3HRDD 1V1OA 1SEBD 1MVKA 2JZPA 4B0EA 2JYTA 2KDMA 3R8BA 2VAOA 2H89B 1VJKA 5HMRA 1HZ5A 2JYEA 4JPSA 3S1CA 4YXDB 1P7EA 3SR6B 1KLUD 2LGIA 1QQRA 1QILA 1WYGA 4YSXB 1I4QA 2FUG1 3SR6A 4RGTA 1ET9A 2LFIA 3V3XA 2WXGA 5EE0A 3AE8B 4AS1A 1AWDA 2WXIA 2MJEA 1C4AA 4IDIA 2EXRA 2P13A 2WU2B 1FFUC 4TMAB 3D2HA 1K53A 3AEFB 1P7FA 2H88B 4JAYA 1PUTA 2GRIA 2VFRA 2K3UA 5BYSA 3DWMA 3SFDB 5JXVA 2W82A 3R2TA 4YSZB 1N63C 1M4VA 1GOZA 1MI0A 5AUKA 1IBXA 3FW7A 3GSYA 1JWUD 1E9MA 4GDKB 2WP9B 4C7YA 2R61A 3MFGA 4BBYA 3RPFC 2WXJA 2I2YA 2PKOA 2MH7A 2X38A 3E56A 2UUUA 3RFZB 1N61A 2DBYA 2L83A 5GXGB 3B9JA 4PYTA 3NRZB 3TEYA 5I4DA 1FRRA 2PVOD 4XDDA 1ZUD2 1RFKA 4RNAA 1AYFA 4RFBA 1IGCA 4RH6A 2R2ZA 3MHZA 5HHZA 5BYRA 2QKNA 1BUIC 1D5ZC 1VZ7A 3BZDB 4PZFA 3R07C 2BW2A 5EE1A 3RJ8A 1FNUA 3AEBB 3Q69A 3KJMA 1J7AA 3BVMA 1C78A 3GB1A 2XN9C 3UI3A 1XLQA 2V0GA 1IGDA 3N9YC 1W1LA 3FILB 2CU3A 1SIJA 1QLBB 2KN4A 3NVWA 5K8EA 1UUPA 3E9SA 3D2JA 2WQYB 2I38A 3W9CB 2G1EA 2I0KA 1I4GA 2LJIA 2VZKB 3ABVB 1PGAA 1ZE3D 4MT5A 1N62A 1JWAD 1JMLA 2HTME 1C9FA 1L4ZB 5HQXA 3P4RB 2GI9A 1SE2A 4HG0A 1YN5A 1EM7A 2WLBA 5D79A 4ZHOA 1GAQB 1JROA 5EE3A 1N63A 3NZ3A 3LXFA 4HROA 1DOXA 1E8GA 2Y5CA 4A55A 1F0XA 1VAOA 3GS2A 1UNSA 1V1PB 2YEPB 2QEJC 5BMHA 1PYWD 4RGOS 1WXQA 1E8HA 1JCKB 1VDVA 1SE3A 5FXDA 1NI3A 1V1PA 5D3IB 2ZW0A 3FAHA 2WDQB 4HKZE 3KWVA 4ZRPA 5H92C 1ZR6A 4YT0B 4PVHA 2AX5A 3NVVB 1WRIA 1E6EB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIQ A;  1TKG A;  3P4P B;  3ETR B;  1TYG B;  5MPO A;  3A7R A;  1AHU A;  1DOI A;  2BS3 B;  4UD8 A;  3AE9 B;  3AE7 B;  4DNS A;  1RM6 C;  4JX1 C;  1QLU A;  1A70 A;  3TSJ A;  3NVY B;  3B2G A;  1IUE A;  1PFD A;  3HUI A;  2W3S A;  3EUB 2;  4N6E B;  3AE4 B;  3JS8 A;  4YTN B;  1N60 A;  2PIA A;  1OFF A;  1W1Q A;  3SFE B;  2R8D A;  1DOY A;  1NEN B;  2E3T A;  1W1O A;  3PM9 A;  3P1M A;  3VRA B;  3A7A A;  3FC4 A;  1V8C A;  1FFV A;  1JWB D;  3AMZ A;  1XLO A;  3HVZ A;  1NYQ A;  3B2F A;  3L4P A;  1X2G A;  2K5P A;  3AM9 A;  1KF6 B;  1I7H A;  3VR9 B;  3TSH A;  3BW7 A;  3NVY A;  2AXR A;  5AE3 A;  3P63 A;  2PLI A;  1RWS A;  1XLP A;  1VLB A;  2BVH A;  2P4P A;  2KMM A;  4ZHP A;  1WVE A;  1SF0 A;  2BVG A;  1J7B A;  3S1D A;  1NYR A;  4ZOH C;  1VQZ A;  2RK5 A;  4ML8 A;  4MLA A;  1L0V B;  1PDX A;  4YSY B;  1QLT A;  1XO3 A;  1AHV A;  1ZP0 B;  2MJ3 A;  3W5V B;  4EC3 A;  3W8W A;  3HRD C;  1RYJ A;  4US8 A;  3NVW B;  3AV8 A;  1KFY B;  3DED A;  1YJI A;  2W55 A;  3P4S B;  4YTP B;  1TJE A;  2JX5 A;  5AE2 A;  3FW8 A;  1JRP A;  1RM6 B;  3AEC B;  4A9A A;  2NQW A;  3ZYY X;  2O3G A;  2Q85 A;  4TVY A;  2FBW B;  2Q4W A;  2K22 A;  3S1E A;  2YVS A;  4ZOH B;  1OQR A;  1ZOY B;  5EE9 A;  3I99 A;  2Q5W D;  1WGK A;  2B76 B;  3NVZ B;  3AN1 A;  4HRS A;  2W54 A;  1EWY C;  1UXY A;  1FIQ B;  3ETR A;  1FM0 D;  2L52 A;  3AED B;  3NVZ A;  1FFU A;  1QOA A;  4LTU A;  2WDV B;  2CJO A;  5FXP A;  3NS1 A;  1N62 C;  5C3J B;  1L6V A;  3AE1 B;  1FMA D;  2EKI A;  3D2D A;  3VR8 B;  1E10 A;  3CWI A;  4US9 A;  2WDR B;  4BC7 A;  3VRB B;  1MBT A;  1W1R A;  1W1J A;  4PWC A;  3CIR B;  1JW9 D;  2BS2 B;  2MBR A;  4PWB A;  1N5W A;  2KAJ A;  3LLB A;  4JWU C;  3BII D;  3LAE A;  3FWA A;  4BCA A;  1SB3 C;  1YJJ A;  2DWQ A;  1NVI D;  1QOB A;  2VFS A;  5AE1 A;  5FXF A;  3VTE A;  3NS1 B;  2CJN A;  4WQM A;  1N61 C;  4FXC A;  3AE5 B;  4JB1 A;  3FW9 A;  1HSK A;  2BS4 B;  4YTM B;  3S1F A;  3DWG C;  1JQ4 A;  1NEK B;  4PVJ A;  3KWL A;  1WWT A;  2VFV A;  2BVF A;  1YQ3 B;  1YQ4 B;  2M19 A;  2W3R A;  3AE3 B;  1L5P A;  1X2H A;  5G5H B;  1FO4 A;  1J7C A;  4OAL A;  4PVE A;  1V97 A;  2QJL A;  3PO0 A;  2GQU A;  5G5G B;  1FFV C;  3AE6 B;  1ZXI A;  1T3Q A;  1GPX A;  2LEK A;  2P3H A;  3LB8 C;  3AB5 A;  3W5U B;  5H8Y E;  3AH7 A;  3C0P A;  2BT6 A;  4USA A;  1KRH A;  4P6V F;  3WCQ A;  3TX1 A;  4WWM A;  1CJE A;  3B9J B;  4ITK A;  4N58 A;  1UWM A;  1JAL A;  2WS3 B;  4C7Z A;  4TVW A;  2WU5 B;  5G5G A;  1FXI A;  2PVG C;  5AUI A;  1L6U A;  1R7S A;  1QOG A;  2ACZ B;  4JWS C;  3AEA B;  1WVF A;  3A7U A;  3W8Z A;  3P4Q B;  1QT9 A;  2E5A A;  1FXA A;  1N5W C;  1T3Q C;  2MJD A;  1MBB A;  1ZXI C;  1DIQ A;  1DGJ A;  1CZP A;  2VFU A;  1XLN A;  1QF6 A;  3DQ0 A;  3AEG B;  1DZN A;  2QPM A;  1AHZ A;  2GQT A;  4BC9 A;  1OQQ A;  1I19 A;  2QIE B;  1E8F A;  1W1K A;  4XLO A;  1TKE A;  3EUB 3;  2K9X A;  1E0Y A;  4C80 A;  1E0Z A;  1B9R A;  5C2T B;  5FXE A;  1DII A;  2N0S B;  1SB3 B;  2OAI A;  1FRD A;  3NRZ A;  4PVK A;  1N5X A;  1E7P B;  1TKY A;  1F0Z A;  3W8X A;  1ROE A;  3AE2 B;  2OHF A;  3NVV A;  5G5H A;  2PLS A;  5ADZ A;  1W1M A;  2JQR B;  1W1S A;  3AEE B;  1QOF A;  2M56 B;  1N60 C;  4KX6 B;  4N59 A;  4O95 A;  2VFT A;  3HRD D;  2VAO A;  2H89 B;  1VJK A;  5HMR A;  3S1C A;  4YXD B;  3SR6 B;  1WYG A;  4YSX B;  3SR6 A;  5EE0 A;  3AE8 B;  1AWD A;  2MJE A;  4IDI A;  2EXR A;  2P13 A;  2WU2 B;  1FFU C;  3D2H A;  3AEF B;  2H88 B;  4JAY A;  1PUT A;  2VFR A;  3DWM A;  3SFD B;  4YSZ B;  1N63 C;  3FW7 A;  5AUK A;  3GSY A;  1E9M A;  2WP9 B;  4C7Y A;  4BBY A;  3RPF C;  2PKO A;  2MH7 A;  1N61 A;  2DBY A;  2L83 A;  5GXG B;  3B9J A;  4PYT A;  3NRZ B;  1FRR A;  2PVO D;  1ZUD 2;  1RFK A;  1AYF A;  2R2Z A;  5HHZ A;  2QKN A;  3R07 C;  4PZF A;  5EE1 A;  3AEB B;  3KJM A;  1J7A A;  1XLQ A;  1W1L A;  2CU3 A;  1SIJ A;  1QLB B;  3NVW A;  3D2J A;  2WQY B;  3W9C B;  2G1E A;  2I0K A;  3ABV B;  1N62 A;  1JWA D;  2HTM E;  5HQX A;  3P4R B;  4HG0 A;  5D79 A;  2WLB A;  4ZHO A;  1GAQ B;  1JRO A;  5EE3 A;  1N63 A;  3LXF A;  4HRO A;  1DOX A;  1E8G A;  2Y5C A;  1F0X A;  1VAO A;  1WXQ A;  1E8H A;  1VDV A;  5FXD A;  1NI3 A;  5H92 C;  3FAH A;  2WDQ B;  1ZR6 A;  4YT0 B;  4PVH A;  2AX5 A;  3NVV B;  1WRI A;  1E6E B; 
#chains in the Genus database with same CATH topology
 1TKG A;  4F72 A;  3ETR B;  2JZB A;  4Y2Y A;  2YML A;  1DOI A;  1I35 A;  2BS3 B;  2OX4 A;  4XWW A;  3BZC A;  4TKN A;  9ICM A;  1LVH A;  1SL1 A;  1P43 A;  3RYT A;  5J2H A;  2ZJ8 A;  4O1N A;  1RM6 C;  4F7Z A;  4DNS A;  2JHD A;  2WAQ F;  1YJ1 A;  2KDE B;  3TL5 A;  4FLH A;  2MHJ A;  2L3Z A;  1NDA A;  3LJ3 A;  2VRR B;  3EAN A;  1ZQO A;  4KLM A;  4I29 A;  2WOW A;  1PFD A;  5FJO A;  3GIK A;  5ALZ A;  2ZW1 A;  2H3Q A;  2YX8 A;  1ZQK A;  4A8X C;  4N6E B;  1V5T A;  2YQU A;  4YQW A;  5CRX A;  4C8K A;  4YTN B;  1N60 A;  3PHX B;  3MY9 A;  2JUO A;  1S8O A;  2OWO A;  2ZIV A;  1GNU A;  4PL2 A;  4XRH A;  4FBT A;  1STE A;  1DOY A;  3VCB A;  2HHW A;  2NYV A;  3NZU A;  2XO7 A;  1UZX B;  2VJ4 A;  4CE6 A;  1W1O A;  3PM9 A;  3DES A;  4IRD A;  3GD6 A;  4ECR A;  4EQW A;  3A7A A;  2KO3 A;  1Y88 A;  1ECQ A;  1L4D B;  2N1W A;  3LWM A;  2EAM A;  3AMZ A;  1NJW A;  2WB1 C;  1ET6 A;  5IKC M;  1PGX A;  3PFR A;  3DGZ A;  4J9L A;  5JCK A;  3RJI A;  4YXM A;  2HHX A;  2JZ3 B;  4NQK E;  2C9W B;  5J0W A;  2QSD A;  4WWN A;  1ZPS A;  5BYQ A;  2CHR A;  5ALN A;  2UVW A;  5KG0 A;  4PYZ A;  4IHC A;  2WDT B;  2BB6 A;  3T8M A;  1D7Y A;  1RYS A;  4M2Y A;  2P6R A;  2KTF A;  2V1Y A;  4FHK A;  4AWJ A;  4PGX A;  1T8E A;  1RZT A;  2WPF A;  2GH1 A;  2H3Z A;  1KF6 B;  2W0H A;  3BW7 A;  1T0R C;  2XH0 A;  1RQN A;  3H0R B;  5AI0 A;  1SKS A;  3PS6 A;  2ESE A;  5AM5 A;  5DPR A;  1XLP A;  1J2N A;  1VLB A;  1FPY A;  1ZQG A;  1CK1 A;  2XBB C;  2GGH A;  5L6F A;  3RCZ A;  1WVE A;  9ICK A;  3HW8 A;  4MJS A;  3RF9 A;  8ICO A;  1JIH A;  3TAN A;  4JHM A;  1L3V A;  1Z1V A;  4YVZ A;  3Q45 A;  3BYT B;  4XGA B;  3UJE A;  3VUW A;  5L1I A;  4ML8 A;  5AKK A;  4ECU A;  4I2C A;  2XY7 A;  4BVU C;  3CT2 A;  3MSY A;  4YSY B;  8ICJ A;  1MRA A;  4GIS A;  3P42 A;  1JX4 A;  3BOX A;  2MP2 A;  1TFR A;  2NPT A;  1ZP0 B;  5AM3 A;  2MJ3 A;  1SJD A;  3SEN A;  3RBD A;  3W5V B;  3RAX A;  2EEL A;  1MO9 A;  1A76 A;  3W8W A;  3G6Y A;  1RYJ A;  3MHS D;  4FBJ B;  4EZL A;  4KLL A;  3HRD C;  3JSV B;  3NVW B;  3BQ0 A;  4NY8 A;  4MM3 A;  5ALG A;  1MHH E;  4HPP A;  2FLN A;  2ZG6 A;  1T4G A;  3UJ2 A;  3DED A;  7ICG A;  3MC0 B;  1UQV A;  3IXS A;  4YTP B;  2WGS A;  4EZJ A;  2JEG A;  4TUR A;  2SEB D;  2X8H A;  7ICH A;  4MF8 A;  2RDH A;  4C8O A;  1BT0 A;  2C2E A;  3PG6 A;  1EBH A;  2KVC A;  2KV2 A;  4XUS A;  2HJ1 A;  2QMT A;  4C56 C;  1RM6 B;  4C8N A;  4ECS A;  1WJN A;  3AL0 B;  9ICX A;  1RRB A;  4EEW A;  4GME A;  4DF8 A;  9ICV A;  3PK7 A;  1ACC A;  1GG3 A;  4RPY A;  2F1J A;  2MSN A;  4KSK C;  3VA8 A;  2YVS A;  1OQR A;  4FDC B;  4TUU A;  4FS1 A;  1NHR A;  2N4F A;  4K1W A;  4RQ4 A;  2P6U A;  2YVC A;  2B76 B;  5KAI U;  2INC C;  1OJT A;  5III A;  3WAO A;  4J9Q A;  4PS7 A;  2LVO A;  1Q0W B;  5IIK A;  1PVQ A;  1KCZ A;  4O3M A;  2ZUB A;  2J42 A;  2KC2 A;  1FFU A;  1TE2 A;  1ZQZ A;  4RPZ A;  2R8I A;  2R8K A;  5AKY A;  1XEE A;  3Q3J A;  1AOG A;  2P66 A;  1TIF A;  4F2R A;  1YIW A;  4MSQ B;  2KHQ A;  3CB3 A;  3SAH A;  1HUO A;  5IDZ A;  2OJW A;  3VDG A;  2WF5 A;  2D3G A;  3WK7 A;  3WAP A;  3AE1 B;  4GB9 A;  5ALD A;  4P0P B;  3H8H A;  3HPO A;  1FMA D;  2MRP A;  3MC9 A;  4ZYN A;  3V7K A;  4K1R B;  2HNE A;  3Q8E A;  2ZTC A;  2BCS A;  1Z19 A;  8ICM A;  4OJP A;  1TT5 B;  4HDO A;  1JPM A;  3IAM 1;  4H83 A;  4EQR A;  1RQL A;  1C79 A;  4GLX A;  4OHJ A;  4ZRI A;  4PZO A;  1T7P A;  2KMD A;  1CUK A;  1ZDX A;  7ICT A;  4HCN B;  4FFD A;  4NJ7 A;  1R4M B;  5D49 A;  2D3C A;  1L3S A;  5CEH A;  2KFK B;  1S3S G;  3DVG Y;  4WJP A;  3N4E A;  2KQ4 X;  5GTH U;  3QX1 A;  5J2J A;  3TAC B;  1W1J A;  3PZ8 A;  4ED8 A;  5J8Y C;  3T6C A;  3KHL A;  4F71 A;  4RQ7 A;  2KFK A;  4M6W B;  4KGS A;  2JGA A;  4KVG B;  2MBR A;  2WXO A;  3QUQ A;  3RNM A;  4IL0 A;  1P3Q U;  1WXS A;  2Y5P A;  1XO0 A;  3VH3 B;  4JL9 A;  3FYY A;  3BVG A;  3TJ4 A;  4F1S A;  1T3N A;  3QU4 A;  5KFM A;  2DYB A;  3Q2A C;  1QOB A;  4WUR A;  5D94 A;  2CPR A;  5J8Y A;  1FNV A;  3VTE A;  3NS1 B;  3C5F A;  4NM1 A;  2KAC A;  2XIC A;  1SJE D;  4WQM A;  2V4I B;  1EU3 A;  3TCA A;  2GQW A;  4FXC A;  3RNG C;  4P2H A;  3MFH A;  3SDL C;  4O5E A;  4O9M A;  3NHE B;  3LXD A;  2LJ5 A;  4YR3 A;  5JRT A;  5J0X A;  4ZYS A;  4JB1 A;  4JWN A;  3H4K A;  4KGT A;  1ZQW A;  1OEP A;  3MQT A;  4K4G A;  4AOF A;  1ZQU A;  1C76 A;  1WGH A;  1F1H A;  2M8S A;  4WJQ A;  1DNC A;  3FJ4 A;  1NHP A;  1Q1W A;  3DK8 A;  1NEK B;  3RNB C;  3PWI A;  3VC8 A;  1TK5 A;  1GUA B;  3FXG A;  3TFR A;  1YD8 U;  2PSN A;  1XSL A;  2K8A A;  4TV3 A;  3QLD A;  3T5J A;  5G5H B;  4NEW A;  4P1B C;  2ZCB A;  3OTQ A;  2AKZ A;  3SSZ A;  8ICT A;  2ZTD A;  5TSS A;  5KFT A;  3I63 C;  2K8C A;  2MX2 A;  2LPE A;  5AKH A;  4OAL A;  4ZH4 A;  5BPC A;  2QJL A;  1EF5 A;  3R0K A;  1MFW A;  3R25 A;  4YD2 A;  2XGP A;  1FEH A;  5E6J A;  1ZKQ A;  2AL1 A;  1XF5 L;  1Z5S B;  5G5G B;  3BIN A;  3BVZ A;  5IA7 A;  2L32 A;  5L6G A;  2DF4 B;  3O0H A;  4ED3 A;  5HR6 A;  1ZXI A;  1P98 A;  2GGE A;  3WU2 U;  1KFT A;  2RAB A;  2KJ8 A;  2WBA A;  3AU5 A;  5F9L A;  1M94 A;  5IP4 D;  1C3T A;  2GLE A;  3AH7 A;  2JV3 A;  2EZY A;  2ZC8 A;  2KTR A;  2BT6 A;  3ZRC A;  2GR1 A;  3QHT A;  2PP3 A;  1U48 A;  3AQE A;  3DHI C;  3KUD B;  5KFO A;  4KX3 A;  4PS8 A;  3TX1 A;  1EC9 A;  1L8P A;  2D2Q A;  2GH5 A;  4H4W A;  3ZLF A;  5FS6 A;  3DGH A;  4M01 A;  5DBB A;  5J2C A;  4IC7 B;  1I4R A;  1ZX9 A;  2MUT A;  3EF6 A;  2E1F A;  4IOI E;  4NJ6 A;  1TYT A;  4EX6 A;  4MF2 A;  1HXY D;  1FHV A;  2FCN A;  2ASL A;  2C3C A;  2VZK D;  2CN1 A;  2OM6 A;  7ICP A;  3URY A;  4YCX A;  4N58 A;  2HW3 A;  1GB1 A;  4KLH A;  1JAL A;  3OGU A;  2N1R A;  2M0N A;  3RIT A;  5ALM A;  5KFN A;  1KFS A;  4O3O A;  4KDI C;  3H7S A;  3PO4 A;  1IP9 A;  1SV4 A;  3OTR A;  2RDJ A;  3T5L A;  2BZF A;  2ZEQ A;  9ICF A;  1Z3E B;  2V9W A;  2K1F A;  2IA6 A;  4CQN A;  2K25 A;  3GV7 B;  1R7S A;  5FJP A;  1TTN A;  4I27 A;  4U7C A;  9ICQ A;  4JWS C;  4PHA A;  1HUZ A;  5AK6 A;  3W8Z A;  2FCS A;  2KKV A;  4E8G A;  2FMP A;  3U30 A;  3TAD A;  4UDU C;  2M17 A;  2GBN A;  2NR2 A;  2QJJ A;  3GRS A;  1TS3 A;  2MJD A;  3PX6 A;  2RPQ A;  1MBB A;  2P88 A;  4OVU A;  2YQE A;  3RT3 B;  4EX7 A;  2CHW A;  2BCR A;  4PHP A;  4LNO A;  3R2I A;  2F5Z A;  3UJS A;  1K5O A;  1TZZ A;  2KNJ A;  4WJ3 B;  5CHV C;  1NBF C;  4Y2P A;  1DZN A;  2Y3S A;  3NRW A;  2C7H A;  1IYF A;  2GQT A;  1LO5 D;  1KTQ A;  2KK0 A;  4GYP A;  1QLN A;  3C8Y A;  4GYP C;  1H8C A;  1GRH A;  2PI5 A;  2FID A;  3MJ5 A;  3C2L A;  3BJY A;  3O0F A;  5KFV A;  2GB1 A;  2DNF A;  4JLC A;  3EEZ A;  3P2B A;  1ZK7 A;  2AQ0 A;  2K89 A;  4KEM A;  2HHS A;  4Q8F A;  2WXL A;  3KH0 A;  2W9C A;  1T0S C;  3MWC A;  4HAI A;  3N1Y C;  3CYJ A;  5C0Y A;  1S0N A;  3LAE A;  2LM4 A;  1GV4 A;  4IZG A;  1ZQC A;  2N0S B;  1WRD B;  2MEK A;  4EQS A;  1FRD A;  2BHN A;  4E3C A;  5L1J A;  1FNW A;  2KZ3 A;  2N9K A;  2W9C B;  1E7P B;  4LJO B;  4M0A A;  2AJQ A;  4XX5 A;  4DXK A;  4I2D A;  3A33 B;  1IXR A;  3UPQ A;  4M47 A;  4HPN A;  5KNI A;  1LV5 A;  3JW7 A;  3CF6 E;  5J0Q A;  3TSS A;  2F3N A;  5IIO A;  4J9N A;  4NPN A;  2JQR B;  2EQ9 A;  4BJQ A;  5J0S A;  1YQZ A;  2A4Z A;  2VIX A;  1DXS A;  1TZO A;  2M56 B;  4F91 B;  5CHG A;  1L0X B;  3ZLZ A;  2AU0 A;  2BDP A;  3V60 A;  4EUT A;  2L00 B;  5AZF A;  1V1O A;  3BJS A;  2QQ6 A;  2W43 A;  3KHR A;  8ICU A;  3FG2 P;  1E8Z A;  3RZW C;  3LWL A;  1NK9 A;  5DDY A;  4KSL C;  3WKA A;  2HOQ A;  2HHT A;  2HXT A;  2Q0Z X;  2G06 A;  4HXD A;  4YXD B;  2PGW A;  4RQM A;  4RQ0 A;  4M02 A;  1QIL A;  2MCN B;  3V6H A;  4UB1 A;  5B5E U;  1F44 A;  3SR6 A;  3F53 A;  4LNI A;  3V72 A;  3PW0 A;  1ZYQ A;  2KMC A;  1ET9 A;  2LFI A;  5D6J B;  3CAW A;  2WXG A;  2G08 A;  4DDG D;  2GR3 A;  2NQL A;  4CF4 A;  1TBE A;  1U47 A;  3D32 A;  3Q3M C;  4A6G A;  4Z6F A;  3QIJ A;  4WWO A;  1DXL A;  1KD0 A;  2KOB A;  5TZV A;  4IDI A;  2EXR A;  1EC8 A;  4RQ5 A;  4NWI A;  1SWW A;  1TVA A;  3WAM A;  4TMA B;  3V3W A;  3AEF B;  3RNC C;  2WOI A;  3AUO A;  4Q8E A;  4HWI B;  2VFR A;  3NS8 A;  2K6Q A;  5BYS A;  5JXV A;  4QIW C;  1FHU A;  2BC0 A;  2NRT A;  4NEV A;  1OTR B;  4YSZ B;  3IN5 A;  3V7J A;  4WQO B;  1GOZ A;  1MI0 A;  1LKY B;  4HCP B;  4MGG A;  3NY5 A;  2W9B B;  3GSY A;  3IG3 A;  4P7I A;  4JIO U;  2WP9 B;  4C7Y A;  5G2N A;  2KG5 A;  3MFG A;  2OZ8 A;  4GC7 A;  2NVU I;  4BBY A;  4EEK A;  4GRT A;  1EO6 A;  2KX3 A;  2X38 A;  2YVF A;  2MP2 B;  3RR7 A;  3K4G A;  5GXG B;  2L83 A;  2K8C B;  1L3U A;  1Y8R C;  2FMS A;  2X99 A;  5I4D A;  1FRR A;  1ZUD 2;  1MDL A;  3ZXR A;  1Q46 A;  1AYF A;  2IO0 B;  1X9S A;  2GR0 A;  1NKE A;  1KN5 A;  3MR5 A;  3NUQ A;  2QKN A;  3WKD A;  5J2I A;  5EE1 A;  2QVH A;  4LA1 A;  3GQC A;  2IOF K;  2PI4 A;  2ZIX A;  3F2B A;  8ICX A;  2WX1 A;  3M8S A;  2ZCC A;  3AEB B;  4YMN A;  3Q69 A;  5KG7 A;  4KIK B;  3KJM A;  4C00 A;  1Q1R A;  5BOL A;  3QEA Z;  1MQ3 A;  1JRU A;  4M04 A;  1OEY J;  5J2A A;  2XN9 C;  3BVM A;  3UI3 A;  4M9L A;  2V0G A;  3T9L A;  4I6P A;  4B9S A;  8ICI A;  4DEZ A;  3SAG A;  3MR6 A;  4Y2U A;  1WR6 E;  4IC9 A;  4KN4 A;  4YR0 A;  1PDZ A;  2DW6 A;  1R6W A;  5KL1 B;  4BUR A;  4H4U A;  1UUP A;  3D2J A;  2KMA A;  4IG7 B;  3ISC A;  2KFZ A;  1BQG A;  1QCK A;  2G5H B;  2G1E A;  2I0K A;  3A9J A;  2PU1 A;  2BYV E;  2X8C A;  3KZI U;  4ECV A;  4JB3 A;  2HCF A;  4ELT A;  5IIJ A;  5J2G A;  1L4Z B;  4ICV A;  5HQX A;  3P4R B;  2F44 A;  2R8H A;  1SE2 A;  1MA7 A;  2KNB A;  2BPG A;  1EM7 A;  3A4S C;  3PLV A;  4ZHO A;  1X9W A;  1JRO A;  3PX4 A;  3ZTD A;  2MBB B;  3WKC A;  2OCE A;  7ICR A;  1DOX A;  4ZDV A;  1F0X A;  2MQJ A;  1V1P B;  4FUL A;  2I1J A;  2FKP A;  3WK6 A;  4ENL A;  3PVX A;  5FXD A;  3CW2 C;  2Y1I A;  5D3I B;  2NO4 A;  4YL8 A;  3TAD C;  4I6N B;  4B9M A;  4KZ0 A;  2AX5 A;  3SN4 A;  3V7L A;  1FIQ A;  1EC7 A;  5MPO A;  1AHU A;  3HJE A;  3OPX A;  4PL1 A;  3UQ0 A;  5DQG A;  1XD3 B;  1XU4 A;  2CRX A;  2HD5 B;  2Y4G A;  1R4N I;  3EW9 A;  3RTV A;  2HHQ A;  1COO A;  4F4Z A;  4QWB A;  3KZX A;  2EH9 A;  1A70 A;  2KSO A;  2L76 A;  4P4O A;  3GE8 C;  3MJW A;  3ZNH B;  3D2N A;  1GRA A;  3B2G A;  1D6E C;  1QSY A;  1IUE A;  1TS5 A;  2DUY A;  3PV1 A;  3HUI A;  2W3S A;  4CYE A;  3L5O A;  4MHV A;  3UGV A;  4C4T A;  1EU4 A;  4RMA A;  4KLO A;  1ONF A;  2KIC A;  1XCT L;  2JK6 A;  2QAE A;  3AE4 B;  2ONE A;  2AXT U;  3N32 A;  4HCL A;  3KQ4 A;  2NRZ A;  1L2N A;  2RHF A;  2OFJ A;  1S9F A;  2XID A;  3RJE A;  3HPF A;  4FA6 A;  2HOI A;  2MU2 A;  5KFR A;  2E3T A;  1C4C A;  1WIA A;  1WSP A;  2LKY A;  3THU A;  1QKZ A;  3P1M A;  3VRA B;  1Z00 B;  3ED5 A;  4QZA A;  1JWB D;  4MGI E;  4ED7 A;  3SD7 A;  3RJK A;  8ICW A;  1SV0 C;  1ONE A;  5I1V A;  2HBK A;  2JXX A;  4MEL A;  1V86 A;  1T5X D;  5J0R A;  3RR8 A;  5CHF A;  2QB0 A;  1NYQ A;  1OGW A;  1WF9 A;  5AI5 A;  1YQB A;  4II2 B;  3IHP C;  2P0I A;  1R4N B;  2IGD A;  2W8L A;  4J3Z A;  2EZX A;  4ZRJ A;  4LJX A;  3C2M A;  3LK9 A;  3NG0 A;  3OHA A;  2ON8 A;  3ZDC A;  4TUP A;  1E8Y A;  4W9L A;  3U2S C;  5LXI B;  3H8A A;  3IJQ A;  1L7P A;  3NVY A;  3CSF A;  3FM9 A;  3J9C A;  4K7Z A;  5J0T A;  4EM3 A;  1BXT A;  1RWS A;  3CST A;  4JN7 A;  2RDI A;  4FZL A;  2BVH A;  1WWV A;  1UPH A;  1VJ5 A;  4JV0 A;  1Q3U A;  2K39 A;  2LUE A;  4Q2J A;  3DK4 A;  3TKA A;  3TFS A;  4DSK A;  3V6K A;  1SBB B;  2POZ A;  1PQS A;  4WIP A;  2O6K A;  2EQY A;  2BQQ A;  3S1D A;  5CP2 A;  3VVW B;  1NYR A;  3DCG A;  3VUX A;  5C1Z A;  4EYI B;  2V3P A;  4LCD E;  3OG5 A;  3PST A;  2DHZ A;  4IRC A;  4G7F A;  1K50 A;  4GR1 A;  3PW2 A;  4QJF B;  3M1Y A;  2E8N A;  3M8R A;  4KLD A;  5KFJ A;  2ASD A;  4PT5 A;  5I1W A;  3ZD9 A;  4G3I A;  4K2S A;  1L0V B;  5KVH A;  1XS9 D;  2QLT A;  1PGB A;  2KWV B;  4JGH B;  1PDY A;  1AW7 A;  2PE6 B;  5K4L A;  3GZF A;  9ICU A;  2F8K A;  3I5J C;  4LDT B;  2PTX A;  1TY0 A;  1S0M A;  4H4V A;  1LPF A;  3N3K B;  2A8X A;  2MBE A;  2BQR A;  3LYY A;  4YWG G;  1R0M A;  1ZDL A;  2W55 A;  4TQR A;  5CTR C;  1BZL A;  1PVP A;  9ICI A;  2FCM A;  2LVP A;  3P4S B;  3U52 E;  3LYS A;  2KKC A;  1U4A A;  4P0P A;  1U49 A;  4DOA A;  3QKE A;  1BPB A;  1TJE A;  2JX5 A;  3IT6 B;  1BNP A;  2ZVN A;  1WR1 A;  4NNJ B;  5AE2 A;  1JRP A;  1UWX A;  4OVZ A;  5J0O A;  4F8C B;  2PTY A;  4DOB A;  2NQW A;  3RB4 A;  2ASJ A;  3CK5 A;  1HA5 A;  4TVY A;  2FBW B;  5BMI A;  2Q4W A;  1FCL A;  3APF A;  2KKP A;  5EE9 A;  4F5Q A;  8ICG A;  3DOW A;  4TSS A;  3I99 A;  2J3N A;  2HBM A;  4OCZ A;  1ZQN A;  7ICQ A;  1KOT A;  1OW5 A;  5ALJ A;  4IW0 A;  4DFJ A;  4IKG A;  1C77 A;  1YZ7 A;  4DQS A;  2J6T A;  3PR4 A;  1WGD A;  2FIF A;  5J2E A;  5AKX A;  3V6C B;  5IN7 A;  8ICF A;  3Q8S B;  2P35 A;  1FM0 D;  4ED1 A;  4A8E A;  1WE6 A;  1QQ6 A;  2BF8 B;  1L5U A;  2N1V A;  3KYD D;  1ZQP A;  1I4X A;  3UF8 A;  1QOA A;  3PVL A;  2K8B A;  1ZQ1 C;  3SAF A;  2XCA A;  4Q43 A;  2KDF B;  1MPE A;  2NTS A;  3Q8P B;  2AQ3 B;  3FCP A;  5J17 A;  2ATL A;  3SZ2 A;  2N7J A;  2C22 A;  4U6P A;  1U45 A;  5FR6 A;  1L6V A;  1B0X A;  3BQ7 A;  4RGM A;  4B9T A;  3NXL A;  1URJ A;  2V4L A;  2EKI A;  2K4P A;  1NK4 A;  2JRI B;  3VR8 B;  1KH0 A;  4BWM A;  2PU0 A;  3ZVH A;  3PLU A;  4DQP A;  4EZ9 A;  3UCC A;  4QZB A;  3G6V A;  2N9P C;  3PRP B;  1MBT A;  3GZN I;  3V62 A;  1W1R A;  2EMT A;  3PQB A;  2RP5 A;  5LLI A;  3OJS A;  5AK5 A;  3RJA A;  4Y2V A;  3HM3 A;  2PPH A;  3QAR A;  3C1Z A;  2ZUC A;  4UAZ A;  5LXH A;  3QCA A;  2ZAD A;  3OHB A;  2KAJ A;  5L1K A;  3A1Q B;  3UXK A;  2L5Y A;  4H2A A;  2A19 A;  2MBO A;  1XC9 A;  3BII D;  2KWU B;  2MWS B;  2OVL A;  4MEY A;  4P16 A;  4QZ8 A;  3F2D A;  3RJH A;  4BCA A;  1RXV A;  4EBD A;  3KUC B;  2DWQ A;  2ZVO A;  4WWP A;  5FXF A;  2CS4 A;  5KG2 A;  1NJX A;  2GSH A;  2PE9 A;  3EGR A;  1N61 C;  4I6L B;  2KFJ A;  3R66 C;  4FI4 A;  3AE5 B;  2NBV B;  1F9J A;  1YMH E;  3N1Z C;  2AQ2 B;  3VC5 A;  2HBL A;  1SZH A;  3N28 A;  1ZQE A;  3KKA A;  3S1F A;  4J3O D;  1JQ4 A;  2WF7 A;  3E0F A;  2VFV A;  4F4Y A;  3G6X A;  4ZCW A;  2DAJ A;  1K8R B;  3EHV A;  1YQ4 B;  4Y2S A;  2HDO A;  2M19 A;  1X2H A;  4EQX A;  1UGJ A;  1FO4 A;  3SN1 A;  4JWM A;  3IM1 A;  2DZK A;  1ELS A;  2WX0 A;  5DGA A;  5L83 A;  5JH5 C;  3ALB A;  4L1B A;  4Z6E A;  4UAY A;  1BML C;  4H50 A;  5FKA C;  1NZP A;  5CX3 A;  5AWV A;  2J6S A;  4PVE A;  9ICH A;  5FK9 C;  4B9N A;  2JZB B;  2Y3R A;  4M0W B;  4FAD A;  2HHV A;  2QDD A;  1K51 A;  2HJ8 A;  3FIL A;  3BK1 A;  2UVR A;  2YN4 A;  7ICS A;  2D3A A;  3IJI A;  2BPC A;  1BPD A;  5FR3 A;  3AU6 A;  2GOL A;  3TAQ A;  4HYK A;  1NU5 A;  1Q1O A;  4IQU A;  5BOM A;  4DFM A;  4F8R A;  2GDQ A;  1GPX A;  3PX0 A;  1S76 D;  3R7R A;  5KTQ A;  2UU7 A;  3QUC A;  2PP1 A;  2IPI A;  5H8Y E;  4NY0 A;  4YMO A;  2AYO B;  3RD2 A;  4MMW A;  4YR2 A;  9ICE A;  3UMG A;  1PK1 B;  4OZA A;  4P6V F;  3DK9 A;  2PLP A;  3PZD A;  4AJY B;  3T3F A;  4F4X A;  4BX9 C;  4DXG A;  4H4Z A;  2CR5 A;  4ED2 A;  5AI4 A;  1UH6 A;  3PNC A;  3B97 A;  2DX5 B;  2KAN A;  4ITK A;  3LVV A;  4IM3 A;  1ZMC A;  1M6Y A;  5CHW A;  1NK8 A;  3T4W A;  4DQI A;  2BKE A;  4M9G A;  3M62 B;  3MP9 A;  1YN3 A;  1JCT A;  1MN8 A;  1YT3 A;  4GLS C;  1C4P A;  2M1M A;  3U7Z A;  4TVW A;  2W9M A;  1B4F A;  1ED1 A;  3Q8F A;  3N30 A;  2K6D B;  2WU5 B;  4MGK E;  4LII A;  2PVG C;  4BGD A;  4L23 A;  4J9R A;  1ZW7 A;  5AUI A;  2QIL A;  4KLU A;  3RNE C;  1DK2 A;  2JEF A;  3GZN B;  1X9X A;  3Q8C A;  5IOI A;  5TIS U;  1F2R C;  5DG7 A;  9ICC A;  3DIP A;  4PHD A;  4KIT B;  1UEL A;  2WF8 A;  2F1H A;  2KJ5 A;  5CB1 A;  5J2D A;  5J2B A;  3PO5 A;  2FI1 A;  4QZE A;  3P4Q B;  2B3A A;  3CGB A;  4KZC A;  1QT9 A;  1K4Q A;  4GDL A;  1SSN A;  2H3I A;  1FXA A;  2F8L A;  5KAF U;  4LNK A;  1HE8 A;  1ZXI C;  2XEW A;  3RNA C;  1CZP A;  2WB1 F;  3HK0 A;  2W03 A;  3UIN B;  4AP4 C;  1XLN A;  3DV9 A;  1QF6 A;  1TV9 A;  4FZM A;  2LHD A;  3DQ0 A;  1D5M C;  3AEG B;  4MFF A;  5HR7 A;  1XSP A;  1AHZ A;  5HHI A;  2KVR A;  1F52 A;  2W7P A;  1JPD X;  3JW0 X;  2VH2 A;  3T3N A;  2YMM A;  3VCC A;  3TJP A;  2XY6 A;  1SGG A;  5HI1 A;  2IHM A;  3SQP A;  3GD3 A;  1BNO A;  1I19 A;  5D4B A;  5FMH A;  2QIE B;  3R1Z A;  1E8F A;  1SL2 A;  3GV5 B;  2CU1 A;  2DPJ A;  4XLO A;  2WXF A;  4DK5 A;  3EUB 3;  4LZD A;  2RMM A;  4FX9 A;  2L7R A;  1L8L A;  3AU2 A;  3I28 A;  8ICE A;  4MAC A;  2KHV A;  2GMI C;  3DG3 A;  2ICI A;  4WJN A;  3RB0 A;  1P1A A;  1L7N A;  4I2I A;  3PV8 A;  1TAU A;  4R63 A;  1F2R I;  1YX5 B;  2KWD A;  2N9L A;  1B9R A;  3ZXV A;  1ZDV A;  1DII A;  3W1S A;  4MH8 A;  2G45 B;  4RNN A;  3SQI A;  4EZK A;  1TYP A;  2ZZ0 A;  4PGY A;  2YTU A;  2OAI A;  2WXR A;  3R7Q A;  4RNO A;  5ALY A;  1N5X A;  2FMQ A;  4LLG M;  1OQY A;  3KW5 B;  2BYF A;  3F5A A;  3ZJU A;  3OZM A;  2Y08 A;  2D07 B;  2YMQ A;  4UB3 A;  2OHF A;  1Z4N A;  3NVV A;  4DSF A;  1GRE A;  3QU2 A;  4YD1 A;  1GXF A;  5ADZ A;  4DLE A;  4ECX A;  2AQ4 A;  4F5O A;  2C60 A;  1SJB A;  2KFN A;  4GMV A;  3OZY A;  2ZIV B;  3C1Y A;  4H4S A;  3OLM D;  3ZVH B;  2PMZ F;  3PRM B;  3RZF A;  4DHJ B;  4MGY E;  1F8W A;  3VDZ A;  1UGM A;  1N60 C;  3JZU A;  4IWQ A;  1I4P A;  4KT2 A;  2PCE A;  4OZC A;  4DS4 A;  5IAA C;  2IDY A;  4E5T A;  4BDP A;  2C28 A;  4PS3 A;  5JZE B;  8ICK A;  3PR5 B;  4B0E A;  3Q14 C;  3JYU A;  3ENL A;  4IL6 U;  4J03 A;  2WHE A;  5KFK A;  3RBE A;  2N9X A;  2VAO A;  4O5C A;  1HZ5 A;  3EFU A;  2POD A;  2BPS A;  3JVZ X;  4DN1 A;  2DPI A;  4DL2 A;  3DBL I;  1J19 A;  3Q6B A;  4OD0 A;  9ICG A;  2PFO A;  2KTR B;  3QJZ A;  4EBE A;  3EYZ A;  4LDT D;  1KKR A;  2REX A;  2JH1 A;  4J9K A;  3ZDD A;  5TR5 A;  3V3X A;  2GLS A;  4G9B A;  4KIK A;  1AAR A;  4AS1 A;  2Z0D B;  2EAN A;  2PKE A;  1C4A A;  3CXB A;  4FJZ A;  1V59 A;  3UJR A;  3GIL A;  2P13 A;  4R65 A;  4I2A A;  2WU2 B;  4BKS A;  1FFU C;  2VAN A;  3DBH I;  2HQM A;  3H70 A;  2Y9T A;  1K53 A;  5EBK A;  3JVA A;  5J29 A;  2H88 B;  1Z1B A;  1PUT A;  4JAY A;  5TR3 A;  3MZN A;  2W9B A;  3SFD B;  2JMG A;  3VXW A;  1RDF A;  3R2T A;  1N63 C;  3KKA C;  3FW7 A;  4IL2 A;  5AUK A;  1UHU A;  5DG9 A;  3IHQ B;  3H4D A;  4K7W A;  5KHQ A;  2WTF A;  4MSM B;  2ALZ A;  5BOE A;  2ZJA A;  7ICM A;  5BOF A;  1XWL A;  2PKO A;  2MH7 A;  2LZ6 A;  5ENL A;  4M9N A;  2DZJ A;  9ICP A;  1LFD A;  4HYR A;  1MQ2 A;  3K9O B;  4UAS A;  3NRZ B;  4IQT A;  4ASW C;  4W9F A;  3ZDM C;  4O3S A;  4RNA A;  5AIC A;  8ICS A;  2D10 A;  4RFB A;  4ADW A;  1LXD A;  2UYZ B;  4IM0 A;  1IGC A;  4GIR A;  1V80 A;  3OJ4 B;  3K1G A;  5HHZ A;  3UCD A;  2YLM A;  4PZF A;  2V3B A;  2QCZ A;  3GFK B;  1TAM A;  4E74 A;  2X8G A;  4DHZ B;  4IP4 A;  2BKF A;  3TWA A;  1Z2M A;  4PGQ A;  3RJG A;  3M95 A;  1IPG A;  3GO2 A;  1J7A A;  1EF1 A;  2CKH B;  4PJ0 U;  2DL0 A;  1VD2 A;  4MDK E;  2AH5 A;  4DNA A;  3OSN A;  3L0W B;  1W1L A;  3II4 A;  3PGE A;  3D47 A;  2R2O A;  4DL3 A;  4GIV A;  1I42 A;  4BXO A;  5JU5 A;  4H4Q A;  2Z0E B;  1U9L A;  4RT3 A;  2ZJ5 A;  1NK6 A;  1BKH A;  5ALS A;  1F9C A;  2EQ7 A;  1N6Z A;  5CA7 A;  2WQY B;  3V6E B;  2I38 A;  3NTU A;  3W9C B;  1TZ1 A;  1W6T A;  2KJR A;  4ACO A;  1PGA A;  1RFA A;  2KVZ A;  5FS8 A;  2FAZ A;  1WH3 A;  3IBE A;  3ISB A;  2J0K A;  5D79 A;  2PXI A;  2LYH A;  1H6V A;  2Y0S F;  4IQV A;  4DFK A;  1GAQ B;  3TQP A;  3RGT A;  2R9Z A;  1N63 A;  4PZN A;  4CRX A;  3LXF A;  5G55 A;  4E71 A;  3IC9 A;  5T14 A;  1E8G A;  2Y5C A;  1XT9 B;  1MSW D;  3N20 C;  3ZVI A;  1H2I A;  3PRZ A;  4CHK A;  2PPG A;  1TAQ A;  5DBC A;  1JCK B;  1VDV A;  1SE3 A;  5H92 C;  2W9N A;  5HKH A;  1OUQ A;  7ICE A;  1JN3 A;  2E8O A;  2G3Q B;  3KWV A;  3O65 B;  3PPA A;  3BS5 A;  1ZR6 A;  4LZG A;  4YT0 B;  3VHT C;  2HZG A;  3P4P B;  2EZZ A;  3DHG C;  3A7R A;  4BWJ A;  1NHQ A;  4O3N A;  2O6V A;  2KIV A;  4UD8 A;  5J2K A;  2EQ8 A;  5AZH A;  2QB1 A;  3AE9 B;  1L7O A;  2DFL A;  3L13 A;  3VFK A;  4E4F A;  4JX1 C;  1QLU A;  1MHX A;  1F3P A;  1KDH A;  2QGY A;  2LBO A;  4GXB A;  4AQ7 A;  1TS4 A;  3TSJ A;  5AM0 A;  1EXN A;  1UA1 A;  3UM9 A;  1ZD4 A;  2AGQ A;  4E0D A;  5ALQ A;  8ICV A;  1STZ A;  3QU5 A;  5KL8 B;  3ZJV A;  4DHG A;  5KHO A;  1WMH A;  5KFU A;  4RCO A;  2I5Q A;  5KFC A;  3B0A A;  3Q8M A;  4CO7 A;  2GR2 A;  5DCN A;  1V38 A;  1PK1 A;  3L8K A;  2LHE A;  1W1Q A;  2JT4 B;  4FHJ A;  1JEH A;  3KLS X;  1RXW A;  4KLJ A;  5JCN A;  3S6J A;  1I4H A;  2NBU A;  3UXO A;  3U26 A;  3KHH A;  3L17 A;  1D8B A;  4K8G A;  1V8C A;  2RDB C;  1XLO A;  4IS7 A;  2WWZ A;  3HVZ A;  4L2Y A;  2J53 A;  4C4R A;  1WZ0 A;  2L1A A;  2UUV A;  3AI5 A;  4WH4 A;  3TUO A;  2K60 A;  5ALI A;  3A0H U;  4Y2T A;  4G0N B;  4EYH B;  3L4P A;  4JE3 B;  1X2G A;  1MJD A;  4FN2 A;  3AM9 A;  5AK3 A;  1HZ6 A;  5AKE A;  1JWS D;  4EEY A;  4R64 A;  2MW5 A;  3VTV A;  2RLT A;  2KZR A;  1I7H A;  3VR9 B;  3TSH A;  9ICO A;  2V6O A;  1D3Z A;  1PK3 A;  2RD0 A;  4HVB A;  1E8X A;  4DXF A;  4DO9 A;  2BCQ A;  1QZE A;  5AE3 A;  1D8L A;  4UAV A;  1O03 A;  3P63 A;  4A3P A;  1LVL A;  2PLI A;  1SWV A;  2CXY A;  3HIL A;  5D46 A;  4GXI A;  2JWZ A;  4B9L A;  2KTQ A;  3M6K A;  3Q8L A;  2KMM A;  5HHH A;  2FPM A;  3AU4 A;  2BWF A;  2JY6 A;  3SI8 A;  5D2M B;  1C1Y B;  5KFP A;  3D2Q A;  1SF0 A;  2BVG A;  3FDS A;  1S97 A;  4G11 A;  1NKC A;  4F93 B;  3UXP A;  3SQS A;  4PHE A;  1ZQV A;  4LK0 M;  3N4M B;  2BCV A;  2LYA A;  2MUT B;  2OYY A;  3VQI A;  3PHW B;  1VQZ A;  2IO1 B;  1JXE A;  5L95 C;  2E8P A;  5KFI A;  1T6B X;  1XXG A;  2L05 A;  2G9H D;  3KHG A;  4DF4 A;  2GWS A;  4HNC A;  1SIF A;  2C2R A;  1XO3 A;  2ZZP B;  1AHV A;  7ICO A;  4GN1 A;  1EWC A;  3IRU A;  4B6W A;  4BKS D;  5AI8 A;  3IAS 1;  2JEI A;  2MA9 B;  3MUC A;  1VCB A;  3IP4 B;  4C0Z A;  3PW4 A;  2LXC A;  1ZQX A;  3IFW B;  2KLG A;  2BQU A;  3L08 A;  2AGP A;  3KFU F;  4UAR A;  1YJI A;  2OED A;  4HN8 A;  3S5S A;  4Z1Y A;  1SE4 A;  3DVN V;  5IO9 A;  3DFY A;  5FP0 A;  2JF5 A;  3VFC A;  3GRT A;  1ZQB A;  2LXA A;  2ZNV C;  4GXK A;  3Q8Q B;  3I9V 1;  3FW8 A;  2A1J B;  1TKD A;  2Y3A A;  4J9O A;  3FYH A;  3I57 A;  2HI0 A;  4OO1 J;  1P9D U;  3KUZ A;  2W7O A;  2INN E;  4A9A A;  3B0Y A;  3QZ7 A;  1GES A;  1GER A;  3M7D A;  4QZF A;  1KFD A;  1M6I A;  3D2S A;  1L7M A;  4IQW A;  4ACF A;  4DFP A;  5J04 A;  2WOV A;  1YX6 B;  1ZOY B;  4RQ6 A;  5T8I A;  4BKT A;  1WUE A;  4RUA A;  2IGG A;  3MAB A;  2Q5W D;  4UBC A;  6ENL A;  1C20 A;  4CGZ A;  3QU9 A;  1K52 A;  7ICI A;  3RB3 A;  2DZM A;  3NVZ B;  3AN1 A;  3Q4D A;  1IIP A;  3GIM A;  4HRS A;  4DXA B;  5ER0 A;  1EWY C;  2O2V A;  3N6H A;  2WFA A;  1VZ8 A;  3IK4 A;  1X66 A;  3UQB A;  1UXY A;  2LGS A;  3ETR A;  2L52 A;  5DB7 A;  5JCI A;  3Q3F A;  3NVZ A;  2LYB A;  4HCH A;  3RN9 C;  1MUC A;  3GP7 A;  3N1X C;  4MGZ E;  5FXP A;  4E6M A;  2G4D B;  3NS1 A;  1LKY A;  4GFJ A;  4EZ6 A;  2JWU A;  2LGY A;  1X6I A;  4BFR A;  1N62 C;  3DDC B;  1KEJ A;  4YWO A;  5E6N A;  4F4W A;  1NDD A;  3A9K B;  2F76 X;  4NLK A;  1SJA A;  1IM4 A;  3D2D A;  4F2S A;  3DDM A;  3KUM A;  4RNM A;  3MDC A;  4X5V A;  4RF0 A;  3CWI A;  4DHJ D;  4RQ8 A;  2AL3 A;  4FJY A;  4ANW A;  3OC4 A;  3PSP A;  5DKW A;  3VRB B;  3TJI A;  4H2H A;  3EKG A;  4PH5 A;  5EWF A;  3FKY A;  4RF1 A;  2OXO A;  2IMW P;  3OJ3 A;  3WK5 A;  1BPX A;  3CGD A;  4GDK A;  2KDI A;  2WYQ A;  4PWC A;  1HEZ E;  2BTE A;  1NEL A;  3CIR B;  4DL7 A;  1NJY A;  1JW9 D;  3WAL A;  4DHZ E;  2RQ5 A;  2E6X A;  4PWB A;  4O3Q A;  2OPJ A;  1WX8 A;  4LJP B;  3TMP B;  5GMV A;  3H0L B;  4W9G A;  4JWU C;  1X9M A;  2JVC A;  2J4X A;  8ICP A;  1COK A;  5KFZ A;  1S0O A;  4P4P A;  3IG5 A;  2N9E B;  4GU2 A;  3FWA A;  1IG6 A;  1SB3 C;  2KN7 A;  2VFS A;  4BXO B;  5CJ7 A;  2JXT A;  2OEH A;  5ALV A;  3ZW3 A;  4J1O A;  1WFY A;  2LGD A;  2H5X A;  3ZO5 B;  2XH7 A;  4JV1 A;  4QZ9 A;  4BUG A;  1BPE A;  2F1I A;  3NUH B;  1ZQS A;  4HPL B;  3KOO A;  4A6Q A;  2ZPY A;  1NNL A;  1BGX T;  4ED0 A;  3ENE A;  2QKQ A;  3HHM A;  3L54 A;  3RMK C;  3I1Y A;  3ZDE A;  3DQV A;  3FW9 A;  3DBR B;  3PY8 A;  1HSK A;  2DQN B;  4AYB C;  2AWT A;  2XGQ A;  4QWC A;  2R8J A;  1S77 D;  2NS5 A;  1WWT A;  3D6J A;  1NZB A;  1LB2 B;  3KWL A;  4PVJ A;  4KPR A;  1YQ3 B;  3GY1 A;  3I6E A;  2W3R A;  3AE3 B;  1L5P A;  3DGB A;  2DYO A;  4B9K A;  5H2F U;  2KQ7 A;  2YMP A;  3U4E G;  5F9N A;  1QQ5 A;  8ICB A;  3H7P B;  4YN4 A;  3WAN A;  4JQW C;  4FS2 A;  1GC7 A;  2C7N B;  1V97 A;  2G5I B;  2KC1 A;  3PRE A;  4DL5 A;  3AQF A;  2OH2 A;  3ML8 A;  3PO0 A;  3W2D A;  4M0X A;  2NPT B;  4HPM B;  5HML A;  3MTN B;  2GQU A;  3O13 A;  1KM7 A;  7ICF A;  4NZL B;  2WPC A;  2KEY A;  2MRL A;  4G8T A;  4JK1 A;  4HEA 1;  3N7R C;  4CF3 A;  2KX0 A;  2ZTE A;  3RFA A;  2LVQ A;  3AE6 B;  3V61 A;  1T3Q A;  2IY0 B;  7ICK A;  4M8N A;  1LQB A;  2P3H A;  3LB8 A;  2I1K A;  3LB8 C;  5D7G A;  3AB5 A;  3W5U B;  1GET A;  4K4I A;  3SMV A;  4QWD A;  2LRU A;  3C21 A;  2OG9 A;  2ES6 A;  2AGO A;  3SEB A;  3NFU A;  5E6O A;  4DQQ A;  4Y2R A;  3L3F X;  2D11 A;  4X2P A;  5ALE A;  1TY2 A;  2RR9 A;  5KT5 A;  1LGR A;  3WCQ A;  5FJR A;  1TK8 A;  3V05 A;  2HXU A;  4F4R A;  3IT4 B;  3GU3 A;  4J9M A;  3B9J B;  5KVI A;  4EEN A;  3NO1 A;  1V5O A;  3VTU A;  2NRW A;  2QDE A;  3Q8A A;  1YN4 A;  3ICX A;  2LRW A;  5AI6 A;  3R10 A;  2YAU A;  1UWM A;  1TS2 A;  1KLN A;  4QZD A;  2WS3 B;  2PFN A;  3EA6 A;  1ZQM A;  4C7Z A;  5AM2 A;  4EM4 A;  2BVC A;  5JCM A;  5KFG A;  4QWA A;  5AKZ A;  1B43 A;  3X0W A;  2BR0 A;  3APC A;  4QZG A;  1E7U A;  1MNS A;  3C29 A;  5ALR A;  2IGH A;  2XCP A;  2PEA A;  5FJT A;  2QAR B;  1HTQ A;  4JUZ A;  3PT2 B;  1QOG A;  1EBD A;  2H3F A;  2FDR A;  2ACZ B;  3UMB A;  4Q45 A;  2UWQ A;  3DJJ A;  9ICS A;  1L6N A;  7ICU A;  5HG2 A;  4EWJ A;  2FE9 A;  5DB8 A;  1N48 A;  1WVF A;  4R66 A;  3S2A A;  3ZRF A;  2IBI B;  2DKZ A;  3W1S C;  2TPR A;  4WAF A;  3ONN A;  4A3R A;  2RDG A;  1GJZ A;  1ZD2 P;  3Q8B A;  2YB4 A;  4KLF A;  3AEV A;  2AAQ A;  2MNR A;  3H7P A;  2G4S A;  2DGZ A;  1YNT E;  2D8C A;  1KSP A;  3QUT A;  4OVV A;  1ISN A;  1Q3V A;  3QXG A;  4Y2Q A;  2QPM A;  3PTF C;  2EAO A;  2LMC A;  2KN5 A;  2BGF A;  2YEP F;  2WXN A;  1D4B A;  2D3B A;  2Z7J A;  4PYU A;  3R3M A;  1WI0 A;  2PMV A;  3ALR A;  1A5R A;  3D46 A;  3DHH C;  2Z8L A;  4PPX A;  2X8X X;  3OW1 A;  2PMZ C;  3T3O A;  1W1K A;  3A1Q A;  4QIW F;  1AN8 A;  2IJ0 A;  4A90 A;  1MOK A;  3ZI4 A;  1BPY A;  1X6J A;  5E79 U;  1ZJN A;  2K9X A;  2M4N A;  2ONQ A;  4XWT A;  5DPW A;  1WGG A;  3WK4 A;  4F5R A;  1FEC A;  2C3D A;  2NPX A;  2YVJ A;  2A1A A;  2F2A B;  3WA0 A;  4R8U A;  2V4Q A;  5KG4 A;  3KD3 A;  1HTO A;  2IHN A;  9ICT A;  1S10 A;  5KFE A;  5KG3 A;  3TEW A;  5FXE A;  3ZDA A;  1S0V A;  3UXN A;  2R2Q A;  2HMX A;  2VKQ A;  3OSP A;  4NQL B;  1XNS A;  5KG1 A;  3CRX A;  3NRZ A;  4A35 A;  4PVK A;  5EU9 A;  4NAW B;  5HFY A;  4YG2 A;  3HX0 A;  3C23 A;  3EZ5 A;  2XNA C;  3W8X A;  1ROE A;  3JPT A;  3QFB A;  4QZI A;  3FV9 A;  1VZ6 A;  2PLS A;  4W9K A;  4IR9 A;  1A77 A;  1JWM D;  4XC2 A;  1W1S A;  3GIJ A;  1UF0 A;  2DLB A;  1ZJM A;  3MC1 A;  4KKI A;  3AEE B;  3NJT A;  1QOF A;  2RGF A;  2QAR A;  2KD0 A;  4XYC A;  1E8W A;  1ZRM A;  4EKU A;  3QFA A;  3VUY A;  1KLV A;  5KFB A;  2OOB B;  4KN7 A;  1WXA A;  4KX5 A;  3M9O B;  9ICJ A;  4HJG E;  2KWC A;  3QX7 A;  5EDS A;  4KLG A;  3SV3 A;  1MVK A;  2O2V B;  3R8B A;  2PS2 A;  3JPQ A;  4GIB A;  3H1U A;  4EMW A;  4Z6C A;  1VJK A;  4M6W A;  4ECW A;  2JYE A;  5HMR A;  2PGE A;  1GO3 F;  3UQ2 A;  3S1C A;  2FYM A;  1P7E A;  3SR6 B;  1P7D A;  5KFL A;  2LGI A;  1CMX B;  1QQR A;  4K4H A;  4YSX B;  5KFH A;  1I4Q A;  2FUG 1;  2CDU A;  3QPE A;  2PP0 A;  1ECW A;  1X42 A;  3GDX A;  4RGT A;  4LNN A;  3FVD A;  2JRZ A;  2KVS A;  2HHU A;  2HSZ A;  3AE8 B;  4K3C A;  1KN0 A;  1ZQY A;  2IBK A;  1AWD A;  2WXI A;  1ZMD A;  2BCP A;  1WUF A;  1SXE A;  3DVN U;  4KTQ A;  4XQ8 A;  3OAW A;  4JN8 A;  2I1Q A;  4RUC A;  5KT2 A;  2FLP A;  3RO6 A;  1S1Q B;  4K8D A;  3BS7 A;  3K9P B;  4ANU A;  1KW4 A;  2GRI A;  3DG7 A;  4ECT A;  4C4S A;  3N97 B;  3DWM A;  2QJM A;  3ZNG C;  2E8M A;  2B21 A;  4W9J A;  1FEZ A;  1IYX A;  1M4V A;  1R4M I;  2BGW A;  4F92 B;  3TAP A;  1EBG A;  1JWU D;  1E9M A;  2DAF A;  4GDK B;  2R61 A;  4M9J A;  1V9J A;  4P0Q A;  4J56 A;  5J0P A;  3SJN A;  4CF5 A;  2WXJ A;  2I2Y A;  4ECQ A;  1QSS A;  2P3Z A;  1XQQ A;  3RFZ B;  2I9G A;  3IJL A;  4NLN A;  3QYP A;  2DBY A;  4AP9 A;  2ISP A;  3B9J A;  3PMN A;  3MC8 A;  3TEY A;  4XZ4 A;  4KLI A;  1TKK A;  3VH4 B;  4XDD A;  3BDP A;  1RFK A;  4IR1 A;  4OJ6 A;  5E6P A;  2R2Z A;  3M9M B;  4P4M A;  5BYR A;  1XPY A;  2L0F A;  3R07 C;  3BZD B;  4HCD A;  4KPL A;  2X50 A;  5IIN A;  3N7S C;  1NI2 A;  4UW9 A;  2CHX A;  1MG8 A;  3RJ8 A;  8ICL A;  2Q4T A;  4MEX A;  2BC1 A;  2VJ5 A;  4JQ9 A;  3CGE A;  3ZNZ B;  3GE3 C;  3RI7 C;  2K4H A;  8ICR A;  2XK5 A;  4KLE A;  4C8M A;  4K7S A;  4DWI A;  5AEK B;  2XY5 A;  3LVW A;  2N7D A;  3H0M B;  4G3X B;  1GRF A;  2ZIX B;  3B08 A;  2HBJ A;  1E9I A;  1RVK A;  3PZP A;  3THV A;  3B1L X;  1FXT B;  5DGB A;  2I5H A;  2KN4 A;  1X40 A;  3NVW A;  3JSV A;  5K8E A;  3DEE A;  3IDW A;  4KMO B;  4DQR A;  1WJ6 A;  2I6X A;  2OQH A;  4DLG A;  1RG6 A;  4DFD A;  2LJI A;  2VZK B;  3MGI A;  2HVI A;  4NLB A;  2N7E A;  4NV0 A;  4KLT A;  1N62 A;  1JWA D;  1JML A;  1XAN A;  3EC8 A;  3MKC A;  2GL5 A;  3Q8K A;  4GC6 A;  4H4X A;  1E90 A;  4CCH A;  2GI9 A;  3H40 A;  2EKE C;  5BO4 B;  1P48 A;  4HG0 A;  2PFP A;  1YN5 A;  2V3S A;  1NPX A;  3TWB A;  1NKB A;  2BCU A;  2G0A A;  4K81 A;  3GD4 A;  4ED6 A;  3IV6 A;  1K1Q A;  5AM4 A;  3MGH A;  2ODG A;  4B9U A;  4KWS A;  4A55 A;  1MC8 A;  1WX7 A;  3GS2 A;  3DFH A;  5GRT A;  3TTE A;  2QEJ C;  5BMH A;  4GSW A;  2GGI A;  1PYW D;  4RGO S;  2J6U A;  4O3R A;  3C19 A;  1NI3 A;  1V1P A;  2JEJ A;  1U4B A;  4DBG A;  4JDR A;  2M0X A;  1D9F A;  1ZKH A;  4QZC A;  1SXD A;  3NVV B;  4PVH A;  2XK5 B;  3I3T B;  2H3V A;  2IND C;  5DLF A;  7ICV A;  3HT3 A;  1TYG B;  1Z4O A;  1GB4 A;  1SL0 A;  2VA2 A;  2K4I A;  3F2C A;  4H4P A;  2KSO B;  1Y56 A;  2IYD B;  5ALH A;  2Z59 B;  4Q44 A;  7ICN A;  1WMH B;  3X23 A;  3AE7 B;  4F5P A;  1P0R A;  3I76 A;  5HMM A;  5B66 U;  4DDI D;  3A9J B;  4II3 B;  3NVY B;  2GGJ A;  2XH4 A;  3EWA A;  4HDQ A;  3R0U A;  2LUM A;  3GOE A;  2WXK A;  3EUB 2;  1RPL A;  3EJE B;  1SJH D;  1ARO P;  5KG6 A;  2LGX A;  2KZM A;  3JS8 A;  3WK9 A;  4GGH A;  4FO6 A;  3DDH A;  2PIA A;  5DG8 A;  4EBC A;  1OFF A;  2NO5 A;  1NHS A;  3V5C A;  3KVF B;  3SFE B;  1YEY A;  2R8D A;  5AM1 A;  2KDB A;  2AL6 A;  3RR1 A;  1E7V A;  1NEN B;  4MEM A;  5KFW A;  2L0T A;  4S0R A;  4BOZ B;  4BZA A;  2AL2 A;  5F3X B;  3FC4 A;  3N7P D;  4B6J A;  1FFV A;  4J9S A;  5DLG A;  1GSN A;  2JPH A;  2D6F C;  3RH6 A;  3DG6 A;  1B22 A;  4I2E A;  5BMG A;  2XGZ A;  5KT6 A;  4DSJ A;  4OJ5 A;  2C7M B;  1HQR D;  3B2F A;  4M0W A;  3VC6 A;  2NTT A;  4B9V A;  3L5K A;  3EAO A;  2LI5 A;  4ROP A;  5GTI U;  2PFQ A;  2KZZ A;  5ALO A;  1TE6 A;  4DCC A;  4RZR A;  2K5P A;  5DPS A;  3SU8 X;  2GGG A;  2NVK X;  5HP4 A;  2WXH A;  4ZA0 A;  4OW0 A;  3NZS A;  3BSM A;  4Z6D A;  3DBS A;  1V2Y A;  2RPV A;  4DOC A;  3MR3 A;  2AXR A;  2PTZ A;  2E1E A;  1WXM A;  2FNJ B;  3I4K A;  4EE2 A;  4UAW A;  3OWE B;  3UXL A;  9ICL A;  5KFS A;  3LAD A;  1X1M A;  4K7U A;  2P4P A;  1L3T A;  1SKR A;  3TCS A;  4ELV A;  3DBL B;  4UB4 A;  1WJ4 A;  4ZHP A;  2P8B A;  1DGS A;  1ZRN A;  2EAP A;  2IOH A;  2QDF A;  1J7B A;  4MH0 E;  4TQ0 A;  1V81 A;  4EFO A;  1T0Y A;  4CDG A;  2EQ6 A;  1XO1 A;  2RRD A;  3IG8 A;  4ZOH C;  2ZXH A;  5JUM A;  4QWE A;  1XHC A;  2OZT A;  4IP5 A;  2RDX A;  3N6J A;  2RK5 A;  3HKZ C;  2ZIW A;  2BB5 A;  1GEU A;  4MLA A;  1GRT A;  2VA3 A;  1SXT A;  3BYY B;  1PDX A;  4KV2 A;  3QTP A;  5J2R A;  1ZET A;  3APD A;  1QLT A;  2BDU A;  2MA1 A;  3ETL A;  4BOS C;  4W9E A;  3JPP A;  3BQ2 A;  3TOY A;  5ALU A;  1JUD A;  5AIB A;  2FPL A;  2V3N A;  2K0P A;  2B0C A;  2FPK A;  2JR5 A;  3QE9 Y;  1KJT A;  4M8M A;  4EC3 A;  3H8M A;  2NRV A;  3PSF A;  2PMQ A;  4US8 A;  4UAT A;  3NOB A;  3AV8 A;  4I2F A;  4RU9 A;  3ML9 A;  8ICN A;  4HJK A;  4J6I A;  3V6J A;  1KFY B;  1MDR A;  3PW5 A;  5IIL A;  2KK8 A;  4NXZ A;  2GOW A;  4W9C A;  4DSE A;  3BQ1 A;  3ZDB A;  4UB5 A;  1WGR A;  5AZG A;  1SKW A;  4R8U B;  1ESF A;  3PML A;  3U9I A;  1V9P A;  3MBY A;  3TAR A;  2VH1 A;  2ZJD A;  4RQN A;  4RQ3 A;  3JPO A;  1IBX B;  3WK8 A;  1WM3 A;  3AEC B;  4NAW A;  1V85 A;  4MKS A;  2WP5 A;  5JTI A;  2J52 A;  5DQH A;  4TUQ A;  3ZYY X;  4D2K A;  2O3G A;  1D8Y A;  4URK A;  1UD7 A;  2AQ1 B;  2BYT A;  4NAM A;  1H38 A;  3OJU A;  4DSI A;  2Q85 A;  5KT7 A;  2Y9U A;  3ZGZ A;  1WWU A;  4M6U A;  3LDZ E;  4NJ8 A;  1ZXH A;  2YY6 A;  2K22 A;  4ZOH B;  5CR0 A;  2ZXI A;  3S1E A;  5KT3 A;  1SJC A;  2C5L C;  3H7I A;  1KLG D;  5HHD G;  4C8L A;  4IM2 A;  3AXC A;  3MGV A;  1WGK A;  3M6Z A;  1ZD5 A;  3SV4 A;  5EOZ A;  4QAY A;  2W54 A;  1WUD A;  2PTL A;  4ICA A;  3ISD A;  4M52 A;  4G50 A;  4QNL A;  1FIQ B;  3K1R B;  1J8C A;  3AED B;  1E5W A;  5JHB A;  3L10 B;  4TUS A;  3MDA A;  3C5G A;  4A20 A;  2P8C A;  4MJS B;  4UBB A;  4EEL A;  2R8G A;  2WDV B;  3BWU D;  2CJO A;  4LTU A;  3ZNI D;  4AJW A;  5EWE A;  1QTM A;  2O6V B;  2GRT A;  4O5K A;  5L1L A;  3WKE A;  5AKG A;  3M9N B;  3D9X A;  5C3J B;  3JPS A;  5J2F A;  4H19 A;  3RAQ A;  1FD6 A;  1FEA A;  4KKJ A;  5KFY A;  3OP2 A;  4DYE A;  2FLL A;  5KFA A;  2KJH B;  1A0P A;  4H1Z A;  1E10 A;  2F77 X;  3EPG A;  5AK4 A;  4O0I A;  3HKZ F;  2W04 A;  1NJZ A;  2UVV A;  4US9 A;  3M3J A;  2WDR B;  4BC7 A;  2MAX A;  4DX3 A;  4RQ1 A;  4ARC A;  4ANX A;  1SE9 A;  1WCN A;  1LM8 B;  3DEQ A;  2J0M A;  3E58 A;  4FJV B;  4DL6 A;  2IO2 B;  4MM3 B;  4FP1 A;  2OZ3 A;  3CP8 A;  4N9F 4;  4A3O A;  1JOA A;  2WP6 A;  3PSI A;  1L7Y A;  2HOF A;  2QC8 A;  3ZDT A;  1V6E A;  2UVU A;  3B0X A;  4OJO A;  2BS2 B;  2LWP A;  3BQT A;  4RGN A;  1N5W A;  1OXJ A;  2PTW A;  4ECY A;  1J2M A;  4W9H A;  4DS5 A;  3UQA A;  1XSN A;  3LLB A;  2SAK A;  1HIW A;  4HK2 A;  3F5E A;  3DPD A;  4GOC A;  1Q5W B;  1YJJ A;  5AE1 A;  1NVI D;  2ZIU B;  4M00 A;  3TW9 A;  1NOM A;  3RRH A;  1C7Y A;  4B0M A;  2CJN A;  4XA5 A;  3M63 B;  4RPX A;  2V4R A;  1WGY A;  4EOY A;  4LVS A;  7ICJ A;  2R18 A;  4JV2 A;  2QHO A;  2IPK D;  3PSE B;  3Q6J A;  1XCQ L;  3NAS A;  3E2E A;  3CMM B;  3PW7 A;  8ICZ A;  2A5U A;  1ZQF A;  1KQQ A;  5DB9 A;  2BS4 B;  3DWG C;  4YTM B;  2GBJ A;  2MUC A;  3TEZ A;  5JHA A;  2KYW A;  4H4R A;  3TBL D;  2WNM A;  2BVF A;  4S17 A;  1YOV B;  3ZKJ C;  3UIP B;  5KFQ A;  4AUQ C;  5AI9 A;  1DRG A;  1WYW B;  5AKL A;  2OO6 A;  4REZ A;  4W9I A;  4FBU A;  1L8O A;  1J0G A;  3RJF A;  1J7C A;  1NK5 A;  1ZQT A;  1WY8 A;  1B1Z A;  1WG8 A;  1ENF A;  2BWE S;  4J9P A;  5AKJ A;  2TSS A;  4GDL B;  4R3D A;  5AKI A;  4BV6 A;  2MSE D;  3C28 A;  2HVH A;  1VR9 A;  3TEX A;  3P3B A;  3VCN A;  1TK0 A;  5J0Y A;  3A9K A;  5AHX A;  4OZB A;  3T8Q A;  2ZNV B;  2AKM A;  2WXM A;  3POP A;  5HNK A;  1FFV C;  3PZ7 A;  2XVT A;  4MFC A;  4JMU A;  2V3A A;  1FCC C;  4FZN A;  1BVS A;  1O08 A;  2LEK A;  4ELU A;  4I2B A;  2WXQ A;  3SN0 A;  8ICA A;  3HVD A;  1BWC A;  3HW2 A;  4MFA A;  3C0P A;  3ZUN A;  1ZY8 A;  5ALW A;  1RLF A;  1WZ3 A;  2GBM A;  3KYC D;  3ORY A;  3RNF C;  2G09 A;  3EPI A;  4IWP A;  4USA A;  1KRH A;  1UCV A;  1GRB A;  3QEB Z;  3ECI A;  3NZG A;  4DL4 A;  2HTH A;  2MBQ A;  1WM2 A;  1VRA B;  4WWM A;  3EEC A;  1CJE A;  4QW9 A;  3RRG A;  2O56 A;  1F77 A;  1PVR A;  9ICW A;  4XE0 A;  1ZOL A;  3VAW A;  3H8S A;  3DH9 A;  3GC2 A;  1K1S A;  5LNK 1;  3QAQ A;  1ZQR A;  3ZJT A;  2IZV B;  2NMQ A;  1KRP A;  3ZIM A;  3CYM A;  1WX9 A;  5ALF A;  4BBN F;  5KT4 A;  2GBR A;  3BS5 B;  4RM9 A;  1XDI A;  3QUB A;  4B95 A;  2FUH B;  3P0W A;  1CQV A;  1Z00 A;  1N2X A;  3SHQ A;  2WXP A;  2KD1 A;  3NGD A;  1AQ6 A;  2KIW A;  4YXJ A;  7ICL A;  1UT8 A;  1ZQD A;  2JSV X;  5DDM A;  2KXJ A;  2A3V A;  3RCY A;  3T79 A;  3DBR I;  1BPZ A;  4E4U A;  5G5G A;  2VA8 A;  2YB1 A;  4M9H A;  1KKX A;  1FXI A;  4HLE A;  1L6U A;  4APN A;  1WE7 A;  3H12 A;  4Z17 A;  3ZD8 A;  2Y5B B;  1QQ7 A;  4KLQ A;  2BYE A;  3ZLG A;  2PW9 A;  1T94 A;  5DB6 A;  4FE3 A;  1N56 A;  3AEA B;  3MR2 A;  3AUL A;  3EJD B;  5JRB A;  2V9H A;  3A7U A;  3TI0 A;  2JZZ A;  2NCN A;  4I2J A;  4HNL A;  1UT5 A;  3T5H A;  2E5A A;  2ZZB A;  1N5W C;  2Y0S C;  2O6V D;  5C23 A;  3S47 A;  1T3Q C;  3RB6 A;  5JCL A;  4NLC A;  1DIQ A;  1DGJ A;  5ALK A;  2EDU A;  7ENL A;  5C5J A;  2KJ9 A;  1V49 A;  2VFU A;  1D5X C;  1ZQJ A;  2M9N A;  4KMU A;  1UA0 A;  2DYM A;  5D3D A;  1G6J A;  2LHT A;  4QZH A;  1HJP A;  2BPF A;  3C0R B;  3QQ8 B;  2D5G A;  3U8Z A;  4KDL B;  4J57 A;  2LD9 A;  4ANV A;  5J18 A;  4I2G A;  4YP3 A;  5J0U A;  4Y2X A;  1WJU A;  4IT1 A;  4BC9 A;  1JI7 A;  4UAU A;  3RH4 A;  2FE8 A;  3QU7 A;  4GXJ A;  1Q10 A;  3BK2 A;  3HWT A;  1OQQ A;  2XH2 A;  2XC9 A;  1L0Y B;  3VTW A;  1OEY A;  3W1Y A;  2WDW A;  4EMJ A;  2G07 A;  5ALL A;  5DQI A;  2INP E;  4ZRQ A;  2FCQ A;  3QA8 A;  4HKQ A;  1TKE A;  3ZTC A;  2ISO A;  2BBC A;  3H8J A;  4TQ1 A;  3HSU A;  2ZIU A;  4AYB F;  1EUV B;  3P93 A;  4DQO C;  9ICA A;  4NLZ A;  2HDE A;  1T0Q C;  2JU6 X;  3EFC A;  1E0Y A;  5FJU A;  4DWD A;  3OPS A;  3ZQ4 A;  3H6N A;  8ICH A;  4C80 A;  3A4R A;  2WF9 A;  1ZQI A;  4NLG A;  2LMR A;  2M0A A;  2FJ6 A;  2NV3 A;  3HIZ A;  4XDC A;  5C2T B;  1KTK A;  2B6G A;  2GBK A;  5KG5 A;  5CWR A;  3QC8 B;  4BBN C;  3ONS A;  1SB3 B;  3ES7 A;  4WJO A;  4P0Q B;  4K3B A;  2OQY A;  3SBF A;  1SGH A;  2W8K A;  4KGR A;  4UB8 U;  3UMC A;  1A6S A;  4YFK A;  3CNH A;  4H4T A;  1CEZ A;  2PJH A;  1TKY A;  1RAX A;  1F0Z A;  1KL9 A;  1QSL A;  4NJC A;  4H4Y A;  2A1J A;  3RH5 A;  3AE2 B;  2DKX A;  3T9P A;  2JH7 A;  3HP6 A;  2D3D A;  5G5H A;  1PZN A;  1XS2 A;  4Y2J A;  1W1M A;  1DYQ A;  1UBI A;  1FEB A;  1F5S A;  1QH9 A;  3KTQ A;  3R9K A;  2CHZ A;  4F3O A;  4WAA A;  4ARI A;  2OJR A;  1HEK A;  3T5K A;  1S7M A;  3CXO A;  5KFX A;  2NRX A;  1X2I A;  3RUI B;  4NL9 A;  4NL9 C;  4KX6 B;  5ALP A;  4N59 A;  4DWF A;  2KP7 A;  2PA6 A;  2E5S A;  3V5F A;  4O95 A;  2K8B B;  2VFT A;  3QN3 A;  2WHI A;  2BQ3 A;  3HRD D;  1SEB D;  2DEN B;  9ICR A;  4ZRK A;  2MBH A;  4BAX A;  2JZP A;  2JYT A;  2OKT A;  1JXL A;  2KDM A;  2LM1 A;  1WXV A;  2QJN A;  3Q3N C;  3I6T A;  4EMI A;  2H89 B;  4UB6 U;  5KFF A;  1Q8K A;  1CI4 A;  1F0M A;  4PK1 A;  4JPS A;  2YVG A;  1ZQQ A;  2XI9 A;  2IOF A;  1KLU D;  3Q8R B;  2MLB A;  3KLJ A;  1SV0 A;  2GO7 A;  1WYG A;  4OJL A;  2IY1 B;  4GFI A;  2KT7 A;  3UGB B;  4QW8 A;  5L9X A;  4I28 A;  5EE0 A;  1NK7 A;  3H7V A;  4YMM A;  1RYR A;  2MJE A;  5L1M A;  1ZD3 A;  2OLA A;  3KBB A;  3BZK A;  3D2H A;  3H9D A;  4YWS A;  3V4B A;  5AIA A;  1P7F A;  2L8J A;  2J7Q B;  4NM2 A;  3U7D A;  1SZP A;  5A0L A;  5FS9 A;  2IO3 B;  2Y1J A;  2K3U A;  8ICC A;  1NK0 A;  2W82 A;  2AEH A;  2W9A A;  3SYZ A;  1IBX A;  3PWG A;  4RT2 A;  1E0Z A;  2JXJ A;  1GRG A;  3WIM A;  2CFY A;  3C2K A;  1GC6 A;  3RPF C;  3E56 A;  1DK3 A;  2UUU A;  1N61 A;  3BY4 B;  1KKO A;  5DBA A;  3DER A;  5IIM A;  1ZQL A;  4ECZ A;  3SD5 A;  3LDA A;  4PYT A;  5EWG A;  4GGB A;  3DBH B;  3ZVV A;  4UB2 A;  1S5L U;  4RM8 A;  4CNQ A;  2PVO D;  5U1O A;  2EMS A;  3R11 A;  4W9D A;  2LAS A;  4I2H A;  1J97 A;  2DW7 A;  3U4F A;  3DVG X;  4P1C C;  1WCL A;  4UQG A;  4RH6 A;  1H4R A;  3H8W A;  3MHZ A;  1TGZ B;  3WKB A;  1DOQ A;  2KE7 A;  4F5N A;  1BUI C;  1D5Z C;  1VZ7 A;  4IUM B;  2BW2 A;  1CRX A;  2AHO B;  2ZIW B;  3RUL A;  2KJ6 A;  2KLC A;  4LNF A;  1FNU A;  3STP A;  3TQ1 A;  3K1Z A;  3QZ8 A;  3H4B A;  2HE7 A;  3N4F A;  3URH A;  2NBW B;  4C4V A;  5ALT A;  3QNM A;  3MFI A;  1JDF A;  1C78 A;  3GB1 A;  2RSU A;  3UJF A;  1XLQ A;  2ZPN A;  2J0J A;  3QK0 A;  4F4K A;  4O3P A;  1IGD A;  1RYU A;  1KBU A;  3N9Y C;  4GGQ A;  4C4V B;  2JRH A;  1MG4 A;  3FIL B;  5KFD A;  3L16 A;  3RRA A;  2CU3 A;  4BKG A;  1SIJ A;  1QLB B;  3UIO B;  2C2D A;  3ZLH A;  4RQ2 A;  3GV8 B;  3E9S A;  3Q3O C;  4IWO A;  2LI6 A;  4TQS A;  1UBQ A;  3ES8 A;  2BKR B;  2QB0 B;  1I4G A;  5DPT A;  3ABV B;  9ICN A;  2WF6 A;  3QWZ B;  3RJJ A;  1ZE3 D;  4MT5 A;  2ZUD A;  2WPE A;  2HTM E;  1C9F A;  9ICB A;  2DZI A;  3HM6 X;  4ICU A;  2WLB A;  3SEI A;  4DSL A;  3CGC A;  2KHW B;  5EE3 A;  4X57 B;  2K8H A;  2K4E A;  3JPR A;  1ZGU B;  3IVF A;  1D9D A;  2W11 A;  3NZ3 A;  4HRO A;  1JMS A;  1ZQH A;  3J81 j;  5ALX A;  3TIX A;  4IRK A;  1VAO A;  1UNS A;  2ZZC A;  2YEP B;  5FS7 A;  1DTN A;  5U25 A;  3GII A;  3EJB B;  2AL2 B;  4F50 A;  8ICY A;  1WXQ A;  1E8H A;  2KOX A;  1PUZ A;  3JPN A;  4KLS A;  2KQS A;  3DJG X;  4ZRP A;  2ZW0 A;  3FAH A;  3A0B U;  2WDQ B;  3K75 D;  2ASQ A;  2WAQ C;  4HKZ E;  1IV8 A;  1YZ6 A;  8ICQ A;  1ZQA A;  1WRI A;  2XSX A;  1E6E B; 
#chains in the Genus database with same CATH homology
 1FIQ A;  1TKG A;  3P4P B;  3ETR B;  1TYG B;  5MPO A;  3A7R A;  1GB4 A;  1AHU A;  1DOI A;  2BS3 B;  4UD8 A;  1Y56 A;  4XWW A;  3AE9 B;  2Y4G A;  3AE7 B;  4O1N A;  1RM6 C;  4DNS A;  4JX1 C;  1QLU A;  1MHX A;  1A70 A;  4AQ7 A;  1TS4 A;  3TSJ A;  3NVY B;  3B2G A;  1D6E C;  1TS5 A;  1IUE A;  1PFD A;  2LUM A;  3ZJV A;  3HUI A;  2W3S A;  2WXK A;  2ZW1 A;  1EU4 A;  4A8X C;  3EUB 2;  4N6E B;  1XCT L;  1SJH D;  4RCO A;  3AE4 B;  3JS8 A;  4YTN B;  1N60 A;  2PIA A;  3KQ4 A;  1OFF A;  2LHE A;  1W1Q A;  3SFE B;  3KLS X;  2R8D A;  1STE A;  1DOY A;  1NEN B;  2E3T A;  1C4C A;  1I4H A;  1WSP A;  1W1O A;  3PM9 A;  1QKZ A;  3P1M A;  3VRA B;  3A7A A;  1L4D B;  3FC4 A;  1V8C A;  1FFV A;  1JWB D;  3AMZ A;  1ET6 A;  1XLO A;  3HVZ A;  5BMG A;  1PGX A;  4L2Y A;  2J53 A;  2L1A A;  2UUV A;  5I1V A;  1T5X D;  4WH4 A;  5BYQ A;  2QSD A;  3TUO A;  1HQR D;  1ZPS A;  1NYQ A;  3B2F A;  4M0W A;  2NTT A;  2IGD A;  2BB6 A;  3L4P A;  4JE3 B;  1X2G A;  2K5P A;  3AM9 A;  1HZ6 A;  2ON8 A;  1JWS D;  2WXH A;  4OW0 A;  1KF6 B;  3U2S C;  1I7H A;  3VR9 B;  3TSH A;  3BW7 A;  3NVY A;  2RPV A;  2AXR A;  4DXF A;  5AE3 A;  4EE2 A;  3J9C A;  3P63 A;  3OWE B;  1BXT A;  1RWS A;  1XLP A;  2PLI A;  1VLB A;  2BVH A;  2P4P A;  1CK1 A;  4Q2J A;  2KMM A;  5L6F A;  4ZHP A;  1WVE A;  1SBB B;  1SF0 A;  2BVG A;  4WIP A;  1J7B A;  4TQ0 A;  3S1D A;  1NYR A;  2V3P A;  3BYT B;  4ZOH C;  4LK0 M;  1K50 A;  1VQZ A;  3VQI A;  2RK5 A;  2BB5 A;  4ML8 A;  4MLA A;  5I1W A;  4PT5 A;  1T6B X;  1SXT A;  1XXG A;  1L0V B;  1PDX A;  2G9H D;  3BYY B;  4YSY B;  3P42 A;  1PGB A;  1QLT A;  1AW7 A;  1XO3 A;  1AHV A;  1ZP0 B;  2MJ3 A;  1EWC A;  3W5V B;  2V3N A;  2K0P A;  2EEL A;  1TY0 A;  3IAS 1;  3W8W A;  4EC3 A;  1RYJ A;  3HRD C;  4US8 A;  3LYY A;  3NVW B;  3AV8 A;  4YWG G;  1MHH E;  1KFY B;  3DED A;  1YJI A;  2W55 A;  2OED A;  1SE4 A;  3MC0 B;  3U52 E;  3IXS A;  3P4S B;  4YTP B;  2SEB D;  1ESF A;  1TJE A;  2JX5 A;  2RDH A;  3IT6 B;  3I9V 1;  1IBX B;  3FW8 A;  5AE2 A;  1JRP A;  1UWX A;  2Y3A A;  2QMT A;  3I57 A;  4OVZ A;  3AEC B;  4C56 C;  1RM6 B;  2INN E;  4A9A A;  2NQW A;  2J52 A;  3ZYY X;  2O3G A;  4D2K A;  2BYT A;  2AQ1 B;  4NAM A;  1HA5 A;  2Q85 A;  4TVY A;  1ACC A;  2FBW B;  5BMI A;  3ZGZ A;  2Q4W A;  1FCL A;  1ZXH A;  2K22 A;  3S1E A;  2YVS A;  4ZOH B;  1OQR A;  1ZOY B;  4TSS A;  5EE9 A;  5T8I A;  5HHD G;  3I99 A;  1KLG D;  2IGG A;  2Q5W D;  1WGK A;  1K52 A;  2B76 B;  3NVZ B;  3AN1 A;  4IKG A;  1C77 A;  4HRS A;  2W54 A;  1EWY C;  2PTL A;  1VZ8 A;  1UXY A;  1FIQ B;  3ETR A;  1FM0 D;  2L52 A;  3AED B;  3NVZ A;  2J42 A;  1FFU A;  1I4X A;  1QOA A;  1XEE A;  4LTU A;  2WDV B;  3BWU D;  3GP7 A;  1MPE A;  2CJO A;  5FXP A;  2NTS A;  3NS1 A;  2AQ3 B;  2JWU A;  1N62 C;  2N7J A;  5C3J B;  1L6V A;  1FD6 A;  3AE1 B;  4RGM A;  4KKJ A;  3H8H A;  1FMA D;  2EKI A;  3D2D A;  3VR8 B;  3Q8E A;  4RF0 A;  1E10 A;  1KH0 A;  3CWI A;  3IAM 1;  1C79 A;  4OHJ A;  4US9 A;  2WDR B;  4BC7 A;  3VRB B;  4ARC A;  1ZDX A;  1MBT A;  1W1R A;  3PQB A;  4RF1 A;  3RJA A;  4MM3 B;  2KQ4 X;  1W1J A;  1HEZ E;  3PZ8 A;  2BTE A;  4PWC A;  3CIR B;  1JW9 D;  2BS2 B;  4KGS A;  2E6X A;  4RGN A;  1N5W A;  2KAJ A;  2WXO A;  2MBR A;  4PWB A;  3LLB A;  4H2A A;  4JWU C;  2Y5P A;  2SAK A;  3BII D;  2J4X A;  3LAE A;  3BVG A;  4P16 A;  3FWA A;  4BCA A;  1SB3 C;  4WUR A;  1YJJ A;  2DWQ A;  1NVI D;  1QOB A;  2VFS A;  5AE1 A;  5FXF A;  1FNV A;  3VTE A;  2JXT A;  3NS1 B;  4B0M A;  2CJN A;  2KAC A;  4WQM A;  1SJE D;  3EGR A;  1N61 C;  2V4I B;  1EU3 A;  4FXC A;  4A6Q A;  3AE5 B;  3NUH B;  1YMH E;  2IPK D;  4ZYS A;  1XCQ L;  4JB1 A;  4KGT A;  2AQ2 B;  1C76 A;  3FW9 A;  1HSK A;  2BS4 B;  4YTM B;  3S1F A;  3DWG C;  4J3O D;  1NEK B;  1JQ4 A;  3TEZ A;  4PVJ A;  3KWL A;  1WWT A;  2WNM A;  2VFV A;  2BVF A;  1YQ3 B;  1YQ4 B;  2M19 A;  2W3R A;  3AE3 B;  1L5P A;  1X2H A;  5G5H B;  1UGJ A;  1FO4 A;  2DYO A;  3U4E G;  4REZ A;  1J7C A;  5TSS A;  4L1B A;  5AWV A;  1BML C;  1B1Z A;  5FKA C;  1ENF A;  2TSS A;  4OAL A;  4PVE A;  5FK9 C;  4GDL B;  1V97 A;  4R3D A;  2Y3R A;  2QJL A;  1K51 A;  3W2D A;  3PO0 A;  3FIL A;  3BK1 A;  1VR9 A;  1FEH A;  5E6J A;  3TEX A;  2GQU A;  3O13 A;  1XF5 L;  5G5G B;  4OZB A;  4NZL B;  5FR3 A;  3BVZ A;  2WXM A;  3POP A;  4HEA 1;  1FFV C;  3PZ7 A;  3AE6 B;  2L32 A;  5L6G A;  1FCC C;  1ZXI A;  1T3Q A;  1GPX A;  2LEK A;  2P3H A;  3LB8 C;  5D7G A;  2WXQ A;  3AB5 A;  3W5U B;  3HVD A;  2IPI A;  5H8Y E;  3AH7 A;  3SEB A;  3C0P A;  2BT6 A;  4USA A;  1KRH A;  4OZA A;  4P6V F;  2PLP A;  1TY2 A;  3WCQ A;  3TX1 A;  3V05 A;  4DXG A;  1VRA B;  4WWM A;  3IT4 B;  1CJE A;  3B9J B;  1I4R A;  4ITK A;  1F77 A;  4XE0 A;  4IOI E;  1HXY D;  3MP9 A;  5LNK 1;  3Q8A A;  3ZJT A;  1YN4 A;  2NMQ A;  2VZK D;  1YN3 A;  3URY A;  1GB1 A;  4N58 A;  1UWM A;  1TS2 A;  1JAL A;  2WS3 B;  3EA6 A;  1CQV A;  4GLS C;  4C7Z A;  1C4P A;  3U7Z A;  2WXP A;  4TVW A;  2JSV X;  3Q8F A;  2WU5 B;  5G5G A;  1FXI A;  2PVG C;  4L23 A;  2IGH A;  5AUI A;  1L6U A;  2QIL A;  4CQN A;  1R7S A;  1QOG A;  3Q8C A;  1F2R C;  2ACZ B;  2PW9 A;  4JWS C;  3AEA B;  5HG2 A;  1WVF A;  3A7U A;  3W8Z A;  3P4Q B;  4WAF A;  1QT9 A;  2E5A A;  4UDU C;  1SSN A;  2RDG A;  1FXA A;  3Q8B A;  1N5W C;  1TS3 A;  1T3Q C;  2MJD A;  1MBB A;  1ZXI C;  1DIQ A;  1DGJ A;  1CZP A;  1YNT E;  2VFU A;  1D5X C;  1XLN A;  3R2I A;  2DYM A;  5D3D A;  1QF6 A;  2LHD A;  3DQ0 A;  1D5M C;  3AEG B;  1DZN A;  2QPM A;  2Y3S A;  1AHZ A;  2D5G A;  2LMC A;  2YEP F;  2WXN A;  3T3N A;  1D4B A;  2GQT A;  4BC9 A;  1LO5 D;  3C8Y A;  2FE8 A;  1Q10 A;  3BK2 A;  5HI1 A;  2PMV A;  1OQQ A;  1L0Y B;  3MJ5 A;  1I19 A;  2WDW A;  2Z8L A;  2GB1 A;  2QIE B;  2INP E;  4ZRQ A;  3T3O A;  1E8F A;  1W1K A;  4XLO A;  3HSU A;  4HKQ A;  1AN8 A;  1TKE A;  2BBC A;  2IJ0 A;  2WXF A;  2K9X A;  4TQ1 A;  4A90 A;  2ONQ A;  2RMM A;  4XWT A;  3EUB 3;  4DQO C;  2HDE A;  2JU6 X;  1E0Y A;  2WXL A;  4MAC A;  3ZQ4 A;  2ICI A;  4C80 A;  1E0Z A;  2M0A A;  1B9R A;  1F2R I;  2N9L A;  4XDC A;  2KWD A;  5C2T B;  3TEW A;  1KTK A;  5FXE A;  1ZDV A;  1DII A;  3W1S A;  2N0S B;  4MH8 A;  1SB3 B;  2MEK A;  2OAI A;  1FRD A;  3NRZ A;  2WXR A;  4KGR A;  1FNW A;  4PVK A;  1N5X A;  2N9K A;  4LLG M;  1E7P B;  4NAW B;  5HFY A;  1TKY A;  1F0Z A;  4NJC A;  3ZJU A;  2XNA C;  3W8X A;  1ROE A;  2Y08 A;  3AE2 B;  2OHF A;  1VZ6 A;  3NVV A;  5G5H A;  3TSS A;  2PLS A;  5ADZ A;  1W1M A;  1DYQ A;  1JWM D;  2JQR B;  1W1S A;  2DLB A;  4ARI A;  4KKI A;  3AEE B;  1QOF A;  1TZO A;  2M56 B;  1N60 C;  4KX6 B;  4N59 A;  1I4P A;  4O95 A;  4OZC A;  1L0X B;  2VFT A;  2IDY A;  4HJG E;  3HRD D;  1V1O A;  1SEB D;  1MVK A;  2JZP A;  4B0E A;  2JYT A;  2KDM A;  3R8B A;  2VAO A;  2H89 B;  1VJK A;  5HMR A;  1HZ5 A;  2JYE A;  4JPS A;  3S1C A;  4YXD B;  1P7E A;  3SR6 B;  1KLU D;  2LGI A;  1QQR A;  1QIL A;  1WYG A;  4YSX B;  1I4Q A;  2FUG 1;  3SR6 A;  4RGT A;  1ET9 A;  2LFI A;  3V3X A;  2WXG A;  5EE0 A;  3AE8 B;  4AS1 A;  1AWD A;  2WXI A;  2MJE A;  1C4A A;  4IDI A;  2EXR A;  2P13 A;  2WU2 B;  1FFU C;  4TMA B;  3D2H A;  1K53 A;  3AEF B;  1P7F A;  2H88 B;  4JAY A;  1PUT A;  2GRI A;  2VFR A;  2K3U A;  5BYS A;  3DWM A;  3SFD B;  5JXV A;  2W82 A;  3R2T A;  4YSZ B;  1N63 C;  1M4V A;  1GOZ A;  1MI0 A;  5AUK A;  1IBX A;  3FW7 A;  3GSY A;  1JWU D;  1E9M A;  4GDK B;  2WP9 B;  4C7Y A;  2R61 A;  3MFG A;  4BBY A;  3RPF C;  2WXJ A;  2I2Y A;  2PKO A;  2MH7 A;  2X38 A;  3E56 A;  2UUU A;  3RFZ B;  1N61 A;  2DBY A;  2L83 A;  5GXG B;  3B9J A;  4PYT A;  3NRZ B;  3TEY A;  5I4D A;  1FRR A;  2PVO D;  4XDD A;  1ZUD 2;  1RFK A;  4RNA A;  1AYF A;  4RFB A;  1IGC A;  4RH6 A;  2R2Z A;  3MHZ A;  5HHZ A;  5BYR A;  2QKN A;  1BUI C;  1D5Z C;  1VZ7 A;  3BZD B;  4PZF A;  3R07 C;  2BW2 A;  5EE1 A;  3RJ8 A;  1FNU A;  3AEB B;  3Q69 A;  3KJM A;  1J7A A;  3BVM A;  1C78 A;  3GB1 A;  2XN9 C;  3UI3 A;  1XLQ A;  2V0G A;  1IGD A;  3N9Y C;  1W1L A;  3FIL B;  2CU3 A;  1SIJ A;  1QLB B;  2KN4 A;  3NVW A;  5K8E A;  1UUP A;  3E9S A;  3D2J A;  2WQY B;  2I38 A;  3W9C B;  2G1E A;  2I0K A;  1I4G A;  2LJI A;  2VZK B;  3ABV B;  1PGA A;  1ZE3 D;  4MT5 A;  1N62 A;  1JWA D;  1JML A;  2HTM E;  1C9F A;  1L4Z B;  5HQX A;  3P4R B;  2GI9 A;  1SE2 A;  4HG0 A;  1YN5 A;  1EM7 A;  2WLB A;  5D79 A;  4ZHO A;  1GAQ B;  1JRO A;  5EE3 A;  1N63 A;  3NZ3 A;  3LXF A;  4HRO A;  1DOX A;  1E8G A;  2Y5C A;  4A55 A;  1F0X A;  1VAO A;  3GS2 A;  1UNS A;  1V1P B;  2YEP B;  2QEJ C;  5BMH A;  1PYW D;  4RGO S;  1WXQ A;  1E8H A;  1JCK B;  1VDV A;  1SE3 A;  5FXD A;  1NI3 A;  1V1P A;  5D3I B;  2ZW0 A;  3FAH A;  2WDQ B;  4HKZ E;  3KWV A;  4ZRP A;  5H92 C;  1ZR6 A;  4YT0 B;  4PVH A;  2AX5 A;  3NVV B;  1WRI A;  1E6E B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...