2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
1XLQA 3VRBB 4PZFA 1TKEA 3AMZA 3SR6B 4FXCA 3A7AA 3B2FA 2G1EA 1HSKA 3AE5B 4XLOA 5AE1A 1OQQA 2K5PA 2YVSA 1QLTA 2QKNA 1JROA 5C3JB 3C0PA 4US9A 1YJIA 1FRDA 1OQRA 3AEDB 3AM9A 2K22A 4UD8A 3NVYB 2PVGC 1EWYC 3VR8B 1F0ZA 4N58A 1SB3C 2PKOA 1IUEA 3AE2B 5G5GA 1QOFA 1WXQA 4HG0A 2WS3B 3S1EA 3PO0A 2WP9B 3WCQA 2VFVA 2AX5A 3B2GA 1W1OA 1NEKB 1W1SA 3CIRB 3TSHA 1W1QA 5EE0A 3A7RA 1ZUD2 2OAIA 1ZOYB 2CU3A 3NVWA 3NS1B 2L83A 3DWGC 4BBYA 2GQUA 4YTNB 3DQ0A 2MH7A 3B9JB 3FWAA 1OFFA 4ITKA 1X2GA 3P1MA 2WU5B 1XLNA 1YQ4B 4YT0B 2P13A 2PIAA 2B76B 1XLOA 2E3TA 1FFUA 2BS4B 3RPFC 2NQWA 5H8YE 1W1MA 3A7UA 4BCAA 1UXYA 3FW8A 1A70A 1N63C 4JWUC 1FFVA 3L4PA 4PVEA 4P6VF 3AE4B 5HHZA 1N61C 3DWMA 1WRIA 2PLSA 2W3SA 4C7YA 1VAOA 2W55A 3FW7A 2M56B 2Q85A 2BVHA 4IDIA 1J7CA 3JS8A 3AEGB 1X2HA 2VAOA 4ZHOA 1UWMA 5AUKA 3P4QB 3S1CA 4BC9A 2W3RA 5FXFA 3EUB2 1NENB 2Q5WD 5D79A 3HRDD 3W8WA 4HROA 1QT9A 5MPOA 1WVFA 1DZNA 1FFUC 2WQYB 2QJLA 4YTPB 2HTME 1N60A 2P3HA 4YSXB 1VQZA 1FIQA 1FXIA 1TKGA 2BS3B 3NVWB 1QOAA 5G5GB 2AXRA 2BS2B 2WU2B 3P4RB 3AEFB 1SIJA 2H88B 2MJEA 3B9JA 1RM6C 1TKYA 5AUIA 1TYGB 1FXAA 5EE9A 2OHFA 2MJDA 1NI3A 1AHVA 4JX1C 2JQRB 4BC7A 1JWBD 1AWDA 2O3GA 4JB1A 5G5HA 2Y5CA 3HVZA 1RWSA 3FW9A 3NVVA 3W8ZA 4YSZB 5HQXA 2P4PA 1L5PA 1ZXIC 1W1LA 3ABVB 1E6EB 5EE3A 1YQ3B 1ZR6A 1GPXA 3D2DA 4TVWA 1E8FA 4PVKA 3NRZA 1N60C 4PWCA 5FXPA 1E9MA 2KAJA 1JWAD 1L6UA 2WLBA 1XO3A 3AN1A 3NS1A 2L52A 1V8CA 4OALA 5FXEA 1FM0D 3SR6A 3PM9A 2RK5A 3VRAB 1KFYB 3KJMA 1YJJA 1FO4A 3LB8C 3NVZA 2VFSA 2WDRB 1AHZA 3D2HA 1QOBA 2MJ3A 3AE7B 2PLIA 1N63A 4YXDB 1V97A 1KF6B 5FXDA 1MBBA 1DIIA 1I7HA 3KWLA 3AE3B 1WVEA 4PVJA 1J7BA 2BVFA 3AEBB 4DNSA 3NVYA 4TVYA 3SFEB 2KMMA 2VFUA 3NRZB 4WWMA 1T3QA 1R7SA 3CWIA 1WWTA 1DIQA 1TJEA 3VR9B 3SFDB 2K9XA 5G5HB 2QIEB 1KRHA 4ZOHB 1NYRA 5GXGB 2MBRA 2LEKA 1W1RA 3AE8B 3I99A 1JQ4A 1B9RA 5EE1A 3AH7A 1WYGA 4JAYA 1E0ZA 3FAHA 1AYFA 2N0SB 5C2TB 1E8GA 1J7AA 1QLUA 3ETRA 3AECB 1DOIA 2VFTA 4PVHA 1SB3B 3P63A 4N6EB 3ZYYX 2FBWB 3HUIA 1NVID 1MBTA 3TX1A 3W5UB 1VJKA 1PFDA 4US8A 3VTEA 2QPMA 2R8DA 3AEAB 4LTUA 1ZXIA 1N5WA 3EUB3 1W1JA 1CJEA 1PUTA 1L6VA 1NYQA 1ZP0B 1JALA 4PYTA 4C80A 1N5WC 3NVVB 2CJOA 1FFVC 3S1FA 3ETRB 1RFKA 2H89B 3LXFA 3DEDA 1N61A 3W5VB 1E7PB 1N62A 4ZOHC 1JW9D 2ACZB 1E10A 3FC4A 2CJNA 1QOGA 1ROEA 3LLBA 2EXRA 5HMRA 2PVOD 1DOYA 3NVZB 3AB5A 3AEEB 1T3QC 3GSYA 4ML8A 4N59A 4EC3A 4YTMB 5AE3A 3D2JA 2EKIA 2DWQA 3AV8A 1E8HA 3S1DA 2E5AA 3TSJA 1FIQB 4KX6B 4O95A 1JRPA 4USAA 1RYJA 3AE9B 3AE1B 4HRSA 1PDXA 1VDVA 2GQTA 1FRRA 2W54A 1L0VB 2WDQB 3LAEA 1RM6B 1W1KA 1DGJA 1F0XA 1SF0A 2Q4WA 2VFRA 4ZHPA 2BT6A 1N5XA 2R2ZA 1FMAD 1CZPA 3W9CB 2M19A 1VLBA 5H92C 1N62C 3AE6B 4WQMA 4PWBA 1I19A 4C7ZA 3P4SB 4MLAA 4YSYB 4JWSC 3BW7A 5ADZA 2JX5A 1DOXA 1AHUA 2WDVB 1QF6A 3R07C 2I0KA 3HRDC 4A9AA 3BIID 1QLBB 3W8XA 5AE2A 1WGKA 1XLPA 2DBYA 2BVGA 3P4PB 1GAQB 1E0YA
chains in the Genus database with same CATH superfamily
2C7MB 2OFJA 2W9BA 3RNCC 5L1IA 1ZQAA 3VRBB 4IHCA 2C5LC 3HVDA 4OCZA 3L16A 3A9KA 5HMLA 1HQRD 2KT7A 3ZLZA 3EJDB 3AMZA 4J9LA 2G9HD 2QJNA 3QFBA 3AUOA 3VCNA 3PHWB 4NL9C 2GBMA 3VCCA 3A7AA 3RYTA 3E56A 2A1JB 4FFDA 1T0SC 3DVGX 4EFOA 5AE1A 4MKSA 5J2IA 3RJIA 3AXCA 5J0PA 4TMAB 2ICIA 2LUMA 4H83A 1GRFA 3PQBA 1BNOA 1Q8KA 3VCBA 4CNQA 1LVHA 9ICAA 4GIVA 1WUEA 2QKNA 3MSYA 1RFAA 1X6JA 3IBEA 1NZBA 4YR2A 3NTUA 4NAMA 2KFKA 3NG0A 4HN8A 3VTWA 1NK0A 3PO4A 1E8YA 3PREA 1FRDA 1P98A 3D32A 2K22A 1F44A 2PVGC 3VR8B 1F0ZA 3KUMA 4N58A 2ONQA 2PKOA 3DJJA 2KZZA 3IVFA 3SV3A 1QKZA 3ZJTA 3BK2A 1WFYA 1B0XA 2HDEA 3GOEA 1OGWA 4A6QA 4HG0A 3PSIA 2N9KA 3CW2C 2AGQA 5DQHA 1F52A 4NV0A 5CJ7A 1VZ6A 3PZ7A 2KJHB 3GD6A 1WCLA 2JGAA 3RH4A 4PGQA 2R18A 2XY7A 4IOIE 1RVKA 2GR1A 4Y2UA 3RITA 2VA2A 2AX5A 4J9PA 1L7MA 3DBRI 2G4SA 3B2GA 4MGZE 4F2SA 4P16A 3IJIA 2YB4A 3LYSA 3IJQA 2J0KA 3CIRB 3DIPA 3TSHA 3LB8A 1DK2A 4Z6CA 3U26A 3Q8FA 3TEZA 3EYZA 3F2CA 4BFRA 2VZKB 2R2OA 2ZW1A 4XDCA 1SIFA 2WWZA 4JK1A 2CU3A 3NVWA 1Z5SB 3BYTB 3PHXB 3QC8B 4O3SA 2HOQA 3NS1B 2L83A 3KQ4A 3HKZC 2KIVA 4M47A 4BBYA 4KT2A 5J29A 3DQ0A 2KOBA 4YMNA 3DK9A 3ES8A 3EPGA 3DEEA 1NK6A 2MH7A 3B9JB 4DF8A 2PP3A 1XWLA 2K4HA 4KLHA 1B22A 3C1YA 4HYRA 4H4ZA 3MR2A 1TT5B 1X2GA 1X2IA 2YLMA 4P0QB 2WU5B 2RDJA 3AU4A 5HFYA 5DQGA 2PFPA 4HKQA 1SL0A 3H1UA 2D6FC 1YN5A 2ZTCA 2HQMA 1HJPA 4NQKE 4W9LA 5L1MA 2BPGA 1CUKA 2FAZA 5L95C 3ALBA 2K8CB 2ASJA 5ALOA 4ECWA 3QWZB 2E3TA 2FNJB 1RZTA 4CQNA 5D3DA 3RPFC 2NQWA 2PS2A 3FILA 2GL5A 2FPMA 3I5JC 1P3QU 4HPPA 4FBUA 3TARA 3RJHA 3A33B 5CWRA 4FZNA 3MGHA 3GRSA 1A70A 4QWCA 1H4RA 9ICTA 1ELSA 4JWUC 1F2RI 3FYYA 2IHMA 5JCIA 5CP2A 3FYHA 8ICFA 1ZQFA 5IINA 2G08A 4J3OD 1GXFA 2WPFA 4BURA 4MEXA 1N61C 5TR3A 2KTRB 2KDIA 1DXLA 3HJEA 1S8OA 1PVPA 2NBWB 2N4FA 2RQ5A 4F5RA 4EUTA 4KGTA 3FW7A 3UM9A 4GLXA 4JPSA 3DK4A 3TFSA 4PL1A 3THVA 1C76A 2BQRA 4DHGA 2D5GA 5DPWA 3L5KA 4U6PA 1B4FA 2IOHA 4BJQA 1A5RA 1X2HA 4EQXA 1QSLA 1T94A 5AUKA 4RPYA 5DLGA 3PW0A 2QQ6A 3P4QB 1ZJNA 4ZYSA 4RQ4A 5CR0A 2KMCA 3S1CA 3URHA 3C2KA 1J8CA 2YX8A 3EUB2 5D79A 4P4PA 2J42A 3W8WA 1KD0A 4HROA 1QT9A 3UF8A 1W6TA 2GOLA 5DDYA 5GMVA 1WVFA 4HK2A 1BPZA 1FFUC 4YXJA 5J0UA 3WK5A 4YTPB 3AULA 3ZTDA 4DL7A 2TPRA 1SE9A 3QX7A 3U4EG 4J9OA 2HXTA 5IAAC 4GGHA 3ZVHB 3DPDA 5KG3A 1TKGA 3APFA 4PZOA 3L17A 3ZO5B 3DVNU 5KT7A 3MGIA 1PVQA 2DW7A 5DB7A 1N6ZA 3QXGA 3N20C 2R8JA 2RDHA 2LZ6A 1GJZA 1XNSA 2OOBB 4DHZE 2WU2B 3CXOA 2GBRA 2XSXA 3JVAA 1SIJA 5ALLA 4NLNA 2VJ5A 5EDSA 3EJEB 4F91B 1SXEA 1E7VA 2I1QA 1V9PA 1GB1A 4H19A 5AKXA 1XD3B 1SWWA 2Y5PA 2KN4A 4TQRA 5JCMA 1J2NA 3OC4A 4NQLB 4RQ5A 3N7PD 3LXDA 2OH2A 3L08A 4EMWA 3F2DA 1ECQA 3SJNA 2KANA 1XS2A 3ZRFA 2O3GA 4JB1A 2MUTA 1WGHA 3KH0A 1F9CA 2KKVA 2V4IB 3WK8A 3IN5A 4A8EA 2R8HA 2KFNA 2WX1A 4UB6U 4P7IA 4YSZB 3W8ZA 5HQXA 2R8GA 5U1OA 4ZH4A 2JXTA 5DB8A 1Z00B 1YQ3B 2HE7A 4S17A 2XH2A 1ZQQA 1I4HA 3DGHA 2A4ZA 2K6DB 3U52E 5HHDG 2N1VA 4ASWC 2CFYA 2KHVA 4IR9A 4P1CC 4BAXA 4ZA0A 4J03A 1OXJA 4F71A 2QB0A 2O6KA 2NRTA 3TAQA 4JN7A 3EHVA 1ZQWA 2M9NA 4JMUA 2HDOA 5KL1B 5KAFU 4H4UA 2LGDA 3HT3A 4MACA 5JUMA 3ZDCA 4X57B 2W43A 2UWQA 1IBXA 4BOSC 3ZXVA 2HHQA 2JK6A 1X40A 5TZVA 5AM0A 2M17A 2X8GA 2FLNA 1KH0A 3Q8BA 5J0QA 1L6UA 3D9XA 3IHPC 4QW9A 2WLBA 4XX5A 4DFPA 2RLTA 1UT8A 2J53A 4TUQA 2DYOA 3E9SA 3AN1A 4K3BA 3VTVA 1ONFA 2EZYA 2PMZF 2L52A 4ENLA 2JV3A 6ENLA 3GIIA 1CRXA 4I2IA 4CHKA 2O6VB 2REXA 4C8MA 3MFGA 4IKGA 1SE3A 5DB9A 5ALWA 2WOWA 2NR2A 2Z0DB 2IJ0A 2EQ7A 4ECTA 4F7ZA 3VRAB 1WCNA 1KFYB 2WXFA 3U30A 3KJMA 3T4WA 4O5EA 1PK1A 3DK8A 4UAYA 4OD0A 2BCUA 2KD0A 5KFPA 2ZUCA 2H3QA 4RM8A 5JHBA 3CAWA 1S10A 2EH9A 3PV1A 2KE7A 1Q0WB 1NPXA 5C5JA 2HW3A 5EWGA 1C77A 3BJSA 4PHPA 2BPFA 1QILA 1N63A 3X0WA 3R25A 1KEJA 5FXDA 3SDLC 1KRPA 4CE6A 4O5KA 1I7HA 2LI6A 4M9JA 4GRTA 2XVTA 3LDAA 1Y88A 2I6XA 3IM1A 4PGYA 5KFQA 3GE3C 5F9NA 1FEBA 8ICWA 5FR6A 1ZMCA 4IL0A 4DNSA 5FJRA 4DDGD 2KMMA 2AAQA 3TIXA 2ZADA 4J3ZA 4M52A 1UH6A 2ZIUA 3A1QB 1L7YA 3DVGY 5AI0A 5L6FA 3LJ3A 1U48A 3ZQ4A 3BVGA 4DQQA 3SHQA 4GGQA 3RRHA 3Q8CA 2PW9A 3R1ZA 3C23A 4PL2A 5C0YA 3VQIA 4ZDVA 4FI4A 2LMCA 3I6EA 1B43A 4ICVA 3H8JA 1QTMA 1MQ3A 2CR5A 2W0HA 2B0CA 3I63C 4NLBA 3IG5A 2BKRB 1NYRA 2GB1A 2N7JA 4OZCA 2DKZA 4DL6A 3H8SA 5J0SA 4J9KA 5GXGB 3RNAC 2ZIXA 3ZIMA 5J0YA 1SL2A 2DENB 1F8WA 2MEKA 4H2AA 1W1RA 4LDTB 3I99A 4F72A 1SJDA 4LJXA 2AU0A 1JXLA 4RCOA 1Z19A 1XXGA 1WX8A 4ELVA 3C28A 1E8WA 4QZCA 3BK1A 3H8MA 9ICSA 1QQ6A 4OJ5A 2N9XA 3UMCA 5C2TB 1J7AA 3H8WA 4MFAA 4DL2A 5IIKA 2EQYA 3AECB 1GOZA 4PVHA 2KP7A 3K1RB 2WFAA 2GQWA 5L1JA 1U49A 4ACOA 4RT3A 3HUIA 4UBCA 4F4ZA 4GN1A 4MSQB 2F3NA 1EO6A 2F8KA 1T0QC 1DXSA 3QUCA 2J52A 4IWPA 3PFRA 3APDA 3UJRA 5ALVA 5CA7A 1R4MI 1SV0A 2NPTB 5KG7A 1VJKA 2OZTA 3MHZA 3FCPA 3PY8A 2IHNA 5KFKA 3PSPA 4US8A 1E90A 1PFDA 2L3ZA 3MC9A 1GRGA 2K4IA 3C8YA 2QARB 1CEZA 4QW8A 2FCNA 4A90A 3ZDTA 4K7WA 3TFRA 4M0AA 1MA7A 2K1FA 3DDHA 1M94A 4IP4A 2B6GA 3PX6A 1AQ6A 2AHOB 2K89A 2LJIA 5DBBA 1UCVA 4B95A 4A55A 1F0MA 1Q1RA 2LMRA 4BDPA 1V9JA 4S0RA 2ZNVC 4BKGA 4K8DA 3URYA 5JCKA 3ZW3A 9ICPA 1WYWB 2AL2B 5IIMA 2Y4GA 5KVIA 2NRWA 3ZDDA 3QE9Y 4F93B 1N5WC 2UVUA 5J2BA 1RLFA 4ICUA 2IBIB 2ZIVB 2SEBD 2K6QA 3UI3A 4JWMA 3DG6A 1IYFA 2GSHA 3WU2U 1SBBB 4RM9A 2OKTA 8ICPA 3QAQA 1ET6A 4E3CA 1C3TA 1T8EA 1C7YA 3CRXA 1BUIC 2L76A 4JE3B 4F50A 2JRZA 3LK9A 2CJNA 2Z0EB 3SN0A 2KDBA 3V6JA 1ZDLA 4I2AA 2P0IA 2QJMA 2INPE 4IL2A 4K81A 3PSFA 2G5IB 2CXYA 4KZ0A 3NVZB 3V7JA 4YWGG 4WQOB 1KBUA 5AKGA 2KZMA 4GYPC 1T3QC 3GSYA 3RH6A 2G09A 3W2DA 4MMWA 3RJ8A 3FXGA 3IK4A 4RPZA 1D5ZC 3D2JA 3GDXA 2VJ4A 2DWQA 3VTUA 7ICIA 4H4TA 4OW0A 2D07B 3AV8A 2IO2B 1JCKB 3KYCD 1E8HA 1AROP 5KG1A 3PW7A 4LNNA 3OJ4B 3N1XC 3VFKA 4P2HA 2GI9A 4EEKA 3CYJA 2F1JA 3AE1B 2KO3A 2M0AA 9ICXA 4QIWC 2CHZA 1VDVA 4NAWA 4NJ7A 4URKA 4CF5A 1XQQA 2DNFA 1MUCA 2MUCA 3STPA 2WDQB 2RHFA 5AHXA 3DFHA 5G2NA 3R66C 1UD7A 1D8BA 1R4NI 3DDCB 4WWNA 4II2B 1UBIA 5ALKA 3GILA 4NEVA 4A35A 1ZW7A 3ISCA 3PVXA 1W1KA 1T6BX 2WPCA 2Y9TA 4W9JA 1SF0A 2DZKA 1E5WA 1FEZA 4Q43A 1SKSA 1IM4A 2INCC 3UINB 4RNAA 5IN7A 4AYBF 8ICXA 4DQPA 2N1RA 1KDHA 1JWUD 3GFKB 2DHZA 3EKGA 1TK8A 5J2EA 3RZFA 2WF9A 2ZW0A 3VUWA 1GRHA 3J9CA 2GGEA 2QMTA 2ISOA 5AEKB 9ICHA 9ICGA 1NBFC 3RNBC 2I38A 1NHQA 3H0RB 9ICUA 2RRDA 1V81A 2GWSA 1N62C 3WK7A 4I2GA 3JSVB 3QPEA 4FN2A 3D47A 2W8KA 2CHRA 4PWBA 1I19A 4IRDA 2ES6A 3N4MB 2R2QA 2OLAA 1SEBD 2WAQF 2V4QA 4W9GA 4C7ZA 1GC6A 4K2SA 4EZLA 4YFKA 2MA1A 1S97A 3BDPA 1VZ7A 4MLAA 1IXRA 3M63B 3T8MA 2LM1A 5ADZA 2H3FA 3M9OB 2JX5A 4OVVA 2WF6A 2XCAA 2IY0B 5HP4A 4L23A 4W9KA 2OX4A 3RI7C 1L3UA 3WANA 1OEPA 3VH3B 2RD0A 3BY4B 3DCGA 3NO1A 4J6IA 2AYOB 1QF6A 5KFOA 4GDLB 3HRDC 3UJEA 2D3AA 4KLSA 2O56A 2I5QA 1NK4A 4JUZA 4O5CA 2Y0SF 8ICUA 1T5XD 4EBEA 1IV8A 3SU8X 1L7PA 1WGKA 2IDYA 1S0NA 4KLJA 2NMQA 2DBYA 2BVGA 1JPDX 7ICFA 1GESA 3UJ2A 1NK9A 1E0YA 1SKWA 2ZXHA 3PW5A 1PVRA 1ZX9A 3JPSA 5KVHA 3PWGA 4ECRA 5HG2A 4XC2A 4KLMA 1Q46A 5AICA 2ZXIA 4PZFA 4M0WA 3FV9A 7ICSA 3KD3A 4AYBC 5D46A 5KG0A 2HTHA 2PEAA 9ICWA 4XA5A 5BPCA 5L1LA 3HM6X 3ZI4A 4GLSC 1LXDA 3DBHI 5BYQA 5E6PA 2X8XX 1BMLC 4YR3A 3B2FA 2F8LA 3HPFA 2G1EA 3AE5B 5EBKA 1EU3A 4F5NA 5E6NA 3RCZA 4ZRIA 2W9CB 2UYZB 1QQ7A 2YVSA 3UQ2A 2KMDA 2GO7A 3GIMA 2BCVA 3OJ3A 4ED6A 2EQ8A 2JH1A 5J0WA 1WR6E 2FCQA 2L1AA 2G0AA 2IYDB 5C3JB 3C0PA 3IAM1 4GFIA 2V4RA 2D11A 3PX0A 1SGHA 3LVVA 3C2MA 2M4NA 3N30A 2YQUA 1WGRA 1YJIA 9ICIA 3AEDB 1F2RC 1SKRA 3CNHA 2K39A 5DPSA 1EWYC 1BPBA 2KJ5A 4RNOA 2AQ2B 4DBGA 2LI5A 1P48A 1WRDB 3OW1A 2L0TA 1IUEA 3TANA 3PRPB 1H2IA 2ONEA 1UNSA 5IP4D 3KKAC 5J2HA 3GU3A 2YTUA 3ZDBA 4HKZE 3PO0A 4DXAB 4HDQA 1PZNA 3HSUA 1SE4A 2V4LA 2GLEA 1BQGA 2BR0A 1NHSA 3QU9A 2FKPA 1C79A 4NLZA 1XO1A 1BPYA 2QARA 2L5YA 3DVNV 4KEMA 3ED5A 5J2JA 2KLCA 3GV8B 3N28A 3DERA 3R9KA 4FZLA 4H4SA 4OJ6A 3OZMA 2WXLA 4LLGM 1KSPA 3LYYA 3CMMB 4C4RA 2FMPA 3MABA 2AL2A 4BXOB 2KTQA 2G4DB 1WZ0A 1FEHA 2QGYA 1TYPA 2KC2A 3QIJA 1ONEA 5J0OA 5AK6A 1MHHE 1JMLA 4ED0A 3WK9A 1STZA 4E8GA 1RRBA 3S2AA 5D2MB 1C78A 4ED8A 5LLIA 1XEEA 3RNMA 3FWAA 3T9LA 4YL8A 1FXTB 1OFFA 5KT3A 4ITKA 4RQ6A 5IO9A 3KKAA 1ZQSA 2HNEA 2K25A 3PR5B 1PGXA 2G45B 3QUBA 3BZDB 1BPXA 1PDZA 7ICKA 3UGBB 4AQ7A 1D4BA 3RAQA 4JV1A 1WI0A 3VAWA 1AOGA 2P13A 3T5HA 1GERA 2K0PA 2YMPA 4G3IA 4M04A 1SSNA 4H2HA 3DBLI 3C2LA 3N3KB 1R6WA 4WJOA 3LVWA 1FFUA 4IRKA 5KFZA 2PTZA 2ZG6A 4EBCA 1K1SA 1X6IA 4K3CA 3VUXA 2L7RA 1GC7A 1W1MA 3A7UA 4J9SA 4GDLA 3VDZA 3UPQA 7ICMA 3EECA 3BOXA 3QARA 1WMHA 4PVEA 4QJFB 1PK3A 1WXMA 5K4LA 2WYQA 4DF4A 3QU5A 3DWMA 2BW2A 3TMPB 2BB5A 3EANA 3OP2A 2BB6A 4MF2A 4YXMA 2M56B 2BVHA 2ZZ0A 4FHKA 4C0ZA 4ZRQA 8ICHA 4GC7A 5AIAA 4UAWA 3GV7B 1UA0A 1J7CA 1K51A 3AEGB 1LQBA 4KGSA 3ML9A 1Q1WA 4WH4A 1UPHA 1UWMA 7ICEA 5CHGA 4K7UA 4P4MA 4IQVA 4YR0A 4YVZA 5ALNA 2Q5WD 2KOXA 1VCBA 4EQWA 1STEA 4CCHA 2BZFA 1YX6B 4GDKA 5KFJA 2WQYB 4GXBA 2MNRA 3Q8KA 2QJLA 1RG6A 1F5SA 4AOFA 4TKNA 5ALRA 2JMGA 3DV9A 5IIIA 2QVHA 3IJLA 4YSXB 2HOFA 2OZ3A 4JV2A 3NUQA 4JV0A 1FIQA 2YEPB 1AARA 4EYHB 1FXIA 5KFEA 3ZDAA 2MRPA 3R10A 3BINA 1RXVA 3PW2A 3NVWB 1QOAA 4NXZA 1U4AA 3EW9A 2H3ZA 4DS5A 3H8HA 1LM8B 4XWTA 4ED7A 1NKCA 2AXRA 1Y56A 3TKAA 4KITB 1X66A 3MHSD 4DSIA 1LKYA 2LYAA 2H88B 4G7FA 3I57A 2E1FA 2ZIXB 3DG7A 3B9JA 1TKYA 4FJZA 4JL9A 1TZZA 1OUQA 1BWCA 4IW0A 5AUIA 1TYGB 5EE9A 1FXAA 3SD5A 2OHFA 2HJ8A 2PMQA 1NI3A 3GIJA 4QZBA 2PPHA 5KFAA 4G0NB 2B3AA 2AEHA 2JQRB 1IYXA 4K7ZA 4KLEA 3Q6BA 1KLGD 2R9ZA 3DDMA 2NO4A 2JH7A 4B9TA 3KUDB 4UASA 3HPOA 3ZUNA 1IP9A 1YX5B 1TY2A 3NVVA 3FW9A 3TJIA 1UT5A 3WAPA 2P4PA 3B1LX 1L5PA 1SL1A 2KSOA 4XGAB 2NVKX 4EQRA 3ABVB 5D6JB 2PI4A 4FP1A 2GH5A 4BBNF 2H5XA 4EX7A 5J8YC 5CHWA 2ALZA 4QZIA 3KZIU 1ZR6A 1ZQEA 3KZXA 4MH8A 2CRXA 3IDWA 3V61A 1GPXA 3MBYA 3H4BA 4KIKB 4MJSA 1ACCA 4W9FA 4MGGA 9ICRA 4BWJA 4PVKA 5EU9A 4ZRKA 4A3OA 3Q69A 1N60C 1YZ7A 4FBTA 1TKDA 3OJUA 4Q44A 3PVLA 3U8ZA 4A8XC 3RJGA 2JXJA 2PMVA 3PV8A 2W04A 2J6TA 2Y1JA 2HHXA 2WF7A 1L5UA 2HTME 3NRWA 4M02A 4ICAA 3PO5A 3GZFA 5BOLA 8ICGA 1D6EC 1EF1A 3G6VA 4I2EA 2W7OA 2QAEA 8ICMA 1FCCC 4ECXA 2YMMA 4KSKC 3JPTA 5KFYA 1FD6A 4R64A 4DLGA 1F1HA 1XO3A 2V1YA 1HIWA 1TKKA 2BGWA 3SD7A 2HJ1A 3WAOA 4XE0A 5JHAA 3TWBA 5DPTA 2NBVB 3O65B 4FX9A 1HZ6A 2JF5A 1ZQRA 4B9MA 4GYPA 3DESA 4EZ6A 2XH7A 3SR6A 5HHIA 1KW4A 8ICYA 1JCTA 3ZVHA 1ISNA 1YJJA 1WZ3A 3R8BA 3NVZA 2F2AB 4FS1A 2WDRB 4M8NA 2VFSA 3QEBZ 1QLNA 3PLUA 1L3VA 1E8XA 1XT9B 3CSTA 3AE7B 4ECSA 1I4QA 3RD2A 1P7FA 4UB8U 4JDRA 4B9VA 1L8LA 1JEHA 3RUIB 1ZQVA 4BVUC 4Z6FA 3OHAA 2WXHA 1V97A 4YXDB 4NLKA 1DIIA 3KLJA 3KWLA 7ENLA 2ZPNA 4EZ9A 1YZ6A 5AI4A 2MBHA 4YCXA 5DGBA 3M3JA 4FJYA 4NJ6A 3ZNHB 4YQWA 1NJWA 2GGHA 3T8QA 3MFIA 4E4UA 3NRZB 2D3DA 2N9PC 2UUUA 2IO1B 9ICOA 4P0QA 4QZ9A 4DEZA 2X38A 4MM3B 1T3QA 2RPQA 5C23A 4DXFA 4W9EA 4LIIA 1HUOA 3CWIA 1DIQA 2VRRB 1D8LA 2MW5A 4HNLA 2FE9A 1LPFA 2QC8A 2Y0SC 4UDUC 2AKMA 2WP6A 4XRHA 2LASA 2J6UA 1YQZA 3DEQA 4O0IA 5G5HB 4LZGA 3KFUF 2QIEB 4DXKA 2WOVA 3BZKA 2WPEA 1PQSA 5J2DA 1P43A 2IGHA 5DLFA 2KV2A 2XGPA 1J2MA 1S3SG 4PYZA 3DHGC 2NBUA 4NEWA 3RBEA 2RDXA 3HWTA 2GGJA 2MQJA 1WUDA 4O1NA 2DUYA 1Z4OA 1Z1BA 4KLDA 2LVPA 1B9RA 3AH7A 2AGPA 4QZDA 4QZGA 3HX0A 1C4CA 2KKCA 1WM3A 1E0ZA 4JAYA 1ZQ1C 1EBGA 2PU0A 3KBBA 3JPQA 1H38A 3OZYA 3QTPA 3ETRA 8ICIA 3OSPA 1J97A 2DPJA 1SB3B 5ALSA 3CGDA 3P63A 1NHRA 3APCA 4EBDA 3H7SA 1F9JA 3I6TA 4EZKA 1U9LA 4JN8A 1NVID 2YVFA 2HI0A 4EQSA 3C1ZA 4B6WA 2FMQA 5IA7A 1CK1A 2RDGA 1WWUA 4KMUA 3KYDD 1EU4A 1J19A 2GH1A 5D4BA 2YB1A 3CGEA 8ICTA 2Z59B 1Q3UA 2Y9UA 2A5UA 2PGWA 3Q3NC 2FDRA 1M6IA 2E8OA 3VA8A 1LO5D 1GREA 2PTWA 2LGYA 2I2YA 1XANA 5I4DA 3B0YA 3AEAB 1EF5A 3TACB 2Y3SA 1E8ZA 7ICGA 3RULA 4HPMB 2FI1A 4M2YA 3V5CA 3N6HA 4JQ9A 1D8YA 4IM2A 4F4YA 1BGXT 3TQ1A 2GLSA 1WG8A 3EUB3 3MY9A 3SQPA 4ADWA 5AK5A 2UVRA 4YP3A 2FPLA 5KG4A 4CO7A 1PUTA 4O3NA 1L6VA 2O2VA 1EC8A 4OJOA 4XUSA 4PYTA 4C80A 4BZAA 4IL6U 2DFLA 2CJOA 2MLBA 5IKCM 5DBAA 1FFVC 3NVVB 2YVGA 3S1FA 4QWAA 5I1VA 1UGJA 4F1SA 3QCAA 2O6VA 2OCEA 3T9PA 2VANA 4WJ3B 5FS8A 1WGGA 1N61A 1WXSA 2FE8A 2ASDA 5J04A 1N62A 4II3B 1O08A 1YOVB 3H4KA 3HKZF 3S6JA 2AQ3B 4R63A 1WM2A 4KDIC 5L83A 2E8MA 3OG5A 4MFFA 1ZRMA 5HMRA 1JI7A 4RT2A 5JH5C 4DWDA 5AKZA 3QU7A 1KKXA 2DZMA 3QU2A 4GOCA 4GDKB 4HVBA 4N59A 3N9YC 1C4PA 2INNE 2BPSA 4IUMB 2HBJA 3CF6E 4EC3A 2EKIA 3UQBA 1MOKA 2KLGA 2WNMA 4QZ8A 3TSJA 2KIWA 4QZEA 2MBEA 4XDDA 1VRAB 1FIQB 4KX6B 3W1YA 3DGZA 1A6SA 3TW9A 1R4NB 1WE6A 1JRPA 3V3XA 2MX2A 4PHDA 3V7LA 1TV9A 2PP0A 2MRLA 3I3TB 2CU1A 1ZETA 5LXIB 5F9LA 2K4PA 2CPRA 3CP8A 4YD2A 1L3TA 1Z00A 7ICPA 2WXIA 3UJSA 4E5TA 1SZPA 1Z4NA 3LAEA 5KFVA 1JRUA 3H0LB 3V6KA 4FLHA 2HHUA 2ZC8A 4NPNA 4DSFA 1KTKA 1IBXB 2LGIA 2XC9A 1FECA 4MELA 2KEYA 4NJ8A 2EMTA 3I9V1 4U7CA 1F0XA 2Q4WA 4J9QA 1P1AA 1RYUA 4GMEA 4HAIA 2VFRA 1KL9A 2BT6A 3C29A 3R2TA 3SI8A 1A0PA 4G11A 3DQVA 3NOBA 2M8SA 3D2NA 1AW7A 1NK8A 2C7HA 2R2ZA 4QWDA 2QSDA 4Y2YA 1TGZB 2XH0A 3A4SC 3TWAA 2KSOB 4ELUA 2YN4A 3Q8EA 1GRTA 5IILA 5H92C 1MO9A 1RAXA 2WXKA 2ZCCA 2ZVOA 3HILA 4NWIA 4QZFA 3TL5A 3AE6B 2KACA 4DSEA 1IGCA 1KN0A 3OLMD 1PK1B 3TADA 4RPXA 2K4EA 3EC8A 2W9CA 4DFDA 2LJ5A 2N9EB 2P66A 4JWSC 4DS4A 1SV0C 2HVHA 7ICNA 1DGSA 4C8OA 1LGRA 4ZCWA 4WJNA 3RB0A 1TK5A 1UUPA 3E2EA 3M9NB 3ML8A 3PRMB 3T6CA 4UW9A 1H8CA 1AHUA 1IGDA 3Q6JA 2WDVB 4I2FA 4M0WB 2I0KA 1TAMA 3UIOB 2KD1A 3EAOA 1ZQUA 3ZDMC 1MI0A 1S0VA 3RFZB 5AE2A 2XCPA 2DQNB 2XH4A 3RO6A 1XLPA 2C60A 4J57A 2DYMA 1TFRA 1JMSA 3DHHC 1KLVA 4F5QA 2DL0A 3IXSA 1VD2A 1OEYA 4GSWA 3CSFA 5KNIA 3Q14C 2WGSA 5BOEA 2OQYA 4G9BA 2J0MA 1OTRB 5J2AA 5FKAC 5KFTA 3OJSA 1KCZA 3Q45A 1ED1A 3NGDA 4EEYA 1NI2A 3RR1A 5B5EU 3RMKC 3GZNI 3SR6B 4Y2RA 3POPA 3U7ZA 4FXCA 8ICZA 1KFSA 3ZD8A 4I2DA 3BVZA 5E6OA 3EPIA 2K5PA 5BMIA 4UBBA 4RQ7A 3BS7A 1ZQGA 3WAMA 1JROA 1CQVA 3V3WA 4HCDA 4Z6DA 5HNKA 2FCMA 5D49A 4KPLA 4NLGA 7ICRA 2KN5A 3RNFC 3IV6A 4CDGA 2OJWA 3NZ3A 4UATA 2R8IA 4AP9A 3AM9A 3J81j 2D3BA 2ZIUB 3A1QA 4RFBA 2V0GA 3NVYB 1NELA 2LKYA 3ISBA 3V60A 3AE2B 3SMVA 4KN4A 1ZKHA 5G5GA 1JN3A 4JGHB 3CK5A 4C8NA 4ZRJA 3VFCA 1COKA 2WS3B 2G06A 1YN4A 2WHEA 2LHTA 1ZQIA 3QEAZ 4I2CA 3EFUA 3N6JA 5AK3A 2JVCA 2PE9A 2KQ7A 2WP9B 3Q3OC 2PTLA 3WCQA 3V6HA 2VFVA 4M0XA 3V4BA 2R8KA 2CHWA 2E5SA 2D3GA 5BOMA 5IDZA 1KN5A 2NTSA 1EM7A 3PRZA 4HCLA 3C0RB 2SAKA 3I28A 2BWFA 2PCEA 3ZJUA 1VJ5A 3CT2A 4RZRA 9ICLA 1HEZE 5DBCA 4DWIA 2LBOA 2OM6A 4RGMA 3A7RA 2NPTA 3C21A 4F5PA 2OEHA 1L7OA 4PJ0U 3Q8LA 2C7NB 3TSSA 1C9FA 4Y2JA 1ZUD2 3CGBA 1UZXB 4HJKA 2OAIA 3RR7A 1ZOYB 4TSSA 4HLEA 4IS7A 4FDCB 3F53A 4DOBA 2NRXA 2KTFA 1OQYA 1BVSA 2DAFA 3F5AA 4RQ0A 3DWGC 4I6LB 4TQ1A 4YTNB 4DL3A 1P7EA 4BUGA 4ACFA 4GGBA 2KX3A 1JOAA 3HHMA 3SEBA 3WA0A 1YIWA 5AM4A 5K8EA 3DBLB 1KLNA 1LKYB 2BQUA 3H70A 3RRGA 3TOYA 5AI9A 7ICOA 2MCNB 1NNLA 1SWVA 5KFWA 1BKHA 3UMGA 2MU2A 4W9DA 2G3QB 2WP5A 3JVZX 3H0MB 3LDZE 4FE3A 4J9MA 4HDOA 4NM2A 1XF5L 1XU4A 2LHEA 4PK1A 2B76B 1XLOA 2I1JA 5CHVC 2JWUA 2GMIC 2X8HA 4DCCA 2BS4B 4EKUA 1D9FA 3VC8A 1TIFA 4BCAA 1UXYA 2JSVX 2IGGA 3FW8A 4WIPA 4BKSD 3MC0B 1WUFA 4EMIA 3L4PA 1MG8A 1HEKA 5ALMA 4P6VF 4KWSA 5AM5A 2MP2A 8ICQA 4E4FA 2O2VB 4HJGE 2VKQA 4TV3A 4F3OA 3AE4B 4XYCA 3K9OB 1T3NA 5J17A 3FDSA 5HHZA 2W9NA 1XPYA 3W1SC 3HK0A 2PLSA 2W3SA 4C7YA 1VAOA 3AU6A 2J0JA 2W55A 2Q85A 2F77X 4TQSA 3P2BA 4MH0E 4IDIA 4ANUA 2MUTB 5J2RA 3QUQA 5KFRA 2V9HA 3JS8A 4MFCA 4JHMA 3IAS1 1Q1OA 4R8UB 4EYIB 3A4RA 1YNTE 2V3BA 4DFMA 4M6WA 5FJTA 3KW5B 4MF8A 4WWPA 2XO7A 2BCPA 2VAOA 2KKPA 1WXVA 4ZHOA 2F1IA 2BQQA 2Q4TA 3MC8A 4W9CA 3H40A 2W3RA 5ALDA 4TQ0A 5FXFA 4BC9A 3GD4A 4WWOA 1YD8U 9ICKA 4A20A 2ZNVB 3HRDD 4KKIA 2KWDA 5MPOA 2KZ3A 1MG4A 1TYTA 5KFGA 2PPGA 1O03A 4Q8FA 2L0FA 1ZQHA 2C28A 3QJZA 4DX3A 5D3IB 4OJPA 1IG6A 1N2XA 1B1ZA 3PK7A 4RQ2A 4APNA 3V5FA 2HHSA 5L1KA 1V80A 4BV6A 3U9IA 2QHOA 5FP0A 3UGVA 3PGEA 2OVLA 2ZZCA 5J18A 5J0RA 3T5LA 1MSWD 4DQOC 3WKCA 3TQPA 3PTFC 2KWCA 5KAIU 1NK7A 3ZJVA 2GBNA 2UVWA 2XGQA 3QNMA 1ZQMA 2XY5A 3SSZA 5DG7A 3FM9A 4KLTA 3RJAA 3L13A 2AL3A 2EZZA 2MJEA 1TS2A 5AK4A 4WJQA 1TS4A 2MJDA 4WAFA 4DXGA 4LNKA 1AHVA 3FKYA 4I2HA 5ALXA 1GUAB 3RR8A 3RB4A 1I4PA 2MWSB 5ALIA 4BC7A 4ELTA 1DNCA 4KPRA 1L8PA 5JRTA 3MFHA 3R11A 5G5HA 1V1PB 4RGNA 2ZJ8A 3UJFA 1RWSA 2IPKD 2FIFA 1DTNA 5KT2A 3MWCA 1L0XB 2LWPA 2DPIA 2J4XA 5CB1A 3Q8RB 2BBCA 3MJWA 1W1LA 4UAZA 1RXWA 4RNMA 1TE6A 2IOFK 1LV5A 3MC1A 4WJPA 4UB5A 5KHOA 3T5JA 2NPXA 3BS5A 1QQ5A 3DFYA 2F76X 3THUA 2PU1A 3D2DA 3DJGX 2AQ1B 5ALYA 1XDIA 4E74A 4B9KA 2MSED 3MUCA 2D2QA 4K1WA 1E8FA 3SN4A 4R66A 4K4HA 3ES7A 4UARA 4YMOA 3JPOA 1ZQCA 5L9XA 4KMOB 4DSJA 4I27A 3ZKJC 3I1YA 5A0LA 1JWMD 3M95A 5AKKA 3M7DA 4KLLA 5FXPA 1MDLA 3BSMA 3P3BA 1ZD5A 5JRBA 5DKWA 5CX3A 1E9MA 2CHXA 3PMNA 1JWAD 2KDFB 4W9IA 2C3CA 3GIKA 2W9BB 4ED3A 1V59A 4AP4C 3H7PB 3DBSA 4JWNA 5KFCA 4RQMA 1JX4A 1ZQBA 2AKZA 3MTNB 1Q10A 2LYHA 3NS1A 2VA3A 2JEIA 3SAGA 1NJZA 4REZA 1FCLA 1MC8A 1KLUD 2WXRA 3VC5A 2GR2A 3E0FA 3KHHA 2HVIA 3KHLA 1WJ4A 3RNGC 1XCQL 4H4YA 1SJED 4DDID 3HW8A 4NZLB 1SGGA 1KQQA 5CEHA 3OHBA 2EAOA 4J9RA 4I2BA 1WX9A 3PM9A 5GTIU 3R3MA 2RK5A 2JRHA 2PGEA 2RDIA 2EQ9A 5DG8A 1FO4A 1S76D 3LB8C 2QDFA 4KKJA 1AHZA 5DDMA 3RNEC 3FVDA 4ANVA 1I4RA 4TUUA 2MJ3A 4JB3A 1FPYA 3NFUA 2PLIA 1GG3A 2E8NA 2JEGA 3H6NA 4CF4A 3SQSA 4MEMA 4UAVA 4RMAA 1FNUA 4M00A 3AE3B 4PVJA 1SXDA 4MEYA 2BVFA 3JSVA 4J56A 2XI9A 4ARCA 1KFTA 3PLVA 7ICVA 3NVYA 4X2PA 3T3FA 2E6XA 2VFUA 3HM3A 3Q8PB 3DG3A 1WMHB 3RAXA 3MQTA 1SJHD 4Y2TA 2WXOA 2WF5A 3NASA 4EEWA 1M4VA 5AM1A 4WWMA 2OPJA 2WXJA 3JYUA 5AKLA 2AWTA 1R7SA 2AXTU 2P8CA 3UCDA 2KTRA 3OTQA 1QSYA 3Q8QB 3VR9B 3RJKA 1K53A 3IG3A 2KFZA 3WK4A 4PHAA 4QZHA 4I28A 1WX7A 1HZ5A 5LXHA 2Z7JA 2NVUI 8ICCA 1KRHA 3PPAA 1TZ1A 4AUQC 2HSZA 3WK6A 1WIAA 4ZOHB 2A1JA 4F4KA 2VZKD 1MQ2A 2PP1A 3RB6A 5ALTA 1V49A 4IRCA 2FIDA 4LCDE 5T8IA 2YVJA 1I4GA 4RUCA 2BVCA 3NY5A 3RBDA 4K8GA 4L1BA 2AH5A 3HW2A 3ZNGC 3PX4A 1YN3A 3A0HU 3C5FA 1ZQZA 1BPDA 3EWAA 4IC9A 2UUVA 1WYGA 4Q45A 1NJXA 3FAHA 4F5OA 1AYFA 2N0SB 2G07A 2QCZA 1Q3VA 3U2SC 1QLUA 2PODA 2PKEA 4H4RA 2ZIVA 5AIBA 7ICTA 1URJA 3S5SA 2VFTA 1UGMA 4DYEA 3ZYYX 1I35A 2KDMA 1C20A 2HXUA 1NDAA 2PA6A 4M6UA 5AKYA 1ENFA 3UCCA 3TI0A 1S0MA 1WE7A 3Q3FA 3FG2P 5AZGA 3E58A 3RN9C 3IT4B 1MBTA 2GRTA 2EDUA 3L10B 3TX1A 2HHVA 5JXVA 1ZQLA 3VHTC 3ICXA 4MGIE 2ATLA 8ICKA 4AJWA 3RF9A 4Z1YA 1ZK7A 1E7UA 3TADC 3JZUA 2QPMA 1KJTA 5ER0A 2AQ4A 2K8HA 3AQFA 2P6RA 3RCYA 2WB1F 3GQCA 3H9DA 4Q2JA 4EM3A 3MDCA 4IWQA 4CYEA 4NY8A 1XCTL 1Z3EB 2KK8A 5JU5A 2RSUA 5CHFA 1MDRA 2QILA 1GV4A 4QWBA 2W03A 2IZVB 1N5WA 3M6KA 5BMGA 3P93A 5J0XA 3RH5A 2ASLA 1CJEA 2IPIA 1C4AA 2GOWA 3QZ7A 3DBHB 5FK9C 2IBKA 3WKDA 3KHRA 1CMXB 1GNUA 4LNOA 1JIHA 1GEUA 2WXPA 4DNAA 1U45A 5HI1A 2MHJA 5E79U 1KTQA 3JW0X 5ENLA 2PFNA 5AZFA 5FS7A 2Q0ZX 1ZGUB 4IM3A 2Y3RA 2KWUB 2QDEA 4TURA 4I29A 1HTOA 4IT1A 1JW9D 2ACZB 3TCAA 3FC4A 3KTQA 2AJQA 1ROEA 2QEJC 4HNCA 3LLBA 2DX5B 1PDYA 1X1MA 2DKXA 9ICEA 4L2YA 1FNVA 2ON8A 5KTQA 3X23A 3QHTA 3QLDA 3K4GA 3D6JA 4P0PB 1X9WA 3B08A 3QX1A 2FPKA 2PXIA 2CN1A 3GS2A 4ML8A 4GIRA 2ZPYA 5F3XB 3OPXA 1F77A 4IWOA 3VH4B 3ZTCA 4F8CB 3H8AA 4LDTD 4HCHA 3U4FA 3NUHB 5AI8A 5CRXA 4C8KA 5C1ZA 4I6NB 3A9JB 2KK0A 2KQSA 4RU9A 3S1DA 1S5LU 2E5AA 2BC0A 3AL0B 1GRAA 5J2FA 1E9IA 4O95A 4LVSA 3S47A 3ONNA 1TZOA 2WB1C 3BYYB 1N56A 2L32A 5TR5A 1YT3A 2GQTA 4WURA 2W54A 3LWMA 2C3DA 1L0VB 2KJ6A 2MA9B 2PJHA 1JXEA 2B21A 1TTNA 2C9WB 2RP5A 5ALFA 3PWIA 3QUTA 1WJUA 3A9JA 2NYVA 2F44A 4J9NA 4B9UA 2OJRA 3N32A 2CDUA 3L3FX 2FLLA 2KNJA 2KVSA 4TUSA 1DGJA 5AZHA 2BC1A 4PS3A 2KHQA 5ALZA 3GY1A 3PG6A 4O3MA 3B0XA 4OJLA 2A19A 1ZQXA 2NV3A 5ALJA 5KT4A 4GXKA 9ICQA 3NHEB 1FNWA 4ZHPA 2JEFA 2KN7A 3T3OA 1N5XA 3M6ZA 5AKJA 4IR1A 2WBAA 1FMAD 1V1PA 2XN9C 2HBLA 1CZPA 3R7QA 3W9CB 1JDFA 3QN3A 2AL1A 2I1KA 1WH3A 2Y5BB 2M0NA 3UXLA 2ZVNA 2JHDA 4MDKE 8ICRA 3MR5A 4C00A 2BCRA 2MBOA 4EELA 9ICJA 4KZCA 2J3NA 1SE2A 2BF8B 2P8BA 3HIZA 3N1ZC 1NK5A 2H3IA 1WGYA 3P4SB 3DGBA 3L8KA 5KFBA 2OEDA 5FMHA 4YSYB 5E6JA 3M1YA 1BNPA 2RMMA 3Q8MA 1X9XA 3Q2AC 4FO6A 2GR3A 2AGOA 5AI6A 3K75D 5FS6A 1PUZA 1RQNA 2K8CA 3C19A 4F2RA 2W7PA 4M9NA 4UB4A 1PYWD 2JZZA 1DOXA 1K5OA 5KFLA 9ICCA 3BZCA 2F5ZA 2BHNA 5FJOA 2JZBA 3OAWA 2ZIWB 3MGVA 4MT5A 1WR1A 2BCQA 2ZUBA 2VH2A 2L8JA 4DHJB 4PPXA 1QLBB 3AU5A 2H3VA 3GZNB 3W8XA 4IC7B 1C1YB 3R7RA 2K8BA 4RGOS 2VA8A 3P4PB 1IIPA 2GBKA 3DBRB 2QJJA 2MBQA 4OHJA 2KVZA 3SN1A 3N4FA 1XLQA 8ICOA 5GTHU 3ENEA 3NZUA 1TKEA 1MHXA 5BMHA 2YAUA 1X9SA 8ICAA 1EUVB 5ALQA 4KIKA 2JR5A 4MJSB 3TEYA 2BTEA 2OO6A 3P0WA 3BWUD 1V2YA 1ZQNA 4LNFA 4XLOA 1HSKA 4NM1A 1HE8A 2JY6A 3TEWA 2Y3AA 4GFJA 1L4ZB 4PYUA 1T0RC 4DO9A 2A3VA 1OQQA 2E8PA 3WKAA 2LD9A 4E0DA 3SYZA 3OGUA 1TVAA 3M8RA 4LJPB 1QLTA 5DG9A 2NRZA 2DZJA 2FUG1 2DGZA 1ZQDA 2EANA 2P6UA 2JT4B 3ETLA 4US9A 3VDGA 1ZQYA 4FULA 2VIXA 1BPEA 4CF3A 3IFWB 4FJVB 3N4EA 3MZNA 1ZQTA 5IOIA 9ICVA 2OZ8A 5GRTA 1BT0A 1MRAA 1OQRA 4OVZA 2O6VD 1BXTA 2GR0A 4MM3A 4UD8A 4XZ4A 4DK5A 1SB3C 1CI4A 1SJAA 4K4IA 4EOYA 4EZJA 3ZNZB 1YMHE 4KTQA 2JUOA 4PT5A 5HMMA 3K1ZA 4DL5A 1QOFA 3PSTA 1WXQA 2RGFA 2OG9A 4KLOA 4BGDA 2WTFA 2OXOA 3O0FA 1HA5A 3S1EA 3GC2A 5DQIA 2WX0A 4DL4A 2KNBA 2ZTEA 3ORYA 3EA6A 1LB2B 3GO2A 2KX0A 3PNCA 2JXXA 2W82A 3UXOA 2V3SA 5IIJA 3PZDA 3QK0A 4FZMA 2KYWA 2ODGA 1L2NA 1W1OA 4HEA1 5AKHA 1T0YA 3Q4DA 4M8MA 2RPVA 1NEKB 2JRIB 5AM3A 1W1SA 2BYTA 2W9MA 2KG5A 1W1QA 2BDUA 2IMWP 3H7PA 4KLUA 5EE0A 8ICNA 5HKHA 1K8RB 2HZGA 4KDLB 3KUZA 2DYBA 4H4XA 3PW4A 3M8SA 2WXQA 3N1YC 3R0KA 1A76A 3IT6B 4H1ZA 5JCNA 3N97B 1TAUA 9ICMA 4K7SA 3TJ4A 2LXCA 3SEIA 2V3NA 1RDFA 1SZHA 1ZE3D 1QCKA 2BDPA 2EZXA 1NDDA 2WXGA 1BZLA 2ASQA 2GQUA 3TJPA 5ALPA 3W1SA 1ZY8A 2LFIA 3EF6A 4KLQA 2HMXA 4YMMA 1X42A 3ZD9A 1P0RA 5HR7A 1G6JA 2ZJ5A 2RR9A 2KDEB 4PGXA 2JU6X 2JZBB 1L0YB 5KL8B 3ISDA 4IQWA 2XNAC 1MNSA 1KOTA 4RF1A 3P1MA 2D10A 1GB4A 3EFCA 2ZEQA 1XLNA 3Q8SB 1YQ4B 4ROPA 4OO1J 4YT0B 3TEXA 2PI5A 2X99A 3L54A 2ZTDA 4GC6A 2EELA 2NCNA 2NTTA 2RABA 1RYRA 2PIAA 3UXPA 1UWXA 7ICJA 3K9PB 3BJYA 4NY0A 1TS3A 4EM4A 3JPNA 4RH6A 5J2CA 4Y2SA 4NLCA 3UXKA 3A0BU 5H8YE 1WY8A 2LUEA 1EC7A 5ALEA 1P7DA 1N63C 3KHGA 1FFVA 2HBMA 3RTVA 1ZPSA 2CS4A 2EKEC 1HTQA 2BKEA 4BXOA 4KLGA 2EMSA 2UU7A 4RGTA 3PZPA 3SAHA 1FEAA 3ZDEA 4B6JA 4XQ8A 4JIOU 1F3PA 2JEJA 3EJBB 1WRIA 5KFFA 4DHJD 1XS9D 3GB1A 4JLCA 4ANWA 1WJ6A 5CTRC 2XGZA 3RJFA 2QDDA 5KT5A 2XIDA 2LVOA 3KLSX 2PSNA 2KWVB 4BWMA 3D46A 3IRUA 4CGZA 4YD1A 4LJOB 4LK0M 3U7DA 3TCSA 5IIOA 1U47A 3ALRA 4DOAA 2AQ0A 5KFHA 1ZD2P 4C56C 2QLTA 1WXAA 4RF0A 1NENB 2FYMA 1DRGA 3CYMA 4O3QA 1ZYQA 2WAQC 4G8TA 1DZNA 1V5TA 4G3XB 3L5OA 4RQNA 2Y1IA 1COOA 1EXNA 4O3RA 1A77A 4O9MA 2FCSA 4LNIA 4ZYNA 4A3PA 4H4WA 3RJJA 1L3SA 3T79A 2DLBA 1N60A 1S0OA 3BQ1A 4Y2PA 3SZ2A 2K8AA 2HOIA 9ICFA 4DLEA 2TSSA 3QA8A 3UIPB 3Q3MC 1QZEA 2W9AA 1P9DU 3SAFA 2FLPA 2PE6B 5G55A 1VQZA 1J0GA 4ED1A 1YQBA 3ECIA 2IGDA 4KGRA 5B66U 2RDBC 4DHZB 4IZGA 2LRWA 2BS3B 3TTEA 3N7SC 2V3AA 2WXNA 1V6EA 5G5GB 2BS2B 4EMJA 4NNJB 2XY6A 2V6OA 4ECYA 4LZDA 5KFMA 4KLFA 5FR3A 2YY6A 3P4RB 3AEFB 1KM7A 3V6CB 2YQEA 3RJEA 2YEPF 2DF4B 1RM6C 4HYKA 3D2QA 5DB6A 1IPGA 2N9LA 2PLPA 2R61A 4OZBA 3UQAA 4E71A 2HHWA 4ANXA 1DK3A 1UHUA 5J2KA 1MVKA 2C2DA 4JX1C 4Q8EA 1JWBD 4P0PA 2W11A 1KFDA 3BS5B 3JPPA 1AWDA 3FILB 2KJ9A 4Z6EA 2ZJDA 4UAUA 1T7PA 2Y5CA 3HVZA 3CGCA 3VUYA 1H6VA 3V05A 4GMVA 4RQ1A 3NZSA 3T5KA 1GRBA 4ED2A 1VZ8A 2LXAA 5DPRA 4XWWA 2ZIWA 1EBHA 1ZXIC 4GB9A 4P4OA 1SJCA 1ZOLA 1YEYA 3ZXRA 2HHTA 2MSNA 1E6EB 1V85A 5EE3A 4FA6A 3T3NA 3H7IA 4E6MA 4P1BC 2W8LA 1MFWA 3ZLFA 1ECWA 4M9HA 8ICLA 4YG2A 2XK5B 3OTRA 3Q8AA 1OJTA 3LWLA 3SENA 4H4PA 2V9WA 2MAXA 2C2EA 4DFKA 4Z17A 2ZUDA 5HHHA 4TVWA 2KJRA 4I2JA 1D7YA 1NOMA 2MBBB 3B97A 5BOFA 2FJ6A 3IP4B 4AS1A 3NRZA 3C5GA 2OYYA 4TUPA 1S77D 1DOQA 1T4GA 4HCPB 2EAMA 4PWCA 1SXTA 5EWEA 9ICNA 2HBKA 4PS7A 3II4A 4IP5A 1ZMDA 4YWOA 3SV4A 5EWFA 2P3HA 2KAJA 5L6GA 2YMQA 3TAPA 2E1EA 3V62A 3H4DA 1ET9A 3DOWA 2F1HA 3MJ5A 1ZQKA 3CXBA 3RZWC 1ZD4A 3QKEA 5ALHA 2K60A 4Y2QA 4PHEA 4YN4A 2C22A 1XSNA 3BQ7A 3EGRA 1FHVA 1NKBA 2L05A 4HWIB 3ZNID 1ZQPA 4MHVA 3PMLA 2HCFA 1V8CA 1MPEA 3G6YA 4EE2A 4OALA 1L4DB 5FXEA 1L6NA 1FM0D 3BQ0A 8ICJA 1TY0A 2BGFA 3F2BA 4N9F4 4W9HA 3GP7A 3O13A 2ZJAA 3VC6A 3CB3A 2PFOA 4HXDA 2LPEA 3NZGA 4R65A 3BQTA 5KT6A 1MJDA 3VXWA 1JPMA 4KLIA 4M6WB 2JYTA 1V5OA 4A6GA 3M62B 5AWVA 4B9SA 3D2HA 2A8XA 4EWJA 3BQ2A 3ZGZA 1X9MA 2BQ3A 1QOBA 5AM2A 3AU2A 2ZZPB 3NXLA 4J1OA 1WF9A 2KHWB 1LVLA 2XK5A 2BPCA 2D8CA 2PTXA 1NHPA 2IY1B 2GGIA 2PFQA 1D9DA 4M9LA 3ZVIA 1NKEA 4C8LA 1KF6B 1UF0A 1MBBA 1JUDA 2KFKB 5KFIA 5J8YA 1HUZA 5TISU 1WVEA 2KICA 4F4XA 1ZQOA 2BYVE 2BWES 4H4VA 1J7BA 2QB0B 1ZDVA 3NJTA 2YVCA 4G50A 1R4MB 1VR9A 2LGXA 2BYEA 1K1QA 3D2SA 2NO5A 3AEBB 2Z8LA 2FMSA 2WOIA 3FJ4A 3LADA 3SFEB 4LA1A 4TVYA 2LVQA 5U25A 5KG2A 2BKFA 2DW6A 1UA1A 1OW5A 1TK0A 4FBJB 1XSPA 3ENLA 2YMLA 2A1AA 2ESEA 3QFAA 2QB1A 3V6EB 2LRUA 1WWTA 4H4QA 1TJEA 2ZZBA 4DOCA 3SFDB 3RGTA 4B0MA 5EOZA 3A9KB 2K9XA 2KZRA 3M9MB 2P35A 3MR6A 3MDAA 1D5MC 1ZDXA 4BX9C 2EXRA 4HPLB 3PZ8A 2PTYA 3L0WB 1WSPA 2JWZA 1SV4A 3EZ5A 1AN8A 2KJ8A 3R0UA 2PMZC 4MGYE 3UMBA 1ZQJA 4FHJA 4KVGB 4DQIA 4Y2XA 3P42A 2MBRA 1TBEA 3IG8A 5KFUA 2KXJA 5DCNA 3DHIC 2LM4A 3SQIA 1D5XC 2LEKA 3PSEB 4PS8A 3AE8B 1L8OA 1EBDA 1EC9A 4DSKA 2HD5B 1TAQA 2J7QB 4ECUA 1DYQA 4O3OA 1V1OA 5KFDA 2J6SA 5JTIA 7ICHA 3PT2B 1JQ4A 4MSMB 5EE1A 3TBLD 2KFJA 2GGGA 3ZVVA 4ECQA 1E8GA 3JW7A 4UB1A 3UXNA 2N7DA 1XSLA 1DOIA 5TSSA 3AI5A 3B0AA 4N6EB 4KN7A 1QSSA 3V7KA 1KKOA 2WDWA 2FBWB 2CKHB 4DN1A 3G6XA 1RYSA 1V86A 4C4SA 3KVFB 1EWCA 3PR4A 3RB3A 4OVUA 3W5UB 4QNLA 4UB2A 4BKSA 4RNNA 1V38A 3WKBA 3O0HA 4RQ3A 1GO3F 1JWSD 4HCNB 3WKEA 5D7GA 5KG5A 8ICBA 3VTEA 2R8DA 5KFNA 1HXYD 3R2IA 2N1WA 4F4RA 2MP2B 2L00B 4AJYB 4B9LA 2OWOA 2P3ZA 3UQ0A 5ALGA 4LTUA 4Y2VA 2M1MA 2IO3B 1D3ZA 3MR3A 1YJ1A 4UB3A 2BCSA 1ZXIA 9ICBA 1XO0A 2KMAA 3PS6A 1W1JA 1R0MA 4ECVA 2GRIA 4B0EA 1I42A 1XHCA 1Z1VA 2JZ3B 4F4WA 4A3RA 5H2FU 1ZP0B 1NYQA 1JALA 3TUOA 4HPNA 2WF8A 3H7VA 5FJUA 2G5HB 1PGAA 4DFJA 5DGAA 4PH5A 1RPLA 1QH9A 5BYSA 3ETRB 1RFKA 2WDTB 1UQVA 2NS5A 1SJBA 4AWJA 2UVVA 2H89B 3I76A 3LXFA 4DQSA 3GD3A 5T14A 1XC9A 3K1GA 5FJPA 5JCLA 3DEDA 1RQLA 1ZJMA 2I5HA 4KX3A 8ICVA 3W5VB 4EX6A 3VVWB 4F92B 1E7PB 3IC9A 4KV2A 1ZXHA 4ZOHC 2C2RA 4IQUA 1E10A 2JYEA 1UELA 1QOGA 4ZRPA 4WAAA 2JPHA 4CRXA 4NJCA 2BYFA 1ZD3A 4PZNA 1PGBA 3GE8C 4GXIA 4R3DA 5J0TA 2XBBC 5BYRA 4BBNC 2PVOD 2XEWA 4FADA 1DOYA 2POZA 4I6PA 1L7NA 2GBJA 3AB5A 2DAJA 1ESFA 1K50A 3AEEB 4YWSA 2AL6A 5KFSA 3HP6A 3V72A 4GXJA 1UBQA 2D3CA 2N7EA 3KWVA 3OWEB 1Q5WB 4YTMB 1WGDA 5AE3A 4FS2A 2ISPA 1K52A 5ALUA 3AEVA 8ICEA 2GDQA 2X8CA 3OPSA 5FS9A 4QAYA 3QQ8B 1KKRA 2WXMA 1TE2A 1TS5A 5AKIA 5J2GA 2VH1A 4USAA 2FUHB 3GV5B 1RYJA 3AE9B 4UQGA 4O3PA 1OEYJ 2I9GA 5BO4B 4BOZB 4HRSA 1PDXA 4M01A 3N7RC 3NS8A 2INDC 1FRRA 2KQ4X 2IA6A 2K8BB 8ICSA 2X50A 4QZAA 3IHQB 1RM6B 2KVRA 4H50A 1NJYA 4K4GA 1GSNA 3RT3B 4B9NA 1MN8A 3ONSA 1I4XA 2XICA 2IOFA 2QKQA 2NQLA 2LGSA 4C4VA 4RQ8A 2DZIA 5KHQA 4DSLA 2LHDA 3KUCB 2V3PA 2EQ6A 1U4BA 7ICUA 3I4KA 4MGKE 4KX5A 2KVCA 2JZPA 5D94A 4GISA 1LFDA 3F5EA 2M19A 1VLBA 5KFXA 1N48A 1NU5A 4IM0A 2ZCBA 1S9FA 4ARIA 1GETA 1K4QA 1S7MA 3QZ8A 1Y8RC 3QYPA 2WHIA 3KOOA 1QQRA 2K3UA 3GRTA 5AKEA 3H12A 3AQEA 1Z2MA 4C4VB 4WQMA 4DQRA 3MP9A 4NL9A 4R8UA 5HR6A 7ICLA 3BVMA 1NZPA 2LYBA 4IG7B 4OZAA 3EEZA 3Q3JA 5LNK1 4RUAA 4KSLC 2OQHA 2IO0B 2EAPA 4GU2A 7ICQA 3OSNA 3ZRCA 4EENA 2M0XA 3BW7A 5I1WA 3SBFA 3QU4A 1FHUA 4GR1A 4X5VA 1M6YA 5AI5A 4K1RB 4D2KA 4ECZA 4DWFA 4F8RA 3DH9A 3RRAA 3ZLGA 1WWVA 3WIMA 1ZKQA 4M9GA 5KG6A 4JQWC 3WALA 3MKCA 3ZLHA 4GIBA 4C4TA 4BKTA 5JZEB 3R07C 4A9AA 3BIID 4QIWF 1S1QB 1WJNA 2Y08A 4IQTA 2KC1A 1ZRNA 4NAWB 2P88A 3JPRA 3RFAA 2NRVA 4QWEA 1GAQB
chains in the Genus database with same CATH topology
4OHJA 5HG2A 1XLQA 3VRBB 5FKAC 3HVDA 4PZFA 4M0WA 1HQRD 1MHXA 1TKEA 5BMHA 3AMZA 2G9HD 3SR6B 3TEYA 4GLSC 3U7ZA 4FXCA 2BTEA 5BYQA 3A7AA 3BWUD 3POPA 3E56A 1BMLC 3B2FA 2G1EA 1HSKA 3AE5B 4XLOA 5AE1A 3TEWA 2Y3AA 1L4ZB 1EU3A 3BVZA 4TMAB 1OQQA 2ICIA 2K5PA 2LUMA 3PQBA 5BMIA 2YVSA 1QLTA 2QKNA 2FUG1 1JROA 1CQVA 2L1AA 5C3JB 3C0PA 3IAM1 4US9A 4NAMA 1YJIA 1FRDA 3NZ3A 1OQRA 3AEDB 4OVZA 3AM9A 1BXTA 1F2RC 2K22A 4RFBA 4UD8A 2PVGC 1EWYC 3VR8B 2V0GA 1F0ZA 4N58A 1SB3C 2AQ2B 2ONQA 2PKOA 1YMHE 1IUEA 1QKZA 3ZJTA 3AE2B 1UNSA 3BK2A 2HDEA 4PT5A 5G5GA 1QOFA 1WXQA 4A6QA 4HG0A 2N9KA 2WS3B 1VZ6A 3S1EA 1HA5A 1YN4A 3PZ7A 4HKZE 3PO0A 3EA6A 1SE4A 2WP9B 4IOIE 2PTLA 3WCQA 2VFVA 2W82A 1C79A 2AX5A 2NTSA 1EM7A 3B2GA 4HEA1 4P16A 1W1OA 2SAKA 3ZJUA 2RPVA 1NEKB 1W1SA 3CIRB 2BYTA 1HEZE 3TSHA 2WXLA 1W1QA 4LLGM 3LYYA 5EE0A 4RGMA 3Q8FA 3TEZA 3A7RA 3TSSA 1C9FA 2WXQA 2VZKB 3IT6B 1ZUD2 2OAIA 2ZW1A 4XDCA 1ZOYB 3BYTB 4TSSA 2CU3A 3NVWA 2V3NA 3NS1B 1ZE3D 2L83A 2WXGA 3KQ4A 1FEHA 3DWGC 4BBYA 2GQUA 4TQ1A 1MHHE 4YTNB 3W1SA 1JMLA 1P7EA 2LFIA 3DQ0A 3SEBA 1C78A 2MH7A 1XEEA 3B9JB 3FWAA 5K8EA 2JU6X 1L0YB 1OFFA 2XNAC 4ITKA 1X2GA 4RF1A 3P1MA 3BZDB 1PGXA 2WU5B 5HFYA 1GB4A 1XLNA 4AQ7A 1YQ4B 1D4BA 4HKQA 4YT0B 1YN5A 3TEXA 2EELA 2NTTA 2P13A 2K0PA 2PIAA 1XF5L 2LHEA 2B76B 1XLOA 1UWXA 1SSNA 2JWUA 2E3TA 1TS3A 1FFUA 2BS4B 4CQNA 5D3DA 3RPFC 4RH6A 2NQWA 3FILA 5H8YE 1W1MA 3A7UA 4BCAA 1UXYA 2JSVX 2IGGA 3FW8A 4WIPA 1A70A 3MC0B 1N63C 4JWUC 1FFVA 1ZPSA 3L4PA 1F2RI 4PVEA 4P6VF 4RGTA 4HJGE 4J3OD 3AE4B 5HHZA 1N61C 3DWMA 2BW2A 1WRIA 2BB5A 2PLSA 2W3SA 4C7YA 1VAOA 2BB6A 2W55A 3GB1A 2M56B 4KGTA 2BVHA 2Q85A 3FW7A 4IDIA 4ZRQA 4JPSA 1J7CA 3JS8A 3AEGB 1K51A 1C76A 4KGSA 3IAS1 3KLSX 2D5GA 1YNTE 4WH4A 1X2HA 4LK0M 2VAOA 5AUKA 1UWMA 4ZHOA 3P4QB 4ZYSA 3S1CA 4C56C 4TQ0A 4BC9A 2W3RA 5FXFA 4RF0A 3EUB2 1NENB 2Q5WD 5D79A 3HRDD 2J42A 4KKIA 3W8WA 4HROA 1QT9A 2KWDA 5MPOA 1WVFA 1STEA 1DZNA 1FFUC 2WQYB 5D3IB 2QJLA 1B1ZA 4YTPB 2DLBA 1N60A 2HTME 2P3HA 3HSUA 2TSSA 3U4EG 4YSXB 1VQZA 1FIQA 2YEPB 1FXIA 1TKGA 4KGRA 2IGDA 4DQOC 2BS3B 3NVWB 2WXNA 1QOAA 3ZJVA 5G5GB 2AXRA 2BS2B 3H8HA 4XWTA 2RDHA 1Y56A 5FR3A 2WU2B 3P4RB 3RJAA 3AEFB 1SIJA 2H88B 3I57A 2MJEA 2YEPF 3B9JA 1RM6C 1TKYA 1TS2A 1GB1A 2N9LA 1TYGB 1FXAA 2PLPA 2R61A 1TS4A 2OHFA 2MJDA 1NI3A 2KN4A 2Y5PA 4WAFA 4DXGA 1AHVA 1MVKA 4JX1C 2JQRB 4BC7A 1JWBD 1I4PA 1KLGD 1AWDA 2O3GA 3FILB 4JB1A 5G5HA 1V1PB 2Y5CA 3HVZA 4RGNA 3V05A 1RWSA 2V4IB 2IPKD 5AUIA 1TY2A 3NVVA 3FW9A 3W8ZA 4YSZB 5HQXA 1VZ8A 2P4PA 1L0XB 4XWWA 1L5PA 1ZXIC 2J4XA 1W1LA 2BBCA 3ABVB 1E6EB 2JXTA 5EE3A 3T3NA 1YQ3B 1I4HA 3U52E 5HHDG 3Q8AA 1ZR6A 4MH8A 1GPXA 3D2DA 2AQ1B 4TVWA 1ACCA 1E8FA 4PVKA 4AS1A 3NRZA 3Q69A 1N60C 4MACA 4A8XC 4PWCA 1SXTA 1JWMD 2PMVA 5FXPA 1IBXA 1E9MA 5L6GA 2KAJA 1JWAD 1KH0A 1D6EC 3Q8BA 1L6UA 1ET9A 2WLBA 3MJ5A 1FCCC 1FD6A 2J53A 1XO3A 2DYOA 3E9SA 3EGRA 3AN1A 1Q10A 3NS1A 4REZA 4XE0A 1FCLA 2L52A 1V8CA 1MPEA 4EE2A 4OALA 1KLUD 1L4DB 2WXRA 5FXEA 1FM0D 1HZ6A 1XCQL 1TY0A 1SJED 3MFGA 4IKGA 1SE3A 4NZLB 3GP7A 3O13A 2IJ0A 3SR6A 3PM9A 2RK5A 3VRAB 2WXFA 1KFYB 3KJMA 2JYTA 1YJJA 3R8BA 1FO4A 3LB8C 3NVZA 4KKJA 2WDRB 5EE9A 1AHZA 2VFSA 3D2HA 1I4RA 3ZGZA 1QOBA 2MJ3A 3AE7B 1I4QA 1P7FA 1C77A 5AWVA 2PLIA 1QILA 1N63A 2WXHA 1V97A 4YXDB 1KF6B 5FXDA 1MBBA 1DIIA 1I7HA 1FNUA 3KWLA 3AE3B 1WVEA 4PVJA 1J7BA 1ZDVA 2BVFA 3AEBB 1VR9A 4ARCA 4DNSA 2Z8LA 3NVYA 4TVYA 3SFEB 2E6XA 2KMMA 2VFUA 3NRZB 2UUUA 1SJHD 2WXOA 2X38A 1M4VA 4MM3B 1T3QA 4WWMA 2WXJA 4DXFA 1R7SA 3CWIA 1WWTA 5L6FA 1DIQA 3ZQ4A 1TJEA 3BVGA 3VR9B 3SFDB 1K53A 4UDUC 4B0MA 3Q8CA 2PW9A 2K9XA 3VQIA 5G5HB 2LMCA 1HZ5A 1D5MC 1ZDXA 2QIEB 1KRHA 3PZ8A 1WSPA 2IGHA 1AN8A 2N7JA 1NYRA 2GB1A 4OZCA 4ZOHB 2VZKD 5GXGB 3P42A 2MBRA 2MEKA 1D5XC 2LEKA 4H2AA 5T8IA 1W1RA 1I4GA 3AE8B 3I99A 4L1BA 4O1NA 4RCOA 1DYQA 1XXGA 1V1OA 1YN3A 3BK1A 1JQ4A 1B9RA 5EE1A 3AH7A 2UUVA 1WYGA 1C4CA 4JAYA 3FAHA 1E0ZA 1AYFA 2N0SB 5C2TB 1E8GA 3U2SC 1J7AA 1QLUA 3ETRA 3AECB 1GOZA 1DOIA 5TSSA 2VFTA 4PVHA 1SB3B 3P63A 4N6EB 3ZYYX 2WDWA 2FBWB 2KDMA 3HUIA 1ENFA 1NVID 2J52A 1EWCA 3IT4B 1CK1A 2RDGA 1MBTA 3TX1A 5JXVA 3W5UB 1EU4A 1VJKA 3MHZA 3NVYB 1PFDA 4US8A 1JWSD 3C8YA 4A90A 1LO5D 5D7GA 3VTEA 2QPMA 2R8DA 1HXYD 3R2IA 4OZBA 5I4DA 3AEAB 2I2YA 2LJIA 2Y3SA 4Q2JA 4LTUA 4A55A 1XCTL 2QILA 1ZXIA 5BMGA 3URYA 1N5WA 3EUB3 1W1JA 2GRIA 1CJEA 4B0EA 2IPIA 1C4AA 2Y4GA 1PUTA 1L6VA 1NYQA 1ZP0B 5FK9C 1JALA 3TUOA 4PYTA 4C80A 1N5WC 3NVVB 1PGAA 2CJOA 1FFVC 2WXPA 5BYSA 2SEBD 3ETRB 3UI3A 1RFKA 1UGJA 5HI1A 3S1FA 5I1VA 2H89B 3LXFA 3DEDA 1SBBB 1N61A 2Y3RA 2FE8A 3W5VB 1ET6A 1E7PB 1N62A 1BUIC 1ZXHA 4ZOHC 1JW9D 2ACZB 4JE3B 1E10A 3FC4A 2CJNA 1QOGA 2JYEA 2AQ3B 4ZRPA 1ROEA 2QEJC 3LLBA 4NJCA 1PGBA 4R3DA 2INPE 5BYRA 2EXRA 5HMRA 4L2YA 2PVOD 1FNVA 1DOYA 2ON8A 3NVZB 3AB5A 4YWGG 1ESFA 1K50A 3AEEB 1T3QC 3GSYA 4GDKB 4ML8A 3W2DA 3RJ8A 4N59A 3N9YC 1C4PA 3GS2A 2INNE 3KWVA 3OWEB 1F77A 4YTMB 4EC3A 1D5ZC 5AE3A 3D2JA 2EKIA 1K52A 2DWQA 3NUHB 4OW0A 3AV8A 1JCKB 1E8HA 3S1DA 2E5AA 2WNMA 3TSJA 1FIQB 4XDDA 1VRAB 4KX6B 2WXMA 2GI9A 4O95A 1TS5A 1JRPA 4USAA 1RYJA 3V3XA 3AE9B 3AE1B 1TZOA 3BYYB 1PDXA 2M0AA 4HRSA 2L32A 1VDVA 2KQ4X 1FRRA 2WXIA 4WURA 2W54A 2GQTA 1L0VB 2WDQB 3LAEA 1RM6B 1KTKA 1IBXB 2LGIA 1W1KA 1DGJA 1I4XA 1T6BX 3I9V1 1SF0A 1F0XA 2Q4WA 4RNAA 2VFRA 1JWUD 4ZHPA 2BT6A 2LHDA 1FNWA 2V3PA 3R2TA 3T3OA 2ZW0A 1N5XA 1AW7A 3J9CA 2JZPA 2QMTA 2R2ZA 1FMAD 1V1PA 2XN9C 2QSDA 1CZPA 3W9CB 2M19A 1VLBA 2I38A 4ARIA 3Q8EA 5H92C 2WXKA 1N62C 1QQRA 2K3UA 3AE6B 2KACA 4WQMA 3MP9A 1I19A 4PWBA 1SE2A 1SEBD 3BVMA 1IGCA 4C7ZA 4OZAA 5LNK1 1VZ7A 3P4SB 4MLAA 2OEDA 4YSYB 5E6JA 2RMMA 4JWSC 3BW7A 5ADZA 5I1WA 2JX5A 4L23A 1UUPA 4D2KA 1PYWD 1DOXA 1AHUA 1IGDA 2WDVB 1QF6A 3R07C 2I0KA 4GDLB 3HRDC 4A9AA 3BIID 4MT5A 2Y08A 1MI0A 3RFZB 1QLBB 1T5XD 3W8XA 5AE2A 2IDYA 1WGKA 1XLPA 4NAWB 2DYMA 2NMQA 2DBYA 2BVGA 4RGOS 3IXSA 3P4PB 1GAQB 1E0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLQ A;  3VRB B;  4PZF A;  1TKE A;  3AMZ A;  3SR6 B;  4FXC A;  3A7A A;  3B2F A;  2G1E A;  1HSK A;  3AE5 B;  4XLO A;  5AE1 A;  1OQQ A;  2K5P A;  2YVS A;  1QLT A;  2QKN A;  1JRO A;  5C3J B;  3C0P A;  4US9 A;  1YJI A;  1FRD A;  1OQR A;  3AED B;  3AM9 A;  2K22 A;  4UD8 A;  3NVY B;  2PVG C;  1EWY C;  3VR8 B;  1F0Z A;  4N58 A;  1SB3 C;  2PKO A;  1IUE A;  3AE2 B;  5G5G A;  1QOF A;  1WXQ A;  4HG0 A;  2WS3 B;  3S1E A;  3PO0 A;  2WP9 B;  3WCQ A;  2VFV A;  2AX5 A;  3B2G A;  1W1O A;  1NEK B;  1W1S A;  3CIR B;  3TSH A;  1W1Q A;  5EE0 A;  3A7R A;  1ZUD 2;  2OAI A;  1ZOY B;  2CU3 A;  3NVW A;  3NS1 B;  2L83 A;  3DWG C;  4BBY A;  2GQU A;  4YTN B;  3DQ0 A;  2MH7 A;  3B9J B;  3FWA A;  1OFF A;  4ITK A;  1X2G A;  3P1M A;  2WU5 B;  1XLN A;  1YQ4 B;  4YT0 B;  2P13 A;  2PIA A;  2B76 B;  1XLO A;  2E3T A;  1FFU A;  2BS4 B;  3RPF C;  2NQW A;  5H8Y E;  1W1M A;  3A7U A;  4BCA A;  1UXY A;  3FW8 A;  1A70 A;  1N63 C;  4JWU C;  1FFV A;  3L4P A;  4PVE A;  4P6V F;  3AE4 B;  5HHZ A;  1N61 C;  3DWM A;  1WRI A;  2PLS A;  2W3S A;  4C7Y A;  1VAO A;  2W55 A;  3FW7 A;  2M56 B;  2Q85 A;  2BVH A;  4IDI A;  1J7C A;  3JS8 A;  3AEG B;  1X2H A;  2VAO A;  4ZHO A;  1UWM A;  5AUK A;  3P4Q B;  3S1C A;  4BC9 A;  2W3R A;  5FXF A;  3EUB 2;  1NEN B;  2Q5W D;  5D79 A;  3HRD D;  3W8W A;  4HRO A;  1QT9 A;  5MPO A;  1WVF A;  1DZN A;  1FFU C;  2WQY B;  2QJL A;  4YTP B;  2HTM E;  1N60 A;  2P3H A;  4YSX B;  1VQZ A;  1FIQ A;  1FXI A;  1TKG A;  2BS3 B;  3NVW B;  1QOA A;  5G5G B;  2AXR A;  2BS2 B;  2WU2 B;  3P4R B;  3AEF B;  1SIJ A;  2H88 B;  2MJE A;  3B9J A;  1RM6 C;  1TKY A;  5AUI A;  1TYG B;  1FXA A;  5EE9 A;  2OHF A;  2MJD A;  1NI3 A;  1AHV A;  4JX1 C;  2JQR B;  4BC7 A;  1JWB D;  1AWD A;  2O3G A;  4JB1 A;  5G5H A;  2Y5C A;  3HVZ A;  1RWS A;  3FW9 A;  3NVV A;  3W8Z A;  4YSZ B;  5HQX A;  2P4P A;  1L5P A;  1ZXI C;  1W1L A;  3ABV B;  1E6E B;  5EE3 A;  1YQ3 B;  1ZR6 A;  1GPX A;  3D2D A;  4TVW A;  1E8F A;  4PVK A;  3NRZ A;  1N60 C;  4PWC A;  5FXP A;  1E9M A;  2KAJ A;  1JWA D;  1L6U A;  2WLB A;  1XO3 A;  3AN1 A;  3NS1 A;  2L52 A;  1V8C A;  4OAL A;  5FXE A;  1FM0 D;  3SR6 A;  3PM9 A;  2RK5 A;  3VRA B;  1KFY B;  3KJM A;  1YJJ A;  1FO4 A;  3LB8 C;  3NVZ A;  2VFS A;  2WDR B;  1AHZ A;  3D2H A;  1QOB A;  2MJ3 A;  3AE7 B;  2PLI A;  1N63 A;  4YXD B;  1V97 A;  1KF6 B;  5FXD A;  1MBB A;  1DII A;  1I7H A;  3KWL A;  3AE3 B;  1WVE A;  4PVJ A;  1J7B A;  2BVF A;  3AEB B;  4DNS A;  3NVY A;  4TVY A;  3SFE B;  2KMM A;  2VFU A;  3NRZ B;  4WWM A;  1T3Q A;  1R7S A;  3CWI A;  1WWT A;  1DIQ A;  1TJE A;  3VR9 B;  3SFD B;  2K9X A;  5G5H B;  2QIE B;  1KRH A;  4ZOH B;  1NYR A;  5GXG B;  2MBR A;  2LEK A;  1W1R A;  3AE8 B;  3I99 A;  1JQ4 A;  1B9R A;  5EE1 A;  3AH7 A;  1WYG A;  4JAY A;  1E0Z A;  3FAH A;  1AYF A;  2N0S B;  5C2T B;  1E8G A;  1J7A A;  1QLU A;  3ETR A;  3AEC B;  1DOI A;  2VFT A;  4PVH A;  1SB3 B;  3P63 A;  4N6E B;  3ZYY X;  2FBW B;  3HUI A;  1NVI D;  1MBT A;  3TX1 A;  3W5U B;  1VJK A;  1PFD A;  4US8 A;  3VTE A;  2QPM A;  2R8D A;  3AEA B;  4LTU A;  1ZXI A;  1N5W A;  3EUB 3;  1W1J A;  1CJE A;  1PUT A;  1L6V A;  1NYQ A;  1ZP0 B;  1JAL A;  4PYT A;  4C80 A;  1N5W C;  3NVV B;  2CJO A;  1FFV C;  3S1F A;  3ETR B;  1RFK A;  2H89 B;  3LXF A;  3DED A;  1N61 A;  3W5V B;  1E7P B;  1N62 A;  4ZOH C;  1JW9 D;  2ACZ B;  1E10 A;  3FC4 A;  2CJN A;  1QOG A;  1ROE A;  3LLB A;  2EXR A;  5HMR A;  2PVO D;  1DOY A;  3NVZ B;  3AB5 A;  3AEE B;  1T3Q C;  3GSY A;  4ML8 A;  4N59 A;  4EC3 A;  4YTM B;  5AE3 A;  3D2J A;  2EKI A;  2DWQ A;  3AV8 A;  1E8H A;  3S1D A;  2E5A A;  3TSJ A;  1FIQ B;  4KX6 B;  4O95 A;  1JRP A;  4USA A;  1RYJ A;  3AE9 B;  3AE1 B;  4HRS A;  1PDX A;  1VDV A;  2GQT A;  1FRR A;  2W54 A;  1L0V B;  2WDQ B;  3LAE A;  1RM6 B;  1W1K A;  1DGJ A;  1F0X A;  1SF0 A;  2Q4W A;  2VFR A;  4ZHP A;  2BT6 A;  1N5X A;  2R2Z A;  1FMA D;  1CZP A;  3W9C B;  2M19 A;  1VLB A;  5H92 C;  1N62 C;  3AE6 B;  4WQM A;  4PWB A;  1I19 A;  4C7Z A;  3P4S B;  4MLA A;  4YSY B;  4JWS C;  3BW7 A;  5ADZ A;  2JX5 A;  1DOX A;  1AHU A;  2WDV B;  1QF6 A;  3R07 C;  2I0K A;  3HRD C;  4A9A A;  3BII D;  1QLB B;  3W8X A;  5AE2 A;  1WGK A;  1XLP A;  2DBY A;  2BVG A;  3P4P B;  1GAQ B;  1E0Y A; 
#chains in the Genus database with same CATH topology
 2C7M B;  2OFJ A;  2W9B A;  3RNC C;  5L1I A;  1ZQA A;  3VRB B;  4IHC A;  2C5L C;  3HVD A;  4OCZ A;  3L16 A;  3A9K A;  5HML A;  1HQR D;  2KT7 A;  3ZLZ A;  3EJD B;  3AMZ A;  4J9L A;  2G9H D;  2QJN A;  3QFB A;  3AUO A;  3VCN A;  3PHW B;  4NL9 C;  2GBM A;  3VCC A;  3A7A A;  3RYT A;  3E56 A;  2A1J B;  4FFD A;  1T0S C;  3DVG X;  4EFO A;  5AE1 A;  4MKS A;  5J2I A;  3RJI A;  3AXC A;  5J0P A;  4TMA B;  2ICI A;  2LUM A;  4H83 A;  1GRF A;  3PQB A;  1BNO A;  1Q8K A;  3VCB A;  4CNQ A;  1LVH A;  9ICA A;  4GIV A;  1WUE A;  2QKN A;  3MSY A;  1RFA A;  1X6J A;  3IBE A;  1NZB A;  4YR2 A;  3NTU A;  4NAM A;  2KFK A;  3NG0 A;  4HN8 A;  3VTW A;  1NK0 A;  3PO4 A;  1E8Y A;  3PRE A;  1FRD A;  1P98 A;  3D32 A;  2K22 A;  1F44 A;  2PVG C;  3VR8 B;  1F0Z A;  3KUM A;  4N58 A;  2ONQ A;  2PKO A;  3DJJ A;  2KZZ A;  3IVF A;  3SV3 A;  1QKZ A;  3ZJT A;  3BK2 A;  1WFY A;  1B0X A;  2HDE A;  3GOE A;  1OGW A;  4A6Q A;  4HG0 A;  3PSI A;  2N9K A;  3CW2 C;  2AGQ A;  5DQH A;  1F52 A;  4NV0 A;  5CJ7 A;  1VZ6 A;  3PZ7 A;  2KJH B;  3GD6 A;  1WCL A;  2JGA A;  3RH4 A;  4PGQ A;  2R18 A;  2XY7 A;  4IOI E;  1RVK A;  2GR1 A;  4Y2U A;  3RIT A;  2VA2 A;  2AX5 A;  4J9P A;  1L7M A;  3DBR I;  2G4S A;  3B2G A;  4MGZ E;  4F2S A;  4P16 A;  3IJI A;  2YB4 A;  3LYS A;  3IJQ A;  2J0K A;  3CIR B;  3DIP A;  3TSH A;  3LB8 A;  1DK2 A;  4Z6C A;  3U26 A;  3Q8F A;  3TEZ A;  3EYZ A;  3F2C A;  4BFR A;  2VZK B;  2R2O A;  2ZW1 A;  4XDC A;  1SIF A;  2WWZ A;  4JK1 A;  2CU3 A;  3NVW A;  1Z5S B;  3BYT B;  3PHX B;  3QC8 B;  4O3S A;  2HOQ A;  3NS1 B;  2L83 A;  3KQ4 A;  3HKZ C;  2KIV A;  4M47 A;  4BBY A;  4KT2 A;  5J29 A;  3DQ0 A;  2KOB A;  4YMN A;  3DK9 A;  3ES8 A;  3EPG A;  3DEE A;  1NK6 A;  2MH7 A;  3B9J B;  4DF8 A;  2PP3 A;  1XWL A;  2K4H A;  4KLH A;  1B22 A;  3C1Y A;  4HYR A;  4H4Z A;  3MR2 A;  1TT5 B;  1X2G A;  1X2I A;  2YLM A;  4P0Q B;  2WU5 B;  2RDJ A;  3AU4 A;  5HFY A;  5DQG A;  2PFP A;  4HKQ A;  1SL0 A;  3H1U A;  2D6F C;  1YN5 A;  2ZTC A;  2HQM A;  1HJP A;  4NQK E;  4W9L A;  5L1M A;  2BPG A;  1CUK A;  2FAZ A;  5L95 C;  3ALB A;  2K8C B;  2ASJ A;  5ALO A;  4ECW A;  3QWZ B;  2E3T A;  2FNJ B;  1RZT A;  4CQN A;  5D3D A;  3RPF C;  2NQW A;  2PS2 A;  3FIL A;  2GL5 A;  2FPM A;  3I5J C;  1P3Q U;  4HPP A;  4FBU A;  3TAR A;  3RJH A;  3A33 B;  5CWR A;  4FZN A;  3MGH A;  3GRS A;  1A70 A;  4QWC A;  1H4R A;  9ICT A;  1ELS A;  4JWU C;  1F2R I;  3FYY A;  2IHM A;  5JCI A;  5CP2 A;  3FYH A;  8ICF A;  1ZQF A;  5IIN A;  2G08 A;  4J3O D;  1GXF A;  2WPF A;  4BUR A;  4MEX A;  1N61 C;  5TR3 A;  2KTR B;  2KDI A;  1DXL A;  3HJE A;  1S8O A;  1PVP A;  2NBW B;  2N4F A;  2RQ5 A;  4F5R A;  4EUT A;  4KGT A;  3FW7 A;  3UM9 A;  4GLX A;  4JPS A;  3DK4 A;  3TFS A;  4PL1 A;  3THV A;  1C76 A;  2BQR A;  4DHG A;  2D5G A;  5DPW A;  3L5K A;  4U6P A;  1B4F A;  2IOH A;  4BJQ A;  1A5R A;  1X2H A;  4EQX A;  1QSL A;  1T94 A;  5AUK A;  4RPY A;  5DLG A;  3PW0 A;  2QQ6 A;  3P4Q B;  1ZJN A;  4ZYS A;  4RQ4 A;  5CR0 A;  2KMC A;  3S1C A;  3URH A;  3C2K A;  1J8C A;  2YX8 A;  3EUB 2;  5D79 A;  4P4P A;  2J42 A;  3W8W A;  1KD0 A;  4HRO A;  1QT9 A;  3UF8 A;  1W6T A;  2GOL A;  5DDY A;  5GMV A;  1WVF A;  4HK2 A;  1BPZ A;  1FFU C;  4YXJ A;  5J0U A;  3WK5 A;  4YTP B;  3AUL A;  3ZTD A;  4DL7 A;  2TPR A;  1SE9 A;  3QX7 A;  3U4E G;  4J9O A;  2HXT A;  5IAA C;  4GGH A;  3ZVH B;  3DPD A;  5KG3 A;  1TKG A;  3APF A;  4PZO A;  3L17 A;  3ZO5 B;  3DVN U;  5KT7 A;  3MGI A;  1PVQ A;  2DW7 A;  5DB7 A;  1N6Z A;  3QXG A;  3N20 C;  2R8J A;  2RDH A;  2LZ6 A;  1GJZ A;  1XNS A;  2OOB B;  4DHZ E;  2WU2 B;  3CXO A;  2GBR A;  2XSX A;  3JVA A;  1SIJ A;  5ALL A;  4NLN A;  2VJ5 A;  5EDS A;  3EJE B;  4F91 B;  1SXE A;  1E7V A;  2I1Q A;  1V9P A;  1GB1 A;  4H19 A;  5AKX A;  1XD3 B;  1SWW A;  2Y5P A;  2KN4 A;  4TQR A;  5JCM A;  1J2N A;  3OC4 A;  4NQL B;  4RQ5 A;  3N7P D;  3LXD A;  2OH2 A;  3L08 A;  4EMW A;  3F2D A;  1ECQ A;  3SJN A;  2KAN A;  1XS2 A;  3ZRF A;  2O3G A;  4JB1 A;  2MUT A;  1WGH A;  3KH0 A;  1F9C A;  2KKV A;  2V4I B;  3WK8 A;  3IN5 A;  4A8E A;  2R8H A;  2KFN A;  2WX1 A;  4UB6 U;  4P7I A;  4YSZ B;  3W8Z A;  5HQX A;  2R8G A;  5U1O A;  4ZH4 A;  2JXT A;  5DB8 A;  1Z00 B;  1YQ3 B;  2HE7 A;  4S17 A;  2XH2 A;  1ZQQ A;  1I4H A;  3DGH A;  2A4Z A;  2K6D B;  3U52 E;  5HHD G;  2N1V A;  4ASW C;  2CFY A;  2KHV A;  4IR9 A;  4P1C C;  4BAX A;  4ZA0 A;  4J03 A;  1OXJ A;  4F71 A;  2QB0 A;  2O6K A;  2NRT A;  3TAQ A;  4JN7 A;  3EHV A;  1ZQW A;  2M9N A;  4JMU A;  2HDO A;  5KL1 B;  5KAF U;  4H4U A;  2LGD A;  3HT3 A;  4MAC A;  5JUM A;  3ZDC A;  4X57 B;  2W43 A;  2UWQ A;  1IBX A;  4BOS C;  3ZXV A;  2HHQ A;  2JK6 A;  1X40 A;  5TZV A;  5AM0 A;  2M17 A;  2X8G A;  2FLN A;  1KH0 A;  3Q8B A;  5J0Q A;  1L6U A;  3D9X A;  3IHP C;  4QW9 A;  2WLB A;  4XX5 A;  4DFP A;  2RLT A;  1UT8 A;  2J53 A;  4TUQ A;  2DYO A;  3E9S A;  3AN1 A;  4K3B A;  3VTV A;  1ONF A;  2EZY A;  2PMZ F;  2L52 A;  4ENL A;  2JV3 A;  6ENL A;  3GII A;  1CRX A;  4I2I A;  4CHK A;  2O6V B;  2REX A;  4C8M A;  3MFG A;  4IKG A;  1SE3 A;  5DB9 A;  5ALW A;  2WOW A;  2NR2 A;  2Z0D B;  2IJ0 A;  2EQ7 A;  4ECT A;  4F7Z A;  3VRA B;  1WCN A;  1KFY B;  2WXF A;  3U30 A;  3KJM A;  3T4W A;  4O5E A;  1PK1 A;  3DK8 A;  4UAY A;  4OD0 A;  2BCU A;  2KD0 A;  5KFP A;  2ZUC A;  2H3Q A;  4RM8 A;  5JHB A;  3CAW A;  1S10 A;  2EH9 A;  3PV1 A;  2KE7 A;  1Q0W B;  1NPX A;  5C5J A;  2HW3 A;  5EWG A;  1C77 A;  3BJS A;  4PHP A;  2BPF A;  1QIL A;  1N63 A;  3X0W A;  3R25 A;  1KEJ A;  5FXD A;  3SDL C;  1KRP A;  4CE6 A;  4O5K A;  1I7H A;  2LI6 A;  4M9J A;  4GRT A;  2XVT A;  3LDA A;  1Y88 A;  2I6X A;  3IM1 A;  4PGY A;  5KFQ A;  3GE3 C;  5F9N A;  1FEB A;  8ICW A;  5FR6 A;  1ZMC A;  4IL0 A;  4DNS A;  5FJR A;  4DDG D;  2KMM A;  2AAQ A;  3TIX A;  2ZAD A;  4J3Z A;  4M52 A;  1UH6 A;  2ZIU A;  3A1Q B;  1L7Y A;  3DVG Y;  5AI0 A;  5L6F A;  3LJ3 A;  1U48 A;  3ZQ4 A;  3BVG A;  4DQQ A;  3SHQ A;  4GGQ A;  3RRH A;  3Q8C A;  2PW9 A;  3R1Z A;  3C23 A;  4PL2 A;  5C0Y A;  3VQI A;  4ZDV A;  4FI4 A;  2LMC A;  3I6E A;  1B43 A;  4ICV A;  3H8J A;  1QTM A;  1MQ3 A;  2CR5 A;  2W0H A;  2B0C A;  3I63 C;  4NLB A;  3IG5 A;  2BKR B;  1NYR A;  2GB1 A;  2N7J A;  4OZC A;  2DKZ A;  4DL6 A;  3H8S A;  5J0S A;  4J9K A;  5GXG B;  3RNA C;  2ZIX A;  3ZIM A;  5J0Y A;  1SL2 A;  2DEN B;  1F8W A;  2MEK A;  4H2A A;  1W1R A;  4LDT B;  3I99 A;  4F72 A;  1SJD A;  4LJX A;  2AU0 A;  1JXL A;  4RCO A;  1Z19 A;  1XXG A;  1WX8 A;  4ELV A;  3C28 A;  1E8W A;  4QZC A;  3BK1 A;  3H8M A;  9ICS A;  1QQ6 A;  4OJ5 A;  2N9X A;  3UMC A;  5C2T B;  1J7A A;  3H8W A;  4MFA A;  4DL2 A;  5IIK A;  2EQY A;  3AEC B;  1GOZ A;  4PVH A;  2KP7 A;  3K1R B;  2WFA A;  2GQW A;  5L1J A;  1U49 A;  4ACO A;  4RT3 A;  3HUI A;  4UBC A;  4F4Z A;  4GN1 A;  4MSQ B;  2F3N A;  1EO6 A;  2F8K A;  1T0Q C;  1DXS A;  3QUC A;  2J52 A;  4IWP A;  3PFR A;  3APD A;  3UJR A;  5ALV A;  5CA7 A;  1R4M I;  1SV0 A;  2NPT B;  5KG7 A;  1VJK A;  2OZT A;  3MHZ A;  3FCP A;  3PY8 A;  2IHN A;  5KFK A;  3PSP A;  4US8 A;  1E90 A;  1PFD A;  2L3Z A;  3MC9 A;  1GRG A;  2K4I A;  3C8Y A;  2QAR B;  1CEZ A;  4QW8 A;  2FCN A;  4A90 A;  3ZDT A;  4K7W A;  3TFR A;  4M0A A;  1MA7 A;  2K1F A;  3DDH A;  1M94 A;  4IP4 A;  2B6G A;  3PX6 A;  1AQ6 A;  2AHO B;  2K89 A;  2LJI A;  5DBB A;  1UCV A;  4B95 A;  4A55 A;  1F0M A;  1Q1R A;  2LMR A;  4BDP A;  1V9J A;  4S0R A;  2ZNV C;  4BKG A;  4K8D A;  3URY A;  5JCK A;  3ZW3 A;  9ICP A;  1WYW B;  2AL2 B;  5IIM A;  2Y4G A;  5KVI A;  2NRW A;  3ZDD A;  3QE9 Y;  4F93 B;  1N5W C;  2UVU A;  5J2B A;  1RLF A;  4ICU A;  2IBI B;  2ZIV B;  2SEB D;  2K6Q A;  3UI3 A;  4JWM A;  3DG6 A;  1IYF A;  2GSH A;  3WU2 U;  1SBB B;  4RM9 A;  2OKT A;  8ICP A;  3QAQ A;  1ET6 A;  4E3C A;  1C3T A;  1T8E A;  1C7Y A;  3CRX A;  1BUI C;  2L76 A;  4JE3 B;  4F50 A;  2JRZ A;  3LK9 A;  2CJN A;  2Z0E B;  3SN0 A;  2KDB A;  3V6J A;  1ZDL A;  4I2A A;  2P0I A;  2QJM A;  2INP E;  4IL2 A;  4K81 A;  3PSF A;  2G5I B;  2CXY A;  4KZ0 A;  3NVZ B;  3V7J A;  4YWG G;  4WQO B;  1KBU A;  5AKG A;  2KZM A;  4GYP C;  1T3Q C;  3GSY A;  3RH6 A;  2G09 A;  3W2D A;  4MMW A;  3RJ8 A;  3FXG A;  3IK4 A;  4RPZ A;  1D5Z C;  3D2J A;  3GDX A;  2VJ4 A;  2DWQ A;  3VTU A;  7ICI A;  4H4T A;  4OW0 A;  2D07 B;  3AV8 A;  2IO2 B;  1JCK B;  3KYC D;  1E8H A;  1ARO P;  5KG1 A;  3PW7 A;  4LNN A;  3OJ4 B;  3N1X C;  3VFK A;  4P2H A;  2GI9 A;  4EEK A;  3CYJ A;  2F1J A;  3AE1 B;  2KO3 A;  2M0A A;  9ICX A;  4QIW C;  2CHZ A;  1VDV A;  4NAW A;  4NJ7 A;  4URK A;  4CF5 A;  1XQQ A;  2DNF A;  1MUC A;  2MUC A;  3STP A;  2WDQ B;  2RHF A;  5AHX A;  3DFH A;  5G2N A;  3R66 C;  1UD7 A;  1D8B A;  1R4N I;  3DDC B;  4WWN A;  4II2 B;  1UBI A;  5ALK A;  3GIL A;  4NEV A;  4A35 A;  1ZW7 A;  3ISC A;  3PVX A;  1W1K A;  1T6B X;  2WPC A;  2Y9T A;  4W9J A;  1SF0 A;  2DZK A;  1E5W A;  1FEZ A;  4Q43 A;  1SKS A;  1IM4 A;  2INC C;  3UIN B;  4RNA A;  5IN7 A;  4AYB F;  8ICX A;  4DQP A;  2N1R A;  1KDH A;  1JWU D;  3GFK B;  2DHZ A;  3EKG A;  1TK8 A;  5J2E A;  3RZF A;  2WF9 A;  2ZW0 A;  3VUW A;  1GRH A;  3J9C A;  2GGE A;  2QMT A;  2ISO A;  5AEK B;  9ICH A;  9ICG A;  1NBF C;  3RNB C;  2I38 A;  1NHQ A;  3H0R B;  9ICU A;  2RRD A;  1V81 A;  2GWS A;  1N62 C;  3WK7 A;  4I2G A;  3JSV B;  3QPE A;  4FN2 A;  3D47 A;  2W8K A;  2CHR A;  4PWB A;  1I19 A;  4IRD A;  2ES6 A;  3N4M B;  2R2Q A;  2OLA A;  1SEB D;  2WAQ F;  2V4Q A;  4W9G A;  4C7Z A;  1GC6 A;  4K2S A;  4EZL A;  4YFK A;  2MA1 A;  1S97 A;  3BDP A;  1VZ7 A;  4MLA A;  1IXR A;  3M63 B;  3T8M A;  2LM1 A;  5ADZ A;  2H3F A;  3M9O B;  2JX5 A;  4OVV A;  2WF6 A;  2XCA A;  2IY0 B;  5HP4 A;  4L23 A;  4W9K A;  2OX4 A;  3RI7 C;  1L3U A;  3WAN A;  1OEP A;  3VH3 B;  2RD0 A;  3BY4 B;  3DCG A;  3NO1 A;  4J6I A;  2AYO B;  1QF6 A;  5KFO A;  4GDL B;  3HRD C;  3UJE A;  2D3A A;  4KLS A;  2O56 A;  2I5Q A;  1NK4 A;  4JUZ A;  4O5C A;  2Y0S F;  8ICU A;  1T5X D;  4EBE A;  1IV8 A;  3SU8 X;  1L7P A;  1WGK A;  2IDY A;  1S0N A;  4KLJ A;  2NMQ A;  2DBY A;  2BVG A;  1JPD X;  7ICF A;  1GES A;  3UJ2 A;  1NK9 A;  1E0Y A;  1SKW A;  2ZXH A;  3PW5 A;  1PVR A;  1ZX9 A;  3JPS A;  5KVH A;  3PWG A;  4ECR A;  5HG2 A;  4XC2 A;  4KLM A;  1Q46 A;  5AIC A;  2ZXI A;  4PZF A;  4M0W A;  3FV9 A;  7ICS A;  3KD3 A;  4AYB C;  5D46 A;  5KG0 A;  2HTH A;  2PEA A;  9ICW A;  4XA5 A;  5BPC A;  5L1L A;  3HM6 X;  3ZI4 A;  4GLS C;  1LXD A;  3DBH I;  5BYQ A;  5E6P A;  2X8X X;  1BML C;  4YR3 A;  3B2F A;  2F8L A;  3HPF A;  2G1E A;  3AE5 B;  5EBK A;  1EU3 A;  4F5N A;  5E6N A;  3RCZ A;  4ZRI A;  2W9C B;  2UYZ B;  1QQ7 A;  2YVS A;  3UQ2 A;  2KMD A;  2GO7 A;  3GIM A;  2BCV A;  3OJ3 A;  4ED6 A;  2EQ8 A;  2JH1 A;  5J0W A;  1WR6 E;  2FCQ A;  2L1A A;  2G0A A;  2IYD B;  5C3J B;  3C0P A;  3IAM 1;  4GFI A;  2V4R A;  2D11 A;  3PX0 A;  1SGH A;  3LVV A;  3C2M A;  2M4N A;  3N30 A;  2YQU A;  1WGR A;  1YJI A;  9ICI A;  3AED B;  1F2R C;  1SKR A;  3CNH A;  2K39 A;  5DPS A;  1EWY C;  1BPB A;  2KJ5 A;  4RNO A;  2AQ2 B;  4DBG A;  2LI5 A;  1P48 A;  1WRD B;  3OW1 A;  2L0T A;  1IUE A;  3TAN A;  3PRP B;  1H2I A;  2ONE A;  1UNS A;  5IP4 D;  3KKA C;  5J2H A;  3GU3 A;  2YTU A;  3ZDB A;  4HKZ E;  3PO0 A;  4DXA B;  4HDQ A;  1PZN A;  3HSU A;  1SE4 A;  2V4L A;  2GLE A;  1BQG A;  2BR0 A;  1NHS A;  3QU9 A;  2FKP A;  1C79 A;  4NLZ A;  1XO1 A;  1BPY A;  2QAR A;  2L5Y A;  3DVN V;  4KEM A;  3ED5 A;  5J2J A;  2KLC A;  3GV8 B;  3N28 A;  3DER A;  3R9K A;  4FZL A;  4H4S A;  4OJ6 A;  3OZM A;  2WXL A;  4LLG M;  1KSP A;  3LYY A;  3CMM B;  4C4R A;  2FMP A;  3MAB A;  2AL2 A;  4BXO B;  2KTQ A;  2G4D B;  1WZ0 A;  1FEH A;  2QGY A;  1TYP A;  2KC2 A;  3QIJ A;  1ONE A;  5J0O A;  5AK6 A;  1MHH E;  1JML A;  4ED0 A;  3WK9 A;  1STZ A;  4E8G A;  1RRB A;  3S2A A;  5D2M B;  1C78 A;  4ED8 A;  5LLI A;  1XEE A;  3RNM A;  3FWA A;  3T9L A;  4YL8 A;  1FXT B;  1OFF A;  5KT3 A;  4ITK A;  4RQ6 A;  5IO9 A;  3KKA A;  1ZQS A;  2HNE A;  2K25 A;  3PR5 B;  1PGX A;  2G45 B;  3QUB A;  3BZD B;  1BPX A;  1PDZ A;  7ICK A;  3UGB B;  4AQ7 A;  1D4B A;  3RAQ A;  4JV1 A;  1WI0 A;  3VAW A;  1AOG A;  2P13 A;  3T5H A;  1GER A;  2K0P A;  2YMP A;  4G3I A;  4M04 A;  1SSN A;  4H2H A;  3DBL I;  3C2L A;  3N3K B;  1R6W A;  4WJO A;  3LVW A;  1FFU A;  4IRK A;  5KFZ A;  2PTZ A;  2ZG6 A;  4EBC A;  1K1S A;  1X6I A;  4K3C A;  3VUX A;  2L7R A;  1GC7 A;  1W1M A;  3A7U A;  4J9S A;  4GDL A;  3VDZ A;  3UPQ A;  7ICM A;  3EEC A;  3BOX A;  3QAR A;  1WMH A;  4PVE A;  4QJF B;  1PK3 A;  1WXM A;  5K4L A;  2WYQ A;  4DF4 A;  3QU5 A;  3DWM A;  2BW2 A;  3TMP B;  2BB5 A;  3EAN A;  3OP2 A;  2BB6 A;  4MF2 A;  4YXM A;  2M56 B;  2BVH A;  2ZZ0 A;  4FHK A;  4C0Z A;  4ZRQ A;  8ICH A;  4GC7 A;  5AIA A;  4UAW A;  3GV7 B;  1UA0 A;  1J7C A;  1K51 A;  3AEG B;  1LQB A;  4KGS A;  3ML9 A;  1Q1W A;  4WH4 A;  1UPH A;  1UWM A;  7ICE A;  5CHG A;  4K7U A;  4P4M A;  4IQV A;  4YR0 A;  4YVZ A;  5ALN A;  2Q5W D;  2KOX A;  1VCB A;  4EQW A;  1STE A;  4CCH A;  2BZF A;  1YX6 B;  4GDK A;  5KFJ A;  2WQY B;  4GXB A;  2MNR A;  3Q8K A;  2QJL A;  1RG6 A;  1F5S A;  4AOF A;  4TKN A;  5ALR A;  2JMG A;  3DV9 A;  5III A;  2QVH A;  3IJL A;  4YSX B;  2HOF A;  2OZ3 A;  4JV2 A;  3NUQ A;  4JV0 A;  1FIQ A;  2YEP B;  1AAR A;  4EYH B;  1FXI A;  5KFE A;  3ZDA A;  2MRP A;  3R10 A;  3BIN A;  1RXV A;  3PW2 A;  3NVW B;  1QOA A;  4NXZ A;  1U4A A;  3EW9 A;  2H3Z A;  4DS5 A;  3H8H A;  1LM8 B;  4XWT A;  4ED7 A;  1NKC A;  2AXR A;  1Y56 A;  3TKA A;  4KIT B;  1X66 A;  3MHS D;  4DSI A;  1LKY A;  2LYA A;  2H88 B;  4G7F A;  3I57 A;  2E1F A;  2ZIX B;  3DG7 A;  3B9J A;  1TKY A;  4FJZ A;  4JL9 A;  1TZZ A;  1OUQ A;  1BWC A;  4IW0 A;  5AUI A;  1TYG B;  5EE9 A;  1FXA A;  3SD5 A;  2OHF A;  2HJ8 A;  2PMQ A;  1NI3 A;  3GIJ A;  4QZB A;  2PPH A;  5KFA A;  4G0N B;  2B3A A;  2AEH A;  2JQR B;  1IYX A;  4K7Z A;  4KLE A;  3Q6B A;  1KLG D;  2R9Z A;  3DDM A;  2NO4 A;  2JH7 A;  4B9T A;  3KUD B;  4UAS A;  3HPO A;  3ZUN A;  1IP9 A;  1YX5 B;  1TY2 A;  3NVV A;  3FW9 A;  3TJI A;  1UT5 A;  3WAP A;  2P4P A;  3B1L X;  1L5P A;  1SL1 A;  2KSO A;  4XGA B;  2NVK X;  4EQR A;  3ABV B;  5D6J B;  2PI4 A;  4FP1 A;  2GH5 A;  4BBN F;  2H5X A;  4EX7 A;  5J8Y C;  5CHW A;  2ALZ A;  4QZI A;  3KZI U;  1ZR6 A;  1ZQE A;  3KZX A;  4MH8 A;  2CRX A;  3IDW A;  3V61 A;  1GPX A;  3MBY A;  3H4B A;  4KIK B;  4MJS A;  1ACC A;  4W9F A;  4MGG A;  9ICR A;  4BWJ A;  4PVK A;  5EU9 A;  4ZRK A;  4A3O A;  3Q69 A;  1N60 C;  1YZ7 A;  4FBT A;  1TKD A;  3OJU A;  4Q44 A;  3PVL A;  3U8Z A;  4A8X C;  3RJG A;  2JXJ A;  2PMV A;  3PV8 A;  2W04 A;  2J6T A;  2Y1J A;  2HHX A;  2WF7 A;  1L5U A;  2HTM E;  3NRW A;  4M02 A;  4ICA A;  3PO5 A;  3GZF A;  5BOL A;  8ICG A;  1D6E C;  1EF1 A;  3G6V A;  4I2E A;  2W7O A;  2QAE A;  8ICM A;  1FCC C;  4ECX A;  2YMM A;  4KSK C;  3JPT A;  5KFY A;  1FD6 A;  4R64 A;  4DLG A;  1F1H A;  1XO3 A;  2V1Y A;  1HIW A;  1TKK A;  2BGW A;  3SD7 A;  2HJ1 A;  3WAO A;  4XE0 A;  5JHA A;  3TWB A;  5DPT A;  2NBV B;  3O65 B;  4FX9 A;  1HZ6 A;  2JF5 A;  1ZQR A;  4B9M A;  4GYP A;  3DES A;  4EZ6 A;  2XH7 A;  3SR6 A;  5HHI A;  1KW4 A;  8ICY A;  1JCT A;  3ZVH A;  1ISN A;  1YJJ A;  1WZ3 A;  3R8B A;  3NVZ A;  2F2A B;  4FS1 A;  2WDR B;  4M8N A;  2VFS A;  3QEB Z;  1QLN A;  3PLU A;  1L3V A;  1E8X A;  1XT9 B;  3CST A;  3AE7 B;  4ECS A;  1I4Q A;  3RD2 A;  1P7F A;  4UB8 U;  4JDR A;  4B9V A;  1L8L A;  1JEH A;  3RUI B;  1ZQV A;  4BVU C;  4Z6F A;  3OHA A;  2WXH A;  1V97 A;  4YXD B;  4NLK A;  1DII A;  3KLJ A;  3KWL A;  7ENL A;  2ZPN A;  4EZ9 A;  1YZ6 A;  5AI4 A;  2MBH A;  4YCX A;  5DGB A;  3M3J A;  4FJY A;  4NJ6 A;  3ZNH B;  4YQW A;  1NJW A;  2GGH A;  3T8Q A;  3MFI A;  4E4U A;  3NRZ B;  2D3D A;  2N9P C;  2UUU A;  2IO1 B;  9ICO A;  4P0Q A;  4QZ9 A;  4DEZ A;  2X38 A;  4MM3 B;  1T3Q A;  2RPQ A;  5C23 A;  4DXF A;  4W9E A;  4LII A;  1HUO A;  3CWI A;  1DIQ A;  2VRR B;  1D8L A;  2MW5 A;  4HNL A;  2FE9 A;  1LPF A;  2QC8 A;  2Y0S C;  4UDU C;  2AKM A;  2WP6 A;  4XRH A;  2LAS A;  2J6U A;  1YQZ A;  3DEQ A;  4O0I A;  5G5H B;  4LZG A;  3KFU F;  2QIE B;  4DXK A;  2WOV A;  3BZK A;  2WPE A;  1PQS A;  5J2D A;  1P43 A;  2IGH A;  5DLF A;  2KV2 A;  2XGP A;  1J2M A;  1S3S G;  4PYZ A;  3DHG C;  2NBU A;  4NEW A;  3RBE A;  2RDX A;  3HWT A;  2GGJ A;  2MQJ A;  1WUD A;  4O1N A;  2DUY A;  1Z4O A;  1Z1B A;  4KLD A;  2LVP A;  1B9R A;  3AH7 A;  2AGP A;  4QZD A;  4QZG A;  3HX0 A;  1C4C A;  2KKC A;  1WM3 A;  1E0Z A;  4JAY A;  1ZQ1 C;  1EBG A;  2PU0 A;  3KBB A;  3JPQ A;  1H38 A;  3OZY A;  3QTP A;  3ETR A;  8ICI A;  3OSP A;  1J97 A;  2DPJ A;  1SB3 B;  5ALS A;  3CGD A;  3P63 A;  1NHR A;  3APC A;  4EBD A;  3H7S A;  1F9J A;  3I6T A;  4EZK A;  1U9L A;  4JN8 A;  1NVI D;  2YVF A;  2HI0 A;  4EQS A;  3C1Z A;  4B6W A;  2FMQ A;  5IA7 A;  1CK1 A;  2RDG A;  1WWU A;  4KMU A;  3KYD D;  1EU4 A;  1J19 A;  2GH1 A;  5D4B A;  2YB1 A;  3CGE A;  8ICT A;  2Z59 B;  1Q3U A;  2Y9U A;  2A5U A;  2PGW A;  3Q3N C;  2FDR A;  1M6I A;  2E8O A;  3VA8 A;  1LO5 D;  1GRE A;  2PTW A;  2LGY A;  2I2Y A;  1XAN A;  5I4D A;  3B0Y A;  3AEA B;  1EF5 A;  3TAC B;  2Y3S A;  1E8Z A;  7ICG A;  3RUL A;  4HPM B;  2FI1 A;  4M2Y A;  3V5C A;  3N6H A;  4JQ9 A;  1D8Y A;  4IM2 A;  4F4Y A;  1BGX T;  3TQ1 A;  2GLS A;  1WG8 A;  3EUB 3;  3MY9 A;  3SQP A;  4ADW A;  5AK5 A;  2UVR A;  4YP3 A;  2FPL A;  5KG4 A;  4CO7 A;  1PUT A;  4O3N A;  1L6V A;  2O2V A;  1EC8 A;  4OJO A;  4XUS A;  4PYT A;  4C80 A;  4BZA A;  4IL6 U;  2DFL A;  2CJO A;  2MLB A;  5IKC M;  5DBA A;  1FFV C;  3NVV B;  2YVG A;  3S1F A;  4QWA A;  5I1V A;  1UGJ A;  4F1S A;  3QCA A;  2O6V A;  2OCE A;  3T9P A;  2VAN A;  4WJ3 B;  5FS8 A;  1WGG A;  1N61 A;  1WXS A;  2FE8 A;  2ASD A;  5J04 A;  1N62 A;  4II3 B;  1O08 A;  1YOV B;  3H4K A;  3HKZ F;  3S6J A;  2AQ3 B;  4R63 A;  1WM2 A;  4KDI C;  5L83 A;  2E8M A;  3OG5 A;  4MFF A;  1ZRM A;  5HMR A;  1JI7 A;  4RT2 A;  5JH5 C;  4DWD A;  5AKZ A;  3QU7 A;  1KKX A;  2DZM A;  3QU2 A;  4GOC A;  4GDK B;  4HVB A;  4N59 A;  3N9Y C;  1C4P A;  2INN E;  2BPS A;  4IUM B;  2HBJ A;  3CF6 E;  4EC3 A;  2EKI A;  3UQB A;  1MOK A;  2KLG A;  2WNM A;  4QZ8 A;  3TSJ A;  2KIW A;  4QZE A;  2MBE A;  4XDD A;  1VRA B;  1FIQ B;  4KX6 B;  3W1Y A;  3DGZ A;  1A6S A;  3TW9 A;  1R4N B;  1WE6 A;  1JRP A;  3V3X A;  2MX2 A;  4PHD A;  3V7L A;  1TV9 A;  2PP0 A;  2MRL A;  3I3T B;  2CU1 A;  1ZET A;  5LXI B;  5F9L A;  2K4P A;  2CPR A;  3CP8 A;  4YD2 A;  1L3T A;  1Z00 A;  7ICP A;  2WXI A;  3UJS A;  4E5T A;  1SZP A;  1Z4N A;  3LAE A;  5KFV A;  1JRU A;  3H0L B;  3V6K A;  4FLH A;  2HHU A;  2ZC8 A;  4NPN A;  4DSF A;  1KTK A;  1IBX B;  2LGI A;  2XC9 A;  1FEC A;  4MEL A;  2KEY A;  4NJ8 A;  2EMT A;  3I9V 1;  4U7C A;  1F0X A;  2Q4W A;  4J9Q A;  1P1A A;  1RYU A;  4GME A;  4HAI A;  2VFR A;  1KL9 A;  2BT6 A;  3C29 A;  3R2T A;  3SI8 A;  1A0P A;  4G11 A;  3DQV A;  3NOB A;  2M8S A;  3D2N A;  1AW7 A;  1NK8 A;  2C7H A;  2R2Z A;  4QWD A;  2QSD A;  4Y2Y A;  1TGZ B;  2XH0 A;  3A4S C;  3TWA A;  2KSO B;  4ELU A;  2YN4 A;  3Q8E A;  1GRT A;  5IIL A;  5H92 C;  1MO9 A;  1RAX A;  2WXK A;  2ZCC A;  2ZVO A;  3HIL A;  4NWI A;  4QZF A;  3TL5 A;  3AE6 B;  2KAC A;  4DSE A;  1IGC A;  1KN0 A;  3OLM D;  1PK1 B;  3TAD A;  4RPX A;  2K4E A;  3EC8 A;  2W9C A;  4DFD A;  2LJ5 A;  2N9E B;  2P66 A;  4JWS C;  4DS4 A;  1SV0 C;  2HVH A;  7ICN A;  1DGS A;  4C8O A;  1LGR A;  4ZCW A;  4WJN A;  3RB0 A;  1TK5 A;  1UUP A;  3E2E A;  3M9N B;  3ML8 A;  3PRM B;  3T6C A;  4UW9 A;  1H8C A;  1AHU A;  1IGD A;  3Q6J A;  2WDV B;  4I2F A;  4M0W B;  2I0K A;  1TAM A;  3UIO B;  2KD1 A;  3EAO A;  1ZQU A;  3ZDM C;  1MI0 A;  1S0V A;  3RFZ B;  5AE2 A;  2XCP A;  2DQN B;  2XH4 A;  3RO6 A;  1XLP A;  2C60 A;  4J57 A;  2DYM A;  1TFR A;  1JMS A;  3DHH C;  1KLV A;  4F5Q A;  2DL0 A;  3IXS A;  1VD2 A;  1OEY A;  4GSW A;  3CSF A;  5KNI A;  3Q14 C;  2WGS A;  5BOE A;  2OQY A;  4G9B A;  2J0M A;  1OTR B;  5J2A A;  5FKA C;  5KFT A;  3OJS A;  1KCZ A;  3Q45 A;  1ED1 A;  3NGD A;  4EEY A;  1NI2 A;  3RR1 A;  5B5E U;  3RMK C;  3GZN I;  3SR6 B;  4Y2R A;  3POP A;  3U7Z A;  4FXC A;  8ICZ A;  1KFS A;  3ZD8 A;  4I2D A;  3BVZ A;  5E6O A;  3EPI A;  2K5P A;  5BMI A;  4UBB A;  4RQ7 A;  3BS7 A;  1ZQG A;  3WAM A;  1JRO A;  1CQV A;  3V3W A;  4HCD A;  4Z6D A;  5HNK A;  2FCM A;  5D49 A;  4KPL A;  4NLG A;  7ICR A;  2KN5 A;  3RNF C;  3IV6 A;  4CDG A;  2OJW A;  3NZ3 A;  4UAT A;  2R8I A;  4AP9 A;  3AM9 A;  3J81 j;  2D3B A;  2ZIU B;  3A1Q A;  4RFB A;  2V0G A;  3NVY B;  1NEL A;  2LKY A;  3ISB A;  3V60 A;  3AE2 B;  3SMV A;  4KN4 A;  1ZKH A;  5G5G A;  1JN3 A;  4JGH B;  3CK5 A;  4C8N A;  4ZRJ A;  3VFC A;  1COK A;  2WS3 B;  2G06 A;  1YN4 A;  2WHE A;  2LHT A;  1ZQI A;  3QEA Z;  4I2C A;  3EFU A;  3N6J A;  5AK3 A;  2JVC A;  2PE9 A;  2KQ7 A;  2WP9 B;  3Q3O C;  2PTL A;  3WCQ A;  3V6H A;  2VFV A;  4M0X A;  3V4B A;  2R8K A;  2CHW A;  2E5S A;  2D3G A;  5BOM A;  5IDZ A;  1KN5 A;  2NTS A;  1EM7 A;  3PRZ A;  4HCL A;  3C0R B;  2SAK A;  3I28 A;  2BWF A;  2PCE A;  3ZJU A;  1VJ5 A;  3CT2 A;  4RZR A;  9ICL A;  1HEZ E;  5DBC A;  4DWI A;  2LBO A;  2OM6 A;  4RGM A;  3A7R A;  2NPT A;  3C21 A;  4F5P A;  2OEH A;  1L7O A;  4PJ0 U;  3Q8L A;  2C7N B;  3TSS A;  1C9F A;  4Y2J A;  1ZUD 2;  3CGB A;  1UZX B;  4HJK A;  2OAI A;  3RR7 A;  1ZOY B;  4TSS A;  4HLE A;  4IS7 A;  4FDC B;  3F53 A;  4DOB A;  2NRX A;  2KTF A;  1OQY A;  1BVS A;  2DAF A;  3F5A A;  4RQ0 A;  3DWG C;  4I6L B;  4TQ1 A;  4YTN B;  4DL3 A;  1P7E A;  4BUG A;  4ACF A;  4GGB A;  2KX3 A;  1JOA A;  3HHM A;  3SEB A;  3WA0 A;  1YIW A;  5AM4 A;  5K8E A;  3DBL B;  1KLN A;  1LKY B;  2BQU A;  3H70 A;  3RRG A;  3TOY A;  5AI9 A;  7ICO A;  2MCN B;  1NNL A;  1SWV A;  5KFW A;  1BKH A;  3UMG A;  2MU2 A;  4W9D A;  2G3Q B;  2WP5 A;  3JVZ X;  3H0M B;  3LDZ E;  4FE3 A;  4J9M A;  4HDO A;  4NM2 A;  1XF5 L;  1XU4 A;  2LHE A;  4PK1 A;  2B76 B;  1XLO A;  2I1J A;  5CHV C;  2JWU A;  2GMI C;  2X8H A;  4DCC A;  2BS4 B;  4EKU A;  1D9F A;  3VC8 A;  1TIF A;  4BCA A;  1UXY A;  2JSV X;  2IGG A;  3FW8 A;  4WIP A;  4BKS D;  3MC0 B;  1WUF A;  4EMI A;  3L4P A;  1MG8 A;  1HEK A;  5ALM A;  4P6V F;  4KWS A;  5AM5 A;  2MP2 A;  8ICQ A;  4E4F A;  2O2V B;  4HJG E;  2VKQ A;  4TV3 A;  4F3O A;  3AE4 B;  4XYC A;  3K9O B;  1T3N A;  5J17 A;  3FDS A;  5HHZ A;  2W9N A;  1XPY A;  3W1S C;  3HK0 A;  2PLS A;  2W3S A;  4C7Y A;  1VAO A;  3AU6 A;  2J0J A;  2W55 A;  2Q85 A;  2F77 X;  4TQS A;  3P2B A;  4MH0 E;  4IDI A;  4ANU A;  2MUT B;  5J2R A;  3QUQ A;  5KFR A;  2V9H A;  3JS8 A;  4MFC A;  4JHM A;  3IAS 1;  1Q1O A;  4R8U B;  4EYI B;  3A4R A;  1YNT E;  2V3B A;  4DFM A;  4M6W A;  5FJT A;  3KW5 B;  4MF8 A;  4WWP A;  2XO7 A;  2BCP A;  2VAO A;  2KKP A;  1WXV A;  4ZHO A;  2F1I A;  2BQQ A;  2Q4T A;  3MC8 A;  4W9C A;  3H40 A;  2W3R A;  5ALD A;  4TQ0 A;  5FXF A;  4BC9 A;  3GD4 A;  4WWO A;  1YD8 U;  9ICK A;  4A20 A;  2ZNV B;  3HRD D;  4KKI A;  2KWD A;  5MPO A;  2KZ3 A;  1MG4 A;  1TYT A;  5KFG A;  2PPG A;  1O03 A;  4Q8F A;  2L0F A;  1ZQH A;  2C28 A;  3QJZ A;  4DX3 A;  5D3I B;  4OJP A;  1IG6 A;  1N2X A;  1B1Z A;  3PK7 A;  4RQ2 A;  4APN A;  3V5F A;  2HHS A;  5L1K A;  1V80 A;  4BV6 A;  3U9I A;  2QHO A;  5FP0 A;  3UGV A;  3PGE A;  2OVL A;  2ZZC A;  5J18 A;  5J0R A;  3T5L A;  1MSW D;  4DQO C;  3WKC A;  3TQP A;  3PTF C;  2KWC A;  5KAI U;  1NK7 A;  3ZJV A;  2GBN A;  2UVW A;  2XGQ A;  3QNM A;  1ZQM A;  2XY5 A;  3SSZ A;  5DG7 A;  3FM9 A;  4KLT A;  3RJA A;  3L13 A;  2AL3 A;  2EZZ A;  2MJE A;  1TS2 A;  5AK4 A;  4WJQ A;  1TS4 A;  2MJD A;  4WAF A;  4DXG A;  4LNK A;  1AHV A;  3FKY A;  4I2H A;  5ALX A;  1GUA B;  3RR8 A;  3RB4 A;  1I4P A;  2MWS B;  5ALI A;  4BC7 A;  4ELT A;  1DNC A;  4KPR A;  1L8P A;  5JRT A;  3MFH A;  3R11 A;  5G5H A;  1V1P B;  4RGN A;  2ZJ8 A;  3UJF A;  1RWS A;  2IPK D;  2FIF A;  1DTN A;  5KT2 A;  3MWC A;  1L0X B;  2LWP A;  2DPI A;  2J4X A;  5CB1 A;  3Q8R B;  2BBC A;  3MJW A;  1W1L A;  4UAZ A;  1RXW A;  4RNM A;  1TE6 A;  2IOF K;  1LV5 A;  3MC1 A;  4WJP A;  4UB5 A;  5KHO A;  3T5J A;  2NPX A;  3BS5 A;  1QQ5 A;  3DFY A;  2F76 X;  3THU A;  2PU1 A;  3D2D A;  3DJG X;  2AQ1 B;  5ALY A;  1XDI A;  4E74 A;  4B9K A;  2MSE D;  3MUC A;  2D2Q A;  4K1W A;  1E8F A;  3SN4 A;  4R66 A;  4K4H A;  3ES7 A;  4UAR A;  4YMO A;  3JPO A;  1ZQC A;  5L9X A;  4KMO B;  4DSJ A;  4I27 A;  3ZKJ C;  3I1Y A;  5A0L A;  1JWM D;  3M95 A;  5AKK A;  3M7D A;  4KLL A;  5FXP A;  1MDL A;  3BSM A;  3P3B A;  1ZD5 A;  5JRB A;  5DKW A;  5CX3 A;  1E9M A;  2CHX A;  3PMN A;  1JWA D;  2KDF B;  4W9I A;  2C3C A;  3GIK A;  2W9B B;  4ED3 A;  1V59 A;  4AP4 C;  3H7P B;  3DBS A;  4JWN A;  5KFC A;  4RQM A;  1JX4 A;  1ZQB A;  2AKZ A;  3MTN B;  1Q10 A;  2LYH A;  3NS1 A;  2VA3 A;  2JEI A;  3SAG A;  1NJZ A;  4REZ A;  1FCL A;  1MC8 A;  1KLU D;  2WXR A;  3VC5 A;  2GR2 A;  3E0F A;  3KHH A;  2HVI A;  3KHL A;  1WJ4 A;  3RNG C;  1XCQ L;  4H4Y A;  1SJE D;  4DDI D;  3HW8 A;  4NZL B;  1SGG A;  1KQQ A;  5CEH A;  3OHB A;  2EAO A;  4J9R A;  4I2B A;  1WX9 A;  3PM9 A;  5GTI U;  3R3M A;  2RK5 A;  2JRH A;  2PGE A;  2RDI A;  2EQ9 A;  5DG8 A;  1FO4 A;  1S76 D;  3LB8 C;  2QDF A;  4KKJ A;  1AHZ A;  5DDM A;  3RNE C;  3FVD A;  4ANV A;  1I4R A;  4TUU A;  2MJ3 A;  4JB3 A;  1FPY A;  3NFU A;  2PLI A;  1GG3 A;  2E8N A;  2JEG A;  3H6N A;  4CF4 A;  3SQS A;  4MEM A;  4UAV A;  4RMA A;  1FNU A;  4M00 A;  3AE3 B;  4PVJ A;  1SXD A;  4MEY A;  2BVF A;  3JSV A;  4J56 A;  2XI9 A;  4ARC A;  1KFT A;  3PLV A;  7ICV A;  3NVY A;  4X2P A;  3T3F A;  2E6X A;  2VFU A;  3HM3 A;  3Q8P B;  3DG3 A;  1WMH B;  3RAX A;  3MQT A;  1SJH D;  4Y2T A;  2WXO A;  2WF5 A;  3NAS A;  4EEW A;  1M4V A;  5AM1 A;  4WWM A;  2OPJ A;  2WXJ A;  3JYU A;  5AKL A;  2AWT A;  1R7S A;  2AXT U;  2P8C A;  3UCD A;  2KTR A;  3OTQ A;  1QSY A;  3Q8Q B;  3VR9 B;  3RJK A;  1K53 A;  3IG3 A;  2KFZ A;  3WK4 A;  4PHA A;  4QZH A;  4I28 A;  1WX7 A;  1HZ5 A;  5LXH A;  2Z7J A;  2NVU I;  8ICC A;  1KRH A;  3PPA A;  1TZ1 A;  4AUQ C;  2HSZ A;  3WK6 A;  1WIA A;  4ZOH B;  2A1J A;  4F4K A;  2VZK D;  1MQ2 A;  2PP1 A;  3RB6 A;  5ALT A;  1V49 A;  4IRC A;  2FID A;  4LCD E;  5T8I A;  2YVJ A;  1I4G A;  4RUC A;  2BVC A;  3NY5 A;  3RBD A;  4K8G A;  4L1B A;  2AH5 A;  3HW2 A;  3ZNG C;  3PX4 A;  1YN3 A;  3A0H U;  3C5F A;  1ZQZ A;  1BPD A;  3EWA A;  4IC9 A;  2UUV A;  1WYG A;  4Q45 A;  1NJX A;  3FAH A;  4F5O A;  1AYF A;  2N0S B;  2G07 A;  2QCZ A;  1Q3V A;  3U2S C;  1QLU A;  2POD A;  2PKE A;  4H4R A;  2ZIV A;  5AIB A;  7ICT A;  1URJ A;  3S5S A;  2VFT A;  1UGM A;  4DYE A;  3ZYY X;  1I35 A;  2KDM A;  1C20 A;  2HXU A;  1NDA A;  2PA6 A;  4M6U A;  5AKY A;  1ENF A;  3UCC A;  3TI0 A;  1S0M A;  1WE7 A;  3Q3F A;  3FG2 P;  5AZG A;  3E58 A;  3RN9 C;  3IT4 B;  1MBT A;  2GRT A;  2EDU A;  3L10 B;  3TX1 A;  2HHV A;  5JXV A;  1ZQL A;  3VHT C;  3ICX A;  4MGI E;  2ATL A;  8ICK A;  4AJW A;  3RF9 A;  4Z1Y A;  1ZK7 A;  1E7U A;  3TAD C;  3JZU A;  2QPM A;  1KJT A;  5ER0 A;  2AQ4 A;  2K8H A;  3AQF A;  2P6R A;  3RCY A;  2WB1 F;  3GQC A;  3H9D A;  4Q2J A;  4EM3 A;  3MDC A;  4IWQ A;  4CYE A;  4NY8 A;  1XCT L;  1Z3E B;  2KK8 A;  5JU5 A;  2RSU A;  5CHF A;  1MDR A;  2QIL A;  1GV4 A;  4QWB A;  2W03 A;  2IZV B;  1N5W A;  3M6K A;  5BMG A;  3P93 A;  5J0X A;  3RH5 A;  2ASL A;  1CJE A;  2IPI A;  1C4A A;  2GOW A;  3QZ7 A;  3DBH B;  5FK9 C;  2IBK A;  3WKD A;  3KHR A;  1CMX B;  1GNU A;  4LNO A;  1JIH A;  1GEU A;  2WXP A;  4DNA A;  1U45 A;  5HI1 A;  2MHJ A;  5E79 U;  1KTQ A;  3JW0 X;  5ENL A;  2PFN A;  5AZF A;  5FS7 A;  2Q0Z X;  1ZGU B;  4IM3 A;  2Y3R A;  2KWU B;  2QDE A;  4TUR A;  4I29 A;  1HTO A;  4IT1 A;  1JW9 D;  2ACZ B;  3TCA A;  3FC4 A;  3KTQ A;  2AJQ A;  1ROE A;  2QEJ C;  4HNC A;  3LLB A;  2DX5 B;  1PDY A;  1X1M A;  2DKX A;  9ICE A;  4L2Y A;  1FNV A;  2ON8 A;  5KTQ A;  3X23 A;  3QHT A;  3QLD A;  3K4G A;  3D6J A;  4P0P B;  1X9W A;  3B08 A;  3QX1 A;  2FPK A;  2PXI A;  2CN1 A;  3GS2 A;  4ML8 A;  4GIR A;  2ZPY A;  5F3X B;  3OPX A;  1F77 A;  4IWO A;  3VH4 B;  3ZTC A;  4F8C B;  3H8A A;  4LDT D;  4HCH A;  3U4F A;  3NUH B;  5AI8 A;  5CRX A;  4C8K A;  5C1Z A;  4I6N B;  3A9J B;  2KK0 A;  2KQS A;  4RU9 A;  3S1D A;  1S5L U;  2E5A A;  2BC0 A;  3AL0 B;  1GRA A;  5J2F A;  1E9I A;  4O95 A;  4LVS A;  3S47 A;  3ONN A;  1TZO A;  2WB1 C;  3BYY B;  1N56 A;  2L32 A;  5TR5 A;  1YT3 A;  2GQT A;  4WUR A;  2W54 A;  3LWM A;  2C3D A;  1L0V B;  2KJ6 A;  2MA9 B;  2PJH A;  1JXE A;  2B21 A;  1TTN A;  2C9W B;  2RP5 A;  5ALF A;  3PWI A;  3QUT A;  1WJU A;  3A9J A;  2NYV A;  2F44 A;  4J9N A;  4B9U A;  2OJR A;  3N32 A;  2CDU A;  3L3F X;  2FLL A;  2KNJ A;  2KVS A;  4TUS A;  1DGJ A;  5AZH A;  2BC1 A;  4PS3 A;  2KHQ A;  5ALZ A;  3GY1 A;  3PG6 A;  4O3M A;  3B0X A;  4OJL A;  2A19 A;  1ZQX A;  2NV3 A;  5ALJ A;  5KT4 A;  4GXK A;  9ICQ A;  3NHE B;  1FNW A;  4ZHP A;  2JEF A;  2KN7 A;  3T3O A;  1N5X A;  3M6Z A;  5AKJ A;  4IR1 A;  2WBA A;  1FMA D;  1V1P A;  2XN9 C;  2HBL A;  1CZP A;  3R7Q A;  3W9C B;  1JDF A;  3QN3 A;  2AL1 A;  2I1K A;  1WH3 A;  2Y5B B;  2M0N A;  3UXL A;  2ZVN A;  2JHD A;  4MDK E;  8ICR A;  3MR5 A;  4C00 A;  2BCR A;  2MBO A;  4EEL A;  9ICJ A;  4KZC A;  2J3N A;  1SE2 A;  2BF8 B;  2P8B A;  3HIZ A;  3N1Z C;  1NK5 A;  2H3I A;  1WGY A;  3P4S B;  3DGB A;  3L8K A;  5KFB A;  2OED A;  5FMH A;  4YSY B;  5E6J A;  3M1Y A;  1BNP A;  2RMM A;  3Q8M A;  1X9X A;  3Q2A C;  4FO6 A;  2GR3 A;  2AGO A;  5AI6 A;  3K75 D;  5FS6 A;  1PUZ A;  1RQN A;  2K8C A;  3C19 A;  4F2R A;  2W7P A;  4M9N A;  4UB4 A;  1PYW D;  2JZZ A;  1DOX A;  1K5O A;  5KFL A;  9ICC A;  3BZC A;  2F5Z A;  2BHN A;  5FJO A;  2JZB A;  3OAW A;  2ZIW B;  3MGV A;  4MT5 A;  1WR1 A;  2BCQ A;  2ZUB A;  2VH2 A;  2L8J A;  4DHJ B;  4PPX A;  1QLB B;  3AU5 A;  2H3V A;  3GZN B;  3W8X A;  4IC7 B;  1C1Y B;  3R7R A;  2K8B A;  4RGO S;  2VA8 A;  3P4P B;  1IIP A;  2GBK A;  3DBR B;  2QJJ A;  2MBQ A;  4OHJ A;  2KVZ A;  3SN1 A;  3N4F A;  1XLQ A;  8ICO A;  5GTH U;  3ENE A;  3NZU A;  1TKE A;  1MHX A;  5BMH A;  2YAU A;  1X9S A;  8ICA A;  1EUV B;  5ALQ A;  4KIK A;  2JR5 A;  4MJS B;  3TEY A;  2BTE A;  2OO6 A;  3P0W A;  3BWU D;  1V2Y A;  1ZQN A;  4LNF A;  4XLO A;  1HSK A;  4NM1 A;  1HE8 A;  2JY6 A;  3TEW A;  2Y3A A;  4GFJ A;  1L4Z B;  4PYU A;  1T0R C;  4DO9 A;  2A3V A;  1OQQ A;  2E8P A;  3WKA A;  2LD9 A;  4E0D A;  3SYZ A;  3OGU A;  1TVA A;  3M8R A;  4LJP B;  1QLT A;  5DG9 A;  2NRZ A;  2DZJ A;  2FUG 1;  2DGZ A;  1ZQD A;  2EAN A;  2P6U A;  2JT4 B;  3ETL A;  4US9 A;  3VDG A;  1ZQY A;  4FUL A;  2VIX A;  1BPE A;  4CF3 A;  3IFW B;  4FJV B;  3N4E A;  3MZN A;  1ZQT A;  5IOI A;  9ICV A;  2OZ8 A;  5GRT A;  1BT0 A;  1MRA A;  1OQR A;  4OVZ A;  2O6V D;  1BXT A;  2GR0 A;  4MM3 A;  4UD8 A;  4XZ4 A;  4DK5 A;  1SB3 C;  1CI4 A;  1SJA A;  4K4I A;  4EOY A;  4EZJ A;  3ZNZ B;  1YMH E;  4KTQ A;  2JUO A;  4PT5 A;  5HMM A;  3K1Z A;  4DL5 A;  1QOF A;  3PST A;  1WXQ A;  2RGF A;  2OG9 A;  4KLO A;  4BGD A;  2WTF A;  2OXO A;  3O0F A;  1HA5 A;  3S1E A;  3GC2 A;  5DQI A;  2WX0 A;  4DL4 A;  2KNB A;  2ZTE A;  3ORY A;  3EA6 A;  1LB2 B;  3GO2 A;  2KX0 A;  3PNC A;  2JXX A;  2W82 A;  3UXO A;  2V3S A;  5IIJ A;  3PZD A;  3QK0 A;  4FZM A;  2KYW A;  2ODG A;  1L2N A;  1W1O A;  4HEA 1;  5AKH A;  1T0Y A;  3Q4D A;  4M8M A;  2RPV A;  1NEK B;  2JRI B;  5AM3 A;  1W1S A;  2BYT A;  2W9M A;  2KG5 A;  1W1Q A;  2BDU A;  2IMW P;  3H7P A;  4KLU A;  5EE0 A;  8ICN A;  5HKH A;  1K8R B;  2HZG A;  4KDL B;  3KUZ A;  2DYB A;  4H4X A;  3PW4 A;  3M8S A;  2WXQ A;  3N1Y C;  3R0K A;  1A76 A;  3IT6 B;  4H1Z A;  5JCN A;  3N97 B;  1TAU A;  9ICM A;  4K7S A;  3TJ4 A;  2LXC A;  3SEI A;  2V3N A;  1RDF A;  1SZH A;  1ZE3 D;  1QCK A;  2BDP A;  2EZX A;  1NDD A;  2WXG A;  1BZL A;  2ASQ A;  2GQU A;  3TJP A;  5ALP A;  3W1S A;  1ZY8 A;  2LFI A;  3EF6 A;  4KLQ A;  2HMX A;  4YMM A;  1X42 A;  3ZD9 A;  1P0R A;  5HR7 A;  1G6J A;  2ZJ5 A;  2RR9 A;  2KDE B;  4PGX A;  2JU6 X;  2JZB B;  1L0Y B;  5KL8 B;  3ISD A;  4IQW A;  2XNA C;  1MNS A;  1KOT A;  4RF1 A;  3P1M A;  2D10 A;  1GB4 A;  3EFC A;  2ZEQ A;  1XLN A;  3Q8S B;  1YQ4 B;  4ROP A;  4OO1 J;  4YT0 B;  3TEX A;  2PI5 A;  2X99 A;  3L54 A;  2ZTD A;  4GC6 A;  2EEL A;  2NCN A;  2NTT A;  2RAB A;  1RYR A;  2PIA A;  3UXP A;  1UWX A;  7ICJ A;  3K9P B;  3BJY A;  4NY0 A;  1TS3 A;  4EM4 A;  3JPN A;  4RH6 A;  5J2C A;  4Y2S A;  4NLC A;  3UXK A;  3A0B U;  5H8Y E;  1WY8 A;  2LUE A;  1EC7 A;  5ALE A;  1P7D A;  1N63 C;  3KHG A;  1FFV A;  2HBM A;  3RTV A;  1ZPS A;  2CS4 A;  2EKE C;  1HTQ A;  2BKE A;  4BXO A;  4KLG A;  2EMS A;  2UU7 A;  4RGT A;  3PZP A;  3SAH A;  1FEA A;  3ZDE A;  4B6J A;  4XQ8 A;  4JIO U;  1F3P A;  2JEJ A;  3EJB B;  1WRI A;  5KFF A;  4DHJ D;  1XS9 D;  3GB1 A;  4JLC A;  4ANW A;  1WJ6 A;  5CTR C;  2XGZ A;  3RJF A;  2QDD A;  5KT5 A;  2XID A;  2LVO A;  3KLS X;  2PSN A;  2KWV B;  4BWM A;  3D46 A;  3IRU A;  4CGZ A;  4YD1 A;  4LJO B;  4LK0 M;  3U7D A;  3TCS A;  5IIO A;  1U47 A;  3ALR A;  4DOA A;  2AQ0 A;  5KFH A;  1ZD2 P;  4C56 C;  2QLT A;  1WXA A;  4RF0 A;  1NEN B;  2FYM A;  1DRG A;  3CYM A;  4O3Q A;  1ZYQ A;  2WAQ C;  4G8T A;  1DZN A;  1V5T A;  4G3X B;  3L5O A;  4RQN A;  2Y1I A;  1COO A;  1EXN A;  4O3R A;  1A77 A;  4O9M A;  2FCS A;  4LNI A;  4ZYN A;  4A3P A;  4H4W A;  3RJJ A;  1L3S A;  3T79 A;  2DLB A;  1N60 A;  1S0O A;  3BQ1 A;  4Y2P A;  3SZ2 A;  2K8A A;  2HOI A;  9ICF A;  4DLE A;  2TSS A;  3QA8 A;  3UIP B;  3Q3M C;  1QZE A;  2W9A A;  1P9D U;  3SAF A;  2FLP A;  2PE6 B;  5G55 A;  1VQZ A;  1J0G A;  4ED1 A;  1YQB A;  3ECI A;  2IGD A;  4KGR A;  5B66 U;  2RDB C;  4DHZ B;  4IZG A;  2LRW A;  2BS3 B;  3TTE A;  3N7S C;  2V3A A;  2WXN A;  1V6E A;  5G5G B;  2BS2 B;  4EMJ A;  4NNJ B;  2XY6 A;  2V6O A;  4ECY A;  4LZD A;  5KFM A;  4KLF A;  5FR3 A;  2YY6 A;  3P4R B;  3AEF B;  1KM7 A;  3V6C B;  2YQE A;  3RJE A;  2YEP F;  2DF4 B;  1RM6 C;  4HYK A;  3D2Q A;  5DB6 A;  1IPG A;  2N9L A;  2PLP A;  2R61 A;  4OZB A;  3UQA A;  4E71 A;  2HHW A;  4ANX A;  1DK3 A;  1UHU A;  5J2K A;  1MVK A;  2C2D A;  4JX1 C;  4Q8E A;  1JWB D;  4P0P A;  2W11 A;  1KFD A;  3BS5 B;  3JPP A;  1AWD A;  3FIL B;  2KJ9 A;  4Z6E A;  2ZJD A;  4UAU A;  1T7P A;  2Y5C A;  3HVZ A;  3CGC A;  3VUY A;  1H6V A;  3V05 A;  4GMV A;  4RQ1 A;  3NZS A;  3T5K A;  1GRB A;  4ED2 A;  1VZ8 A;  2LXA A;  5DPR A;  4XWW A;  2ZIW A;  1EBH A;  1ZXI C;  4GB9 A;  4P4O A;  1SJC A;  1ZOL A;  1YEY A;  3ZXR A;  2HHT A;  2MSN A;  1E6E B;  1V85 A;  5EE3 A;  4FA6 A;  3T3N A;  3H7I A;  4E6M A;  4P1B C;  2W8L A;  1MFW A;  3ZLF A;  1ECW A;  4M9H A;  8ICL A;  4YG2 A;  2XK5 B;  3OTR A;  3Q8A A;  1OJT A;  3LWL A;  3SEN A;  4H4P A;  2V9W A;  2MAX A;  2C2E A;  4DFK A;  4Z17 A;  2ZUD A;  5HHH A;  4TVW A;  2KJR A;  4I2J A;  1D7Y A;  1NOM A;  2MBB B;  3B97 A;  5BOF A;  2FJ6 A;  3IP4 B;  4AS1 A;  3NRZ A;  3C5G A;  2OYY A;  4TUP A;  1S77 D;  1DOQ A;  1T4G A;  4HCP B;  2EAM A;  4PWC A;  1SXT A;  5EWE A;  9ICN A;  2HBK A;  4PS7 A;  3II4 A;  4IP5 A;  1ZMD A;  4YWO A;  3SV4 A;  5EWF A;  2P3H A;  2KAJ A;  5L6G A;  2YMQ A;  3TAP A;  2E1E A;  3V62 A;  3H4D A;  1ET9 A;  3DOW A;  2F1H A;  3MJ5 A;  1ZQK A;  3CXB A;  3RZW C;  1ZD4 A;  3QKE A;  5ALH A;  2K60 A;  4Y2Q A;  4PHE A;  4YN4 A;  2C22 A;  1XSN A;  3BQ7 A;  3EGR A;  1FHV A;  1NKB A;  2L05 A;  4HWI B;  3ZNI D;  1ZQP A;  4MHV A;  3PML A;  2HCF A;  1V8C A;  1MPE A;  3G6Y A;  4EE2 A;  4OAL A;  1L4D B;  5FXE A;  1L6N A;  1FM0 D;  3BQ0 A;  8ICJ A;  1TY0 A;  2BGF A;  3F2B A;  4N9F 4;  4W9H A;  3GP7 A;  3O13 A;  2ZJA A;  3VC6 A;  3CB3 A;  2PFO A;  4HXD A;  2LPE A;  3NZG A;  4R65 A;  3BQT A;  5KT6 A;  1MJD A;  3VXW A;  1JPM A;  4KLI A;  4M6W B;  2JYT A;  1V5O A;  4A6G A;  3M62 B;  5AWV A;  4B9S A;  3D2H A;  2A8X A;  4EWJ A;  3BQ2 A;  3ZGZ A;  1X9M A;  2BQ3 A;  1QOB A;  5AM2 A;  3AU2 A;  2ZZP B;  3NXL A;  4J1O A;  1WF9 A;  2KHW B;  1LVL A;  2XK5 A;  2BPC A;  2D8C A;  2PTX A;  1NHP A;  2IY1 B;  2GGI A;  2PFQ A;  1D9D A;  4M9L A;  3ZVI A;  1NKE A;  4C8L A;  1KF6 B;  1UF0 A;  1MBB A;  1JUD A;  2KFK B;  5KFI A;  5J8Y A;  1HUZ A;  5TIS U;  1WVE A;  2KIC A;  4F4X A;  1ZQO A;  2BYV E;  2BWE S;  4H4V A;  1J7B A;  2QB0 B;  1ZDV A;  3NJT A;  2YVC A;  4G50 A;  1R4M B;  1VR9 A;  2LGX A;  2BYE A;  1K1Q A;  3D2S A;  2NO5 A;  3AEB B;  2Z8L A;  2FMS A;  2WOI A;  3FJ4 A;  3LAD A;  3SFE B;  4LA1 A;  4TVY A;  2LVQ A;  5U25 A;  5KG2 A;  2BKF A;  2DW6 A;  1UA1 A;  1OW5 A;  1TK0 A;  4FBJ B;  1XSP A;  3ENL A;  2YML A;  2A1A A;  2ESE A;  3QFA A;  2QB1 A;  3V6E B;  2LRU A;  1WWT A;  4H4Q A;  1TJE A;  2ZZB A;  4DOC A;  3SFD B;  3RGT A;  4B0M A;  5EOZ A;  3A9K B;  2K9X A;  2KZR A;  3M9M B;  2P35 A;  3MR6 A;  3MDA A;  1D5M C;  1ZDX A;  4BX9 C;  2EXR A;  4HPL B;  3PZ8 A;  2PTY A;  3L0W B;  1WSP A;  2JWZ A;  1SV4 A;  3EZ5 A;  1AN8 A;  2KJ8 A;  3R0U A;  2PMZ C;  4MGY E;  3UMB A;  1ZQJ A;  4FHJ A;  4KVG B;  4DQI A;  4Y2X A;  3P42 A;  2MBR A;  1TBE A;  3IG8 A;  5KFU A;  2KXJ A;  5DCN A;  3DHI C;  2LM4 A;  3SQI A;  1D5X C;  2LEK A;  3PSE B;  4PS8 A;  3AE8 B;  1L8O A;  1EBD A;  1EC9 A;  4DSK A;  2HD5 B;  1TAQ A;  2J7Q B;  4ECU A;  1DYQ A;  4O3O A;  1V1O A;  5KFD A;  2J6S A;  5JTI A;  7ICH A;  3PT2 B;  1JQ4 A;  4MSM B;  5EE1 A;  3TBL D;  2KFJ A;  2GGG A;  3ZVV A;  4ECQ A;  1E8G A;  3JW7 A;  4UB1 A;  3UXN A;  2N7D A;  1XSL A;  1DOI A;  5TSS A;  3AI5 A;  3B0A A;  4N6E B;  4KN7 A;  1QSS A;  3V7K A;  1KKO A;  2WDW A;  2FBW B;  2CKH B;  4DN1 A;  3G6X A;  1RYS A;  1V86 A;  4C4S A;  3KVF B;  1EWC A;  3PR4 A;  3RB3 A;  4OVU A;  3W5U B;  4QNL A;  4UB2 A;  4BKS A;  4RNN A;  1V38 A;  3WKB A;  3O0H A;  4RQ3 A;  1GO3 F;  1JWS D;  4HCN B;  3WKE A;  5D7G A;  5KG5 A;  8ICB A;  3VTE A;  2R8D A;  5KFN A;  1HXY D;  3R2I A;  2N1W A;  4F4R A;  2MP2 B;  2L00 B;  4AJY B;  4B9L A;  2OWO A;  2P3Z A;  3UQ0 A;  5ALG A;  4LTU A;  4Y2V A;  2M1M A;  2IO3 B;  1D3Z A;  3MR3 A;  1YJ1 A;  4UB3 A;  2BCS A;  1ZXI A;  9ICB A;  1XO0 A;  2KMA A;  3PS6 A;  1W1J A;  1R0M A;  4ECV A;  2GRI A;  4B0E A;  1I42 A;  1XHC A;  1Z1V A;  2JZ3 B;  4F4W A;  4A3R A;  5H2F U;  1ZP0 B;  1NYQ A;  1JAL A;  3TUO A;  4HPN A;  2WF8 A;  3H7V A;  5FJU A;  2G5H B;  1PGA A;  4DFJ A;  5DGA A;  4PH5 A;  1RPL A;  1QH9 A;  5BYS A;  3ETR B;  1RFK A;  2WDT B;  1UQV A;  2NS5 A;  1SJB A;  4AWJ A;  2UVV A;  2H89 B;  3I76 A;  3LXF A;  4DQS A;  3GD3 A;  5T14 A;  1XC9 A;  3K1G A;  5FJP A;  5JCL A;  3DED A;  1RQL A;  1ZJM A;  2I5H A;  4KX3 A;  8ICV A;  3W5V B;  4EX6 A;  3VVW B;  4F92 B;  1E7P B;  3IC9 A;  4KV2 A;  1ZXH A;  4ZOH C;  2C2R A;  4IQU A;  1E10 A;  2JYE A;  1UEL A;  1QOG A;  4ZRP A;  4WAA A;  2JPH A;  4CRX A;  4NJC A;  2BYF A;  1ZD3 A;  4PZN A;  1PGB A;  3GE8 C;  4GXI A;  4R3D A;  5J0T A;  2XBB C;  5BYR A;  4BBN C;  2PVO D;  2XEW A;  4FAD A;  1DOY A;  2POZ A;  4I6P A;  1L7N A;  2GBJ A;  3AB5 A;  2DAJ A;  1ESF A;  1K50 A;  3AEE B;  4YWS A;  2AL6 A;  5KFS A;  3HP6 A;  3V72 A;  4GXJ A;  1UBQ A;  2D3C A;  2N7E A;  3KWV A;  3OWE B;  1Q5W B;  4YTM B;  1WGD A;  5AE3 A;  4FS2 A;  2ISP A;  1K52 A;  5ALU A;  3AEV A;  8ICE A;  2GDQ A;  2X8C A;  3OPS A;  5FS9 A;  4QAY A;  3QQ8 B;  1KKR A;  2WXM A;  1TE2 A;  1TS5 A;  5AKI A;  5J2G A;  2VH1 A;  4USA A;  2FUH B;  3GV5 B;  1RYJ A;  3AE9 B;  4UQG A;  4O3P A;  1OEY J;  2I9G A;  5BO4 B;  4BOZ B;  4HRS A;  1PDX A;  4M01 A;  3N7R C;  3NS8 A;  2IND C;  1FRR A;  2KQ4 X;  2IA6 A;  2K8B B;  8ICS A;  2X50 A;  4QZA A;  3IHQ B;  1RM6 B;  2KVR A;  4H50 A;  1NJY A;  4K4G A;  1GSN A;  3RT3 B;  4B9N A;  1MN8 A;  3ONS A;  1I4X A;  2XIC A;  2IOF A;  2QKQ A;  2NQL A;  2LGS A;  4C4V A;  4RQ8 A;  2DZI A;  5KHQ A;  4DSL A;  2LHD A;  3KUC B;  2V3P A;  2EQ6 A;  1U4B A;  7ICU A;  3I4K A;  4MGK E;  4KX5 A;  2KVC A;  2JZP A;  5D94 A;  4GIS A;  1LFD A;  3F5E A;  2M19 A;  1VLB A;  5KFX A;  1N48 A;  1NU5 A;  4IM0 A;  2ZCB A;  1S9F A;  4ARI A;  1GET A;  1K4Q A;  1S7M A;  3QZ8 A;  1Y8R C;  3QYP A;  2WHI A;  3KOO A;  1QQR A;  2K3U A;  3GRT A;  5AKE A;  3H12 A;  3AQE A;  1Z2M A;  4C4V B;  4WQM A;  4DQR A;  3MP9 A;  4NL9 A;  4R8U A;  5HR6 A;  7ICL A;  3BVM A;  1NZP A;  2LYB A;  4IG7 B;  4OZA A;  3EEZ A;  3Q3J A;  5LNK 1;  4RUA A;  4KSL C;  2OQH A;  2IO0 B;  2EAP A;  4GU2 A;  7ICQ A;  3OSN A;  3ZRC A;  4EEN A;  2M0X A;  3BW7 A;  5I1W A;  3SBF A;  3QU4 A;  1FHU A;  4GR1 A;  4X5V A;  1M6Y A;  5AI5 A;  4K1R B;  4D2K A;  4ECZ A;  4DWF A;  4F8R A;  3DH9 A;  3RRA A;  3ZLG A;  1WWV A;  3WIM A;  1ZKQ A;  4M9G A;  5KG6 A;  4JQW C;  3WAL A;  3MKC A;  3ZLH A;  4GIB A;  4C4T A;  4BKT A;  5JZE B;  3R07 C;  4A9A A;  3BII D;  4QIW F;  1S1Q B;  1WJN A;  2Y08 A;  4IQT A;  2KC1 A;  1ZRN A;  4NAW B;  2P88 A;  3JPR A;  3RFA A;  2NRV A;  4QWE A;  1GAQ B; 
#chains in the Genus database with same CATH homology
 4OHJ A;  5HG2 A;  1XLQ A;  3VRB B;  5FKA C;  3HVD A;  4PZF A;  4M0W A;  1HQR D;  1MHX A;  1TKE A;  5BMH A;  3AMZ A;  2G9H D;  3SR6 B;  3TEY A;  4GLS C;  3U7Z A;  4FXC A;  2BTE A;  5BYQ A;  3A7A A;  3BWU D;  3POP A;  3E56 A;  1BML C;  3B2F A;  2G1E A;  1HSK A;  3AE5 B;  4XLO A;  5AE1 A;  3TEW A;  2Y3A A;  1L4Z B;  1EU3 A;  3BVZ A;  4TMA B;  1OQQ A;  2ICI A;  2K5P A;  2LUM A;  3PQB A;  5BMI A;  2YVS A;  1QLT A;  2QKN A;  2FUG 1;  1JRO A;  1CQV A;  2L1A A;  5C3J B;  3C0P A;  3IAM 1;  4US9 A;  4NAM A;  1YJI A;  1FRD A;  3NZ3 A;  1OQR A;  3AED B;  4OVZ A;  3AM9 A;  1BXT A;  1F2R C;  2K22 A;  4RFB A;  4UD8 A;  2PVG C;  1EWY C;  3VR8 B;  2V0G A;  1F0Z A;  4N58 A;  1SB3 C;  2AQ2 B;  2ONQ A;  2PKO A;  1YMH E;  1IUE A;  1QKZ A;  3ZJT A;  3AE2 B;  1UNS A;  3BK2 A;  2HDE A;  4PT5 A;  5G5G A;  1QOF A;  1WXQ A;  4A6Q A;  4HG0 A;  2N9K A;  2WS3 B;  1VZ6 A;  3S1E A;  1HA5 A;  1YN4 A;  3PZ7 A;  4HKZ E;  3PO0 A;  3EA6 A;  1SE4 A;  2WP9 B;  4IOI E;  2PTL A;  3WCQ A;  2VFV A;  2W82 A;  1C79 A;  2AX5 A;  2NTS A;  1EM7 A;  3B2G A;  4HEA 1;  4P16 A;  1W1O A;  2SAK A;  3ZJU A;  2RPV A;  1NEK B;  1W1S A;  3CIR B;  2BYT A;  1HEZ E;  3TSH A;  2WXL A;  1W1Q A;  4LLG M;  3LYY A;  5EE0 A;  4RGM A;  3Q8F A;  3TEZ A;  3A7R A;  3TSS A;  1C9F A;  2WXQ A;  2VZK B;  3IT6 B;  1ZUD 2;  2OAI A;  2ZW1 A;  4XDC A;  1ZOY B;  3BYT B;  4TSS A;  2CU3 A;  3NVW A;  2V3N A;  3NS1 B;  1ZE3 D;  2L83 A;  2WXG A;  3KQ4 A;  1FEH A;  3DWG C;  4BBY A;  2GQU A;  4TQ1 A;  1MHH E;  4YTN B;  3W1S A;  1JML A;  1P7E A;  2LFI A;  3DQ0 A;  3SEB A;  1C78 A;  2MH7 A;  1XEE A;  3B9J B;  3FWA A;  5K8E A;  2JU6 X;  1L0Y B;  1OFF A;  2XNA C;  4ITK A;  1X2G A;  4RF1 A;  3P1M A;  3BZD B;  1PGX A;  2WU5 B;  5HFY A;  1GB4 A;  1XLN A;  4AQ7 A;  1YQ4 B;  1D4B A;  4HKQ A;  4YT0 B;  1YN5 A;  3TEX A;  2EEL A;  2NTT A;  2P13 A;  2K0P A;  2PIA A;  1XF5 L;  2LHE A;  2B76 B;  1XLO A;  1UWX A;  1SSN A;  2JWU A;  2E3T A;  1TS3 A;  1FFU A;  2BS4 B;  4CQN A;  5D3D A;  3RPF C;  4RH6 A;  2NQW A;  3FIL A;  5H8Y E;  1W1M A;  3A7U A;  4BCA A;  1UXY A;  2JSV X;  2IGG A;  3FW8 A;  4WIP A;  1A70 A;  3MC0 B;  1N63 C;  4JWU C;  1FFV A;  1ZPS A;  3L4P A;  1F2R I;  4PVE A;  4P6V F;  4RGT A;  4HJG E;  4J3O D;  3AE4 B;  5HHZ A;  1N61 C;  3DWM A;  2BW2 A;  1WRI A;  2BB5 A;  2PLS A;  2W3S A;  4C7Y A;  1VAO A;  2BB6 A;  2W55 A;  3GB1 A;  2M56 B;  4KGT A;  2BVH A;  2Q85 A;  3FW7 A;  4IDI A;  4ZRQ A;  4JPS A;  1J7C A;  3JS8 A;  3AEG B;  1K51 A;  1C76 A;  4KGS A;  3IAS 1;  3KLS X;  2D5G A;  1YNT E;  4WH4 A;  1X2H A;  4LK0 M;  2VAO A;  5AUK A;  1UWM A;  4ZHO A;  3P4Q B;  4ZYS A;  3S1C A;  4C56 C;  4TQ0 A;  4BC9 A;  2W3R A;  5FXF A;  4RF0 A;  3EUB 2;  1NEN B;  2Q5W D;  5D79 A;  3HRD D;  2J42 A;  4KKI A;  3W8W A;  4HRO A;  1QT9 A;  2KWD A;  5MPO A;  1WVF A;  1STE A;  1DZN A;  1FFU C;  2WQY B;  5D3I B;  2QJL A;  1B1Z A;  4YTP B;  2DLB A;  1N60 A;  2HTM E;  2P3H A;  3HSU A;  2TSS A;  3U4E G;  4YSX B;  1VQZ A;  1FIQ A;  2YEP B;  1FXI A;  1TKG A;  4KGR A;  2IGD A;  4DQO C;  2BS3 B;  3NVW B;  2WXN A;  1QOA A;  3ZJV A;  5G5G B;  2AXR A;  2BS2 B;  3H8H A;  4XWT A;  2RDH A;  1Y56 A;  5FR3 A;  2WU2 B;  3P4R B;  3RJA A;  3AEF B;  1SIJ A;  2H88 B;  3I57 A;  2MJE A;  2YEP F;  3B9J A;  1RM6 C;  1TKY A;  1TS2 A;  1GB1 A;  2N9L A;  1TYG B;  1FXA A;  2PLP A;  2R61 A;  1TS4 A;  2OHF A;  2MJD A;  1NI3 A;  2KN4 A;  2Y5P A;  4WAF A;  4DXG A;  1AHV A;  1MVK A;  4JX1 C;  2JQR B;  4BC7 A;  1JWB D;  1I4P A;  1KLG D;  1AWD A;  2O3G A;  3FIL B;  4JB1 A;  5G5H A;  1V1P B;  2Y5C A;  3HVZ A;  4RGN A;  3V05 A;  1RWS A;  2V4I B;  2IPK D;  5AUI A;  1TY2 A;  3NVV A;  3FW9 A;  3W8Z A;  4YSZ B;  5HQX A;  1VZ8 A;  2P4P A;  1L0X B;  4XWW A;  1L5P A;  1ZXI C;  2J4X A;  1W1L A;  2BBC A;  3ABV B;  1E6E B;  2JXT A;  5EE3 A;  3T3N A;  1YQ3 B;  1I4H A;  3U52 E;  5HHD G;  3Q8A A;  1ZR6 A;  4MH8 A;  1GPX A;  3D2D A;  2AQ1 B;  4TVW A;  1ACC A;  1E8F A;  4PVK A;  4AS1 A;  3NRZ A;  3Q69 A;  1N60 C;  4MAC A;  4A8X C;  4PWC A;  1SXT A;  1JWM D;  2PMV A;  5FXP A;  1IBX A;  1E9M A;  5L6G A;  2KAJ A;  1JWA D;  1KH0 A;  1D6E C;  3Q8B A;  1L6U A;  1ET9 A;  2WLB A;  3MJ5 A;  1FCC C;  1FD6 A;  2J53 A;  1XO3 A;  2DYO A;  3E9S A;  3EGR A;  3AN1 A;  1Q10 A;  3NS1 A;  4REZ A;  4XE0 A;  1FCL A;  2L52 A;  1V8C A;  1MPE A;  4EE2 A;  4OAL A;  1KLU D;  1L4D B;  2WXR A;  5FXE A;  1FM0 D;  1HZ6 A;  1XCQ L;  1TY0 A;  1SJE D;  3MFG A;  4IKG A;  1SE3 A;  4NZL B;  3GP7 A;  3O13 A;  2IJ0 A;  3SR6 A;  3PM9 A;  2RK5 A;  3VRA B;  2WXF A;  1KFY B;  3KJM A;  2JYT A;  1YJJ A;  3R8B A;  1FO4 A;  3LB8 C;  3NVZ A;  4KKJ A;  2WDR B;  5EE9 A;  1AHZ A;  2VFS A;  3D2H A;  1I4R A;  3ZGZ A;  1QOB A;  2MJ3 A;  3AE7 B;  1I4Q A;  1P7F A;  1C77 A;  5AWV A;  2PLI A;  1QIL A;  1N63 A;  2WXH A;  1V97 A;  4YXD B;  1KF6 B;  5FXD A;  1MBB A;  1DII A;  1I7H A;  1FNU A;  3KWL A;  3AE3 B;  1WVE A;  4PVJ A;  1J7B A;  1ZDV A;  2BVF A;  3AEB B;  1VR9 A;  4ARC A;  4DNS A;  2Z8L A;  3NVY A;  4TVY A;  3SFE B;  2E6X A;  2KMM A;  2VFU A;  3NRZ B;  2UUU A;  1SJH D;  2WXO A;  2X38 A;  1M4V A;  4MM3 B;  1T3Q A;  4WWM A;  2WXJ A;  4DXF A;  1R7S A;  3CWI A;  1WWT A;  5L6F A;  1DIQ A;  3ZQ4 A;  1TJE A;  3BVG A;  3VR9 B;  3SFD B;  1K53 A;  4UDU C;  4B0M A;  3Q8C A;  2PW9 A;  2K9X A;  3VQI A;  5G5H B;  2LMC A;  1HZ5 A;  1D5M C;  1ZDX A;  2QIE B;  1KRH A;  3PZ8 A;  1WSP A;  2IGH A;  1AN8 A;  2N7J A;  1NYR A;  2GB1 A;  4OZC A;  4ZOH B;  2VZK D;  5GXG B;  3P42 A;  2MBR A;  2MEK A;  1D5X C;  2LEK A;  4H2A A;  5T8I A;  1W1R A;  1I4G A;  3AE8 B;  3I99 A;  4L1B A;  4O1N A;  4RCO A;  1DYQ A;  1XXG A;  1V1O A;  1YN3 A;  3BK1 A;  1JQ4 A;  1B9R A;  5EE1 A;  3AH7 A;  2UUV A;  1WYG A;  1C4C A;  4JAY A;  3FAH A;  1E0Z A;  1AYF A;  2N0S B;  5C2T B;  1E8G A;  3U2S C;  1J7A A;  1QLU A;  3ETR A;  3AEC B;  1GOZ A;  1DOI A;  5TSS A;  2VFT A;  4PVH A;  1SB3 B;  3P63 A;  4N6E B;  3ZYY X;  2WDW A;  2FBW B;  2KDM A;  3HUI A;  1ENF A;  1NVI D;  2J52 A;  1EWC A;  3IT4 B;  1CK1 A;  2RDG A;  1MBT A;  3TX1 A;  5JXV A;  3W5U B;  1EU4 A;  1VJK A;  3MHZ A;  3NVY B;  1PFD A;  4US8 A;  1JWS D;  3C8Y A;  4A90 A;  1LO5 D;  5D7G A;  3VTE A;  2QPM A;  2R8D A;  1HXY D;  3R2I A;  4OZB A;  5I4D A;  3AEA B;  2I2Y A;  2LJI A;  2Y3S A;  4Q2J A;  4LTU A;  4A55 A;  1XCT L;  2QIL A;  1ZXI A;  5BMG A;  3URY A;  1N5W A;  3EUB 3;  1W1J A;  2GRI A;  1CJE A;  4B0E A;  2IPI A;  1C4A A;  2Y4G A;  1PUT A;  1L6V A;  1NYQ A;  1ZP0 B;  5FK9 C;  1JAL A;  3TUO A;  4PYT A;  4C80 A;  1N5W C;  3NVV B;  1PGA A;  2CJO A;  1FFV C;  2WXP A;  5BYS A;  2SEB D;  3ETR B;  3UI3 A;  1RFK A;  1UGJ A;  5HI1 A;  3S1F A;  5I1V A;  2H89 B;  3LXF A;  3DED A;  1SBB B;  1N61 A;  2Y3R A;  2FE8 A;  3W5V B;  1ET6 A;  1E7P B;  1N62 A;  1BUI C;  1ZXH A;  4ZOH C;  1JW9 D;  2ACZ B;  4JE3 B;  1E10 A;  3FC4 A;  2CJN A;  1QOG A;  2JYE A;  2AQ3 B;  4ZRP A;  1ROE A;  2QEJ C;  3LLB A;  4NJC A;  1PGB A;  4R3D A;  2INP E;  5BYR A;  2EXR A;  5HMR A;  4L2Y A;  2PVO D;  1FNV A;  1DOY A;  2ON8 A;  3NVZ B;  3AB5 A;  4YWG G;  1ESF A;  1K50 A;  3AEE B;  1T3Q C;  3GSY A;  4GDK B;  4ML8 A;  3W2D A;  3RJ8 A;  4N59 A;  3N9Y C;  1C4P A;  3GS2 A;  2INN E;  3KWV A;  3OWE B;  1F77 A;  4YTM B;  4EC3 A;  1D5Z C;  5AE3 A;  3D2J A;  2EKI A;  1K52 A;  2DWQ A;  3NUH B;  4OW0 A;  3AV8 A;  1JCK B;  1E8H A;  3S1D A;  2E5A A;  2WNM A;  3TSJ A;  1FIQ B;  4XDD A;  1VRA B;  4KX6 B;  2WXM A;  2GI9 A;  4O95 A;  1TS5 A;  1JRP A;  4USA A;  1RYJ A;  3V3X A;  3AE9 B;  3AE1 B;  1TZO A;  3BYY B;  1PDX A;  2M0A A;  4HRS A;  2L32 A;  1VDV A;  2KQ4 X;  1FRR A;  2WXI A;  4WUR A;  2W54 A;  2GQT A;  1L0V B;  2WDQ B;  3LAE A;  1RM6 B;  1KTK A;  1IBX B;  2LGI A;  1W1K A;  1DGJ A;  1I4X A;  1T6B X;  3I9V 1;  1SF0 A;  1F0X A;  2Q4W A;  4RNA A;  2VFR A;  1JWU D;  4ZHP A;  2BT6 A;  2LHD A;  1FNW A;  2V3P A;  3R2T A;  3T3O A;  2ZW0 A;  1N5X A;  1AW7 A;  3J9C A;  2JZP A;  2QMT A;  2R2Z A;  1FMA D;  1V1P A;  2XN9 C;  2QSD A;  1CZP A;  3W9C B;  2M19 A;  1VLB A;  2I38 A;  4ARI A;  3Q8E A;  5H92 C;  2WXK A;  1N62 C;  1QQR A;  2K3U A;  3AE6 B;  2KAC A;  4WQM A;  3MP9 A;  1I19 A;  4PWB A;  1SE2 A;  1SEB D;  3BVM A;  1IGC A;  4C7Z A;  4OZA A;  5LNK 1;  1VZ7 A;  3P4S B;  4MLA A;  2OED A;  4YSY B;  5E6J A;  2RMM A;  4JWS C;  3BW7 A;  5ADZ A;  5I1W A;  2JX5 A;  4L23 A;  1UUP A;  4D2K A;  1PYW D;  1DOX A;  1AHU A;  1IGD A;  2WDV B;  1QF6 A;  3R07 C;  2I0K A;  4GDL B;  3HRD C;  4A9A A;  3BII D;  4MT5 A;  2Y08 A;  1MI0 A;  3RFZ B;  1QLB B;  1T5X D;  3W8X A;  5AE2 A;  2IDY A;  1WGK A;  1XLP A;  4NAW B;  2DYM A;  2NMQ A;  2DBY A;  2BVG A;  4RGO S;  3IXS A;  3P4P B;  1GAQ B;  1E0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...