2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
2Y5CA 2QIEB 1W1RA 1F0XA 1KF6B 1HSKA 3NRZB 1A70A 1E0ZA 4WWMA 3NVZA 3S1EA 2MBRA 1FFUA 1CZPA 1TKEA 2QPMA 3DWMA 3W8XA 2B76B 3ZYYX 1WXQA 4ZHPA 4JX1C 1N5XA 3AE6B 4YSZB 1N61C 3AEBB 1TKYA 3R07C 1RM6C 3LAEA 4YT0B 2BS3B 3AB5A 2P4PA 5MPOA 1QOBA 4BC7A 3B2GA 3FAHA 3FC4A 5FXFA 3TSHA 1NEKB 2EKIA 2WDRB 1MBBA 2WP9B 1N63C 1NI3A 3AH7A 1E8HA 2WU5B 2K22A 2WLBA 4EC3A 4HRSA 4YTMB 1JRPA 1N60A 4XLOA 2PLIA 3AN1A 3P1MA 3TSJA 3S1CA 1FFVA 3B2FA 2MJ3A 1AHVA 3RPFC 1NENB 1VDVA 1V97A 5G5GB 4JWUC 1GPXA 4C7ZA 3LB8C 4YSXB 2GQUA 3S1DA 3P4PB 1WVEA 1XLNA 1VLBA 2CU3A 5EE0A 3P4QB 3W8WA 1AWDA 1FRRA 1WGKA 1FIQB 1IUEA 3AMZA 1L0VB 3B9JA 1E7PB 1NYRA 1SF0A 1XLQA 5G5HB 1W1JA 5AE1A 2K5PA 2H88B 1AYFA 1PFDA 3FW7A 3W8ZA 4BBYA 1AHUA 4A9AA 1UWMA 2P3HA 1JQ4A 2NQWA 3FW8A 4PWCA 4PVHA 3PM9A 3P4RB 2K9XA 5AE3A 4JB1A 3TX1A 4O95A 2CJNA 2MJEA 2WQYB 3EUB3 1E8GA 3P4SB 5C3JB 4C7YA 3AE2B 1E10A 2O3GA 1OQRA 1W1QA 3NVVB 3VRBB 1E0YA 2FBWB 4N59A 4JAYA 3SFDB 2JX5A 3SR6B 1QF6A 2L83A 2GQTA 3BIID 1DIIA 3EUB2 1W1KA 4TVWA 2LEKA 3NS1B 2BVFA 3KWLA 1AHZA 1ZP0B 1QLTA 1W1SA 3NVYA 2HTME 1QOGA 1DOIA 4PZFA 4N6EB 3AE4B 1N60C 1FIQA 2BS4B 3LXFA 1JROA 3AE5B 1DGJA 1R7SA 3AEEB 1FFVC 3FW9A 5FXDA 1TJEA 1ROEA 2Q5WD 3KJMA 5HMRA 2WDVB 2BVHA 3I99A 5ADZA 1FXAA 2OAIA 1N62C 1PUTA 3HVZA 3ETRA 5H8YE 3D2JA 2QKNA 3AE8B 1QLUA 5EE1A 1OFFA 1OQQA 1QOAA 3AM9A 2PKOA 1V8CA 2WU2B 1J7AA 3NRZA 2VFRA 1TYGB 1I19A 5AUKA 4YXDB 1ZR6A 4PVEA 2PIAA 3NVVA 4OALA 4YTNB 1N62A 3ABVB 1RFKA 2JQRB 1I7HA 3W5VB 3HRDD 2M19A 1W1MA 1SB3C 4US9A 2RK5A 1W1LA 4N58A 2WDQB 2E5AA 1FXIA 1TKGA 1GAQB 2W54A 2E3TA 1FRDA 1YQ4B 5D79A 3L4PA 3AEDB 2AXRA 4ML8A 1JALA 4PYTA 1VJKA 5FXEA 3GSYA 2BVGA 4DNSA 1E8FA 3DQ0A 1VQZA 3W9CB 1W1OA 4HG0A 1QT9A 4UD8A 3AE1B 3SFEB 1DOXA 4US8A 4HROA 3AE7B 2MJDA 3C0PA 4C80A 1XO3A 3VR9B 5FXPA 2VFVA 5C2TB 4YSYB 4PVJA 1N5WA 5G5GA 2W3RA 1T3QC 2CJOA 1RM6B 1JWBD 3WCQA 3FWAA 1L6VA 1CJEA 1VAOA 3NVWB 1WRIA 1MBTA 2DWQA 3VTEA 5AUIA 4IDIA 1RWSA 1XLPA 4ZOHC 3W5UB 3DEDA 3LLBA 5AE2A 5GXGB 2G1EA 2PLSA 2ACZB 3HUIA 1T3QA 1ZXIA 1XLOA 3D2HA 3BW7A 1KRHA 2VFTA 1DIQA 3CWIA 5G5HA 1JW9D 5EE3A 1EWYC 1X2GA 1WVFA 3JS8A 3AEGB 2I0KA 3B9JB 1WWTA 2P13A 1L5PA 1WYGA 2N0SB 2H89B 2YVSA 3AEFB 4JWSC 1QOFA 4P6VF 1X2HA 2W3SA 2VFSA 2VFUA 1E6EB 1ZOYB 1SB3B 2R2ZA 4WQMA 3PO0A 2BS2B 1N61A 4BCAA 4BC9A 2R8DA 3SR6A 4KX6B 4LTUA 1YJIA 3VRAB 1RYJA 2AX5A 5H92C 3NVWA 3NVZB 1J7BA 3AEAB 1J7CA 2DBYA 3AE9B 3NS1A 4ZHOA 2EXRA 3VR8B 2MH7A 1UXYA 1KFYB 4USAA 5HQXA 2W55A 4FXCA 1N63A 2BT6A 2M56B 2WS3B 5EE9A 1ZUD2 3AV8A 1NVID 1F0ZA 1PDXA 1JWAD 3A7UA 1NYQA 3D2DA 3AECB 3S1FA 1L6UA 4YTPB 1N5WC 3HRDC 3NVYB 3CIRB 4PWBA 3A7RA 1YJJA 1B9RA 4TVYA 1QLBB 2Q4WA 2KMMA 1FO4A 1SIJA 3AE3B 1E9MA 4ITKA 2PVOD 3A7AA 1YQ3B 2OHFA 2Q85A 4MLAA 1FMAD 1FFUC 5HHZA 2PVGC 2VAOA 1DOYA 3DWGC 4PVKA 2L52A 2QJLA 3ETRB 2KAJA 4ZOHB 3P63A 1ZXIC 1FM0D 1DZNA
chains in the Genus database with same CATH superfamily
2F1IA 4H4RA 4M2YA 2NRZA 3BJYA 1KF6B 1XD3B 3NFUA 2BCRA 1IGDA 4EEYA 4J9QA 1X9WA 3X0WA 1JUDA 3FILA 4PS3A 1HSKA 1T94A 2KE7A 2WX1A 3NRZB 2WPFA 3AU6A 4GU2A 1YZ6A 3URHA 4NY8A 5ALUA 3U2SC 4QAYA 4I2DA 1V5TA 4TQSA 2PSNA 1NK5A 3PSFA 2MW5A 3BDPA 3MC0B 4R3DA 3NTUA 1NZBA 4W9IA 2UUUA 4J9MA 2D07B 3RBDA 2KTFA 3BK2A 4NL9C 2DYBA 1BT0A 1IIPA 2KOXA 3FG2P 1ZQMA 1URJA 1LVHA 2ASJA 3ZYYX 1C79A 3SI8A 2IA6A 1ELSA 4JX1C 4IM3A 4MT5A 2QJMA 1WG8A 3UI3A 3ZI4A 3IT6B 4DHZE 3PLVA 3CYJA 4HWIB 3UM9A 2AL3A 1NI2A 4W9LA 5AI8A 1NK7A 4C00A 2OPJA 3LYYA 2OZTA 1N61C 2MCNB 2V3NA 4UATA 3QU7A 2D8CA 4I2GA 4GDKA 2ZZCA 2HBLA 5AM1A 1S8OA 5L1IA 2JZPA 4MGGA 2LZ6A 4F2SA 4URKA 3FAHA 3QXGA 3UQBA 2MA1A 4F5QA 1Q1WA 1RYUA 4Z6CA 2AEHA 2BF8B 2WXJA 1J0GA 4DLGA 2NPTA 1AQ6A 4B9MA 7ICOA 1WCNA 2HDEA 1U9LA 4JE3B 3H8SA 2HZGA 5DCNA 3I63C 2K8BB 3K9PB 5CHVC 1N63C 3II4A 3AH7A 4MSQB 3H7VA 5KFLA 2YVCA 9ICOA 1XCQL 3TACB 3DGBA 5AM3A 3N6JA 4YTMB 5E79U 4C8MA 1T7PA 4ICUA 4IHCA 1MFWA 1V1OA 4DF8A 4JIOU 3CGDA 2NRWA 3MR2A 5CP2A 1BGXT 5KFKA 3AN1A 2G45B 2N9KA 2RDGA 4GXBA 4HK2A 2XK5B 4MH8A 3TSJA 1MG8A 1QTMA 3B2FA 2MJ3A 3IG8A 4RQ1A 2IY1B 2SEBD 3MFGA 4GDLB 3RPFC 3MKCA 2PXIA 1F0MA 5T14A 2EZZA 5HMLA 3RB6A 1HZ5A 4KLUA 1SE2A 2R2QA 4J9RA 3IVFA 1P7DA 4B0EA 3GY1A 2W7OA 4DSFA 1XCTL 1X66A 2R8IA 4JWUC 4K7ZA 2IBIB 3WKCA 1ZD5A 3SN0A 5KFGA 2W9BB 4H4XA 4OCZA 4K4IA 5KFDA 3N97B 1CMXB 4MEMA 3D2SA 4HDOA 3P4PB 4HYKA 3PREA 1XLNA 1PGBA 2BYFA 4MJSB 4Q8EA 5ALGA 3SDLC 3PG6A 3C1ZA 3BQ0A 2ZIUB 3QA8A 3GRSA 4EZLA 4IQVA 4DL5A 3OJUA 3L08A 3PZPA 3C19A 4KGTA 4W9EA 1AWDA 4P7IA 7ICJA 5ALTA 1TIFA 4R8UA 1AW7A 4HXDA 9ICWA 3GD3A 3MGVA 3KOOA 3M6ZA 3T3FA 1SXTA 3Q8MA 1L0VB 1EWCA 4DOAA 1DK2A 1JMLA 1E7PB 3A9KB 2NS5A 3GD4A 3AXCA 2FAZA 1TY0A 1O03A 5D49A 4UB4A 2KX0A 2W9NA 3UGBB 2LGYA 1Q5WB 5J2BA 4WJNA 5AE1A 3DBHI 1K4QA 2ZUBA 4UB8U 7ENLA 1LFDA 5DPRA 2JPHA 2Y5BB 3FW7A 5AIAA 4MACA 2D2QA 2BKFA 4PS7A 3HSUA 1ECWA 2L32A 3VTUA 2JF5A 4ICAA 2W9CB 1FHVA 3O0HA 4KLEA 3UXPA 3DGHA 4YG2A 3BS5A 5AK3A 4PVHA 2O56A 2D6FC 3ES7A 3WK9A 5J2AA 3UJFA 2G09A 1B43A 1L6NA 3IHPC 3ZDAA 2FPLA 3TX1A 2Z59B 3QFBA 2C9WB 2N7EA 4H4TA 1I42A 9ICTA 1OGWA 4RQ0A 5D3IB 2DQNB 3EW9A 2YMPA 4HDQA 4B9KA 1JEHA 3GB1A 1AN8A 2SAKA 5FJOA 3PR5B 1OQRA 3VRBB 1Z3EB 2I6XA 1E0YA 1ZETA 4KLLA 2XBBC 4TKNA 4E74A 1T0QC 4HPNA 2WXGA 5IIKA 2JX5A 2PLPA 4ARCA 3MZNA 3KUCB 4DQRA 2K6DB 2LHDA 3SN1A 4WWNA 2LD9A 2OZ8A 3DEQA 2PGEA 2F2AB 5AI5A 2IPKD 2L0FA 1D9FA 3BIID 4JWNA 2JZ3B 2QCZA 1DIIA 2PMVA 4TVWA 3ZDTA 3R0UA 1UELA 2L1AA 4UAYA 3EEZA 4F5RA 1Q3UA 7ICMA 3KWLA 3QX7A 4KX3A 5D3DA 4PGXA 3I9V1 2LUMA 4FHKA 1QLTA 3KD3A 3PX0A 2VH2A 4HNCA 3AULA 3PTFC 2WF5A 9ICSA 3GZNI 4RQ8A 4JWMA 1DOIA 2H3IA 5J0UA 3T5KA 4WH4A 3QNMA 2K4IA 2ZPNA 1ZQJA 2PMQA 3E0FA 2BS4B 2WBAA 3LXFA 1XHCA 4JUZA 1JROA 1PQSA 3RFAA 1U49A 1Q0WB 2H3VA 2Q4TA 1A0PA 2QB0A 2YLMA 4E4FA 2QGYA 5KT4A 1JCTA 1ZD2P 4FFDA 4AP4C 3CXOA 3UJEA 1WXAA 1SZPA 3CGBA 4KMUA 2FUG1 2RDBC 3HT3A 3RD2A 3QX1A 1I4HA 2L05A 5HMRA 2WDVB 3QU9A 3I99A 1ZRNA 3PZ7A 3Q2AC 2OAIA 2ZADA 5L83A 3WK4A 1TYTA 8ICXA 1XQQA 3DK8A 1BPDA 1TV9A 5H8YE 2BR0A 3MC1A 3D2JA 3AE8B 1Z4NA 3SQIA 4DFJA 4CCHA 2AL2B 2KKPA 1KFDA 9ICJA 2EAMA 3IJIA 3I76A 3AM9A 3IM1A 5KFCA 4NY0A 2PKOA 5KNIA 1GUAB 1HQRD 3QC8B 1L0XB 4B9UA 1V8CA 4E71A 4K4HA 7ICLA 3ZVVA 1B1ZA 4RMAA 4IM2A 4IC7B 1X9XA 2P35A 4QZ9A 1C20A 2ZVNA 3IAM1 2GGHA 2MP2B 4I2IA 5ALWA 9ICFA 4K8GA 4AQ7A 2YY6A 4RT2A 4ZRKA 4DNAA 4HPMB 3NVVA 4IL6U 4YTNB 3GC2A 1CK1A 2OEDA 1P9DU 4QZGA 2N9PC 2D3AA 5B5EU 3C2MA 1KOTA 2POZA 4Y2YA 2ISOA 3PZ8A 1M94A 3PS6A 1Y56A 4ECTA 1YQBA 4FULA 4QZ8A 2BYEA 4GFJA 5AKIA 2FIDA 4TUQA 4IRDA 1WMHA 1M6YA 3U8ZA 3V5FA 4H4VA 5KFOA 4MGZE 1QQ7A 2BQRA 3EHVA 1OXJA 4GR1A 5KHQA 3TEYA 3OZMA 5FJTA 3IDWA 3PLUA 3VH3B 5J2IA 3SMVA 4GSWA 4E5TA 1SB3C 4JGHB 3U30A 3NO1A 2WXPA 5J2RA 3T3OA 4W9FA 1W1LA 5E6OA 2X99A 5JCKA 5E6JA 2AU0A 5KFWA 3L3FX 1TKGA 2AQ0A 4KTQA 2W11A 2HSZA 5AK6A 3V3XA 2RPQA 2MNRA 2O6VD 4M0WA 5U25A 4DN1A 3AEDB 2NMQA 2AXRA 1FNWA 4BZAA 3RAQA 4P0QB 5CTRC 1Z1BA 3H8JA 2OKTA 3O65B 1Z00B 1OW5A 1CRXA 4NXZA 2KFKB 1LM8B 1V59A 1T4GA 1X6IA 2DKZA 5CR0A 1T6BX 4IM0A 5HFYA 3GSYA 1ZK7A 4KPLA 4TQ0A 4KX5A 1L7NA 1IBXA 2C7NB 2BBCA 5AM4A 1EC7A 1E8FA 2LVQA 2KZ3A 5JCNA 1MQ2A 3ZW3A 2BB5A 2BW2A 3E56A 4II3B 5LLIA 2AYOB 1ZQXA 1I4PA 1DOXA 4NM1A 3N4EA 4US8A 4HROA 1YMHE 4H4QA 5KFNA 3EYZA 2N9XA 5AI6A 3V7JA 4JN8A 2AKZA 5BOFA 3ONNA 2DKXA 1S5LU 1QSSA 5FXPA 1HTQA 4MFAA 3ZLHA 7ICEA 9ICCA 5A0LA 2K8CA 3T8MA 4JN7A 1N48A 2WGSA 3TCAA 5C2TB 1NHQA 5ALDA 2GBRA 2I1JA 4G7FA 2DENB 5EDSA 1ZY8A 1N5WA 2LPEA 2NBWB 2W82A 2AQ2B 1YN4A 1KKOA 1U4BA 3RB0A 4RQ2A 3TTEA 3ZO5B 1NJXA 4WAFA 1JWBD 4M9NA 5ALOA 3WAOA 5JXVA 4E8GA 3RH4A 3RNBC 3PHXB 1L6VA 2KWCA 3PQBA 5ALPA 3OWEB 3O0FA 1VAOA 3D9XA 3H8MA 2KV2A 4DQSA 5DG9A 1WRIA 2D10A 1MBTA 3VCCA 3EJBB 4M02A 2DWQA 1MHXA 2A1AA 3LVWA 5F9NA 3PSEB 5CHGA 5G2NA 4P4PA 2LI5A 3H7IA 1RWSA 1K52A 3V7KA 2IYDB 3ZQ4A 2N1RA 7ICKA 3CSTA 3QE9Y 4ZOHC 1WJ6A 3W5UB 4DL4A 2CRXA 4KLOA 3HJEA 3DEDA 4UBCA 4A90A 4LK0M 4K7SA 3DERA 3LLBA 4RQNA 3VXWA 5J0WA 4DLEA 2XNAC 3RR8A 4DQPA 3RFZB 3ED5A 4EKUA 1ZQBA 5LNK1 3RZFA 4AP9A 1JCKB 1ZXIA 3ETLA 4YCXA 2KJ6A 3R3MA 3ZTCA 1XLOA 2MU2A 4F91B 2WXNA 5DBBA 1VRAB 3PSTA 5G5HA 1DIQA 4PYUA 3GV5B 4CE6A 3SEBA 3OG5A 1ZQNA 4YXMA 4QWCA 2Y3RA 5AKHA 3B08A 5ER0A 3H7SA 1XWLA 1ZQEA 5FJPA 1SL2A 1OEYA 1WVFA 2IHMA 2A4ZA 1V86A 2E6XA 3JS8A 3AL0B 2R8GA 1GB1A 3VFKA 2AGOA 2J42A 5AKZA 2HHTA 3ZDCA 5KG1A 4R63A 2PFNA 5J0QA 1WWTA 2ZW1A 3K1GA 2V3SA 4C8OA 2LGIA 1L7MA 3AQFA 3RBEA 5FJRA 2RDIA 4DL3A 3IV6A 3MY9A 5FS7A 3WK6A 2KDEB 3GE3C 4KZ0A 2C28A 3EECA 1WH3A 1PDYA 4CF5A 3H7PA 2W3SA 2KQSA 1A77A 4ZCWA 1ZOYB 1SB3B 2X8XX 3RCYA 3TI0A 4Q2JA 3TEXA 8ICPA 2KTRB 1ZJMA 3SU8X 4BCAA 2R18A 5KFAA 4UB5A 4TV3A 1WIAA 1TAUA 1E8XA 4S17A 1IYFA 1QSLA 1YJIA 2EKEC 3UMBA 2AXTU 3VRAB 3K4GA 4ED3A 4K81A 4C4SA 5AKXA 2JZBA 1SJDA 3GO2A 5KHOA 3NVWA 3UIPB 4DHZB 4HYRA 2YQUA 3KHHA 4QIWC 1A5RA 1C4AA 3AEAB 2ZJDA 3PHWB 4TQRA 2DBYA 2P8CA 5JCIA 1ACCA 2EXRA 5KFPA 2VA8A 4CGZA 3L16A 2PCEA 2EELA 3SQSA 3RJAA 2MH7A 2D3GA 1UXYA 4XE0A 5KG3A 3NZGA 4AYBC 1COOA 2KDFB 1DRGA 4PT5A 1SJAA 5BMHA 4GISA 2PMZC 4F4KA 3EAOA 5TR3A 2KN5A 2GGEA 4Y2RA 5EE9A 3T9LA 2XICA 1ZUD2 4J9NA 2EMSA 2KC2A 2LWPA 4ECRA 4XYCA 4KWSA 2F8LA 1E8ZA 3A7UA 7ICUA 2JWZA 4KLIA 3F2CA 2ZIXB 4U7CA 1L6UA 5JRBA 8ICYA 8ICTA 2G4SA 3NVYB 3HRDC 1XPYA 3HKZC 3Q8SB 2V6OA 1MVKA 3U7DA 4J56A 2PFPA 3V61A 5FS8A 2BCPA 2HI0A 1B9RA 1PK1B 3A0HU 1MQ3A 3B1LX 4F50A 1RQNA 1TBEA 4AJWA 1ZQCA 4EMIA 2ZC8A 4UW9A 5AKKA 2GBMA 3TIXA 3V4BA 2KD1A 3RNMA 3L5KA 2BCSA 1E90A 1WR6E 2PVOD 4KLMA 1TK0A 2M8SA 3DFHA 3LB8A 4GMEA 2Y3SA 2NYVA 2JYEA 3FJ4A 2KIWA 2Q85A 3TWBA 2F77X 1FMAD 2DUYA 1FFUC 1P1AA 4GB9A 1ZD3A 1WGDA 2MAXA 3D32A 4BGDA 4J3OD 3JPNA 3UQ0A 3ETRB 4X5VA 4MFCA 2MA9B 4ZOHB 2JHDA 5CEHA 1EF5A 2DZJA 3P63A 1GSNA 2FE8A 1F9JA 1L8LA 3FXGA 1JDFA 3BVGA 1ZQGA 1TAMA 4DXGA 3BK1A 3LYSA 2KFJA 1OEYJ 1H6VA 2UVUA 4FJZA 2GL5A 2Y5CA 4ASWC 4KITB 3RJKA 1Z4OA 2BPCA 2EZXA 5KFRA 1E0ZA 1QLNA 3NVZA 1ZQZA 3I1YA 3P93A 1FFUA 4WAAA 1TKKA 1JN3A 4M04A 1S0OA 3RULA 5ALNA 1YX6B 4F8CB 1GEUA 1TS3A 2IGDA 2PE9A 3RGTA 1GO3F 5AWVA 2QPMA 1X2IA 3W8XA 2MRLA 2ZJ8A 2JY6A 4GN1A 2M1MA 4ZHPA 1ZQUA 4C4VA 4RUAA 4O3PA 3UJSA 4AWJA 4F92B 2IBKA 2OVLA 3VC8A 1WSPA 2MBQA 3B97A 5BOEA 4M6WA 2CDUA 4K7WA 3AE6B 2G0AA 2A1JB 2KJHB 5L9XA 3AEBB 3QAQA 3Q3MC 3VQIA 2KJ5A 3H9DA 5FR6A 1C78A 4EX7A 2OEHA 2BS3B 3RI7C 1V1PA 1CEZA 3M9OB 2WHIA 3MJ5A 2KQ7A 4IKGA 3A1QB 2JH7A 3WK7A 4TUSA 4RT3A 3HPOA 2E1FA 3CRXA 4O3QA 1W6TA 1U47A 5CRXA 4QZAA 2PS2A 5KVIA 3TSHA 5HHHA 4NAMA 4UB2A 4ECXA 2GGJA 1AARA 2ONQA 2BQQA 1WJUA 1PGAA 3IP4B 2Z0EB 5LXIB 2FI1A 1HUZA 2PODA 4GIRA 4G11A 1IYXA 2E8MA 2OJRA 3ZJTA 2GR1A 4ZRIA 2IZVB 1NU5A 4Y2QA 2VZKD 2ALZA 4HRSA 4ZYSA 4RM9A 1JRPA 1DNCA 5KAIU 4BAXA 4JV2A 2OH2A 2TSSA 1IGCA 4GXJA 4F2RA 5I4DA 2PLIA 1WF9A 2JEFA 3MC9A 3QJZA 4KLTA 3QYPA 4LZGA 4A35A 1WE7A 4JDRA 2WHEA 3V3WA 3PW2A 4NLNA 4KSLC 1KLNA 4QZEA 2QDFA 5KG5A 5F3XB 3VDZA 5G5GB 4ED6A 3QUTA 3DBRB 3H6NA 1UUPA 3M63B 4A3OA 3UXKA 2HHXA 4YD1A 3SSZA 3WU2U 1ZQSA 2P6UA 4RGOS 4O3MA 1WGGA 1L0YB 2ZNVC 1LPFA 4GYPA 4IZGA 3ONSA 2GQUA 3S1DA 3MWCA 2W9AA 5D94A 2PTYA 2IJ0A 5ALXA 4PH5A 2QKQA 4EFOA 3LVVA 2HHUA 2BCVA 3RB4A 2QARA 3ZDDA 5HP4A 1WVEA 2OG9A 2UWQA 3ML9A 4RPXA 5BPCA 2NCNA 2YVGA 3Q45A 2J0JA 2DW7A 1RFAA 4BXOA 4HCHA 1SEBD 3E58A 1V9JA 1SJCA 2MWSB 4X2PA 5FP0A 4FJVB 1FRRA 3ENLA 5L1JA 5JTIA 1KBUA 3TUOA 4HKQA 1V38A 3AMZA 2V4RA 4P0PA 2MRPA 4K3CA 4IWPA 9ICKA 2KKCA 1KTQA 7ICRA 3TBLD 2N9EB 5KT7A 3C23A 3ZVHB 2WX0A 3B9JA 4EQXA 4W9HA 3ZKJC 2GBNA 2BKRB 2BPSA 3JW7A 4HKZE 3TL5A 2ESEA 3OTQA 1LO5D 1WM3A 2IDYA 1D6EC 1SZHA 3J81j 1L4ZB 2ON8A 3ZNHB 4P2HA 5AM0A 3PW0A 2C7HA 1UF0A 3TAQA 4BBYA 4M6UA 1UWMA 3IRUA 2WWZA 3WK8A 4FZNA 1RAXA 4IL2A 4OJ6A 4A3RA 2NQWA 3MGHA 3Q8RB 1UD7A 3FW8A 4PWCA 2FCQA 9ICLA 1BPZA 1S7MA 5AE3A 3GU3A 2J6TA 2WOVA 5ALZA 2CJNA 3WKDA 2K0PA 2MJEA 2WQYB 3MHSD 4OZCA 2MSED 1R4NB 3W1YA 1D4BA 4PZNA 2RQ5A 2BKEA 2XIDA 2N1VA 3V5CA 5ALIA 1LQBA 4H1ZA 4J1OA 4ADWA 4HJKA 4C7YA 4YN4A 2ASDA 3KWVA 4GDLA 4DOBA 4QW9A 5ALQA 3RJFA 2O3GA 1L4DB 3IG3A 3VCNA 2KK0A 2KVZA 2AGQA 9ICEA 1MG4A 3H4BA 2JXJA 4JAYA 3SR6B 2KMDA 5AZFA 3APDA 1QF6A 4GLXA 3DOWA 2L83A 4EELA 4R64A 3NHEB 4XA5A 1PVRA 4NQKE 1I35A 2LEKA 3PZDA 3DVNV 3A4RA 5ALFA 2BVFA 1IV8A 1GRHA 1D8YA 3VFCA 5ALKA 2GMIC 4MJSA 1AHZA 4EQSA 4RGMA 2UUVA 1P48A 3CP8A 7ICNA 1W1SA 2HOQA 2KK8A 4NAWA 2QJJA 3AE4B 1WYWB 5TISU 5EWGA 3R9KA 2LJIA 2J0MA 2EQ8A 4WJQA 2LI6A 3GIKA 2VZKB 2G5IB 4Y2JA 4UB3A 8ICSA 1R7SA 2N7DA 1NDDA 3WA0A 2WP6A 5L6FA 2NRTA 4DQQA 1L3UA 1PK3A 4KV2A 2FMSA 2JRZA 3PFRA 2K8AA 5DPSA 2Q5WD 3X23A 4I2FA 1UPHA 1M4VA 2GH5A 4KGSA 3PX6A 5BMGA 3L17A 4LNOA 2BGWA 1X9MA 1D8BA 2EQ9A 2JVCA 5L1MA 4Z17A 1NBFC 3HVZA 3LDAA 5IINA 2NBUA 3NGDA 2GRTA 2HQMA 1GETA 4HCNB 1Z19A 4FS1A 2C60A 1N56A 3ALRA 2AQ1B 5FMHA 5KG4A 1MPEA 4UQGA 1OQQA 3KLSX 1DGSA 1S0NA 4KIKB 1FNUA 1XO1A 3ZDMC 3SAFA 1PDZA 4C0ZA 9ICRA 4I2HA 5IN7A 2MUTA 2YEPF 2AJQA 2W43A 1WZ0A 3D2QA 2NPXA 1E8WA 1FEAA 4FO6A 2Y1IA 2VFRA 2F3NA 2LM4A 2ZIVB 1TYGB 5IO9A 1I19A 1CI4A 2NRVA 3HP6A 1ZQRA 4YWSA 4Y2UA 5JHAA 1QZEA 1ZR6A 3T9PA 3IHQB 1ZXHA 1ZMDA 8ICCA 2PA6A 3DGZA 5AK4A 3JPOA 1WUDA 4XWWA 2DW6A 5HHIA 2IHNA 3DG3A 3U9IA 3BZKA 1BPBA 1UT8A 3R1ZA 2XH7A 4G9BA 2CU1A 4I2EA 3JPSA 4CQNA 3IFWB 2K89A 3STPA 4F71A 1WX9A 3RNFC 5AI9A 3UJ2A 4MDKE 1QQ6A 4US9A 9ICVA 2RK5A 1FXIA 2EMTA 4KLFA 1MN8A 4RNMA 2PE6B 2DL0A 1O08A 2JT4B 1GAQB 1T0RC 1ZQIA 2HHSA 1V2YA 5J17A 1C1YB 2D11A 2IO0B 3N3KB 2Z7JA 1UHUA 3A0BU 3DESA 2E1EA 3C2LA 2K4PA 1SKRA 4O3SA 4NZLB 1JALA 5J2JA 1UWXA 3KH0A 4NJ6A 2DZKA 2ONEA 3RRHA 4R66A 2BVGA 2R8HA 1R4MB 1ZJNA 2KZMA 3KKAA 9ICAA 1QQRA 2ZXHA 3PX4A 2I1KA 1NELA 4DNSA 4GDKB 3U52E 2OCEA 4MELA 3W9CB 2V1YA 5KFQA 5ALMA 4UD8A 3AE1B 5IIOA 3JW0X 5KFSA 2PP3A 2LBOA 3FYYA 1EF1A 4DQIA 1SE3A 1L8PA 1WXMA 3DHHC 3EFCA 3UGVA 2AL2A 2OM6A 2LFIA 3C29A 3RMKC 2PJHA 3M1YA 3SBFA 3UIOB 3Q6JA 5JCLA 3OSNA 4FP1A 2INCC 3GIMA 1SBBB 5KTQA 5DQIA 1E8YA 4MMWA 3RR1A 1KN0A 5KFEA 2A3VA 4BURA 3QUQA 4YSYB 4PVJA 4QWDA 2CHRA 2ZIWA 3MUCA 3R7RA 4ZRQA 3ISCA 3ZGZA 5KG0A 2B3AA 3N6HA 4B6WA 2MP2A 3MFIA 4UAUA 4P1BC 4AOFA 5BMIA 5J18A 2V0GA 1BKHA 3WCQA 1HEKA 2PTLA 5KFJA 1DK3A 3FWAA 4NEWA 3V6CB 2ODGA 1CJEA 4IWQA 4YWGG 2L3ZA 8ICOA 4FA6A 2V4LA 1KW4A 3BZCA 4IR1A 2K8HA 4FDCB 4DWIA 1KKXA 5FS9A 7ICFA 3KVFB 2W0HA 5AUIA 1F9CA 5DBAA 2M17A 3SQPA 3TFRA 4ECYA 1E7VA 2VIXA 4I27A 5IIIA 3R0KA 4LNFA 4DXFA 4E6MA 4YMNA 3QLDA 5J2KA 2XGPA 5HKHA 2FYMA 1ZQKA 1JWSD 2ZCCA 5GXGB 4NEVA 2P3ZA 3N4FA 2OOBB 1JIHA 3KHRA 8ICLA 2XVTA 3VUWA 2WAQC 1OQYA 3W1SA 3Q8PB 3F2BA 1SV0C 2CPRA 5DQGA 5DLGA 4Y2PA 1KRHA 2YB1A 2KT7A 4P0QA 4OZAA 3I6TA 2NO5A 4ARIA 2IO3B 1GRAA 1PVPA 4KZCA 3VA8A 3WAMA 2KJRA 4BKSA 3C2KA 4KKJA 3DQVA 3ORYA 2BQ3A 1ENFA 2BC1A 4XZ4A 2BPGA 3H40A 5GTIU 1BNOA 3B0YA 4I2CA 3MJWA 3RNGC 2PW9A 1H8CA 4J3ZA 2MBOA 2K60A 4O0IA 1TE6A 1ZOLA 4PL1A 4R65A 3M8SA 1L5PA 1FECA 3H8WA 4UAVA 2N0SB 3QEAZ 2I5HA 2FLPA 3BWUD 4DFDA 2XCPA 1SV0A 2WXIA 5J2GA 3Q8BA 4IT1A 4EZ9A 4W9KA 5HHDG 3H0MB 3NG0A 3P2BA 2H3ZA 1D5ZC 4F7ZA 2VFSA 2WF9A 2NBVB 5KT3A 2JXTA 2JV3A 3EJDB 3IJQA 2WXOA 3BS5B 3FYHA 4DCCA 1SIFA 2CHXA 2GDQA 2GOWA 4GLSC 3HW8A 3MR3A 1NK4A 1KQQA 1X42A 9ICNA 1XDIA 2Z8LA 2X8HA 4DFKA 4YMOA 2R9ZA 4Z6FA 4PHAA 4HVBA 3CW2C 3S6JA 2PGWA 3MGIA 2FIFA 5KFFA 3BYYB 3L5OA 3MDCA 3HWTA 1J7BA 1GRTA 1J7CA 1SKWA 3NS1A 2G4DB 1P7FA 4DWFA 1UA1A 4FZMA 3SV4A 3GD6A 8ICUA 4BJQA 1GESA 1V49A 1RRBA 8ICQA 2DZIA 5C0YA 2J52A 3QU5A 1ZQPA 1KFYB 1ZDXA 3L8KA 5HQXA 5AKLA 2BT6A 4DX3A 4WWOA 9ICQA 4HLEA 4QNLA 2KFNA 1WJ4A 4AS1A 1ZX9A 1SJED 2M56B 2GR3A 2YAUA 3AV8A 1ZQDA 3D2NA 2O2VA 4P1CC 4LVSA 3S1FA 5DB7A 1WXSA 1V9PA 1N5WC 1TYPA 3TW9A 1SL1A 2XCAA 1NKBA 4IG7B 1HZ6A 4DHGA 2WDWA 1L3SA 3P42A 2RPVA 4KN7A 5KFMA 2F5ZA 1RLFA 2INDC 1IXRA 2FLNA 1FCLA 2KMMA 1EBHA 1BXTA 1LVLA 5E6PA 5FJUA 5DDYA 1HTOA 4WJ3B 4A6GA 2QB0B 1FO4A 3RR7A 2X50A 3AE3B 2P66A 4EX6A 2UU7A 3Q8LA 2HW3A 4NJCA 1ET9A 1ESFA 5HR6A 4J03A 4RQ7A 2D5GA 3A7AA 2BDUA 4IOIE 4ZH4A 1YQ3B 4QZFA 2O6KA 3SZ2A 2RLTA 5G55A 3DVGX 4G3IA 3NJTA 3G6XA 2G08A 3CT2A 1JMSA 3UCDA 2RP5A 4QZHA 3K1ZA 4ED2A 2KDMA 5KT6A 2M0AA 4OW0A 2VAOA 2EDUA 1DOYA 4APNA 4PVKA 7ICVA 2L52A 2QJLA 4RGTA 4TQ1A 2KG5A 3MC8A 4RCOA 3OLMD 1ZXIC 3SJNA 1CQVA 4HEA1 5ALEA 3SYZA 2XC9A 2N7JA 5CHWA 4MGIE 4OVZA 3LADA 3VDGA 3C1YA 4KDLB 5J2HA 1T0YA 3N1XC 2PU0A 1W1RA 4QW8A 3ZRCA 1F0XA 1WJNA 3FKYA 3V05A 3BQ7A 4H4WA 2GO7A 3CAWA 1TZ1A 2WOIA 3AEVA 2O6VA 4WWMA 3KUZA 4YVZA 2RMMA 3H0LB 5AKYA 4HPLB 1EC9A 4YL8A 2ZZPB 1SSNA 4C56C 3S1EA 4IL0A 4O5EA 1Q46A 1CZPA 3CMMB 4ANXA 5EU9A 1UNSA 4EM4A 2HCFA 4PL2A 3Q3NC 1KEJA 3D47A 3DBLI 3RJHA 2QEJC 2RGFA 4PZOA 1P0RA 3KHGA 4MM3A 1BVSA 2WTFA 1KLGD 2ZG6A 5KFUA 4KLHA 1TKEA 2Y5PA 3DWMA 2HBMA 1WMHB 4PYZA 3GOEA 5AK5A 5AEKB 1BMLC 2CN1A 3VCBA 2TPRA 1J97A 1C77A 1EC8A 3BSMA 4B0MA 1ZQAA 4QIWF 4F5NA 3EF6A 5DQHA 2KACA 4FADA 4O3NA 1ZRMA 4YSZB 3OTRA 2R61A 4EYHB 3NZ3A 4TUPA 4MEYA 1TKYA 4FE3A 1RM6C 2BCQA 3L10B 3OSPA 3VC5A 3LAEA 4YT0B 3AB5A 4AYBF 5MPOA 1QOBA 4BC7A 2OJWA 2PMZF 1ZQTA 3PW4A 3RZWC 4M0WB 3HX0A 1VR9A 2OYYA 4B9NA 3FC4A 4M9HA 1TVAA 4I6PA 5LXHA 1TFRA 4F8RA 3UQAA 5FXFA 4QWAA 2LHEA 1JWMD 2LMCA 2KZZA 3DVGY 1JPMA 3KLJA 4WJPA 4WJOA 1X40A 4NJ7A 2EKIA 4NPNA 4NWIA 1IBXB 2WP9B 3HKZF 1WR1A 1UT5A 3NZUA 3V60A 2WF6A 3GZFA 3HHMA 4TUUA 4DDID 1E8HA 4H19A 4EQRA 2KHQA 2KMCA 2XGZA 3DBHB 5AICA 3N7PD 4UAWA 3JSVB 1KFTA 3VVWB 2ZZ0A 2WLBA 4EC3A 3JVAA 3WKBA 1XEEA 1N60A 2QVHA 2RHFA 1K1SA 2C2EA 1I4GA 1F5SA 2QMTA 4P16A 1RPLA 4N9F4 2ZTDA 3Q3FA 4DBGA 4XLOA 3QUBA 3GRTA 1WWUA 1YZ7A 2YMMA 3K75D 2RDJA 3PW5A 2K8CB 2WNMA 2Y1JA 3ML8A 3IJLA 1NK6A 1FFVA 3UCCA 4HCLA 4IQTA 1F1HA 1MOKA 1VDVA 1YEYA 1SWWA 1F52A 1V97A 3V7LA 5DG8A 3BVMA 5L1LA 3ZD8A 4GGBA 2PKEA 1VZ7A 4HJGE 1GV4A 3PPAA 3ZJUA 1GPXA 1T5XD 1S9FA 3CSFA 3RNCC 3LB8C 1PUZA 4M52A 2JXXA 4YSXB 1FEHA 5T8IA 4IR9A 2F1HA 1SJBA 3NUQA 2EANA 5ALVA 2HJ1A 4FZLA 2GWSA 2KO3A 1VLBA 3NRWA 2CU3A 2J7QB 1R6WA 5EE0A 1COKA 2A8XA 3QPEA 3PO4A 4M9JA 5IIMA 4KLQA 2FNJB 3P4QB 2OQYA 4RZRA 4Q44A 2I9GA 8ICMA 9ICIA 2WXKA 4DXKA 3APCA 2WPEA 2LYHA 4LIIA 5KAFU 4ZYNA 1TGZB 1FIQB 2GRIA 1IUEA 1VJ5A 3DDCB 2HVHA 1V81A 2MBBB 3RJ8A 3T6CA 3GZNB 4IQUA 5DBCA 4Q43A 5J0YA 1NYRA 2V4QA 1SF0A 1WWVA 1WGYA 3MP9A 1DXSA 5G5HB 1YN3A 1UGJA 3PMLA 4JB3A 2VA2A 2V9WA 1V80A 1W1JA 2GBKA 1IM4A 4RF1A 4J9SA 2K5PA 4KSKC 1GNUA 2PU1A 2H88B 2F76X 1LKYA 4REZA 1PFDA 4I2JA 1ED1A 2KOBA 2ZCBA 3TJ4A 4L1BA 4IRKA 2BQUA 5D6JB 3NXLA 2JRHA 5BYRA 4NLKA 1JQ4A 1NK0A 5GTHU 4Z6EA 3JPQA 3ZNGC 4AUQC 4E4UA 5CB1A 1J19A 5IP4D 3PM9A 5JCMA 1HE8A 1BPEA 1L3VA 5HG2A 4JB1A 2CFYA 2WFAA 5J0TA 3Q14C 3WK5A 2C5LC 3ZTDA 1MRAA 2RSUA 1E8GA 2X8GA 3Q3JA 7ICTA 3RITA 3I3TB 5C3JB 1QKZA 3F53A 4ZDVA 2XY7A 3LWMA 5K4LA 8ICWA 1E10A 2WYQA 4EYIB 4DSEA 1L3TA 1W1QA 2LGSA 2M4NA 4XX5A 5TR5A 4LNNA 3V6JA 4LCDE 4D2KA 4EOYA 4MF2A 2AKMA 3J9CA 3OPSA 1STEA 4C4TA 3EC8A 3NUHB 3KUMA 2JZBB 3TJPA 2Y9TA 1K8RB 4I6LB 2HDOA 2VANA 3TADA 2HD5B 4RFBA 1W1KA 3ENEA 2NVUI 1ZE3D 3DDMA 3RNEC 4MF8A 1ZDLA 4BKGA 5I1WA 2UVVA 1UBQA 3CNHA 8ICNA 1F44A 7ICPA 1ZP0B 3N9YC 3U4EG 1P43A 3VC6A 1J8CA 3EANA 2HTME 1WX7A 2AQ3B 1GREA 1HA5A 4PZFA 3SD7A 3U26A 2XO7A 4M0AA 4O3RA 4N6EB 4NNJB 4F72A 2JK6A 2WXFA 3A9JA 2V9HA 5E6NA 4AJYB 5CWRA 4OD0A 4I29A 4YR0A 2KVSA 2ISPA 2P88A 3AE5B 1WX8A 1S0VA 3OP2A 1DGJA 3RF9A 1KN5A 1YJ1A 3V72A 3FW9A 1P3QU 4YP3A 9ICGA 1GERA 2PTWA 4FBUA 4OO1J 1TJEA 1ROEA 1C9FA 3DPDA 3KJMA 3D6JA 4IP4A 8ICBA 1S1QB 5L95C 3ZLZA 2BVHA 4GYPC 5ADZA 2WP5A 3R10A 7ICQA 2RRDA 1FXAA 1Q10A 2LGDA 1PUTA 5DGBA 1Y88A 3AQEA 3KFUF 2OWOA 4RQ4A 3DG7A 3EA6A 2GH1A 3QN3A 4GRTA 1Q8KA 4EZ6A 2QKNA 1BQGA 2JUOA 5CJ7A 2LVOA 3NASA 4L23A 4HAIA 4EMWA 1K50A 2REXA 5J2FA 3IN5A 2ZUCA 1SKSA 3DHGC 2LUEA 1MDRA 2EAOA 3C21A 1T3NA 3BYTB 3V6KA 5ALYA 4IC9A 4RQMA 4UASA 2Y0SF 4QZCA 1SE9A 2KYWA 2LXAA 3RB3A 4UB1A 1D9DA 1H38A 3QWZB 4BFRA 4UB6U 4NQLB 3NRZA 2C3DA 4M0XA 4RF0A 4IQWA 3Q8KA 3NY5A 3QHTA 3GFKB 4KDIC 4PVEA 4DL2A 2DAFA 1QH9A 5EOZA 2KZRA 2KMAA 4IWOA 4MGYE 3UF8A 4OALA 1K5OA 3OHBA 4GGHA 4ACOA 4FJYA 2B6GA 4NLBA 2HNEA 2JQRB 3DIPA 2C22A 1UA0A 1I7HA 2E8PA 3RTVA 1TE2A 3KBBA 5IAAC 3W5VB 2QLTA 2RABA 1ZD4A 1C76A 2KHVA 3BQ2A 1WUFA 4I28A 2MBEA 3TFSA 1C4PA 2KKVA 2JSVX 1GRGA 4A55A 1MDLA 4M9GA 5ALHA 3MDAA 1XC9A 2OLAA 2PP0A 4DL7A 2WOWA 4BUGA 1U48A 1NNLA 4N58A 2WDQB 2E5AA 2QHOA 4JQWC 2XH0A 3PRZA 2KQ4X 2FPMA 2GLEA 2RDXA 2VJ5A 1LXDA 1NOMA 2E3TA 1FRDA 2KX3A 3DJGX 2PPHA 1JPDX 3L4PA 3N7SC 2Y0SC 4UBBA 2JH1A 7ICHA 4PYTA 4KT2A 2JZZA 2HXTA 2FMQA 1VJKA 2KLCA 4A20A 5FXEA 1XANA 4JHMA 4H4ZA 1WZ3A 1ZMCA 3LXDA 3PO5A 5DB6A 4YQWA 2W8LA 2YMQA 2K8BA 1QCKA 3OJ3A 5BYSA 1VQZA 4ANVA 1S77D 1W1OA 4HG0A 1QT9A 2HMXA 3SFEB 1MJDA 3DVNU 3QEBZ 1GXFA 2QQ6A 2JMGA 3QKEA 3AE7B 2MJDA 4C80A 3VR9B 3BQ1A 1KDHA 5D7GA 1GB4A 2MEKA 4O1NA 2XK5A 3P0WA 4O5CA 2VFVA 1G6JA 1WGHA 5ALRA 2MUCA 3FVDA 2GGGA 4LNKA 1PGXA 1ZKQA 1H2IA 2FKPA 2QB1A 3IAS1 3K1RB 2C2RA 4H83A 5KG7A 1KH0A 1MC8A 4ZRPA 2W3RA 5GMVA 1JXEA 4DFMA 4FLHA 1L7YA 2IGGA 4OVUA 4FS2A 1STZA 2AAQA 2HVIA 4O3OA 3D46A 2KSOB 4DSLA 3UINB 1KLUD 4LJXA 2W9BA 2KIVA 2BHNA 3V6HA 4F5OA 1WY8A 3SHQA 1DXLA 3WIMA 1ISNA 3QFAA 2KN7A 4IDIA 2DPIA 5CX3A 5C5JA 3NZSA 2ZIUA 3MFHA 2BDPA 2GI9A 1MO9A 2H3FA 1XS9D 1NDAA 2WPCA 4TSSA 3BS7A 1RXWA 4ENLA 3GILA 4EQWA 4ELUA 1ONFA 4M8NA 3KUDB 2X38A 2J6SA 1SXDA 5J0SA 3LWLA 2G1EA 1GRBA 3CB3A 4K2SA 3LK9A 3HUIA 2QARB 4PK1A 1ZQLA 1A6SA 4YR2A 1KLVA 2XY5A 1KM7A 4HCPB 5L6GA 3A9KA 3THVA 3BW7A 2XH4A 3I6EA 4HNLA 2H5XA 1C4CA 4BXOB 2V3PA 4WIPA 2VFTA 1XSNA 1JW9D 1YNTE 2WXMA 3OJ4B 4XWTA 2LYBA 1C7YA 1TK5A 3DEEA 5EE3A 3TAPA 1EWYC 4GGQA 1X2GA 4P0PB 4M00A 2PP1A 1YOVB 1EU4A 4EEKA 9ICUA 2IO2B 4ELVA 3AEGB 4F5PA 3TEWA 2DF4B 4FBJB 2W9CA 3B9JB 4CO7A 2GBJA 2P13A 4I2BA 2ZNVB 4BOSC 2KJ9A 2PI5A 4RH6A 1KSPA 1WYGA 3GE8C 3R66C 2GGIA 4Y2TA 3GIIA 1I4QA 2BVCA 2KVRA 3PT2B 3AEFB 4NL9A 4JWSC 4F3OA 3H4DA 4B9VA 3BQTA 1IP9A 1QOFA 5ALJA 5J0OA 3PVXA 4CYEA 2IPIA 4F4WA 2F44A 3RJIA 5DGAA 3I28A 5AM5A 3KYCD 4W9JA 3BOXA 2R2ZA 3OPXA 3RJEA 4QZDA 1TAQA 4ECZA 4WQMA 1F8WA 4NV0A 1Q1OA 3PO0A 1NPXA 2IOFA 2BS2B 1NZPA 3TSSA 3T5JA 5DLFA 1N61A 1ZPSA 2R8DA 4CDGA 4QJFB 2PEAA 3C0RB 4KX6B 4RNNA 3QZ8A 1RYJA 3RJJA 3FILB 2HBJA 4ANWA 3VUXA 4Y2VA 2K6QA 3FCPA 2KANA 4MFFA 3KKAC 3DK9A 1VZ8A 3AE9B 3ISBA 5JH5C 8ICKA 1IPGA 5FK9C 7ICIA 2NQLA 5U1OA 8ICJA 3SAHA 3VR8B 2KN4A 3N32A 2FDRA 1RYSA 3ZUNA 4OJOA 4ECWA 4ECUA 5DG7A 4LDTB 1J2MA 1EU3A 2W55A 5KFIA 1N63A 4FXCA 4W9GA 1FEZA 2DYOA 4JV1A 4EBDA 3HK0A 4ROPA 1P98A 2HOIA 1LGRA 1NVID 2ZVOA 2KJ8A 3QZ7A 3H8HA 1JWAD 5L1KA 1WFYA 1SXEA 3KHLA 1NYQA 4WWPA 2C3CA 2XI9A 5IA7A 5KL1B 4NAWB 1DTNA 4EBEA 4MKSA 1L5UA 3EZ5A 1WXVA 5HNKA 2XY6A 4KLSA 2Q0ZX 4PWBA 4GXIA 3A7RA 3AU4A 1YJJA 3KQ4A 4ECQA 5KG6A 2ICIA 1QLBB 2D3DA 3TQ1A 1V5OA 1EXNA 1IG6A 1Z5SB 3S2AA 1XU4A 4DQOC 4S0RA 4GIBA 4BX9C 4M47A 2WXHA 4C8NA 1UBIA 1VCBA 1M6IA 2NPTB 2WAQF 2E8NA 4ITKA 4JPSA 1F2RI 5C1ZA 4J57A 3DV9A 3DFYA 3DG6A 1FD6A 2OHFA 4GXKA 4EUTA 2GLSA 5AI0A 2K4EA 4I6NB 2D3CA 3JZUA 5AHXA 3LJ3A 4H4UA 8ICEA 3DJJA 2FPKA 4A6QA 1FHUA 2HHWA 3Q4DA 1RQLA 1ONEA 2FUHB 3OAWA 2MSNA 1RG6A 3W1SC 2BYTA 2R8KA 3EJEB 1CUKA 1XO0A 1OJTA 2PI4A 5KFXA 1DZNA 3H8AA 5IDZA 2B0CA 4YXJA 2BC0A 2MLBA 3T4WA 2MUTB 2VA3A 4CNQA 3C5FA 4K3BA 4HCDA 2QIEB 2KICA 5KFZA 4E0DA 3MR5A 2LYAA 1TTNA 2QILA 4RGNA 1ZQHA 4CF4A 4ACFA 1JOAA 4GIVA 2V3BA 4BKSD 3CXBA 1A70A 1EM7A 3T79A 1JWUD 4KLDA 2C2DA 3APFA 4RM8A 4EZJA 3PW7A 1I4XA 2MBRA 2QDEA 3TQPA 2EQ6A 2D3BA 3MTNB 5AI4A 4H50A 2NVKX 4RQ3A 1PYWD 3JYUA 3ZDEA 1KRPA 2JRIB 1BZLA 5DPWA 1D3ZA 2A19A 2AL1A 4IUMB 2WXLA 4H4YA 1ZKHA 1XSLA 2DX5B 2B76B 4KKIA 2OXOA 3H70A 4H2HA 1WXQA 1VD2A 3Q8CA 5FKAC 4OVVA 1BWCA 3GS2A 2R8JA 2ES6A 2ZEQA 2WB1F 1N5XA 3QCAA 4XGAB 4KPRA 3GIJA 3PRPB 1KFSA 1D7YA 3PWIA 4ELTA 1Z00A 1KJTA 5DB8A 2L5YA 2KFKA 5GRTA 1X1MA 1EO6A 4R8UB 4PHEA 1BNPA 5EBKA 3UMCA 3R07C 4MHVA 2ASQA 1SV4A 5B66U 1E5WA 2P4PA 3VTVA 4P4MA 1JX4A 3RO6A 3QUCA 4C4RA 3B2GA 3M95A 5J0PA 2F1JA 1ZQOA 2MX2A 4BKTA 1EBGA 4GOCA 3HPFA 4BDPA 3HIZA 4H4SA 3RUIB 8ICAA 4DO9A 3I57A 3VH4B 3PV1A 5KG2A 3SAGA 4B95A 1NEKB 3QIJA 5J04A 3R2IA 4B9TA 4YMMA 1Y8RC 3T3NA 8ICVA 2WDRB 2DHZA 1MBBA 1NI3A 1S76D 4PGYA 3UMGA 2WU5B 2K22A 3OC4A 1U4AA 4PHDA 5C23A 5CA7A 3EWAA 2JYTA 2I1QA 4LJOB 2YTUA 3R2TA 2G9HD 4H4PA 3OZYA 2KEYA 3T8QA 1MHHE 2YB4A 3SV3A 3E9SA 2ZZBA 2BPFA 4KLGA 1MI0A 4IP5A 3HM3A 4W9DA 2LJ5A 2WB1C 3JPTA 3P1MA 1KL9A 3Q8QB 2VRRB 2YEPB 3EGRA 4Y2XA 3N7RC 3S1CA 1AROP 4GC6A 2JWUA 3DHIC 2CR5A 1AHVA 3CGCA 1L8OA 2KNJA 1NENB 3GP7A 2ZIWB 1E7UA 2X8CA 3W2DA 2WF8A 2K1FA 2I2YA 4JQ9A 5D2MB 3OJSA 2MBHA 4DL6A 2WF7A 3JPPA 3U4FA 3PGEA 4C7ZA 4IS7A 4NLZA 1PZNA 4F1SA 1YIWA 1MNSA 4YR3A 3U7ZA 2EQYA 1RZTA 4C8LA 4PHPA 2KDBA 2FLLA 3TEZA 3CF6E 3VUYA 3QQ8B 2ATLA 1F2RC 1ZQYA 5I1VA 2DFLA 9ICXA 1UZXB 4JL9A 1KCZA 4Q45A 5HMMA 3M8RA 3KTQA 3W8WA 4K8DA 3RRAA 2G5HB 2Y4GA 1WGKA 2K4HA 5TSSA 3Q8AA 3SEIA 2KTQA 1SGHA 2CHWA 4I2AA 2ZTCA 2IMWP 3GDXA 2CS4A 1SL0A 1I4RA 1YT3A 3RJGA 1N2XA 8ICFA 4DK5A 3JVZX 2VKQA 2BZFA 6ENLA 2PTXA 2MHJA 1XLQA 4FHJA 3HVDA 5D4BA 3N1ZC 1JI7A 2HXUA 1ECQA 5KFTA 4ED0A 2XN9C 3UJRA 2XGQA 3T5HA 1AYFA 5FR3A 3W8ZA 3RH6A 1N6ZA 2NTSA 1XS2A 1AHUA 4UAZA 1BPXA 4A9AA 3IK4A 2ZXIA 4EE2A 1QILA 1NJZA 2QAEA 2P3HA 3CYMA 1PVQA 2CHZA 2AGPA 2FCMA 3ZVIA 3BY4B 3JSVA 4ZRJA 4JLCA 2KTRA 3TWAA 4J9KA 5HR7A 2PFOA 4EENA 3C28A 3P4RB 3Q3OC 1GOZA 1TS4A 2K9XA 2KWUB 2AL6A 4MSMB 3PWGA 3R25A 4DWDA 8ICRA 2HBKA 4O95A 5CHFA 1K51A 4RPYA 2KD0A 3EUB3 2IOHA 3DBRI 5JUMA 1OTRB 3P4SB 5F9LA 4PJ0U 1RXVA 3TJIA 2A5UA 3AE2B 1HJPA 4YFKA 2FMPA 4RQ5A 2LRWA 4J9PA 2KC1A 2DGZA 2AQ4A 2HJ8A 3NVVB 3AU5A 2Y9UA 3BJSA 2WXRA 2FBWB 4F93B 3L0WB 2HHQA 2Y3AA 3V62A 3ZLGA 1RYRA 5J0XA 1GG3A 4G0NB 4N59A 3SFDB 3PRMB 3R7QA 3I4KA 5IOIA 1Z2MA 1S3SG 5J8YC 2IY0B 5IIJA 2UYZB 4WQOB 2GQTA 3G6YA 4GC7A 2JEGA 4NLGA 3PVLA 4A3PA 1OEPA 1WCLA 2AWTA 3EUB2 2E8OA 2G06A 3EPIA 1ZW7A 9ICBA 1WRDB 2QSDA 3NS1B 3B0AA 3BZDB 3IT4B 3VAWA 3QK0A 3RT3B 3C8YA 2W9MA 4BBNF 5AKGA 2ZIXA 1UGMA 4PGQA 1ZQWA 2I5QA 4G8TA 1FEBA 2L7RA 3NVYA 1XF5L 1QOGA 2CXYA 3NOBA 3A33B 9ICMA 1N60C 5ENLA 4A8EA 1PK1A 1FIQA 2KXJA 1L2NA 2J3NA 4JMUA 1FXTB 4ICVA 1Q1RA 1YQZA 1HIWA 4Q8FA 3OHAA 4XRHA 5JHBA 2O2VB 4EZKA 3AEEB 1VZ6A 2RDHA 1FFVC 1FCCC 5FXDA 1NHSA 2W7PA 2JGAA 5J8YA 3CK5A 3MBYA 3WKAA 2UVWA 2KWDA 2YVJA 2XSXA 3AI5A 2LGXA 2EH9A 2L76A 2FE9A 2VJ4A 3Q8EA 5KVHA 3BVZA 3KW5B 1N62C 1YD8U 2DAJA 1EUVB 3TKAA 2BWFA 5DPTA 3UQ2A 4DXAB 2GR2A 3ETRA 4RNOA 2GSHA 4CRXA 4OJLA 1R4NI 1SWVA 4G50A 2LM1A 1QLUA 5EE1A 1OFFA 4C8KA 1TT5B 3WANA 5KFBA 3H12A 1E9IA 1LB2B 1RDFA 1QOAA 4J9OA 3RYTA 3WAPA 3ZJVA 4Y2SA 8ICIA 2I38A 5IKCM 4EMJA 3MABA 4JV0A 4TMAB 2W8KA 3QARA 2J6UA 4BBNC 4YWOA 4TURA 5DDMA 3ZDBA 2W04A 2QC8A 1GJZA 2WU2B 1J7AA 4J6IA 1ZQ1C 5BOLA 4W9CA 4QWBA 2ZJ5A 4FN2A 3S47A 2RR9A 5AUKA 4YXDB 3HILA 1GC6A 1F3PA 4PPXA 2PIAA 5TZVA 1ZYQA 4HPPA 3VTWA 4ZA0A 3ZXVA 2WXQA 4EM3A 3QU4A 1N62A 5HI1A 3ABVB 1RFKA 3MHZA 3M9MB 4MEXA 1UH6A 2GQWA 8ICZA 5ALSA 4DS4A 4K1WA 4A8XC 2IGHA 4YD2A 2O6VB 3EKGA 1K53A 4BVUC 2KP7A 4CF3A 1ZQFA 3HRDD 2M19A 1UQVA 1W1MA 2BWES 3PMNA 3N20C 4KMOB 3QTPA 3ZVHA 3PSIA 2A1JA 3R8BA 1QSYA 4MM3B 2EQ7A 1XNSA 3ZD9A 4NJ8A 2KLGA 4UDUC 2P6RA 2K3UA 2W54A 4OJPA 4BWJA 3N30A 5ALLA 1NJWA 3TANA 1YQ4B 5D79A 3IG5A 3A1QA 4XQ8A 2HTHA 4GMVA 3PY8A 1L7OA 3M9NB 4ML8A 2LMRA 2Y08A 3THUA 5JRTA 3C5GA 3GV7B 1GC7A 2K25A 1BPYA 1P7EA 4J9LA 2P8BA 3ZNID 4F4ZA 4X57B 1B4FA 1ZQQA 5K8EA 3DQ0A 3RNAC 2JU6X 3K9OB 2J4XA 3PK7A 2J53A 4RQ6A 2KNBA 2C7MB 3DBSA 3N28A 3TADC 4OZBA 4RU9A 3IBEA 4RNAA 3RRGA 3C0PA 1XO3A 3PSPA 1S0MA 5J2CA 4LNIA 3GV8B 3M7DA 3TARA 1DOQA 5AKJA 2PFQA 2XEWA 3H7PB 4K7UA 4EWJA 3N1YC 4FX9A 3ISDA 2IOFK 1HEZE 2M9NA 1KKRA 2LASA 3BINA 1HUOA 5G5GA 4HN8A 1Q3VA 4O9MA 4B9SA 2HOFA 4M01A 4XDCA 2CJOA 1T3QC 3TMPB 1RM6B 3S5SA 3ZXRA 3E2EA 5DKWA 1T8EA 2EZYA 5EWEA 4M9LA 3LDZE 3AU2A 2GOLA 3R11A 3NVWB 4JK1A 4U6PA 4NM2A 3Q6BA 1NHRA 1MA7A 2OO6A 4PS8A 2JEIA 4XC2A 4DSJA 3ZIMA 2DPJA 1FNVA 1XXGA 4IW0A 2LKYA 5BO4B 3RCZA 3VTEA 4DF4A 4KLJA 4II2B 2PPGA 2VH1A 5AZHA 1B22A 1XLPA 3HM6X 4ED8A 4H2AA 5KFVA 4XDDA 2G07A 1WUEA 3ALBA 3SN4A 4ECVA 4BOZB 1V85A 2YMLA 4LZDA 2JEJA 5AE2A 3EFUA 2GB1A 3T5LA 8ICHA 2G3QB 2M0XA 3MR6A 2N1WA 4DHJD 5KT5A 2NRXA 2PLSA 4KVGB 2B21A 1F77A 2ACZB 3F5AA 1R0MA 1T3QA 2NO4A 2ZPYA 4F4RA 5AIBA 5H2FU 1SE4A 2LXCA 1R4MI 2ASLA 3D2HA 2FCSA 2UVRA 1ET6A 4MH0E 5KL8B 1XSPA 4RUCA 2DLBA 3M62B 4E3CA 4ECSA 3CWIA 1AOGA 3Q8FA 1EBDA 3PR4A 1S10A 3SENA 1JRUA 2YN4A 3F2DA 2KDIA 3NS8A 3O13A 3M6KA 3URYA 4MGKE 2N4FA 2WDTB 2KVCA 5KFHA 3UXLA 2LRUA 3KYDD 1H4RA 2PTZA 3L13A 5BOMA 4EEWA 4DYEA 2V4IB 2I0KA 2ZTEA 2M0NA 2J0KA 2YX8A 4CHKA 3FV9A 2LHTA 1TKDA 5AZGA 2BTEA 4EBCA 1SJHD 2CKHB 1U45A 1X6JA 3CGEA 3IC9A 3A4SC 2V3AA 1GRFA 3ZLFA 2H89B 3KZXA 4O5KA 2YVSA 3ES8A 5J29A 4NLCA 1ZGUB 4DFPA 1J2NA 1LKYB 2W03A 4QZBA 1D5XC 2YQEA 1WI0A 1WM2A 2INNE 4P6VF 1X2HA 4F4YA 3TCSA 3KZIU 1K1QA 5J2DA 3B0XA 4Z6DA 3PNCA 3GQCA 3G6VA 3RH5A 3DCGA 2VFUA 1E6EB 1UCVA 2NR2A 4BV6A 3L54A 4DSKA 2QDDA 2BGFA 1V6EA 2L8JA 3ICXA 2IO1B 3OW1A 2L0TA 4BC9A 1NK8A 3TOYA 2P0IA 2F8KA 1ZDVA 2RD0A 3SR6A 4DS5A 4LTUA 2QJNA 5KFYA 1X9SA 2KSOA 5DB9A 1NJYA 2BCUA 2AX5A 5H92C 1B0XA 5EWFA 1TZOA 1LV5A 4K4GA 1KTKA 1L7PA 3N4MB 1TS5A 2INPE 3SD5A 1NK9A 3NVZB 4ZHOA 5FS6A 1ZQVA 2E5SA 4DSIA 1FPYA 1WE6A 4ANUA 2ZW0A 1NHPA 1D8LA 3V6EB 2DNFA 5AKEA 3PV8A 1BUIC 1Z1VA 1WGRA 4USAA 2KHWB 1NKEA 3UXNA 2KWVB 5J2EA 5J0RA 2L00B 3UPQA 3VHTC 3H4KA 1TK8A 4DOCA 4QWEA 3OGUA 4LLGM 3P3BA 4FI4A 3FDSA 2HHVA 1D5MC 2WS3B 4FBTA 3HW2A 3WKEA 1KD0A 1F0ZA 4C4VB 2Z0DB 3DBLB 1PDXA 3WALA 3RAXA 3I5JC 1QQ5A 3FM9A 3MSYA 4BWMA 2DZMA 2EAPA 4KN4A 4F4XA 4M6WB 2R2OA 3AECB 4P4OA 3D2DA 2OX4A 3F5EA 4GFIA 1RVKA 1A76A 4YTPB 2OQHA 5D46A 5JU5A 3CIRB 1MUCA 3H0RB 2XH2A 4KEMA 9ICHA 4LDTD 2H3QA 3UXOA 4DEZA 5AM2A 4Z1YA 2ZUDA 1TY2A 1YN5A 1OUQA 3A9JB 1V1PB 2Q4WA 4TVYA 2OFJA 3DK4A 2MQJA 3M3JA 3ZRFA 3DH9A 3ECIA 2DYMA 4K1RB 4OHJA 4XUSA 5JZEB 3QU2A 1NKCA 1SIJA 1JXLA 1E9MA 1TS2A 2NV3A 3RN9C 2OZ3A 4ED1A 4LJPB 4LA1A 3DDHA 4B9LA 4WURA 1DYQA 5KT2A 4KIKA 2ZJAA 4UARA 3ZNZB 2NTTA 1MSWD 4DDGD 4RPZA 1XT9B 4MLAA 1HXYD 4KGRA 1C3TA 5HHZA 2JR5A 4L2YA 3IXSA 2PVGC 3Q69A 5IILA 2BB6A 2N9LA 2BYVE 1SGGA 3DWGC 2GR0A 4OJ5A 1YX5B 2KFZA 2ZIVA 2KAJA 2K39A 3JPRA 1T0SC 4QZIA 2AH5A 1S97A 3EPGA 4ED7A 7ICGA 1TZZA 3POPA 2LVPA 4IRCA 3AUOA 1FM0D 2YVFA 9ICPA 5BYQA 7ICSA 4M8MA 2FCNA 2HE7A 2AHOB 4G3XB 4DHJB 3MQTA 3H1UA 8ICGA 2FJ6A 4B6JA
chains in the Genus database with same CATH topology
2Y5CA 2QIEB 2QILA 4RGNA 1W1RA 1F0XA 1KF6B 1IGDA 3V05A 3FILA 1HSKA 1A70A 1E0ZA 1EM7A 4WWMA 3NRZB 3NVZA 1JWUD 2RMMA 3S1EA 1SSNA 4C56C 1I4XA 2MBRA 3U2SC 1FFUA 1CZPA 1UNSA 1PYWD 2QEJC 4R3DA 3MC0B 2UUUA 1KLGD 1TS3A 2IGDA 5AWVA 1TKEA 2WXLA 2Y5PA 3BK2A 3DWMA 2QPMA 3W8XA 2B76B 4KKIA 1BMLC 3ZYYX 1WXQA 1C79A 4ZHPA 3Q8CA 5FKAC 4JX1C 3GS2A 4MT5A 1C77A 3UI3A 1N5XA 3IT6B 4B0MA 1WSPA 2KACA 3AE6B 3LYYA 4YSZB 1N61C 2R61A 3AEBB 3VQIA 2V3NA 3NZ3A 1TKYA 3R07C 1RM6C 3LAEA 1C78A 4YT0B 2BS3B 3AB5A 2P4PA 1V1PA 5MPOA 1QOBA 2JZPA 4BC7A 3B2GA 3MJ5A 3FAHA 4IKGA 2WXJA 1VR9A 3FC4A 5FXFA 3I57A 2LHEA 1JWMD 2LMCA 3TSHA 1NEKB 4NAMA 2HDEA 3R2IA 2ONQA 3T3NA 4JE3B 1IBXB 2EKIA 1PGAA 2WDRB 1MBBA 2WP9B 1N63C 1NI3A 3AH7A 1E8HA 2WU5B 2K22A 1XCQL 3ZJTA 2WLBA 2JYTA 2VZKD 4EC3A 4HRSA 4ZYSA 4YTMB 1XEEA 3R2TA 1JRPA 1N60A 2G9HD 1I4GA 2QMTA 1MHHE 1V1OA 2TSSA 4P16A 4XLOA 1IGCA 5I4DA 3E9SA 2PLIA 2N9KA 3AN1A 1MI0A 2RDGA 2WNMA 3HSUA 3P1MA 4MH8A 3TSJA 2YEPB 3EGRA 3S1CA 1FFVA 3B2FA 2MJ3A 4GDLB 2JWUA 2SEBD 3MFGA 3RPFC 1AHVA 1NENB 3GP7A 3W2DA 1VDVA 1V97A 1HZ5A 3BVMA 2I2YA 5G5GB 1SE2A 1UUPA 1VZ7A 4HJGE 4B0EA 1XCTL 4JWUC 3ZJUA 1GPXA 4RGOS 4C7ZA 1T5XD 1L0YB 3LB8C 4YSXB 1FEHA 5T8IA 3U7ZA 2GQUA 3S1DA 2IJ0A 3P4PB 1WVEA 1XLNA 1PGBA 1VLBA 2CU3A 3TEZA 5EE0A 5I1VA 1F2RC 3P4QB 1SEBD 2WXKA 3W8WA 4KGTA 1AWDA 2Y4GA 1FRRA 1WGKA 1FIQB 2GRIA 1IUEA 3TUOA 5TSSA 4HKQA 1AW7A 3AMZA 3Q8AA 1SXTA 3RJ8A 1I4RA 1L0VB 1EWCA 3B9JA 1JMLA 1E7PB 1NYRA 1SF0A 1XLQA 1TY0A 3MP9A 3HVDA 4HKZE 5G5HB 1YN3A 1UGJA 1W1JA 1LO5D 2IDYA 4RF1A 5AE1A 1D6EC 2K5PA 2XN9C 1L4ZB 2H88B 2ON8A 4REZA 1AYFA 1PFDA 5FR3A 3FW7A 3W8ZA 4MACA 4BBYA 2NTSA 1AHUA 2L32A 4L1BA 4A9AA 1UWMA 4EE2A 1QILA 5BYRA 2P3HA 1JQ4A 2NQWA 3FW8A 4PWCA 4PVHA 3PM9A 3P4RB 1GOZA 1TS4A 2K9XA 5HG2A 4JB1A 3TX1A 5AE3A 4O95A 2CJNA 2K0PA 2MJEA 2WQYB 1K51A 4OZCA 3EUB3 1E8GA 1D4BA 5D3IB 3P4SB 5C3JB 1QKZA 4C7YA 3GB1A 3KWVA 3AE2B 1AN8A 2SAKA 1E10A 2O3GA 1L4DB 1OQRA 1W1QA 3NVVB 3VRBB 1E0YA 2WXRA 2FBWB 2Y3AA 4D2KA 2WXGA 4N59A 3SFDB 2JX5A 2PLPA 3J9CA 4ARCA 4JAYA 3SR6B 1STEA 1QF6A 2LHDA 2L83A 3NUHB 2GQTA 2IPKD 3BIID 1DIIA 3EUB2 1W1KA 2PMVA 4RFBA 2QSDA 4TVWA 2LEKA 1ZE3D 3BZDB 3IT4B 2BVFA 2L1AA 3NS1B 3KWLA 3C8YA 2UUVA 1AHZA 5D3DA 3I9V1 4RGMA 2LUMA 1ZP0B 3N9YC 1QLTA 5I1WA 1W1SA 3U4EG 3NVYA 1XF5L 2HTME 1QOGA 1DOIA 2AQ3B 1HA5A 4WH4A 4PZFA 4N6EB 3AE4B 1N60C 2WXFA 1FIQA 2BS4B 2LJIA 3LXFA 1JROA 2VZKB 3AE5B 1DGJA 1R7SA 3AEEB 1VZ6A 2RDHA 1FFVC 1FCCC 3FW9A 5FXDA 5L6FA 1TJEA 1ROEA 2KWDA 2FUG1 1C9FA 2Q5WD 3KJMA 1I4HA 5HMRA 2WDVB 1M4VA 4KGSA 5BMGA 3Q8EA 2BVHA 3I99A 3PZ7A 5ADZA 1Q10A 1FXAA 3BVZA 2OAIA 1N62C 1PUTA 3HVZA 3EA6A 3ETRA 5H8YE 3D2JA 2QKNA 3AE8B 1QLUA 2AQ1B 5EE1A 1OFFA 4L23A 1MPEA 1K50A 1OQQA 3KLSX 1FNUA 1QOAA 3ZJVA 3AM9A 2I38A 2YEPF 2PKOA 1HQRD 4TMAB 3BYTB 1L0XB 1V8CA 2WU2B 1J7AA 1B1ZA 3NRZA 4RF0A 2VFRA 1TYGB 3IAM1 1I19A 5AUKA 4YXDB 4AQ7A 1ZR6A 4PVEA 2PIAA 3NVVA 1ZXHA 4OALA 4YTNB 1CK1A 2OEDA 2WXQA 4XWWA 1N62A 5HI1A 3ABVB 1RFKA 3MHZA 2JQRB 3PZ8A 1I7HA 1Y56A 3W5VB 1C76A 4A8XC 2IGHA 4CQNA 1K53A 3TEYA 1C4PA 2JSVX 4A55A 3HRDD 2M19A 1W1MA 1SB3C 4US9A 2WXPA 2RK5A 3T3OA 1W1LA 3R8BA 4N58A 2WDQB 4MM3B 1FXIA 2E5AA 5E6JA 2KQ4X 4UDUC 1TKGA 1GAQB 2K3UA 2W54A 2E3TA 3V3XA 1FRDA 1YQ4B 5D79A 4M0WA 3L4PA 3AEDB 2NMQA 2AXRA 1FNWA 4NZLB 4ML8A 1JALA 1UWXA 2Y08A 4PYTA 1VJKA 5FXEA 5HFYA 3GSYA 1P7EA 1T6BX 2BVGA 4TQ0A 1IBXA 1QQRA 2BBCA 4DNSA 4GDKB 5K8EA 3U52E 1E8FA 3DQ0A 5BYSA 2JU6X 3W9CB 1VQZA 2BB5A 2BW2A 2J4XA 3E56A 1W1OA 2J53A 1QT9A 4UD8A 3AE1B 3SFEB 1I4PA 4HG0A 4OZBA 1DOXA 4US8A 4HROA 1SE3A 1YMHE 2LFIA 4RNAA 3AE7B 2MJDA 3C0PA 4C80A 1XO3A 3VR9B 5FXPA 5D7GA 1GB4A 2MEKA 4O1NA 1SBBB 2VFVA 5C2TB 1HEZE 4YSYB 4PVJA 1PGXA 1N5WA 2W82A 3IAS1 4ZRQA 2AQ2B 1YN4A 3ZGZA 1KH0A 5G5GA 4ZRPA 2W3RA 5BMIA 4XDCA 1T3QC 2CJOA 4WAFA 1JWBD 3WCQA 2V0GA 2IGGA 2PTLA 1RM6B 5JXVA 3FWAA 1L6VA 3PQBA 1CJEA 3OWEB 1KLUD 4YWGG 1VAOA 3NVWB 1WRIA 1MBTA 2DWQA 1MHXA 1FNVA 1XXGA 3VTEA 5AUIA 4IDIA 1RWSA 1K52A 3ZQ4A 2GI9A 1XLPA 4H2AA 4XDDA 4ZOHC 3W5UB 4DXFA 4TSSA 3DEDA 4A90A 4LK0M 3LLBA 5AE2A 1JWSD 2GB1A 2XNAC 5GXGB 3RFZB 2X38A 5LNK1 2G1EA 2PLSA 1F77A 1JCKB 2ACZB 3HUIA 1T3QA 1ZXIA 3W1SA 1SE4A 1XLOA 2WXNA 5L6GA 3D2HA 3BW7A 1ET6A 1VRAB 1C4CA 2DLBA 1KRHA 2V3PA 4WIPA 2VFTA 1JW9D 5G5HA 3CWIA 3Q8FA 4OZAA 1DIQA 1YNTE 2WXMA 3SEBA 4XWTA 3O13A 4ARIA 3URYA 2Y3RA 5EE3A 1EWYC 4KKJA 1X2GA 1WVFA 1ENFA 3JS8A 2E6XA 1EU4A 1GB1A 3AEGB 2PW9A 2J42A 2V4IB 3TEWA 2I0KA 3B9JB 2BTEA 1WWTA 1SJHD 2ZW1A 2P13A 2LGIA 1L5PA 4RH6A 1WYGA 2N0SB 1I4QA 2H89B 2YVSA 3AEFB 3BWUD 4JWSC 2WXIA 2INNE 1D5XC 1QOFA 4P6VF 3Q8BA 1X2HA 2W3SA 5HHDG 2VFSA 2IPIA 1D5ZC 2VFUA 1E6EB 1ZOYB 1SB3B 2R2ZA 4WQMA 2JXTA 2WXOA 3PO0A 2BS2B 4Q2JA 3TEXA 3TSSA 1N61A 4BCAA 4BC9A 1ZPSA 4GLSC 2R8DA 1ZDVA 2Z8LA 3SR6A 4KX6B 4LTUA 1YJIA 3VRAB 1RYJA 2AX5A 5H92C 3FILB 3NVWA 3BYYB 1TZOA 1KTKA 1C4AA 1J7BA 1TS5A 2INPE 3AEAB 1J7CA 3NVZB 2DBYA 1VZ8A 3NS1A 1ACCA 1P7FA 3AE9B 4ZHOA 5FK9C 2ZW0A 2EXRA 3RJAA 2EELA 3VR8B 2J52A 2KN4A 2MH7A 1KFYB 1UXYA 1BUIC 4XE0A 1ZDXA 4USAA 1EU3A 5HQXA 2W55A 4FXCA 1N63A 4PT5A 2BT6A 5BMHA 2DYOA 4LLGM 4AS1A 1SJED 2M56B 1D5MC 2WS3B 5EE9A 1ZUD2 3AV8A 1NVID 1F0ZA 3H8HA 1PDXA 1JWAD 3A7UA 1NYQA 3D2DA 3AECB 3S1FA 1L6UA 4YTPB 1N5WC 4NAWB 3HRDC 3NVYB 1HZ6A 3CIRB 4PWBA 3A7RA 1MVKA 2WDWA 3P42A 2RPVA 1YJJA 3KQ4A 1B9RA 1TY2A 1YN5A 2ICIA 1QLBB 1V1PB 1FCLA 2KMMA 2Q4WA 1BXTA 4TVYA 4DQOC 2DYMA 4OHJA 1FO4A 2WXHA 1SIJA 3AE3B 1E9MA 1TS2A 4NJCA 1ET9A 1ESFA 2D5GA 2PVOD 1F2RI 4ITKA 4JPSA 3A7AA 4IOIE 1YQ3B 2Y3SA 4WURA 1DYQA 2JYEA 1FD6A 2OHFA 2Q85A 2NTTA 4MLAA 1FMAD 1FFUC 1HXYD 4KGRA 5HHZA 4L2YA 3IXSA 2PVGC 3Q69A 2BB6A 4OW0A 4J3OD 2VAOA 2KDMA 2M0AA 2N9LA 1DOYA 3DWGC 4A6QA 4PVKA 2L52A 2QJLA 3ETRB 4RGTA 4TQ1A 2KAJA 4ZOHB 3P63A 4RCOA 2BYTA 1ZXIC 3POPA 1CQVA 2FE8A 4HEA1 2N7JA 1FM0D 5BYQA 4OVZA 3BVGA 1DZNA 4DXGA 3BK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y5C A;  2QIE B;  1W1R A;  1F0X A;  1KF6 B;  1HSK A;  3NRZ B;  1A70 A;  1E0Z A;  4WWM A;  3NVZ A;  3S1E A;  2MBR A;  1FFU A;  1CZP A;  1TKE A;  2QPM A;  3DWM A;  3W8X A;  2B76 B;  3ZYY X;  1WXQ A;  4ZHP A;  4JX1 C;  1N5X A;  3AE6 B;  4YSZ B;  1N61 C;  3AEB B;  1TKY A;  3R07 C;  1RM6 C;  3LAE A;  4YT0 B;  2BS3 B;  3AB5 A;  2P4P A;  5MPO A;  1QOB A;  4BC7 A;  3B2G A;  3FAH A;  3FC4 A;  5FXF A;  3TSH A;  1NEK B;  2EKI A;  2WDR B;  1MBB A;  2WP9 B;  1N63 C;  1NI3 A;  3AH7 A;  1E8H A;  2WU5 B;  2K22 A;  2WLB A;  4EC3 A;  4HRS A;  4YTM B;  1JRP A;  1N60 A;  4XLO A;  2PLI A;  3AN1 A;  3P1M A;  3TSJ A;  3S1C A;  1FFV A;  3B2F A;  2MJ3 A;  1AHV A;  3RPF C;  1NEN B;  1VDV A;  1V97 A;  5G5G B;  4JWU C;  1GPX A;  4C7Z A;  3LB8 C;  4YSX B;  2GQU A;  3S1D A;  3P4P B;  1WVE A;  1XLN A;  1VLB A;  2CU3 A;  5EE0 A;  3P4Q B;  3W8W A;  1AWD A;  1FRR A;  1WGK A;  1FIQ B;  1IUE A;  3AMZ A;  1L0V B;  3B9J A;  1E7P B;  1NYR A;  1SF0 A;  1XLQ A;  5G5H B;  1W1J A;  5AE1 A;  2K5P A;  2H88 B;  1AYF A;  1PFD A;  3FW7 A;  3W8Z A;  4BBY A;  1AHU A;  4A9A A;  1UWM A;  2P3H A;  1JQ4 A;  2NQW A;  3FW8 A;  4PWC A;  4PVH A;  3PM9 A;  3P4R B;  2K9X A;  5AE3 A;  4JB1 A;  3TX1 A;  4O95 A;  2CJN A;  2MJE A;  2WQY B;  3EUB 3;  1E8G A;  3P4S B;  5C3J B;  4C7Y A;  3AE2 B;  1E10 A;  2O3G A;  1OQR A;  1W1Q A;  3NVV B;  3VRB B;  1E0Y A;  2FBW B;  4N59 A;  4JAY A;  3SFD B;  2JX5 A;  3SR6 B;  1QF6 A;  2L83 A;  2GQT A;  3BII D;  1DII A;  3EUB 2;  1W1K A;  4TVW A;  2LEK A;  3NS1 B;  2BVF A;  3KWL A;  1AHZ A;  1ZP0 B;  1QLT A;  1W1S A;  3NVY A;  2HTM E;  1QOG A;  1DOI A;  4PZF A;  4N6E B;  3AE4 B;  1N60 C;  1FIQ A;  2BS4 B;  3LXF A;  1JRO A;  3AE5 B;  1DGJ A;  1R7S A;  3AEE B;  1FFV C;  3FW9 A;  5FXD A;  1TJE A;  1ROE A;  2Q5W D;  3KJM A;  5HMR A;  2WDV B;  2BVH A;  3I99 A;  5ADZ A;  1FXA A;  2OAI A;  1N62 C;  1PUT A;  3HVZ A;  3ETR A;  5H8Y E;  3D2J A;  2QKN A;  3AE8 B;  1QLU A;  5EE1 A;  1OFF A;  1OQQ A;  1QOA A;  3AM9 A;  2PKO A;  1V8C A;  2WU2 B;  1J7A A;  3NRZ A;  2VFR A;  1TYG B;  1I19 A;  5AUK A;  4YXD B;  1ZR6 A;  4PVE A;  2PIA A;  3NVV A;  4OAL A;  4YTN B;  1N62 A;  3ABV B;  1RFK A;  2JQR B;  1I7H A;  3W5V B;  3HRD D;  2M19 A;  1W1M A;  1SB3 C;  4US9 A;  2RK5 A;  1W1L A;  4N58 A;  2WDQ B;  2E5A A;  1FXI A;  1TKG A;  1GAQ B;  2W54 A;  2E3T A;  1FRD A;  1YQ4 B;  5D79 A;  3L4P A;  3AED B;  2AXR A;  4ML8 A;  1JAL A;  4PYT A;  1VJK A;  5FXE A;  3GSY A;  2BVG A;  4DNS A;  1E8F A;  3DQ0 A;  1VQZ A;  3W9C B;  1W1O A;  4HG0 A;  1QT9 A;  4UD8 A;  3AE1 B;  3SFE B;  1DOX A;  4US8 A;  4HRO A;  3AE7 B;  2MJD A;  3C0P A;  4C80 A;  1XO3 A;  3VR9 B;  5FXP A;  2VFV A;  5C2T B;  4YSY B;  4PVJ A;  1N5W A;  5G5G A;  2W3R A;  1T3Q C;  2CJO A;  1RM6 B;  1JWB D;  3WCQ A;  3FWA A;  1L6V A;  1CJE A;  1VAO A;  3NVW B;  1WRI A;  1MBT A;  2DWQ A;  3VTE A;  5AUI A;  4IDI A;  1RWS A;  1XLP A;  4ZOH C;  3W5U B;  3DED A;  3LLB A;  5AE2 A;  5GXG B;  2G1E A;  2PLS A;  2ACZ B;  3HUI A;  1T3Q A;  1ZXI A;  1XLO A;  3D2H A;  3BW7 A;  1KRH A;  2VFT A;  1DIQ A;  3CWI A;  5G5H A;  1JW9 D;  5EE3 A;  1EWY C;  1X2G A;  1WVF A;  3JS8 A;  3AEG B;  2I0K A;  3B9J B;  1WWT A;  2P13 A;  1L5P A;  1WYG A;  2N0S B;  2H89 B;  2YVS A;  3AEF B;  4JWS C;  1QOF A;  4P6V F;  1X2H A;  2W3S A;  2VFS A;  2VFU A;  1E6E B;  1ZOY B;  1SB3 B;  2R2Z A;  4WQM A;  3PO0 A;  2BS2 B;  1N61 A;  4BCA A;  4BC9 A;  2R8D A;  3SR6 A;  4KX6 B;  4LTU A;  1YJI A;  3VRA B;  1RYJ A;  2AX5 A;  5H92 C;  3NVW A;  3NVZ B;  1J7B A;  3AEA B;  1J7C A;  2DBY A;  3AE9 B;  3NS1 A;  4ZHO A;  2EXR A;  3VR8 B;  2MH7 A;  1UXY A;  1KFY B;  4USA A;  5HQX A;  2W55 A;  4FXC A;  1N63 A;  2BT6 A;  2M56 B;  2WS3 B;  5EE9 A;  1ZUD 2;  3AV8 A;  1NVI D;  1F0Z A;  1PDX A;  1JWA D;  3A7U A;  1NYQ A;  3D2D A;  3AEC B;  3S1F A;  1L6U A;  4YTP B;  1N5W C;  3HRD C;  3NVY B;  3CIR B;  4PWB A;  3A7R A;  1YJJ A;  1B9R A;  4TVY A;  1QLB B;  2Q4W A;  2KMM A;  1FO4 A;  1SIJ A;  3AE3 B;  1E9M A;  4ITK A;  2PVO D;  3A7A A;  1YQ3 B;  2OHF A;  2Q85 A;  4MLA A;  1FMA D;  1FFU C;  5HHZ A;  2PVG C;  2VAO A;  1DOY A;  3DWG C;  4PVK A;  2L52 A;  2QJL A;  3ETR B;  2KAJ A;  4ZOH B;  3P63 A;  1ZXI C;  1FM0 D;  1DZN A; 
#chains in the Genus database with same CATH topology
 2F1I A;  4H4R A;  4M2Y A;  2NRZ A;  3BJY A;  1KF6 B;  1XD3 B;  3NFU A;  2BCR A;  1IGD A;  4EEY A;  4J9Q A;  1X9W A;  3X0W A;  1JUD A;  3FIL A;  4PS3 A;  1HSK A;  1T94 A;  2KE7 A;  2WX1 A;  3NRZ B;  2WPF A;  3AU6 A;  4GU2 A;  1YZ6 A;  3URH A;  4NY8 A;  5ALU A;  3U2S C;  4QAY A;  4I2D A;  1V5T A;  4TQS A;  2PSN A;  1NK5 A;  3PSF A;  2MW5 A;  3BDP A;  3MC0 B;  4R3D A;  3NTU A;  1NZB A;  4W9I A;  2UUU A;  4J9M A;  2D07 B;  3RBD A;  2KTF A;  3BK2 A;  4NL9 C;  2DYB A;  1BT0 A;  1IIP A;  2KOX A;  3FG2 P;  1ZQM A;  1URJ A;  1LVH A;  2ASJ A;  3ZYY X;  1C79 A;  3SI8 A;  2IA6 A;  1ELS A;  4JX1 C;  4IM3 A;  4MT5 A;  2QJM A;  1WG8 A;  3UI3 A;  3ZI4 A;  3IT6 B;  4DHZ E;  3PLV A;  3CYJ A;  4HWI B;  3UM9 A;  2AL3 A;  1NI2 A;  4W9L A;  5AI8 A;  1NK7 A;  4C00 A;  2OPJ A;  3LYY A;  2OZT A;  1N61 C;  2MCN B;  2V3N A;  4UAT A;  3QU7 A;  2D8C A;  4I2G A;  4GDK A;  2ZZC A;  2HBL A;  5AM1 A;  1S8O A;  5L1I A;  2JZP A;  4MGG A;  2LZ6 A;  4F2S A;  4URK A;  3FAH A;  3QXG A;  3UQB A;  2MA1 A;  4F5Q A;  1Q1W A;  1RYU A;  4Z6C A;  2AEH A;  2BF8 B;  2WXJ A;  1J0G A;  4DLG A;  2NPT A;  1AQ6 A;  4B9M A;  7ICO A;  1WCN A;  2HDE A;  1U9L A;  4JE3 B;  3H8S A;  2HZG A;  5DCN A;  3I63 C;  2K8B B;  3K9P B;  5CHV C;  1N63 C;  3II4 A;  3AH7 A;  4MSQ B;  3H7V A;  5KFL A;  2YVC A;  9ICO A;  1XCQ L;  3TAC B;  3DGB A;  5AM3 A;  3N6J A;  4YTM B;  5E79 U;  4C8M A;  1T7P A;  4ICU A;  4IHC A;  1MFW A;  1V1O A;  4DF8 A;  4JIO U;  3CGD A;  2NRW A;  3MR2 A;  5CP2 A;  1BGX T;  5KFK A;  3AN1 A;  2G45 B;  2N9K A;  2RDG A;  4GXB A;  4HK2 A;  2XK5 B;  4MH8 A;  3TSJ A;  1MG8 A;  1QTM A;  3B2F A;  2MJ3 A;  3IG8 A;  4RQ1 A;  2IY1 B;  2SEB D;  3MFG A;  4GDL B;  3RPF C;  3MKC A;  2PXI A;  1F0M A;  5T14 A;  2EZZ A;  5HML A;  3RB6 A;  1HZ5 A;  4KLU A;  1SE2 A;  2R2Q A;  4J9R A;  3IVF A;  1P7D A;  4B0E A;  3GY1 A;  2W7O A;  4DSF A;  1XCT L;  1X66 A;  2R8I A;  4JWU C;  4K7Z A;  2IBI B;  3WKC A;  1ZD5 A;  3SN0 A;  5KFG A;  2W9B B;  4H4X A;  4OCZ A;  4K4I A;  5KFD A;  3N97 B;  1CMX B;  4MEM A;  3D2S A;  4HDO A;  3P4P B;  4HYK A;  3PRE A;  1XLN A;  1PGB A;  2BYF A;  4MJS B;  4Q8E A;  5ALG A;  3SDL C;  3PG6 A;  3C1Z A;  3BQ0 A;  2ZIU B;  3QA8 A;  3GRS A;  4EZL A;  4IQV A;  4DL5 A;  3OJU A;  3L08 A;  3PZP A;  3C19 A;  4KGT A;  4W9E A;  1AWD A;  4P7I A;  7ICJ A;  5ALT A;  1TIF A;  4R8U A;  1AW7 A;  4HXD A;  9ICW A;  3GD3 A;  3MGV A;  3KOO A;  3M6Z A;  3T3F A;  1SXT A;  3Q8M A;  1L0V B;  1EWC A;  4DOA A;  1DK2 A;  1JML A;  1E7P B;  3A9K B;  2NS5 A;  3GD4 A;  3AXC A;  2FAZ A;  1TY0 A;  1O03 A;  5D49 A;  4UB4 A;  2KX0 A;  2W9N A;  3UGB B;  2LGY A;  1Q5W B;  5J2B A;  4WJN A;  5AE1 A;  3DBH I;  1K4Q A;  2ZUB A;  4UB8 U;  7ENL A;  1LFD A;  5DPR A;  2JPH A;  2Y5B B;  3FW7 A;  5AIA A;  4MAC A;  2D2Q A;  2BKF A;  4PS7 A;  3HSU A;  1ECW A;  2L32 A;  3VTU A;  2JF5 A;  4ICA A;  2W9C B;  1FHV A;  3O0H A;  4KLE A;  3UXP A;  3DGH A;  4YG2 A;  3BS5 A;  5AK3 A;  4PVH A;  2O56 A;  2D6F C;  3ES7 A;  3WK9 A;  5J2A A;  3UJF A;  2G09 A;  1B43 A;  1L6N A;  3IHP C;  3ZDA A;  2FPL A;  3TX1 A;  2Z59 B;  3QFB A;  2C9W B;  2N7E A;  4H4T A;  1I42 A;  9ICT A;  1OGW A;  4RQ0 A;  5D3I B;  2DQN B;  3EW9 A;  2YMP A;  4HDQ A;  4B9K A;  1JEH A;  3GB1 A;  1AN8 A;  2SAK A;  5FJO A;  3PR5 B;  1OQR A;  3VRB B;  1Z3E B;  2I6X A;  1E0Y A;  1ZET A;  4KLL A;  2XBB C;  4TKN A;  4E74 A;  1T0Q C;  4HPN A;  2WXG A;  5IIK A;  2JX5 A;  2PLP A;  4ARC A;  3MZN A;  3KUC B;  4DQR A;  2K6D B;  2LHD A;  3SN1 A;  4WWN A;  2LD9 A;  2OZ8 A;  3DEQ A;  2PGE A;  2F2A B;  5AI5 A;  2IPK D;  2L0F A;  1D9F A;  3BII D;  4JWN A;  2JZ3 B;  2QCZ A;  1DII A;  2PMV A;  4TVW A;  3ZDT A;  3R0U A;  1UEL A;  2L1A A;  4UAY A;  3EEZ A;  4F5R A;  1Q3U A;  7ICM A;  3KWL A;  3QX7 A;  4KX3 A;  5D3D A;  4PGX A;  3I9V 1;  2LUM A;  4FHK A;  1QLT A;  3KD3 A;  3PX0 A;  2VH2 A;  4HNC A;  3AUL A;  3PTF C;  2WF5 A;  9ICS A;  3GZN I;  4RQ8 A;  4JWM A;  1DOI A;  2H3I A;  5J0U A;  3T5K A;  4WH4 A;  3QNM A;  2K4I A;  2ZPN A;  1ZQJ A;  2PMQ A;  3E0F A;  2BS4 B;  2WBA A;  3LXF A;  1XHC A;  4JUZ A;  1JRO A;  1PQS A;  3RFA A;  1U49 A;  1Q0W B;  2H3V A;  2Q4T A;  1A0P A;  2QB0 A;  2YLM A;  4E4F A;  2QGY A;  5KT4 A;  1JCT A;  1ZD2 P;  4FFD A;  4AP4 C;  3CXO A;  3UJE A;  1WXA A;  1SZP A;  3CGB A;  4KMU A;  2FUG 1;  2RDB C;  3HT3 A;  3RD2 A;  3QX1 A;  1I4H A;  2L05 A;  5HMR A;  2WDV B;  3QU9 A;  3I99 A;  1ZRN A;  3PZ7 A;  3Q2A C;  2OAI A;  2ZAD A;  5L83 A;  3WK4 A;  1TYT A;  8ICX A;  1XQQ A;  3DK8 A;  1BPD A;  1TV9 A;  5H8Y E;  2BR0 A;  3MC1 A;  3D2J A;  3AE8 B;  1Z4N A;  3SQI A;  4DFJ A;  4CCH A;  2AL2 B;  2KKP A;  1KFD A;  9ICJ A;  2EAM A;  3IJI A;  3I76 A;  3AM9 A;  3IM1 A;  5KFC A;  4NY0 A;  2PKO A;  5KNI A;  1GUA B;  1HQR D;  3QC8 B;  1L0X B;  4B9U A;  1V8C A;  4E71 A;  4K4H A;  7ICL A;  3ZVV A;  1B1Z A;  4RMA A;  4IM2 A;  4IC7 B;  1X9X A;  2P35 A;  4QZ9 A;  1C20 A;  2ZVN A;  3IAM 1;  2GGH A;  2MP2 B;  4I2I A;  5ALW A;  9ICF A;  4K8G A;  4AQ7 A;  2YY6 A;  4RT2 A;  4ZRK A;  4DNA A;  4HPM B;  3NVV A;  4IL6 U;  4YTN B;  3GC2 A;  1CK1 A;  2OED A;  1P9D U;  4QZG A;  2N9P C;  2D3A A;  5B5E U;  3C2M A;  1KOT A;  2POZ A;  4Y2Y A;  2ISO A;  3PZ8 A;  1M94 A;  3PS6 A;  1Y56 A;  4ECT A;  1YQB A;  4FUL A;  4QZ8 A;  2BYE A;  4GFJ A;  5AKI A;  2FID A;  4TUQ A;  4IRD A;  1WMH A;  1M6Y A;  3U8Z A;  3V5F A;  4H4V A;  5KFO A;  4MGZ E;  1QQ7 A;  2BQR A;  3EHV A;  1OXJ A;  4GR1 A;  5KHQ A;  3TEY A;  3OZM A;  5FJT A;  3IDW A;  3PLU A;  3VH3 B;  5J2I A;  3SMV A;  4GSW A;  4E5T A;  1SB3 C;  4JGH B;  3U30 A;  3NO1 A;  2WXP A;  5J2R A;  3T3O A;  4W9F A;  1W1L A;  5E6O A;  2X99 A;  5JCK A;  5E6J A;  2AU0 A;  5KFW A;  3L3F X;  1TKG A;  2AQ0 A;  4KTQ A;  2W11 A;  2HSZ A;  5AK6 A;  3V3X A;  2RPQ A;  2MNR A;  2O6V D;  4M0W A;  5U25 A;  4DN1 A;  3AED B;  2NMQ A;  2AXR A;  1FNW A;  4BZA A;  3RAQ A;  4P0Q B;  5CTR C;  1Z1B A;  3H8J A;  2OKT A;  3O65 B;  1Z00 B;  1OW5 A;  1CRX A;  4NXZ A;  2KFK B;  1LM8 B;  1V59 A;  1T4G A;  1X6I A;  2DKZ A;  5CR0 A;  1T6B X;  4IM0 A;  5HFY A;  3GSY A;  1ZK7 A;  4KPL A;  4TQ0 A;  4KX5 A;  1L7N A;  1IBX A;  2C7N B;  2BBC A;  5AM4 A;  1EC7 A;  1E8F A;  2LVQ A;  2KZ3 A;  5JCN A;  1MQ2 A;  3ZW3 A;  2BB5 A;  2BW2 A;  3E56 A;  4II3 B;  5LLI A;  2AYO B;  1ZQX A;  1I4P A;  1DOX A;  4NM1 A;  3N4E A;  4US8 A;  4HRO A;  1YMH E;  4H4Q A;  5KFN A;  3EYZ A;  2N9X A;  5AI6 A;  3V7J A;  4JN8 A;  2AKZ A;  5BOF A;  3ONN A;  2DKX A;  1S5L U;  1QSS A;  5FXP A;  1HTQ A;  4MFA A;  3ZLH A;  7ICE A;  9ICC A;  5A0L A;  2K8C A;  3T8M A;  4JN7 A;  1N48 A;  2WGS A;  3TCA A;  5C2T B;  1NHQ A;  5ALD A;  2GBR A;  2I1J A;  4G7F A;  2DEN B;  5EDS A;  1ZY8 A;  1N5W A;  2LPE A;  2NBW B;  2W82 A;  2AQ2 B;  1YN4 A;  1KKO A;  1U4B A;  3RB0 A;  4RQ2 A;  3TTE A;  3ZO5 B;  1NJX A;  4WAF A;  1JWB D;  4M9N A;  5ALO A;  3WAO A;  5JXV A;  4E8G A;  3RH4 A;  3RNB C;  3PHX B;  1L6V A;  2KWC A;  3PQB A;  5ALP A;  3OWE B;  3O0F A;  1VAO A;  3D9X A;  3H8M A;  2KV2 A;  4DQS A;  5DG9 A;  1WRI A;  2D10 A;  1MBT A;  3VCC A;  3EJB B;  4M02 A;  2DWQ A;  1MHX A;  2A1A A;  3LVW A;  5F9N A;  3PSE B;  5CHG A;  5G2N A;  4P4P A;  2LI5 A;  3H7I A;  1RWS A;  1K52 A;  3V7K A;  2IYD B;  3ZQ4 A;  2N1R A;  7ICK A;  3CST A;  3QE9 Y;  4ZOH C;  1WJ6 A;  3W5U B;  4DL4 A;  2CRX A;  4KLO A;  3HJE A;  3DED A;  4UBC A;  4A90 A;  4LK0 M;  4K7S A;  3DER A;  3LLB A;  4RQN A;  3VXW A;  5J0W A;  4DLE A;  2XNA C;  3RR8 A;  4DQP A;  3RFZ B;  3ED5 A;  4EKU A;  1ZQB A;  5LNK 1;  3RZF A;  4AP9 A;  1JCK B;  1ZXI A;  3ETL A;  4YCX A;  2KJ6 A;  3R3M A;  3ZTC A;  1XLO A;  2MU2 A;  4F91 B;  2WXN A;  5DBB A;  1VRA B;  3PST A;  5G5H A;  1DIQ A;  4PYU A;  3GV5 B;  4CE6 A;  3SEB A;  3OG5 A;  1ZQN A;  4YXM A;  4QWC A;  2Y3R A;  5AKH A;  3B08 A;  5ER0 A;  3H7S A;  1XWL A;  1ZQE A;  5FJP A;  1SL2 A;  1OEY A;  1WVF A;  2IHM A;  2A4Z A;  1V86 A;  2E6X A;  3JS8 A;  3AL0 B;  2R8G A;  1GB1 A;  3VFK A;  2AGO A;  2J42 A;  5AKZ A;  2HHT A;  3ZDC A;  5KG1 A;  4R63 A;  2PFN A;  5J0Q A;  1WWT A;  2ZW1 A;  3K1G A;  2V3S A;  4C8O A;  2LGI A;  1L7M A;  3AQF A;  3RBE A;  5FJR A;  2RDI A;  4DL3 A;  3IV6 A;  3MY9 A;  5FS7 A;  3WK6 A;  2KDE B;  3GE3 C;  4KZ0 A;  2C28 A;  3EEC A;  1WH3 A;  1PDY A;  4CF5 A;  3H7P A;  2W3S A;  2KQS A;  1A77 A;  4ZCW A;  1ZOY B;  1SB3 B;  2X8X X;  3RCY A;  3TI0 A;  4Q2J A;  3TEX A;  8ICP A;  2KTR B;  1ZJM A;  3SU8 X;  4BCA A;  2R18 A;  5KFA A;  4UB5 A;  4TV3 A;  1WIA A;  1TAU A;  1E8X A;  4S17 A;  1IYF A;  1QSL A;  1YJI A;  2EKE C;  3UMB A;  2AXT U;  3VRA B;  3K4G A;  4ED3 A;  4K81 A;  4C4S A;  5AKX A;  2JZB A;  1SJD A;  3GO2 A;  5KHO A;  3NVW A;  3UIP B;  4DHZ B;  4HYR A;  2YQU A;  3KHH A;  4QIW C;  1A5R A;  1C4A A;  3AEA B;  2ZJD A;  3PHW B;  4TQR A;  2DBY A;  2P8C A;  5JCI A;  1ACC A;  2EXR A;  5KFP A;  2VA8 A;  4CGZ A;  3L16 A;  2PCE A;  2EEL A;  3SQS A;  3RJA A;  2MH7 A;  2D3G A;  1UXY A;  4XE0 A;  5KG3 A;  3NZG A;  4AYB C;  1COO A;  2KDF B;  1DRG A;  4PT5 A;  1SJA A;  5BMH A;  4GIS A;  2PMZ C;  4F4K A;  3EAO A;  5TR3 A;  2KN5 A;  2GGE A;  4Y2R A;  5EE9 A;  3T9L A;  2XIC A;  1ZUD 2;  4J9N A;  2EMS A;  2KC2 A;  2LWP A;  4ECR A;  4XYC A;  4KWS A;  2F8L A;  1E8Z A;  3A7U A;  7ICU A;  2JWZ A;  4KLI A;  3F2C A;  2ZIX B;  4U7C A;  1L6U A;  5JRB A;  8ICY A;  8ICT A;  2G4S A;  3NVY B;  3HRD C;  1XPY A;  3HKZ C;  3Q8S B;  2V6O A;  1MVK A;  3U7D A;  4J56 A;  2PFP A;  3V61 A;  5FS8 A;  2BCP A;  2HI0 A;  1B9R A;  1PK1 B;  3A0H U;  1MQ3 A;  3B1L X;  4F50 A;  1RQN A;  1TBE A;  4AJW A;  1ZQC A;  4EMI A;  2ZC8 A;  4UW9 A;  5AKK A;  2GBM A;  3TIX A;  3V4B A;  2KD1 A;  3RNM A;  3L5K A;  2BCS A;  1E90 A;  1WR6 E;  2PVO D;  4KLM A;  1TK0 A;  2M8S A;  3DFH A;  3LB8 A;  4GME A;  2Y3S A;  2NYV A;  2JYE A;  3FJ4 A;  2KIW A;  2Q85 A;  3TWB A;  2F77 X;  1FMA D;  2DUY A;  1FFU C;  1P1A A;  4GB9 A;  1ZD3 A;  1WGD A;  2MAX A;  3D32 A;  4BGD A;  4J3O D;  3JPN A;  3UQ0 A;  3ETR B;  4X5V A;  4MFC A;  2MA9 B;  4ZOH B;  2JHD A;  5CEH A;  1EF5 A;  2DZJ A;  3P63 A;  1GSN A;  2FE8 A;  1F9J A;  1L8L A;  3FXG A;  1JDF A;  3BVG A;  1ZQG A;  1TAM A;  4DXG A;  3BK1 A;  3LYS A;  2KFJ A;  1OEY J;  1H6V A;  2UVU A;  4FJZ A;  2GL5 A;  2Y5C A;  4ASW C;  4KIT B;  3RJK A;  1Z4O A;  2BPC A;  2EZX A;  5KFR A;  1E0Z A;  1QLN A;  3NVZ A;  1ZQZ A;  3I1Y A;  3P93 A;  1FFU A;  4WAA A;  1TKK A;  1JN3 A;  4M04 A;  1S0O A;  3RUL A;  5ALN A;  1YX6 B;  4F8C B;  1GEU A;  1TS3 A;  2IGD A;  2PE9 A;  3RGT A;  1GO3 F;  5AWV A;  2QPM A;  1X2I A;  3W8X A;  2MRL A;  2ZJ8 A;  2JY6 A;  4GN1 A;  2M1M A;  4ZHP A;  1ZQU A;  4C4V A;  4RUA A;  4O3P A;  3UJS A;  4AWJ A;  4F92 B;  2IBK A;  2OVL A;  3VC8 A;  1WSP A;  2MBQ A;  3B97 A;  5BOE A;  4M6W A;  2CDU A;  4K7W A;  3AE6 B;  2G0A A;  2A1J B;  2KJH B;  5L9X A;  3AEB B;  3QAQ A;  3Q3M C;  3VQI A;  2KJ5 A;  3H9D A;  5FR6 A;  1C78 A;  4EX7 A;  2OEH A;  2BS3 B;  3RI7 C;  1V1P A;  1CEZ A;  3M9O B;  2WHI A;  3MJ5 A;  2KQ7 A;  4IKG A;  3A1Q B;  2JH7 A;  3WK7 A;  4TUS A;  4RT3 A;  3HPO A;  2E1F A;  3CRX A;  4O3Q A;  1W6T A;  1U47 A;  5CRX A;  4QZA A;  2PS2 A;  5KVI A;  3TSH A;  5HHH A;  4NAM A;  4UB2 A;  4ECX A;  2GGJ A;  1AAR A;  2ONQ A;  2BQQ A;  1WJU A;  1PGA A;  3IP4 B;  2Z0E B;  5LXI B;  2FI1 A;  1HUZ A;  2POD A;  4GIR A;  4G11 A;  1IYX A;  2E8M A;  2OJR A;  3ZJT A;  2GR1 A;  4ZRI A;  2IZV B;  1NU5 A;  4Y2Q A;  2VZK D;  2ALZ A;  4HRS A;  4ZYS A;  4RM9 A;  1JRP A;  1DNC A;  5KAI U;  4BAX A;  4JV2 A;  2OH2 A;  2TSS A;  1IGC A;  4GXJ A;  4F2R A;  5I4D A;  2PLI A;  1WF9 A;  2JEF A;  3MC9 A;  3QJZ A;  4KLT A;  3QYP A;  4LZG A;  4A35 A;  1WE7 A;  4JDR A;  2WHE A;  3V3W A;  3PW2 A;  4NLN A;  4KSL C;  1KLN A;  4QZE A;  2QDF A;  5KG5 A;  5F3X B;  3VDZ A;  5G5G B;  4ED6 A;  3QUT A;  3DBR B;  3H6N A;  1UUP A;  3M63 B;  4A3O A;  3UXK A;  2HHX A;  4YD1 A;  3SSZ A;  3WU2 U;  1ZQS A;  2P6U A;  4RGO S;  4O3M A;  1WGG A;  1L0Y B;  2ZNV C;  1LPF A;  4GYP A;  4IZG A;  3ONS A;  2GQU A;  3S1D A;  3MWC A;  2W9A A;  5D94 A;  2PTY A;  2IJ0 A;  5ALX A;  4PH5 A;  2QKQ A;  4EFO A;  3LVV A;  2HHU A;  2BCV A;  3RB4 A;  2QAR A;  3ZDD A;  5HP4 A;  1WVE A;  2OG9 A;  2UWQ A;  3ML9 A;  4RPX A;  5BPC A;  2NCN A;  2YVG A;  3Q45 A;  2J0J A;  2DW7 A;  1RFA A;  4BXO A;  4HCH A;  1SEB D;  3E58 A;  1V9J A;  1SJC A;  2MWS B;  4X2P A;  5FP0 A;  4FJV B;  1FRR A;  3ENL A;  5L1J A;  5JTI A;  1KBU A;  3TUO A;  4HKQ A;  1V38 A;  3AMZ A;  2V4R A;  4P0P A;  2MRP A;  4K3C A;  4IWP A;  9ICK A;  2KKC A;  1KTQ A;  7ICR A;  3TBL D;  2N9E B;  5KT7 A;  3C23 A;  3ZVH B;  2WX0 A;  3B9J A;  4EQX A;  4W9H A;  3ZKJ C;  2GBN A;  2BKR B;  2BPS A;  3JW7 A;  4HKZ E;  3TL5 A;  2ESE A;  3OTQ A;  1LO5 D;  1WM3 A;  2IDY A;  1D6E C;  1SZH A;  3J81 j;  1L4Z B;  2ON8 A;  3ZNH B;  4P2H A;  5AM0 A;  3PW0 A;  2C7H A;  1UF0 A;  3TAQ A;  4BBY A;  4M6U A;  1UWM A;  3IRU A;  2WWZ A;  3WK8 A;  4FZN A;  1RAX A;  4IL2 A;  4OJ6 A;  4A3R A;  2NQW A;  3MGH A;  3Q8R B;  1UD7 A;  3FW8 A;  4PWC A;  2FCQ A;  9ICL A;  1BPZ A;  1S7M A;  5AE3 A;  3GU3 A;  2J6T A;  2WOV A;  5ALZ A;  2CJN A;  3WKD A;  2K0P A;  2MJE A;  2WQY B;  3MHS D;  4OZC A;  2MSE D;  1R4N B;  3W1Y A;  1D4B A;  4PZN A;  2RQ5 A;  2BKE A;  2XID A;  2N1V A;  3V5C A;  5ALI A;  1LQB A;  4H1Z A;  4J1O A;  4ADW A;  4HJK A;  4C7Y A;  4YN4 A;  2ASD A;  3KWV A;  4GDL A;  4DOB A;  4QW9 A;  5ALQ A;  3RJF A;  2O3G A;  1L4D B;  3IG3 A;  3VCN A;  2KK0 A;  2KVZ A;  2AGQ A;  9ICE A;  1MG4 A;  3H4B A;  2JXJ A;  4JAY A;  3SR6 B;  2KMD A;  5AZF A;  3APD A;  1QF6 A;  4GLX A;  3DOW A;  2L83 A;  4EEL A;  4R64 A;  3NHE B;  4XA5 A;  1PVR A;  4NQK E;  1I35 A;  2LEK A;  3PZD A;  3DVN V;  3A4R A;  5ALF A;  2BVF A;  1IV8 A;  1GRH A;  1D8Y A;  3VFC A;  5ALK A;  2GMI C;  4MJS A;  1AHZ A;  4EQS A;  4RGM A;  2UUV A;  1P48 A;  3CP8 A;  7ICN A;  1W1S A;  2HOQ A;  2KK8 A;  4NAW A;  2QJJ A;  3AE4 B;  1WYW B;  5TIS U;  5EWG A;  3R9K A;  2LJI A;  2J0M A;  2EQ8 A;  4WJQ A;  2LI6 A;  3GIK A;  2VZK B;  2G5I B;  4Y2J A;  4UB3 A;  8ICS A;  1R7S A;  2N7D A;  1NDD A;  3WA0 A;  2WP6 A;  5L6F A;  2NRT A;  4DQQ A;  1L3U A;  1PK3 A;  4KV2 A;  2FMS A;  2JRZ A;  3PFR A;  2K8A A;  5DPS A;  2Q5W D;  3X23 A;  4I2F A;  1UPH A;  1M4V A;  2GH5 A;  4KGS A;  3PX6 A;  5BMG A;  3L17 A;  4LNO A;  2BGW A;  1X9M A;  1D8B A;  2EQ9 A;  2JVC A;  5L1M A;  4Z17 A;  1NBF C;  3HVZ A;  3LDA A;  5IIN A;  2NBU A;  3NGD A;  2GRT A;  2HQM A;  1GET A;  4HCN B;  1Z19 A;  4FS1 A;  2C60 A;  1N56 A;  3ALR A;  2AQ1 B;  5FMH A;  5KG4 A;  1MPE A;  4UQG A;  1OQQ A;  3KLS X;  1DGS A;  1S0N A;  4KIK B;  1FNU A;  1XO1 A;  3ZDM C;  3SAF A;  1PDZ A;  4C0Z A;  9ICR A;  4I2H A;  5IN7 A;  2MUT A;  2YEP F;  2AJQ A;  2W43 A;  1WZ0 A;  3D2Q A;  2NPX A;  1E8W A;  1FEA A;  4FO6 A;  2Y1I A;  2VFR A;  2F3N A;  2LM4 A;  2ZIV B;  1TYG B;  5IO9 A;  1I19 A;  1CI4 A;  2NRV A;  3HP6 A;  1ZQR A;  4YWS A;  4Y2U A;  5JHA A;  1QZE A;  1ZR6 A;  3T9P A;  3IHQ B;  1ZXH A;  1ZMD A;  8ICC A;  2PA6 A;  3DGZ A;  5AK4 A;  3JPO A;  1WUD A;  4XWW A;  2DW6 A;  5HHI A;  2IHN A;  3DG3 A;  3U9I A;  3BZK A;  1BPB A;  1UT8 A;  3R1Z A;  2XH7 A;  4G9B A;  2CU1 A;  4I2E A;  3JPS A;  4CQN A;  3IFW B;  2K89 A;  3STP A;  4F71 A;  1WX9 A;  3RNF C;  5AI9 A;  3UJ2 A;  4MDK E;  1QQ6 A;  4US9 A;  9ICV A;  2RK5 A;  1FXI A;  2EMT A;  4KLF A;  1MN8 A;  4RNM A;  2PE6 B;  2DL0 A;  1O08 A;  2JT4 B;  1GAQ B;  1T0R C;  1ZQI A;  2HHS A;  1V2Y A;  5J17 A;  1C1Y B;  2D11 A;  2IO0 B;  3N3K B;  2Z7J A;  1UHU A;  3A0B U;  3DES A;  2E1E A;  3C2L A;  2K4P A;  1SKR A;  4O3S A;  4NZL B;  1JAL A;  5J2J A;  1UWX A;  3KH0 A;  4NJ6 A;  2DZK A;  2ONE A;  3RRH A;  4R66 A;  2BVG A;  2R8H A;  1R4M B;  1ZJN A;  2KZM A;  3KKA A;  9ICA A;  1QQR A;  2ZXH A;  3PX4 A;  2I1K A;  1NEL A;  4DNS A;  4GDK B;  3U52 E;  2OCE A;  4MEL A;  3W9C B;  2V1Y A;  5KFQ A;  5ALM A;  4UD8 A;  3AE1 B;  5IIO A;  3JW0 X;  5KFS A;  2PP3 A;  2LBO A;  3FYY A;  1EF1 A;  4DQI A;  1SE3 A;  1L8P A;  1WXM A;  3DHH C;  3EFC A;  3UGV A;  2AL2 A;  2OM6 A;  2LFI A;  3C29 A;  3RMK C;  2PJH A;  3M1Y A;  3SBF A;  3UIO B;  3Q6J A;  5JCL A;  3OSN A;  4FP1 A;  2INC C;  3GIM A;  1SBB B;  5KTQ A;  5DQI A;  1E8Y A;  4MMW A;  3RR1 A;  1KN0 A;  5KFE A;  2A3V A;  4BUR A;  3QUQ A;  4YSY B;  4PVJ A;  4QWD A;  2CHR A;  2ZIW A;  3MUC A;  3R7R A;  4ZRQ A;  3ISC A;  3ZGZ A;  5KG0 A;  2B3A A;  3N6H A;  4B6W A;  2MP2 A;  3MFI A;  4UAU A;  4P1B C;  4AOF A;  5BMI A;  5J18 A;  2V0G A;  1BKH A;  3WCQ A;  1HEK A;  2PTL A;  5KFJ A;  1DK3 A;  3FWA A;  4NEW A;  3V6C B;  2ODG A;  1CJE A;  4IWQ A;  4YWG G;  2L3Z A;  8ICO A;  4FA6 A;  2V4L A;  1KW4 A;  3BZC A;  4IR1 A;  2K8H A;  4FDC B;  4DWI A;  1KKX A;  5FS9 A;  7ICF A;  3KVF B;  2W0H A;  5AUI A;  1F9C A;  5DBA A;  2M17 A;  3SQP A;  3TFR A;  4ECY A;  1E7V A;  2VIX A;  4I27 A;  5III A;  3R0K A;  4LNF A;  4DXF A;  4E6M A;  4YMN A;  3QLD A;  5J2K A;  2XGP A;  5HKH A;  2FYM A;  1ZQK A;  1JWS D;  2ZCC A;  5GXG B;  4NEV A;  2P3Z A;  3N4F A;  2OOB B;  1JIH A;  3KHR A;  8ICL A;  2XVT A;  3VUW A;  2WAQ C;  1OQY A;  3W1S A;  3Q8P B;  3F2B A;  1SV0 C;  2CPR A;  5DQG A;  5DLG A;  4Y2P A;  1KRH A;  2YB1 A;  2KT7 A;  4P0Q A;  4OZA A;  3I6T A;  2NO5 A;  4ARI A;  2IO3 B;  1GRA A;  1PVP A;  4KZC A;  3VA8 A;  3WAM A;  2KJR A;  4BKS A;  3C2K A;  4KKJ A;  3DQV A;  3ORY A;  2BQ3 A;  1ENF A;  2BC1 A;  4XZ4 A;  2BPG A;  3H40 A;  5GTI U;  1BNO A;  3B0Y A;  4I2C A;  3MJW A;  3RNG C;  2PW9 A;  1H8C A;  4J3Z A;  2MBO A;  2K60 A;  4O0I A;  1TE6 A;  1ZOL A;  4PL1 A;  4R65 A;  3M8S A;  1L5P A;  1FEC A;  3H8W A;  4UAV A;  2N0S B;  3QEA Z;  2I5H A;  2FLP A;  3BWU D;  4DFD A;  2XCP A;  1SV0 A;  2WXI A;  5J2G A;  3Q8B A;  4IT1 A;  4EZ9 A;  4W9K A;  5HHD G;  3H0M B;  3NG0 A;  3P2B A;  2H3Z A;  1D5Z C;  4F7Z A;  2VFS A;  2WF9 A;  2NBV B;  5KT3 A;  2JXT A;  2JV3 A;  3EJD B;  3IJQ A;  2WXO A;  3BS5 B;  3FYH A;  4DCC A;  1SIF A;  2CHX A;  2GDQ A;  2GOW A;  4GLS C;  3HW8 A;  3MR3 A;  1NK4 A;  1KQQ A;  1X42 A;  9ICN A;  1XDI A;  2Z8L A;  2X8H A;  4DFK A;  4YMO A;  2R9Z A;  4Z6F A;  4PHA A;  4HVB A;  3CW2 C;  3S6J A;  2PGW A;  3MGI A;  2FIF A;  5KFF A;  3BYY B;  3L5O A;  3MDC A;  3HWT A;  1J7B A;  1GRT A;  1J7C A;  1SKW A;  3NS1 A;  2G4D B;  1P7F A;  4DWF A;  1UA1 A;  4FZM A;  3SV4 A;  3GD6 A;  8ICU A;  4BJQ A;  1GES A;  1V49 A;  1RRB A;  8ICQ A;  2DZI A;  5C0Y A;  2J52 A;  3QU5 A;  1ZQP A;  1KFY B;  1ZDX A;  3L8K A;  5HQX A;  5AKL A;  2BT6 A;  4DX3 A;  4WWO A;  9ICQ A;  4HLE A;  4QNL A;  2KFN A;  1WJ4 A;  4AS1 A;  1ZX9 A;  1SJE D;  2M56 B;  2GR3 A;  2YAU A;  3AV8 A;  1ZQD A;  3D2N A;  2O2V A;  4P1C C;  4LVS A;  3S1F A;  5DB7 A;  1WXS A;  1V9P A;  1N5W C;  1TYP A;  3TW9 A;  1SL1 A;  2XCA A;  1NKB A;  4IG7 B;  1HZ6 A;  4DHG A;  2WDW A;  1L3S A;  3P42 A;  2RPV A;  4KN7 A;  5KFM A;  2F5Z A;  1RLF A;  2IND C;  1IXR A;  2FLN A;  1FCL A;  2KMM A;  1EBH A;  1BXT A;  1LVL A;  5E6P A;  5FJU A;  5DDY A;  1HTO A;  4WJ3 B;  4A6G A;  2QB0 B;  1FO4 A;  3RR7 A;  2X50 A;  3AE3 B;  2P66 A;  4EX6 A;  2UU7 A;  3Q8L A;  2HW3 A;  4NJC A;  1ET9 A;  1ESF A;  5HR6 A;  4J03 A;  4RQ7 A;  2D5G A;  3A7A A;  2BDU A;  4IOI E;  4ZH4 A;  1YQ3 B;  4QZF A;  2O6K A;  3SZ2 A;  2RLT A;  5G55 A;  3DVG X;  4G3I A;  3NJT A;  3G6X A;  2G08 A;  3CT2 A;  1JMS A;  3UCD A;  2RP5 A;  4QZH A;  3K1Z A;  4ED2 A;  2KDM A;  5KT6 A;  2M0A A;  4OW0 A;  2VAO A;  2EDU A;  1DOY A;  4APN A;  4PVK A;  7ICV A;  2L52 A;  2QJL A;  4RGT A;  4TQ1 A;  2KG5 A;  3MC8 A;  4RCO A;  3OLM D;  1ZXI C;  3SJN A;  1CQV A;  4HEA 1;  5ALE A;  3SYZ A;  2XC9 A;  2N7J A;  5CHW A;  4MGI E;  4OVZ A;  3LAD A;  3VDG A;  3C1Y A;  4KDL B;  5J2H A;  1T0Y A;  3N1X C;  2PU0 A;  1W1R A;  4QW8 A;  3ZRC A;  1F0X A;  1WJN A;  3FKY A;  3V05 A;  3BQ7 A;  4H4W A;  2GO7 A;  3CAW A;  1TZ1 A;  2WOI A;  3AEV A;  2O6V A;  4WWM A;  3KUZ A;  4YVZ A;  2RMM A;  3H0L B;  5AKY A;  4HPL B;  1EC9 A;  4YL8 A;  2ZZP B;  1SSN A;  4C56 C;  3S1E A;  4IL0 A;  4O5E A;  1Q46 A;  1CZP A;  3CMM B;  4ANX A;  5EU9 A;  1UNS A;  4EM4 A;  2HCF A;  4PL2 A;  3Q3N C;  1KEJ A;  3D47 A;  3DBL I;  3RJH A;  2QEJ C;  2RGF A;  4PZO A;  1P0R A;  3KHG A;  4MM3 A;  1BVS A;  2WTF A;  1KLG D;  2ZG6 A;  5KFU A;  4KLH A;  1TKE A;  2Y5P A;  3DWM A;  2HBM A;  1WMH B;  4PYZ A;  3GOE A;  5AK5 A;  5AEK B;  1BML C;  2CN1 A;  3VCB A;  2TPR A;  1J97 A;  1C77 A;  1EC8 A;  3BSM A;  4B0M A;  1ZQA A;  4QIW F;  4F5N A;  3EF6 A;  5DQH A;  2KAC A;  4FAD A;  4O3N A;  1ZRM A;  4YSZ B;  3OTR A;  2R61 A;  4EYH B;  3NZ3 A;  4TUP A;  4MEY A;  1TKY A;  4FE3 A;  1RM6 C;  2BCQ A;  3L10 B;  3OSP A;  3VC5 A;  3LAE A;  4YT0 B;  3AB5 A;  4AYB F;  5MPO A;  1QOB A;  4BC7 A;  2OJW A;  2PMZ F;  1ZQT A;  3PW4 A;  3RZW C;  4M0W B;  3HX0 A;  1VR9 A;  2OYY A;  4B9N A;  3FC4 A;  4M9H A;  1TVA A;  4I6P A;  5LXH A;  1TFR A;  4F8R A;  3UQA A;  5FXF A;  4QWA A;  2LHE A;  1JWM D;  2LMC A;  2KZZ A;  3DVG Y;  1JPM A;  3KLJ A;  4WJP A;  4WJO A;  1X40 A;  4NJ7 A;  2EKI A;  4NPN A;  4NWI A;  1IBX B;  2WP9 B;  3HKZ F;  1WR1 A;  1UT5 A;  3NZU A;  3V60 A;  2WF6 A;  3GZF A;  3HHM A;  4TUU A;  4DDI D;  1E8H A;  4H19 A;  4EQR A;  2KHQ A;  2KMC A;  2XGZ A;  3DBH B;  5AIC A;  3N7P D;  4UAW A;  3JSV B;  1KFT A;  3VVW B;  2ZZ0 A;  2WLB A;  4EC3 A;  3JVA A;  3WKB A;  1XEE A;  1N60 A;  2QVH A;  2RHF A;  1K1S A;  2C2E A;  1I4G A;  1F5S A;  2QMT A;  4P16 A;  1RPL A;  4N9F 4;  2ZTD A;  3Q3F A;  4DBG A;  4XLO A;  3QUB A;  3GRT A;  1WWU A;  1YZ7 A;  2YMM A;  3K75 D;  2RDJ A;  3PW5 A;  2K8C B;  2WNM A;  2Y1J A;  3ML8 A;  3IJL A;  1NK6 A;  1FFV A;  3UCC A;  4HCL A;  4IQT A;  1F1H A;  1MOK A;  1VDV A;  1YEY A;  1SWW A;  1F52 A;  1V97 A;  3V7L A;  5DG8 A;  3BVM A;  5L1L A;  3ZD8 A;  4GGB A;  2PKE A;  1VZ7 A;  4HJG E;  1GV4 A;  3PPA A;  3ZJU A;  1GPX A;  1T5X D;  1S9F A;  3CSF A;  3RNC C;  3LB8 C;  1PUZ A;  4M52 A;  2JXX A;  4YSX B;  1FEH A;  5T8I A;  4IR9 A;  2F1H A;  1SJB A;  3NUQ A;  2EAN A;  5ALV A;  2HJ1 A;  4FZL A;  2GWS A;  2KO3 A;  1VLB A;  3NRW A;  2CU3 A;  2J7Q B;  1R6W A;  5EE0 A;  1COK A;  2A8X A;  3QPE A;  3PO4 A;  4M9J A;  5IIM A;  4KLQ A;  2FNJ B;  3P4Q B;  2OQY A;  4RZR A;  4Q44 A;  2I9G A;  8ICM A;  9ICI A;  2WXK A;  4DXK A;  3APC A;  2WPE A;  2LYH A;  4LII A;  5KAF U;  4ZYN A;  1TGZ B;  1FIQ B;  2GRI A;  1IUE A;  1VJ5 A;  3DDC B;  2HVH A;  1V81 A;  2MBB B;  3RJ8 A;  3T6C A;  3GZN B;  4IQU A;  5DBC A;  4Q43 A;  5J0Y A;  1NYR A;  2V4Q A;  1SF0 A;  1WWV A;  1WGY A;  3MP9 A;  1DXS A;  5G5H B;  1YN3 A;  1UGJ A;  3PML A;  4JB3 A;  2VA2 A;  2V9W A;  1V80 A;  1W1J A;  2GBK A;  1IM4 A;  4RF1 A;  4J9S A;  2K5P A;  4KSK C;  1GNU A;  2PU1 A;  2H88 B;  2F76 X;  1LKY A;  4REZ A;  1PFD A;  4I2J A;  1ED1 A;  2KOB A;  2ZCB A;  3TJ4 A;  4L1B A;  4IRK A;  2BQU A;  5D6J B;  3NXL A;  2JRH A;  5BYR A;  4NLK A;  1JQ4 A;  1NK0 A;  5GTH U;  4Z6E A;  3JPQ A;  3ZNG C;  4AUQ C;  4E4U A;  5CB1 A;  1J19 A;  5IP4 D;  3PM9 A;  5JCM A;  1HE8 A;  1BPE A;  1L3V A;  5HG2 A;  4JB1 A;  2CFY A;  2WFA A;  5J0T A;  3Q14 C;  3WK5 A;  2C5L C;  3ZTD A;  1MRA A;  2RSU A;  1E8G A;  2X8G A;  3Q3J A;  7ICT A;  3RIT A;  3I3T B;  5C3J B;  1QKZ A;  3F53 A;  4ZDV A;  2XY7 A;  3LWM A;  5K4L A;  8ICW A;  1E10 A;  2WYQ A;  4EYI B;  4DSE A;  1L3T A;  1W1Q A;  2LGS A;  2M4N A;  4XX5 A;  5TR5 A;  4LNN A;  3V6J A;  4LCD E;  4D2K A;  4EOY A;  4MF2 A;  2AKM A;  3J9C A;  3OPS A;  1STE A;  4C4T A;  3EC8 A;  3NUH B;  3KUM A;  2JZB B;  3TJP A;  2Y9T A;  1K8R B;  4I6L B;  2HDO A;  2VAN A;  3TAD A;  2HD5 B;  4RFB A;  1W1K A;  3ENE A;  2NVU I;  1ZE3 D;  3DDM A;  3RNE C;  4MF8 A;  1ZDL A;  4BKG A;  5I1W A;  2UVV A;  1UBQ A;  3CNH A;  8ICN A;  1F44 A;  7ICP A;  1ZP0 B;  3N9Y C;  3U4E G;  1P43 A;  3VC6 A;  1J8C A;  3EAN A;  2HTM E;  1WX7 A;  2AQ3 B;  1GRE A;  1HA5 A;  4PZF A;  3SD7 A;  3U26 A;  2XO7 A;  4M0A A;  4O3R A;  4N6E B;  4NNJ B;  4F72 A;  2JK6 A;  2WXF A;  3A9J A;  2V9H A;  5E6N A;  4AJY B;  5CWR A;  4OD0 A;  4I29 A;  4YR0 A;  2KVS A;  2ISP A;  2P88 A;  3AE5 B;  1WX8 A;  1S0V A;  3OP2 A;  1DGJ A;  3RF9 A;  1KN5 A;  1YJ1 A;  3V72 A;  3FW9 A;  1P3Q U;  4YP3 A;  9ICG A;  1GER A;  2PTW A;  4FBU A;  4OO1 J;  1TJE A;  1ROE A;  1C9F A;  3DPD A;  3KJM A;  3D6J A;  4IP4 A;  8ICB A;  1S1Q B;  5L95 C;  3ZLZ A;  2BVH A;  4GYP C;  5ADZ A;  2WP5 A;  3R10 A;  7ICQ A;  2RRD A;  1FXA A;  1Q10 A;  2LGD A;  1PUT A;  5DGB A;  1Y88 A;  3AQE A;  3KFU F;  2OWO A;  4RQ4 A;  3DG7 A;  3EA6 A;  2GH1 A;  3QN3 A;  4GRT A;  1Q8K A;  4EZ6 A;  2QKN A;  1BQG A;  2JUO A;  5CJ7 A;  2LVO A;  3NAS A;  4L23 A;  4HAI A;  4EMW A;  1K50 A;  2REX A;  5J2F A;  3IN5 A;  2ZUC A;  1SKS A;  3DHG C;  2LUE A;  1MDR A;  2EAO A;  3C21 A;  1T3N A;  3BYT B;  3V6K A;  5ALY A;  4IC9 A;  4RQM A;  4UAS A;  2Y0S F;  4QZC A;  1SE9 A;  2KYW A;  2LXA A;  3RB3 A;  4UB1 A;  1D9D A;  1H38 A;  3QWZ B;  4BFR A;  4UB6 U;  4NQL B;  3NRZ A;  2C3D A;  4M0X A;  4RF0 A;  4IQW A;  3Q8K A;  3NY5 A;  3QHT A;  3GFK B;  4KDI C;  4PVE A;  4DL2 A;  2DAF A;  1QH9 A;  5EOZ A;  2KZR A;  2KMA A;  4IWO A;  4MGY E;  3UF8 A;  4OAL A;  1K5O A;  3OHB A;  4GGH A;  4ACO A;  4FJY A;  2B6G A;  4NLB A;  2HNE A;  2JQR B;  3DIP A;  2C22 A;  1UA0 A;  1I7H A;  2E8P A;  3RTV A;  1TE2 A;  3KBB A;  5IAA C;  3W5V B;  2QLT A;  2RAB A;  1ZD4 A;  1C76 A;  2KHV A;  3BQ2 A;  1WUF A;  4I28 A;  2MBE A;  3TFS A;  1C4P A;  2KKV A;  2JSV X;  1GRG A;  4A55 A;  1MDL A;  4M9G A;  5ALH A;  3MDA A;  1XC9 A;  2OLA A;  2PP0 A;  4DL7 A;  2WOW A;  4BUG A;  1U48 A;  1NNL A;  4N58 A;  2WDQ B;  2E5A A;  2QHO A;  4JQW C;  2XH0 A;  3PRZ A;  2KQ4 X;  2FPM A;  2GLE A;  2RDX A;  2VJ5 A;  1LXD A;  1NOM A;  2E3T A;  1FRD A;  2KX3 A;  3DJG X;  2PPH A;  1JPD X;  3L4P A;  3N7S C;  2Y0S C;  4UBB A;  2JH1 A;  7ICH A;  4PYT A;  4KT2 A;  2JZZ A;  2HXT A;  2FMQ A;  1VJK A;  2KLC A;  4A20 A;  5FXE A;  1XAN A;  4JHM A;  4H4Z A;  1WZ3 A;  1ZMC A;  3LXD A;  3PO5 A;  5DB6 A;  4YQW A;  2W8L A;  2YMQ A;  2K8B A;  1QCK A;  3OJ3 A;  5BYS A;  1VQZ A;  4ANV A;  1S77 D;  1W1O A;  4HG0 A;  1QT9 A;  2HMX A;  3SFE B;  1MJD A;  3DVN U;  3QEB Z;  1GXF A;  2QQ6 A;  2JMG A;  3QKE A;  3AE7 B;  2MJD A;  4C80 A;  3VR9 B;  3BQ1 A;  1KDH A;  5D7G A;  1GB4 A;  2MEK A;  4O1N A;  2XK5 A;  3P0W A;  4O5C A;  2VFV A;  1G6J A;  1WGH A;  5ALR A;  2MUC A;  3FVD A;  2GGG A;  4LNK A;  1PGX A;  1ZKQ A;  1H2I A;  2FKP A;  2QB1 A;  3IAS 1;  3K1R B;  2C2R A;  4H83 A;  5KG7 A;  1KH0 A;  1MC8 A;  4ZRP A;  2W3R A;  5GMV A;  1JXE A;  4DFM A;  4FLH A;  1L7Y A;  2IGG A;  4OVU A;  4FS2 A;  1STZ A;  2AAQ A;  2HVI A;  4O3O A;  3D46 A;  2KSO B;  4DSL A;  3UIN B;  1KLU D;  4LJX A;  2W9B A;  2KIV A;  2BHN A;  3V6H A;  4F5O A;  1WY8 A;  3SHQ A;  1DXL A;  3WIM A;  1ISN A;  3QFA A;  2KN7 A;  4IDI A;  2DPI A;  5CX3 A;  5C5J A;  3NZS A;  2ZIU A;  3MFH A;  2BDP A;  2GI9 A;  1MO9 A;  2H3F A;  1XS9 D;  1NDA A;  2WPC A;  4TSS A;  3BS7 A;  1RXW A;  4ENL A;  3GIL A;  4EQW A;  4ELU A;  1ONF A;  4M8N A;  3KUD B;  2X38 A;  2J6S A;  1SXD A;  5J0S A;  3LWL A;  2G1E A;  1GRB A;  3CB3 A;  4K2S A;  3LK9 A;  3HUI A;  2QAR B;  4PK1 A;  1ZQL A;  1A6S A;  4YR2 A;  1KLV A;  2XY5 A;  1KM7 A;  4HCP B;  5L6G A;  3A9K A;  3THV A;  3BW7 A;  2XH4 A;  3I6E A;  4HNL A;  2H5X A;  1C4C A;  4BXO B;  2V3P A;  4WIP A;  2VFT A;  1XSN A;  1JW9 D;  1YNT E;  2WXM A;  3OJ4 B;  4XWT A;  2LYB A;  1C7Y A;  1TK5 A;  3DEE A;  5EE3 A;  3TAP A;  1EWY C;  4GGQ A;  1X2G A;  4P0P B;  4M00 A;  2PP1 A;  1YOV B;  1EU4 A;  4EEK A;  9ICU A;  2IO2 B;  4ELV A;  3AEG B;  4F5P A;  3TEW A;  2DF4 B;  4FBJ B;  2W9C A;  3B9J B;  4CO7 A;  2GBJ A;  2P13 A;  4I2B A;  2ZNV B;  4BOS C;  2KJ9 A;  2PI5 A;  4RH6 A;  1KSP A;  1WYG A;  3GE8 C;  3R66 C;  2GGI A;  4Y2T A;  3GII A;  1I4Q A;  2BVC A;  2KVR A;  3PT2 B;  3AEF B;  4NL9 A;  4JWS C;  4F3O A;  3H4D A;  4B9V A;  3BQT A;  1IP9 A;  1QOF A;  5ALJ A;  5J0O A;  3PVX A;  4CYE A;  2IPI A;  4F4W A;  2F44 A;  3RJI A;  5DGA A;  3I28 A;  5AM5 A;  3KYC D;  4W9J A;  3BOX A;  2R2Z A;  3OPX A;  3RJE A;  4QZD A;  1TAQ A;  4ECZ A;  4WQM A;  1F8W A;  4NV0 A;  1Q1O A;  3PO0 A;  1NPX A;  2IOF A;  2BS2 B;  1NZP A;  3TSS A;  3T5J A;  5DLF A;  1N61 A;  1ZPS A;  2R8D A;  4CDG A;  4QJF B;  2PEA A;  3C0R B;  4KX6 B;  4RNN A;  3QZ8 A;  1RYJ A;  3RJJ A;  3FIL B;  2HBJ A;  4ANW A;  3VUX A;  4Y2V A;  2K6Q A;  3FCP A;  2KAN A;  4MFF A;  3KKA C;  3DK9 A;  1VZ8 A;  3AE9 B;  3ISB A;  5JH5 C;  8ICK A;  1IPG A;  5FK9 C;  7ICI A;  2NQL A;  5U1O A;  8ICJ A;  3SAH A;  3VR8 B;  2KN4 A;  3N32 A;  2FDR A;  1RYS A;  3ZUN A;  4OJO A;  4ECW A;  4ECU A;  5DG7 A;  4LDT B;  1J2M A;  1EU3 A;  2W55 A;  5KFI A;  1N63 A;  4FXC A;  4W9G A;  1FEZ A;  2DYO A;  4JV1 A;  4EBD A;  3HK0 A;  4ROP A;  1P98 A;  2HOI A;  1LGR A;  1NVI D;  2ZVO A;  2KJ8 A;  3QZ7 A;  3H8H A;  1JWA D;  5L1K A;  1WFY A;  1SXE A;  3KHL A;  1NYQ A;  4WWP A;  2C3C A;  2XI9 A;  5IA7 A;  5KL1 B;  4NAW B;  1DTN A;  4EBE A;  4MKS A;  1L5U A;  3EZ5 A;  1WXV A;  5HNK A;  2XY6 A;  4KLS A;  2Q0Z X;  4PWB A;  4GXI A;  3A7R A;  3AU4 A;  1YJJ A;  3KQ4 A;  4ECQ A;  5KG6 A;  2ICI A;  1QLB B;  2D3D A;  3TQ1 A;  1V5O A;  1EXN A;  1IG6 A;  1Z5S B;  3S2A A;  1XU4 A;  4DQO C;  4S0R A;  4GIB A;  4BX9 C;  4M47 A;  2WXH A;  4C8N A;  1UBI A;  1VCB A;  1M6I A;  2NPT B;  2WAQ F;  2E8N A;  4ITK A;  4JPS A;  1F2R I;  5C1Z A;  4J57 A;  3DV9 A;  3DFY A;  3DG6 A;  1FD6 A;  2OHF A;  4GXK A;  4EUT A;  2GLS A;  5AI0 A;  2K4E A;  4I6N B;  2D3C A;  3JZU A;  5AHX A;  3LJ3 A;  4H4U A;  8ICE A;  3DJJ A;  2FPK A;  4A6Q A;  1FHU A;  2HHW A;  3Q4D A;  1RQL A;  1ONE A;  2FUH B;  3OAW A;  2MSN A;  1RG6 A;  3W1S C;  2BYT A;  2R8K A;  3EJE B;  1CUK A;  1XO0 A;  1OJT A;  2PI4 A;  5KFX A;  1DZN A;  3H8A A;  5IDZ A;  2B0C A;  4YXJ A;  2BC0 A;  2MLB A;  3T4W A;  2MUT B;  2VA3 A;  4CNQ A;  3C5F A;  4K3B A;  4HCD A;  2QIE B;  2KIC A;  5KFZ A;  4E0D A;  3MR5 A;  2LYA A;  1TTN A;  2QIL A;  4RGN A;  1ZQH A;  4CF4 A;  4ACF A;  1JOA A;  4GIV A;  2V3B A;  4BKS D;  3CXB A;  1A70 A;  1EM7 A;  3T79 A;  1JWU D;  4KLD A;  2C2D A;  3APF A;  4RM8 A;  4EZJ A;  3PW7 A;  1I4X A;  2MBR A;  2QDE A;  3TQP A;  2EQ6 A;  2D3B A;  3MTN B;  5AI4 A;  4H50 A;  2NVK X;  4RQ3 A;  1PYW D;  3JYU A;  3ZDE A;  1KRP A;  2JRI B;  1BZL A;  5DPW A;  1D3Z A;  2A19 A;  2AL1 A;  4IUM B;  2WXL A;  4H4Y A;  1ZKH A;  1XSL A;  2DX5 B;  2B76 B;  4KKI A;  2OXO A;  3H70 A;  4H2H A;  1WXQ A;  1VD2 A;  3Q8C A;  5FKA C;  4OVV A;  1BWC A;  3GS2 A;  2R8J A;  2ES6 A;  2ZEQ A;  2WB1 F;  1N5X A;  3QCA A;  4XGA B;  4KPR A;  3GIJ A;  3PRP B;  1KFS A;  1D7Y A;  3PWI A;  4ELT A;  1Z00 A;  1KJT A;  5DB8 A;  2L5Y A;  2KFK A;  5GRT A;  1X1M A;  1EO6 A;  4R8U B;  4PHE A;  1BNP A;  5EBK A;  3UMC A;  3R07 C;  4MHV A;  2ASQ A;  1SV4 A;  5B66 U;  1E5W A;  2P4P A;  3VTV A;  4P4M A;  1JX4 A;  3RO6 A;  3QUC A;  4C4R A;  3B2G A;  3M95 A;  5J0P A;  2F1J A;  1ZQO A;  2MX2 A;  4BKT A;  1EBG A;  4GOC A;  3HPF A;  4BDP A;  3HIZ A;  4H4S A;  3RUI B;  8ICA A;  4DO9 A;  3I57 A;  3VH4 B;  3PV1 A;  5KG2 A;  3SAG A;  4B95 A;  1NEK B;  3QIJ A;  5J04 A;  3R2I A;  4B9T A;  4YMM A;  1Y8R C;  3T3N A;  8ICV A;  2WDR B;  2DHZ A;  1MBB A;  1NI3 A;  1S76 D;  4PGY A;  3UMG A;  2WU5 B;  2K22 A;  3OC4 A;  1U4A A;  4PHD A;  5C23 A;  5CA7 A;  3EWA A;  2JYT A;  2I1Q A;  4LJO B;  2YTU A;  3R2T A;  2G9H D;  4H4P A;  3OZY A;  2KEY A;  3T8Q A;  1MHH E;  2YB4 A;  3SV3 A;  3E9S A;  2ZZB A;  2BPF A;  4KLG A;  1MI0 A;  4IP5 A;  3HM3 A;  4W9D A;  2LJ5 A;  2WB1 C;  3JPT A;  3P1M A;  1KL9 A;  3Q8Q B;  2VRR B;  2YEP B;  3EGR A;  4Y2X A;  3N7R C;  3S1C A;  1ARO P;  4GC6 A;  2JWU A;  3DHI C;  2CR5 A;  1AHV A;  3CGC A;  1L8O A;  2KNJ A;  1NEN B;  3GP7 A;  2ZIW B;  1E7U A;  2X8C A;  3W2D A;  2WF8 A;  2K1F A;  2I2Y A;  4JQ9 A;  5D2M B;  3OJS A;  2MBH A;  4DL6 A;  2WF7 A;  3JPP A;  3U4F A;  3PGE A;  4C7Z A;  4IS7 A;  4NLZ A;  1PZN A;  4F1S A;  1YIW A;  1MNS A;  4YR3 A;  3U7Z A;  2EQY A;  1RZT A;  4C8L A;  4PHP A;  2KDB A;  2FLL A;  3TEZ A;  3CF6 E;  3VUY A;  3QQ8 B;  2ATL A;  1F2R C;  1ZQY A;  5I1V A;  2DFL A;  9ICX A;  1UZX B;  4JL9 A;  1KCZ A;  4Q45 A;  5HMM A;  3M8R A;  3KTQ A;  3W8W A;  4K8D A;  3RRA A;  2G5H B;  2Y4G A;  1WGK A;  2K4H A;  5TSS A;  3Q8A A;  3SEI A;  2KTQ A;  1SGH A;  2CHW A;  4I2A A;  2ZTC A;  2IMW P;  3GDX A;  2CS4 A;  1SL0 A;  1I4R A;  1YT3 A;  3RJG A;  1N2X A;  8ICF A;  4DK5 A;  3JVZ X;  2VKQ A;  2BZF A;  6ENL A;  2PTX A;  2MHJ A;  1XLQ A;  4FHJ A;  3HVD A;  5D4B A;  3N1Z C;  1JI7 A;  2HXU A;  1ECQ A;  5KFT A;  4ED0 A;  2XN9 C;  3UJR A;  2XGQ A;  3T5H A;  1AYF A;  5FR3 A;  3W8Z A;  3RH6 A;  1N6Z A;  2NTS A;  1XS2 A;  1AHU A;  4UAZ A;  1BPX A;  4A9A A;  3IK4 A;  2ZXI A;  4EE2 A;  1QIL A;  1NJZ A;  2QAE A;  2P3H A;  3CYM A;  1PVQ A;  2CHZ A;  2AGP A;  2FCM A;  3ZVI A;  3BY4 B;  3JSV A;  4ZRJ A;  4JLC A;  2KTR A;  3TWA A;  4J9K A;  5HR7 A;  2PFO A;  4EEN A;  3C28 A;  3P4R B;  3Q3O C;  1GOZ A;  1TS4 A;  2K9X A;  2KWU B;  2AL6 A;  4MSM B;  3PWG A;  3R25 A;  4DWD A;  8ICR A;  2HBK A;  4O95 A;  5CHF A;  1K51 A;  4RPY A;  2KD0 A;  3EUB 3;  2IOH A;  3DBR I;  5JUM A;  1OTR B;  3P4S B;  5F9L A;  4PJ0 U;  1RXV A;  3TJI A;  2A5U A;  3AE2 B;  1HJP A;  4YFK A;  2FMP A;  4RQ5 A;  2LRW A;  4J9P A;  2KC1 A;  2DGZ A;  2AQ4 A;  2HJ8 A;  3NVV B;  3AU5 A;  2Y9U A;  3BJS A;  2WXR A;  2FBW B;  4F93 B;  3L0W B;  2HHQ A;  2Y3A A;  3V62 A;  3ZLG A;  1RYR A;  5J0X A;  1GG3 A;  4G0N B;  4N59 A;  3SFD B;  3PRM B;  3R7Q A;  3I4K A;  5IOI A;  1Z2M A;  1S3S G;  5J8Y C;  2IY0 B;  5IIJ A;  2UYZ B;  4WQO B;  2GQT A;  3G6Y A;  4GC7 A;  2JEG A;  4NLG A;  3PVL A;  4A3P A;  1OEP A;  1WCL A;  2AWT A;  3EUB 2;  2E8O A;  2G06 A;  3EPI A;  1ZW7 A;  9ICB A;  1WRD B;  2QSD A;  3NS1 B;  3B0A A;  3BZD B;  3IT4 B;  3VAW A;  3QK0 A;  3RT3 B;  3C8Y A;  2W9M A;  4BBN F;  5AKG A;  2ZIX A;  1UGM A;  4PGQ A;  1ZQW A;  2I5Q A;  4G8T A;  1FEB A;  2L7R A;  3NVY A;  1XF5 L;  1QOG A;  2CXY A;  3NOB A;  3A33 B;  9ICM A;  1N60 C;  5ENL A;  4A8E A;  1PK1 A;  1FIQ A;  2KXJ A;  1L2N A;  2J3N A;  4JMU A;  1FXT B;  4ICV A;  1Q1R A;  1YQZ A;  1HIW A;  4Q8F A;  3OHA A;  4XRH A;  5JHB A;  2O2V B;  4EZK A;  3AEE B;  1VZ6 A;  2RDH A;  1FFV C;  1FCC C;  5FXD A;  1NHS A;  2W7P A;  2JGA A;  5J8Y A;  3CK5 A;  3MBY A;  3WKA A;  2UVW A;  2KWD A;  2YVJ A;  2XSX A;  3AI5 A;  2LGX A;  2EH9 A;  2L76 A;  2FE9 A;  2VJ4 A;  3Q8E A;  5KVH A;  3BVZ A;  3KW5 B;  1N62 C;  1YD8 U;  2DAJ A;  1EUV B;  3TKA A;  2BWF A;  5DPT A;  3UQ2 A;  4DXA B;  2GR2 A;  3ETR A;  4RNO A;  2GSH A;  4CRX A;  4OJL A;  1R4N I;  1SWV A;  4G50 A;  2LM1 A;  1QLU A;  5EE1 A;  1OFF A;  4C8K A;  1TT5 B;  3WAN A;  5KFB A;  3H12 A;  1E9I A;  1LB2 B;  1RDF A;  1QOA A;  4J9O A;  3RYT A;  3WAP A;  3ZJV A;  4Y2S A;  8ICI A;  2I38 A;  5IKC M;  4EMJ A;  3MAB A;  4JV0 A;  4TMA B;  2W8K A;  3QAR A;  2J6U A;  4BBN C;  4YWO A;  4TUR A;  5DDM A;  3ZDB A;  2W04 A;  2QC8 A;  1GJZ A;  2WU2 B;  1J7A A;  4J6I A;  1ZQ1 C;  5BOL A;  4W9C A;  4QWB A;  2ZJ5 A;  4FN2 A;  3S47 A;  2RR9 A;  5AUK A;  4YXD B;  3HIL A;  1GC6 A;  1F3P A;  4PPX A;  2PIA A;  5TZV A;  1ZYQ A;  4HPP A;  3VTW A;  4ZA0 A;  3ZXV A;  2WXQ A;  4EM3 A;  3QU4 A;  1N62 A;  5HI1 A;  3ABV B;  1RFK A;  3MHZ A;  3M9M B;  4MEX A;  1UH6 A;  2GQW A;  8ICZ A;  5ALS A;  4DS4 A;  4K1W A;  4A8X C;  2IGH A;  4YD2 A;  2O6V B;  3EKG A;  1K53 A;  4BVU C;  2KP7 A;  4CF3 A;  1ZQF A;  3HRD D;  2M19 A;  1UQV A;  1W1M A;  2BWE S;  3PMN A;  3N20 C;  4KMO B;  3QTP A;  3ZVH A;  3PSI A;  2A1J A;  3R8B A;  1QSY A;  4MM3 B;  2EQ7 A;  1XNS A;  3ZD9 A;  4NJ8 A;  2KLG A;  4UDU C;  2P6R A;  2K3U A;  2W54 A;  4OJP A;  4BWJ A;  3N30 A;  5ALL A;  1NJW A;  3TAN A;  1YQ4 B;  5D79 A;  3IG5 A;  3A1Q A;  4XQ8 A;  2HTH A;  4GMV A;  3PY8 A;  1L7O A;  3M9N B;  4ML8 A;  2LMR A;  2Y08 A;  3THU A;  5JRT A;  3C5G A;  3GV7 B;  1GC7 A;  2K25 A;  1BPY A;  1P7E A;  4J9L A;  2P8B A;  3ZNI D;  4F4Z A;  4X57 B;  1B4F A;  1ZQQ A;  5K8E A;  3DQ0 A;  3RNA C;  2JU6 X;  3K9O B;  2J4X A;  3PK7 A;  2J53 A;  4RQ6 A;  2KNB A;  2C7M B;  3DBS A;  3N28 A;  3TAD C;  4OZB A;  4RU9 A;  3IBE A;  4RNA A;  3RRG A;  3C0P A;  1XO3 A;  3PSP A;  1S0M A;  5J2C A;  4LNI A;  3GV8 B;  3M7D A;  3TAR A;  1DOQ A;  5AKJ A;  2PFQ A;  2XEW A;  3H7P B;  4K7U A;  4EWJ A;  3N1Y C;  4FX9 A;  3ISD A;  2IOF K;  1HEZ E;  2M9N A;  1KKR A;  2LAS A;  3BIN A;  1HUO A;  5G5G A;  4HN8 A;  1Q3V A;  4O9M A;  4B9S A;  2HOF A;  4M01 A;  4XDC A;  2CJO A;  1T3Q C;  3TMP B;  1RM6 B;  3S5S A;  3ZXR A;  3E2E A;  5DKW A;  1T8E A;  2EZY A;  5EWE A;  4M9L A;  3LDZ E;  3AU2 A;  2GOL A;  3R11 A;  3NVW B;  4JK1 A;  4U6P A;  4NM2 A;  3Q6B A;  1NHR A;  1MA7 A;  2OO6 A;  4PS8 A;  2JEI A;  4XC2 A;  4DSJ A;  3ZIM A;  2DPJ A;  1FNV A;  1XXG A;  4IW0 A;  2LKY A;  5BO4 B;  3RCZ A;  3VTE A;  4DF4 A;  4KLJ A;  4II2 B;  2PPG A;  2VH1 A;  5AZH A;  1B22 A;  1XLP A;  3HM6 X;  4ED8 A;  4H2A A;  5KFV A;  4XDD A;  2G07 A;  1WUE A;  3ALB A;  3SN4 A;  4ECV A;  4BOZ B;  1V85 A;  2YML A;  4LZD A;  2JEJ A;  5AE2 A;  3EFU A;  2GB1 A;  3T5L A;  8ICH A;  2G3Q B;  2M0X A;  3MR6 A;  2N1W A;  4DHJ D;  5KT5 A;  2NRX A;  2PLS A;  4KVG B;  2B21 A;  1F77 A;  2ACZ B;  3F5A A;  1R0M A;  1T3Q A;  2NO4 A;  2ZPY A;  4F4R A;  5AIB A;  5H2F U;  1SE4 A;  2LXC A;  1R4M I;  2ASL A;  3D2H A;  2FCS A;  2UVR A;  1ET6 A;  4MH0 E;  5KL8 B;  1XSP A;  4RUC A;  2DLB A;  3M62 B;  4E3C A;  4ECS A;  3CWI A;  1AOG A;  3Q8F A;  1EBD A;  3PR4 A;  1S10 A;  3SEN A;  1JRU A;  2YN4 A;  3F2D A;  2KDI A;  3NS8 A;  3O13 A;  3M6K A;  3URY A;  4MGK E;  2N4F A;  2WDT B;  2KVC A;  5KFH A;  3UXL A;  2LRU A;  3KYD D;  1H4R A;  2PTZ A;  3L13 A;  5BOM A;  4EEW A;  4DYE A;  2V4I B;  2I0K A;  2ZTE A;  2M0N A;  2J0K A;  2YX8 A;  4CHK A;  3FV9 A;  2LHT A;  1TKD A;  5AZG A;  2BTE A;  4EBC A;  1SJH D;  2CKH B;  1U45 A;  1X6J A;  3CGE A;  3IC9 A;  3A4S C;  2V3A A;  1GRF A;  3ZLF A;  2H89 B;  3KZX A;  4O5K A;  2YVS A;  3ES8 A;  5J29 A;  4NLC A;  1ZGU B;  4DFP A;  1J2N A;  1LKY B;  2W03 A;  4QZB A;  1D5X C;  2YQE A;  1WI0 A;  1WM2 A;  2INN E;  4P6V F;  1X2H A;  4F4Y A;  3TCS A;  3KZI U;  1K1Q A;  5J2D A;  3B0X A;  4Z6D A;  3PNC A;  3GQC A;  3G6V A;  3RH5 A;  3DCG A;  2VFU A;  1E6E B;  1UCV A;  2NR2 A;  4BV6 A;  3L54 A;  4DSK A;  2QDD A;  2BGF A;  1V6E A;  2L8J A;  3ICX A;  2IO1 B;  3OW1 A;  2L0T A;  4BC9 A;  1NK8 A;  3TOY A;  2P0I A;  2F8K A;  1ZDV A;  2RD0 A;  3SR6 A;  4DS5 A;  4LTU A;  2QJN A;  5KFY A;  1X9S A;  2KSO A;  5DB9 A;  1NJY A;  2BCU A;  2AX5 A;  5H92 C;  1B0X A;  5EWF A;  1TZO A;  1LV5 A;  4K4G A;  1KTK A;  1L7P A;  3N4M B;  1TS5 A;  2INP E;  3SD5 A;  1NK9 A;  3NVZ B;  4ZHO A;  5FS6 A;  1ZQV A;  2E5S A;  4DSI A;  1FPY A;  1WE6 A;  4ANU A;  2ZW0 A;  1NHP A;  1D8L A;  3V6E B;  2DNF A;  5AKE A;  3PV8 A;  1BUI C;  1Z1V A;  1WGR A;  4USA A;  2KHW B;  1NKE A;  3UXN A;  2KWV B;  5J2E A;  5J0R A;  2L00 B;  3UPQ A;  3VHT C;  3H4K A;  1TK8 A;  4DOC A;  4QWE A;  3OGU A;  4LLG M;  3P3B A;  4FI4 A;  3FDS A;  2HHV A;  1D5M C;  2WS3 B;  4FBT A;  3HW2 A;  3WKE A;  1KD0 A;  1F0Z A;  4C4V B;  2Z0D B;  3DBL B;  1PDX A;  3WAL A;  3RAX A;  3I5J C;  1QQ5 A;  3FM9 A;  3MSY A;  4BWM A;  2DZM A;  2EAP A;  4KN4 A;  4F4X A;  4M6W B;  2R2O A;  3AEC B;  4P4O A;  3D2D A;  2OX4 A;  3F5E A;  4GFI A;  1RVK A;  1A76 A;  4YTP B;  2OQH A;  5D46 A;  5JU5 A;  3CIR B;  1MUC A;  3H0R B;  2XH2 A;  4KEM A;  9ICH A;  4LDT D;  2H3Q A;  3UXO A;  4DEZ A;  5AM2 A;  4Z1Y A;  2ZUD A;  1TY2 A;  1YN5 A;  1OUQ A;  3A9J B;  1V1P B;  2Q4W A;  4TVY A;  2OFJ A;  3DK4 A;  2MQJ A;  3M3J A;  3ZRF A;  3DH9 A;  3ECI A;  2DYM A;  4K1R B;  4OHJ A;  4XUS A;  5JZE B;  3QU2 A;  1NKC A;  1SIJ A;  1JXL A;  1E9M A;  1TS2 A;  2NV3 A;  3RN9 C;  2OZ3 A;  4ED1 A;  4LJP B;  4LA1 A;  3DDH A;  4B9L A;  4WUR A;  1DYQ A;  5KT2 A;  4KIK A;  2ZJA A;  4UAR A;  3ZNZ B;  2NTT A;  1MSW D;  4DDG D;  4RPZ A;  1XT9 B;  4MLA A;  1HXY D;  4KGR A;  1C3T A;  5HHZ A;  2JR5 A;  4L2Y A;  3IXS A;  2PVG C;  3Q69 A;  5IIL A;  2BB6 A;  2N9L A;  2BYV E;  1SGG A;  3DWG C;  2GR0 A;  4OJ5 A;  1YX5 B;  2KFZ A;  2ZIV A;  2KAJ A;  2K39 A;  3JPR A;  1T0S C;  4QZI A;  2AH5 A;  1S97 A;  3EPG A;  4ED7 A;  7ICG A;  1TZZ A;  3POP A;  2LVP A;  4IRC A;  3AUO A;  1FM0 D;  2YVF A;  9ICP A;  5BYQ A;  7ICS A;  4M8M A;  2FCN A;  2HE7 A;  2AHO B;  4G3X B;  4DHJ B;  3MQT A;  3H1U A;  8ICG A;  2FJ6 A;  4B6J A; 
#chains in the Genus database with same CATH homology
 2Y5C A;  2QIE B;  2QIL A;  4RGN A;  1W1R A;  1F0X A;  1KF6 B;  1IGD A;  3V05 A;  3FIL A;  1HSK A;  1A70 A;  1E0Z A;  1EM7 A;  4WWM A;  3NRZ B;  3NVZ A;  1JWU D;  2RMM A;  3S1E A;  1SSN A;  4C56 C;  1I4X A;  2MBR A;  3U2S C;  1FFU A;  1CZP A;  1UNS A;  1PYW D;  2QEJ C;  4R3D A;  3MC0 B;  2UUU A;  1KLG D;  1TS3 A;  2IGD A;  5AWV A;  1TKE A;  2WXL A;  2Y5P A;  3BK2 A;  3DWM A;  2QPM A;  3W8X A;  2B76 B;  4KKI A;  1BML C;  3ZYY X;  1WXQ A;  1C79 A;  4ZHP A;  3Q8C A;  5FKA C;  4JX1 C;  3GS2 A;  4MT5 A;  1C77 A;  3UI3 A;  1N5X A;  3IT6 B;  4B0M A;  1WSP A;  2KAC A;  3AE6 B;  3LYY A;  4YSZ B;  1N61 C;  2R61 A;  3AEB B;  3VQI A;  2V3N A;  3NZ3 A;  1TKY A;  3R07 C;  1RM6 C;  3LAE A;  1C78 A;  4YT0 B;  2BS3 B;  3AB5 A;  2P4P A;  1V1P A;  5MPO A;  1QOB A;  2JZP A;  4BC7 A;  3B2G A;  3MJ5 A;  3FAH A;  4IKG A;  2WXJ A;  1VR9 A;  3FC4 A;  5FXF A;  3I57 A;  2LHE A;  1JWM D;  2LMC A;  3TSH A;  1NEK B;  4NAM A;  2HDE A;  3R2I A;  2ONQ A;  3T3N A;  4JE3 B;  1IBX B;  2EKI A;  1PGA A;  2WDR B;  1MBB A;  2WP9 B;  1N63 C;  1NI3 A;  3AH7 A;  1E8H A;  2WU5 B;  2K22 A;  1XCQ L;  3ZJT A;  2WLB A;  2JYT A;  2VZK D;  4EC3 A;  4HRS A;  4ZYS A;  4YTM B;  1XEE A;  3R2T A;  1JRP A;  1N60 A;  2G9H D;  1I4G A;  2QMT A;  1MHH E;  1V1O A;  2TSS A;  4P16 A;  4XLO A;  1IGC A;  5I4D A;  3E9S A;  2PLI A;  2N9K A;  3AN1 A;  1MI0 A;  2RDG A;  2WNM A;  3HSU A;  3P1M A;  4MH8 A;  3TSJ A;  2YEP B;  3EGR A;  3S1C A;  1FFV A;  3B2F A;  2MJ3 A;  4GDL B;  2JWU A;  2SEB D;  3MFG A;  3RPF C;  1AHV A;  1NEN B;  3GP7 A;  3W2D A;  1VDV A;  1V97 A;  1HZ5 A;  3BVM A;  2I2Y A;  5G5G B;  1SE2 A;  1UUP A;  1VZ7 A;  4HJG E;  4B0E A;  1XCT L;  4JWU C;  3ZJU A;  1GPX A;  4RGO S;  4C7Z A;  1T5X D;  1L0Y B;  3LB8 C;  4YSX B;  1FEH A;  5T8I A;  3U7Z A;  2GQU A;  3S1D A;  2IJ0 A;  3P4P B;  1WVE A;  1XLN A;  1PGB A;  1VLB A;  2CU3 A;  3TEZ A;  5EE0 A;  5I1V A;  1F2R C;  3P4Q B;  1SEB D;  2WXK A;  3W8W A;  4KGT A;  1AWD A;  2Y4G A;  1FRR A;  1WGK A;  1FIQ B;  2GRI A;  1IUE A;  3TUO A;  5TSS A;  4HKQ A;  1AW7 A;  3AMZ A;  3Q8A A;  1SXT A;  3RJ8 A;  1I4R A;  1L0V B;  1EWC A;  3B9J A;  1JML A;  1E7P B;  1NYR A;  1SF0 A;  1XLQ A;  1TY0 A;  3MP9 A;  3HVD A;  4HKZ E;  5G5H B;  1YN3 A;  1UGJ A;  1W1J A;  1LO5 D;  2IDY A;  4RF1 A;  5AE1 A;  1D6E C;  2K5P A;  2XN9 C;  1L4Z B;  2H88 B;  2ON8 A;  4REZ A;  1AYF A;  1PFD A;  5FR3 A;  3FW7 A;  3W8Z A;  4MAC A;  4BBY A;  2NTS A;  1AHU A;  2L32 A;  4L1B A;  4A9A A;  1UWM A;  4EE2 A;  1QIL A;  5BYR A;  2P3H A;  1JQ4 A;  2NQW A;  3FW8 A;  4PWC A;  4PVH A;  3PM9 A;  3P4R B;  1GOZ A;  1TS4 A;  2K9X A;  5HG2 A;  4JB1 A;  3TX1 A;  5AE3 A;  4O95 A;  2CJN A;  2K0P A;  2MJE A;  2WQY B;  1K51 A;  4OZC A;  3EUB 3;  1E8G A;  1D4B A;  5D3I B;  3P4S B;  5C3J B;  1QKZ A;  4C7Y A;  3GB1 A;  3KWV A;  3AE2 B;  1AN8 A;  2SAK A;  1E10 A;  2O3G A;  1L4D B;  1OQR A;  1W1Q A;  3NVV B;  3VRB B;  1E0Y A;  2WXR A;  2FBW B;  2Y3A A;  4D2K A;  2WXG A;  4N59 A;  3SFD B;  2JX5 A;  2PLP A;  3J9C A;  4ARC A;  4JAY A;  3SR6 B;  1STE A;  1QF6 A;  2LHD A;  2L83 A;  3NUH B;  2GQT A;  2IPK D;  3BII D;  1DII A;  3EUB 2;  1W1K A;  2PMV A;  4RFB A;  2QSD A;  4TVW A;  2LEK A;  1ZE3 D;  3BZD B;  3IT4 B;  2BVF A;  2L1A A;  3NS1 B;  3KWL A;  3C8Y A;  2UUV A;  1AHZ A;  5D3D A;  3I9V 1;  4RGM A;  2LUM A;  1ZP0 B;  3N9Y C;  1QLT A;  5I1W A;  1W1S A;  3U4E G;  3NVY A;  1XF5 L;  2HTM E;  1QOG A;  1DOI A;  2AQ3 B;  1HA5 A;  4WH4 A;  4PZF A;  4N6E B;  3AE4 B;  1N60 C;  2WXF A;  1FIQ A;  2BS4 B;  2LJI A;  3LXF A;  1JRO A;  2VZK B;  3AE5 B;  1DGJ A;  1R7S A;  3AEE B;  1VZ6 A;  2RDH A;  1FFV C;  1FCC C;  3FW9 A;  5FXD A;  5L6F A;  1TJE A;  1ROE A;  2KWD A;  2FUG 1;  1C9F A;  2Q5W D;  3KJM A;  1I4H A;  5HMR A;  2WDV B;  1M4V A;  4KGS A;  5BMG A;  3Q8E A;  2BVH A;  3I99 A;  3PZ7 A;  5ADZ A;  1Q10 A;  1FXA A;  3BVZ A;  2OAI A;  1N62 C;  1PUT A;  3HVZ A;  3EA6 A;  3ETR A;  5H8Y E;  3D2J A;  2QKN A;  3AE8 B;  1QLU A;  2AQ1 B;  5EE1 A;  1OFF A;  4L23 A;  1MPE A;  1K50 A;  1OQQ A;  3KLS X;  1FNU A;  1QOA A;  3ZJV A;  3AM9 A;  2I38 A;  2YEP F;  2PKO A;  1HQR D;  4TMA B;  3BYT B;  1L0X B;  1V8C A;  2WU2 B;  1J7A A;  1B1Z A;  3NRZ A;  4RF0 A;  2VFR A;  1TYG B;  3IAM 1;  1I19 A;  5AUK A;  4YXD B;  4AQ7 A;  1ZR6 A;  4PVE A;  2PIA A;  3NVV A;  1ZXH A;  4OAL A;  4YTN B;  1CK1 A;  2OED A;  2WXQ A;  4XWW A;  1N62 A;  5HI1 A;  3ABV B;  1RFK A;  3MHZ A;  2JQR B;  3PZ8 A;  1I7H A;  1Y56 A;  3W5V B;  1C76 A;  4A8X C;  2IGH A;  4CQN A;  1K53 A;  3TEY A;  1C4P A;  2JSV X;  4A55 A;  3HRD D;  2M19 A;  1W1M A;  1SB3 C;  4US9 A;  2WXP A;  2RK5 A;  3T3O A;  1W1L A;  3R8B A;  4N58 A;  2WDQ B;  4MM3 B;  1FXI A;  2E5A A;  5E6J A;  2KQ4 X;  4UDU C;  1TKG A;  1GAQ B;  2K3U A;  2W54 A;  2E3T A;  3V3X A;  1FRD A;  1YQ4 B;  5D79 A;  4M0W A;  3L4P A;  3AED B;  2NMQ A;  2AXR A;  1FNW A;  4NZL B;  4ML8 A;  1JAL A;  1UWX A;  2Y08 A;  4PYT A;  1VJK A;  5FXE A;  5HFY A;  3GSY A;  1P7E A;  1T6B X;  2BVG A;  4TQ0 A;  1IBX A;  1QQR A;  2BBC A;  4DNS A;  4GDK B;  5K8E A;  3U52 E;  1E8F A;  3DQ0 A;  5BYS A;  2JU6 X;  3W9C B;  1VQZ A;  2BB5 A;  2BW2 A;  2J4X A;  3E56 A;  1W1O A;  2J53 A;  1QT9 A;  4UD8 A;  3AE1 B;  3SFE B;  1I4P A;  4HG0 A;  4OZB A;  1DOX A;  4US8 A;  4HRO A;  1SE3 A;  1YMH E;  2LFI A;  4RNA A;  3AE7 B;  2MJD A;  3C0P A;  4C80 A;  1XO3 A;  3VR9 B;  5FXP A;  5D7G A;  1GB4 A;  2MEK A;  4O1N A;  1SBB B;  2VFV A;  5C2T B;  1HEZ E;  4YSY B;  4PVJ A;  1PGX A;  1N5W A;  2W82 A;  3IAS 1;  4ZRQ A;  2AQ2 B;  1YN4 A;  3ZGZ A;  1KH0 A;  5G5G A;  4ZRP A;  2W3R A;  5BMI A;  4XDC A;  1T3Q C;  2CJO A;  4WAF A;  1JWB D;  3WCQ A;  2V0G A;  2IGG A;  2PTL A;  1RM6 B;  5JXV A;  3FWA A;  1L6V A;  3PQB A;  1CJE A;  3OWE B;  1KLU D;  4YWG G;  1VAO A;  3NVW B;  1WRI A;  1MBT A;  2DWQ A;  1MHX A;  1FNV A;  1XXG A;  3VTE A;  5AUI A;  4IDI A;  1RWS A;  1K52 A;  3ZQ4 A;  2GI9 A;  1XLP A;  4H2A A;  4XDD A;  4ZOH C;  3W5U B;  4DXF A;  4TSS A;  3DED A;  4A90 A;  4LK0 M;  3LLB A;  5AE2 A;  1JWS D;  2GB1 A;  2XNA C;  5GXG B;  3RFZ B;  2X38 A;  5LNK 1;  2G1E A;  2PLS A;  1F77 A;  1JCK B;  2ACZ B;  3HUI A;  1T3Q A;  1ZXI A;  3W1S A;  1SE4 A;  1XLO A;  2WXN A;  5L6G A;  3D2H A;  3BW7 A;  1ET6 A;  1VRA B;  1C4C A;  2DLB A;  1KRH A;  2V3P A;  4WIP A;  2VFT A;  1JW9 D;  5G5H A;  3CWI A;  3Q8F A;  4OZA A;  1DIQ A;  1YNT E;  2WXM A;  3SEB A;  4XWT A;  3O13 A;  4ARI A;  3URY A;  2Y3R A;  5EE3 A;  1EWY C;  4KKJ A;  1X2G A;  1WVF A;  1ENF A;  3JS8 A;  2E6X A;  1EU4 A;  1GB1 A;  3AEG B;  2PW9 A;  2J42 A;  2V4I B;  3TEW A;  2I0K A;  3B9J B;  2BTE A;  1WWT A;  1SJH D;  2ZW1 A;  2P13 A;  2LGI A;  1L5P A;  4RH6 A;  1WYG A;  2N0S B;  1I4Q A;  2H89 B;  2YVS A;  3AEF B;  3BWU D;  4JWS C;  2WXI A;  2INN E;  1D5X C;  1QOF A;  4P6V F;  3Q8B A;  1X2H A;  2W3S A;  5HHD G;  2VFS A;  2IPI A;  1D5Z C;  2VFU A;  1E6E B;  1ZOY B;  1SB3 B;  2R2Z A;  4WQM A;  2JXT A;  2WXO A;  3PO0 A;  2BS2 B;  4Q2J A;  3TEX A;  3TSS A;  1N61 A;  4BCA A;  4BC9 A;  1ZPS A;  4GLS C;  2R8D A;  1ZDV A;  2Z8L A;  3SR6 A;  4KX6 B;  4LTU A;  1YJI A;  3VRA B;  1RYJ A;  2AX5 A;  5H92 C;  3FIL B;  3NVW A;  3BYY B;  1TZO A;  1KTK A;  1C4A A;  1J7B A;  1TS5 A;  2INP E;  3AEA B;  1J7C A;  3NVZ B;  2DBY A;  1VZ8 A;  3NS1 A;  1ACC A;  1P7F A;  3AE9 B;  4ZHO A;  5FK9 C;  2ZW0 A;  2EXR A;  3RJA A;  2EEL A;  3VR8 B;  2J52 A;  2KN4 A;  2MH7 A;  1KFY B;  1UXY A;  1BUI C;  4XE0 A;  1ZDX A;  4USA A;  1EU3 A;  5HQX A;  2W55 A;  4FXC A;  1N63 A;  4PT5 A;  2BT6 A;  5BMH A;  2DYO A;  4LLG M;  4AS1 A;  1SJE D;  2M56 B;  1D5M C;  2WS3 B;  5EE9 A;  1ZUD 2;  3AV8 A;  1NVI D;  1F0Z A;  3H8H A;  1PDX A;  1JWA D;  3A7U A;  1NYQ A;  3D2D A;  3AEC B;  3S1F A;  1L6U A;  4YTP B;  1N5W C;  4NAW B;  3HRD C;  3NVY B;  1HZ6 A;  3CIR B;  4PWB A;  3A7R A;  1MVK A;  2WDW A;  3P42 A;  2RPV A;  1YJJ A;  3KQ4 A;  1B9R A;  1TY2 A;  1YN5 A;  2ICI A;  1QLB B;  1V1P B;  1FCL A;  2KMM A;  2Q4W A;  1BXT A;  4TVY A;  4DQO C;  2DYM A;  4OHJ A;  1FO4 A;  2WXH A;  1SIJ A;  3AE3 B;  1E9M A;  1TS2 A;  4NJC A;  1ET9 A;  1ESF A;  2D5G A;  2PVO D;  1F2R I;  4ITK A;  4JPS A;  3A7A A;  4IOI E;  1YQ3 B;  2Y3S A;  4WUR A;  1DYQ A;  2JYE A;  1FD6 A;  2OHF A;  2Q85 A;  2NTT A;  4MLA A;  1FMA D;  1FFU C;  1HXY D;  4KGR A;  5HHZ A;  4L2Y A;  3IXS A;  2PVG C;  3Q69 A;  2BB6 A;  4OW0 A;  4J3O D;  2VAO A;  2KDM A;  2M0A A;  2N9L A;  1DOY A;  3DWG C;  4A6Q A;  4PVK A;  2L52 A;  2QJL A;  3ETR B;  4RGT A;  4TQ1 A;  2KAJ A;  4ZOH B;  3P63 A;  4RCO A;  2BYT A;  1ZXI C;  3POP A;  1CQV A;  2FE8 A;  4HEA 1;  2N7J A;  1FM0 D;  5BYQ A;  4OVZ A;  3BVG A;  1DZN A;  4DXG A;  3BK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...