2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
1DZNA 1PFDA 1QF6A 3AEFB 1N5WA 1WYGA 1WWTA 1EWYC 3AEGB 2RK5A 3W9CB 3AE1B 1DIQA 3AECB 4PZFA 2N0SB 3AEBB 3SFDB 3TX1A 1XLPA 1QLTA 5FXFA 2P3HA 2BVGA 3AB5A 3P63A 4JX1C 4WWMA 1DOYA 2PVOD 3AE8B 1N62C 5AE2A 4N6EB 3D2JA 3AE5B 2CJOA 3S1DA 1VDVA 3EUB2 4KX6B 1CZPA 1E9MA 4HROA 3AEEB 4JWUC 1QOAA 2M19A 5G5GA 1YQ4B 2VFUA 2JX5A 1QOBA 1WVEA 1RYJA 2WP9B 4PWBA 1TKGA 1RM6B 4BC9A 5G5HA 2BS4B 3ETRA 3AE3B 1CJEA 4HG0A 5C2TB 3AMZA 1XLQA 5H92C 1AYFA 3KJMA 2PLSA 4IDIA 4C7ZA 3ETRB 3FW9A 1N60A 1ZUD2 4US8A 3PO0A 1TKYA 3SR6A 2WDQB 3B2FA 3LXFA 2Q5WD 1NEKB 1OFFA 1B9RA 1QLBB 4PWCA 2PKOA 1WVFA 3DEDA 3HRDD 2QPMA 1TKEA 2CU3A 3NS1B 3NRZB 3LLBA 2ACZB 2VFRA 4YSYB 1W1KA 2LEKA 2GQUA 3ZYYX 4WQMA 2Q4WA 4BBYA 2E5AA 2P13A 3VRBB 5EE1A 4ML8A 3HVZA 1V97A 1W1RA 3NVWA 3DWGC 2WU2B 3NRZA 1R7SA 3WCQA 1L6UA 5FXEA 3W8ZA 1AHUA 1N5WC 2EXRA 1WRIA 5G5GB 1RM6C 1N61C 1OQRA 1YJIA 2AX5A 1E8HA 3S1EA 4US9A 4N59A 1VJKA 4LTUA 3AE4B 4ITKA 2K9XA 1JROA 1AHZA 3FWAA 4C80A 2WS3B 1XO3A 4EC3A 3A7UA 5EE0A 2P4PA 2DBYA 2R8DA 1GAQB 2YVSA 3AE6B 4UD8A 3W5VB 3I99A 1RFKA 1DOXA 4YSZB 3W8WA 4MLAA 5H8YE 3BIID 3SFEB 3AE7B 4YTNB 1NI3A 3B2GA 3EUB3 1E7PB 2H89B 4JAYA 1RWSA 1ROEA 1SB3B 1UWMA 3S1CA 1T3QA 2L83A 1FXAA 1SF0A 2OAIA 2W55A 3AN1A 2M56B 3NVYB 1FIQB 1L6VA 4TVYA 1X2GA 3FW8A 1TYGB 2FBWB 3W8XA 2QIEB 1WGKA 1A70A 4TVWA 4HRSA 1VLBA 2VAOA 2WDRB 1J7AA 1MBBA 3P4SB 2MH7A 4A9AA 1XLNA 1FFVA 5HMRA 2WDVB 3P4QB 1N5XA 2G1EA 4PYTA 1FM0D 5C3JB 5FXDA 2PLIA 2WU5B 2VFSA 1W1MA 1DOIA 2KMMA 1OQQA 4USAA 1AHVA 2L52A 3CIRB 3AH7A 1DGJA 2MJEA 1E6EB 1FO4A 5AE1A 1XLOA 3S1FA 1ZXIA 1QT9A 4PVJA 1E0ZA 3CWIA 3AEDB 5MPOA 2DWQA 3VR9B 1GPXA 1QOFA 1L0VB 1N62A 1FRDA 3NVVA 1F0XA 2E3TA 3HUIA 1E8FA 2QJLA 4N58A 1QOGA 2BT6A 1QLUA 1I19A 1W1OA 4PVEA 1KF6B 5AE3A 3AM9A 1N60C 2OHFA 2BVHA 1FRRA 2MJDA 1SIJA 2K22A 2PIAA 1E0YA 1ZP0B 4C7YA 4DNSA 3DWMA 3FW7A 4YSXB 3P1MA 3L4PA 3BW7A 1JW9D 2HTME 3P4RB 2BS2B 3NVWB 4PVKA 5AUIA 5HQXA 3ABVB 4YTPB 5EE9A 3JS8A 4ZHOA 2H88B 2K5PA 4JB1A 2BS3B 1E10A 1W1SA 1NYQA 1W1LA 4OALA 3KWLA 1FFUC 1NVID 5D79A 3A7RA 3A7AA 1DIIA 2GQTA 1F0ZA 2W3SA 4P6VF 1FMAD 1I7HA 1MBTA 1ZR6A 1WXQA 1JWAD 3RPFC 4BCAA 3NVZB 3VTEA 3AV8A 1UXYA 4YT0B 4ZHPA 1W1JA 2BVFA 4ZOHC 2JQRB 3PM9A 1SB3C 1N63A 2WQYB 3VR8B 4PVHA 2WLBA 1JQ4A 5GXGB 2CJNA 3B9JB 2NQWA 3NVYA 2W54A 3R07C 2MBRA 3NVVB 3B9JA 3AE2B 1J7BA 3NS1A 3TSHA 3TSJA 4FXCA 4YTMB 5ADZA 1YJJA 4JWSC 1T3QC 4O95A 2O3GA 3C0PA 3HRDC 3W5UB 2R2ZA 3P4PB 2VFTA 5HHZA 2I0KA 5FXPA 1N61A 1TJEA 4ZOHB 3LB8C 3DQ0A 3SR6B 4BC7A 1X2HA 3FAHA 1NENB 1KFYB 3NVZA 2KAJA 5EE3A 1L5PA 3AE9B 4YXDB 3LAEA 1ZOYB 1JALA 1VQZA 2W3RA 2Y5CA 1IUEA 1FXIA 1J7CA 5G5HB 2AXRA 1HSKA 1JRPA 1FIQA 3FC4A 1V8CA 1FFUA 5AUKA 3D2HA 2MJ3A 1JWBD 1PDXA 1ZXIC 2PVGC 3VRAB 1NYRA 3AEAB 1VAOA 2B76B 1YQ3B 1FFVC 3D2DA 1KRHA 1W1QA 3GSYA 1N63C 1PUTA 2QKNA 1AWDA 2Q85A 1E8GA 2VFVA 4XLOA 2EKIA
chains in the Genus database with same CATH superfamily
4BGDA 4AS1A 4QWCA 1P7EA 2LUMA 4II2B 3H0LB 2FIDA 4DFKA 1V49A 1ZQUA 2OLAA 3TWAA 3GV5B 1WYGA 2C2DA 3KHLA 4DHJB 3V6EB 2JEFA 3AE1B 1ZDVA 5JRTA 2L1AA 7ICUA 3KHHA 2OVLA 2ES6A 5HMLA 3UXPA 4KLIA 2ZUCA 3BK1A 2R8HA 3O0HA 2K1FA 3GZNI 4DCCA 2Z0DB 8ICZA 2WXOA 3TCAA 1IBXB 2BVGA 3H4DA 1ZDXA 3PGEA 4FADA 3DEQA 5F9LA 4WWMA 4R8UB 2HZGA 4KLDA 3VQIA 5GRTA 3V5CA 2PI5A 4UAWA 3ZNHB 1HZ5A 4HNCA 4GIBA 3SU8X 2C5LC 4HKQA 3A9JB 1F2RI 2DYMA 5CHGA 1TKKA 5EWGA 4PH5A 2HHSA 4HCNB 3GU3A 1WH3A 2MWSB 3VH4B 3JZUA 4NL9C 1V81A 3V7KA 2L8JA 4QWDA 2V3NA 1VDVA 1KN0A 1NJXA 4BKSA 3HP6A 2OYYA 3SAFA 5BO4B 2LVPA 2W11A 4UARA 1X42A 1UHUA 4Z6FA 5AKKA 2M19A 2POZA 3T9PA 2BYTA 1FNUA 2ZIXB 1QOBA 1RYJA 5ALGA 4M0AA 3PZPA 1K5OA 4P1BC 4E8GA 5KG5A 4KLLA 2KN5A 4G9BA 3PY8A 3BK2A 1BUIC 3DBRB 4MFCA 4BC9A 3PV8A 3ETRA 1TS2A 3AE3B 3MC0B 3OAWA 1D9DA 3RGTA 2MSED 2X50A 1ESFA 5AI0A 2PW9A 3MJ5A 1YN5A 4KLGA 1XLQA 2N9PC 1SKWA 4JDRA 1D3ZA 4M6WB 3ETRB 2A5UA 2MW5A 2LUEA 4HKZE 4MJSA 4OVVA 4EENA 3QTPA 3FW9A 4P4OA 1F8WA 3SQSA 3KKAA 2KC2A 2N7EA 3PO0A 1TAMA 3QJZA 3GOEA 3LXFA 2LYAA 1TV9A 1ENFA 2BQRA 4NAWA 4DOBA 1C76A 4NNJB 2F2AB 2D10A 3UJRA 3EGRA 1GC6A 2HBKA 1L8PA 1TKEA 3MZNA 2JSVX 4PS8A 2ACZB 8ICPA 3H12A 7ICGA 1M6YA 4F5OA 3CSTA 1KD0A 1SBBB 4ANVA 2VFRA 4YSYB 1W1KA 4RPYA 2LEKA 4HPMB 4LDTD 3MUCA 1YQZA 9ICFA 2QGYA 3CB3A 4LIIA 2JK6A 2RSUA 2GQWA 4B9UA 5ALDA 2Q4WA 3QEBZ 1QCKA 3PZ8A 2JGAA 4WJNA 4F1SA 1L3UA 2V3PA 4BBYA 3V3WA 2HHVA 3AU6A 2QJNA 2WHIA 1B43A 1I4RA 3L13A 1NKBA 2IO0B 2NBUA 4KLSA 1CUKA 1CMXB 4Q8FA 1ET9A 3HVZA 1X9MA 2JU6X 2HMXA 4F91B 3FYYA 2Y9TA 3U4EG 3KZXA 4ED6A 4LZDA 3PR5B 1KFSA 1S0VA 2L3ZA 4DFJA 1L6UA 1NKCA 2C2RA 4G50A 1AHUA 1T4GA 1U48A 3NOBA 5KFFA 3LXDA 2KZRA 4RQ3A 2AQ3B 2WP6A 1XSNA 2DX5B 4LK0M 2MUCA 3CXOA 3TCSA 2GR1A 3BVMA 3NUQA 2QQ6A 2BPCA 1PZNA 4C8NA 3PMLA 3SV4A 4QNLA 4ECUA 7ICQA 4E0DA 2N1WA 1SE4A 3BINA 3V4BA 2QAEA 5IN7A 4US9A 4N59A 1VJKA 2GI9A 3OSNA 2H3ZA 2EAOA 4ED2A 8ICKA 2RGFA 3RI7C 4J56A 3ZVHA 2LHTA 1V6EA 4C0ZA 2BC1A 3CAWA 5BOEA 3N4FA 1AHZA 4P0QB 1JRUA 1Y88A 3K1GA 4F71A 2BZFA 5JCMA 3PSEB 2BR0A 2DHZA 4B0MA 2QSDA 8ICYA 3KVFB 2YVGA 4CGZA 5J2HA 2IGDA 4MSQB 3MC1A 5J2GA 5BMHA 1PDYA 2K4HA 1JMSA 3HPOA 3VHTC 4OO1J 2JEGA 3A7UA 2BYVE 3T9LA 3C5FA 4YXJA 5EE0A 3T5JA 4KTQA 2D11A 1QQ7A 2DBYA 3BQ7A 1LVLA 5AKIA 2JYEA 2ZIWA 5AZFA 4ANXA 2R8DA 1RLFA 5B66U 2W9NA 4IM3A 7ENLA 4Y2QA 1TVAA 4O5KA 4RQ6A 3CXBA 3W5VB 1SZPA 5KFYA 3IG5A 1RFKA 2ZTCA 1EBDA 2EELA 2NPTB 3ZI4A 3PNCA 3QU4A 7ICVA 3H8HA 4G11A 3SBFA 4A8EA 4F93B 5J8YA 1ZQQA 3SFEB 2GRTA 1ZXHA 2V1YA 4KGTA 4YFKA 3ZLZA 4I29A 7ICMA 1KRPA 8ICUA 3PQBA 4TUPA 2DNFA 3IK4A 2H3IA 4DX3A 4TUQA 4IRCA 2H89B 2HOIA 1RQLA 3H7SA 2AL3A 3TUOA 2ATLA 2FLNA 2KD1A 3E9SA 4A6QA 2WFAA 4PK1A 2F1HA 2L83A 4UB1A 1EC7A 1JN3A 2EH9A 4F50A 7ICEA 5CHVC 1WJNA 2QB0B 2XK5A 5EBKA 1FXAA 2PFPA 2BHNA 2EQYA 2J6TA 1ZMCA 2EZXA 4UBBA 2ODGA 3PRPB 5L1KA 1ZQKA 2O56A 3N4MB 4J57A 2OEHA 2KJRA 5FP0A 3O13A 4FFDA 1GETA 2G09A 2YY6A 4Y2XA 3W8XA 4PGYA 2D2QA 2ZNVB 4EMIA 3N1YC 2LBOA 5KAFU 5J2KA 4TVWA 3U4FA 1B22A 4HRSA 4KGSA 1NHPA 3WKEA 3RULA 2VAOA 3CYJA 2L05A 1HEKA 5EWFA 4DXKA 4M6UA 2GLEA 2LVQA 2WF8A 4RUAA 1TS4A 3T8MA 4ROPA 2LGDA 2M9NA 4QZCA 5J2EA 4LZGA 1FFVA 1ZJNA 4P2HA 3T3OA 4U6PA 4EQXA 4C4SA 1N5XA 4TURA 2VA3A 4NEVA 3SDLC 4F7ZA 2J6UA 5C3JB 2YQEA 1H6VA 3U52E 1W1MA 2ASLA 1P43A 2F5ZA 1B0XA 2YN4A 1DOIA 2AEHA 1E8WA 2J0JA 3O65B 4M8MA 3VTWA 1WM3A 4FBJB 1KEJA 4B6JA 4J1OA 1JWUD 2BTEA 4GXJA 2YB4A 4Y2UA 8ICNA 3TTEA 3D2QA 5G55A 3ZTDA 5JZEB 3IBEA 4H4QA 4HAIA 2V4RA 4GGHA 4DOAA 4M9NA 2KZZA 1MHXA 1NBFC 3R7QA 1ZD5A 5EWEA 3GZNB 3EF6A 5KFKA 1LKYB 4DOCA 2HVIA 2G08A 1FO4A 2UVUA 2ALZA 1EO6A 3S1FA 4J6IA 1ZXIA 1FNVA 1V9PA 4AP9A 5DB8A 2DENB 2KO3A 4L23A 3IJIA 2R8JA 1FEBA 2H5XA 1IM4A 4IC9A 3OC4A 2HE7A 3WK7A 5HMMA 1IGCA 2ZPNA 5A0LA 1WGHA 4FJYA 1GPXA 1L0VB 4KLTA 2KP7A 1Z19A 1SIFA 3M62B 1ZKHA 3R2IA 4CYEA 1FRDA 3T3NA 1WWVA 2HDOA 2BBCA 2A1JA 2E3TA 1FXTB 1T0SC 4DHZE 1BMLC 2MRPA 2QJLA 2VIXA 4N58A 4PPXA 2JT4B 2BT6A 1I19A 3S47A 4W9IA 2KT7A 5AWVA 2EQ9A 3JPSA 1PVRA 3KYCD 1X66A 2V9HA 2PP0A 3F2BA 1D4BA 1N60C 2K4IA 2ONEA 1ZQHA 4R66A 1D5ZC 1N48A 2ONQA 4H4UA 4UASA 2HBLA 3E58A 4RPXA 1ZETA 4Y2RA 4NLGA 4PHAA 4K81A 4KIKA 3VXWA 1FRRA 1TBEA 4RNAA 1C3TA 3H0MB 4K8GA 2AWTA 5JU5A 3OW1A 2PI4A 1PVQA 2JY6A 3PS6A 1D8BA 3K4GA 3RD2A 1S77D 3CGCA 3TQ1A 4ZRKA 1GJZA 5ALQA 2PTWA 4PHPA 4DNSA 5HP4A 3HVDA 3PTFC 2A1AA 5GTIU 2HOQA 2AL6A 2KK8A 2JXJA 1TK0A 1GRFA 3OTQA 1I35A 3P1MA 5KG1A 3SJNA 2JUOA 5FJRA 2H3FA 3DFHA 2ZNVC 3OHBA 1L8LA 2D8CA 2MUTB 1JW9D 2M0XA 1AQ6A 4A8XC 3NVWB 1BZLA 1LFDA 4EX7A 5AUIA 4F92B 4HN8A 2YEPF 3ABVB 4A20A 3JS8A 1SE2A 4ZHOA 3H9DA 2Y5BB 1E8ZA 2HHUA 2CN1A 3QYPA 1OEPA 1NK5A 4LLGM 2BPSA 4NLKA 4A3OA 2KDFB 1MUCA 4RCOA 1L8OA 3QZ8A 3DGZA 1WX8A 4EBEA 2A19A 1RYRA 1SEBD 1SXTA 3DDHA 2PXIA 2ZPYA 5D79A 1C9FA 4H2HA 4JHMA 4MMWA 2PGEA 1F0ZA 2W3SA 3A9KA 4ACFA 1STZA 2DGZA 3KUMA 2G0AA 1UA1A 4A3PA 2UVRA 4I6LB 1F77A 2PFQA 1MPEA 2WXFA 4ZDVA 3OP2A 4PHEA 3ZIMA 1C1YB 1U4BA 3U2SC 2WGSA 2NMQA 2IBKA 4W9GA 3MR2A 2JXTA 1OJTA 4QAYA 2N1RA 2BKRB 1NI2A 5IINA 2PP3A 2L0FA 3WK4A 1WR1A 1ED1A 3QU5A 1S76D 2HD5B 3DJGX 4ZHPA 4ZRPA 1CRXA 4FZNA 3RNGC 2Y3SA 2VA2A 5E6JA 1OW5A 5D3IB 4IZGA 1JWMD 4M0WA 2WQYB 4BAXA 2LJ5A 1SGGA 1T0RC 3WAPA 2XCPA 3ZDAA 2KDMA 2QJMA 3H7IA 4F4RA 9ICOA 1ZW7A 4R8UA 4KDLB 1YOVB 2W9BB 3UM9A 3NVYA 4O3NA 3EW9A 5HHDG 3IG3A 3JPNA 4C4VA 1GRGA 4BVUC 3C2KA 5J0WA 1XSPA 2W9BA 2RDBC 4W9JA 3R07C 1FNWA 3NVVB 2LASA 4ECWA 1J0GA 4Q44A 3ED5A 3OJUA 1KLNA 3CT2A 2O6KA 1UNSA 3Q6JA 2MP2A 2A3VA 1GNUA 3TSJA 4PGQA 4YTMB 1WE6A 5CJ7A 4JWSC 2AL2A 4UB8U 4O95A 5DBBA 2QILA 3ENLA 1ZQIA 2RDXA 2GRIA 1OEYA 1TT5B 3CGBA 4UAUA 3P4PB 3T8QA 1JX4A 2BQUA 3SN1A 4ECVA 3N7PD 3ZDEA 1E7UA 2BCSA 2WXPA 4OCZA 3GZFA 2DW7A 1TJEA 2HTHA 3L54A 3GV8B 4CCHA 3OPXA 3V7JA 4RUCA 4NV0A 1WX9A 3KUDB 2NS5A 1Q5WB 3HK0A 2GGEA 4H4RA 4E4FA 3DQ0A 4BC7A 2N7DA 3OZMA 2YLMA 5BYQA 1PVPA 1AOGA 5KL1B 1DYQA 4DFMA 3BQ0A 2KAJA 4RNMA 1TZZA 4AUQC 4ELUA 5CX3A 4EE2A 2DL0A 2VKQA 2PMZF 1SKRA 1VQZA 3ZQ4A 4KPLA 4NJCA 1KCZA 1UCVA 5AIBA 4IG7B 4IW0A 3C2LA 2K6DB 3WKDA 3TIXA 1FXIA 2CHRA 3IJLA 1Z4NA 1SV0C 4O3MA 5CEHA 1J7CA 4APNA 8ICSA 5AI6A 4LJXA 1P48A 4I2EA 3QUQA 1ZD4A 4QW9A 4BUGA 1FIQA 2X8CA 4LNFA 4XRHA 2MJ3A 2LYHA 5AM2A 3BQ1A 1PDXA 2LGSA 2K4PA 3JW0X 3R9KA 5HNKA 2PMQA 5AKXA 1S97A 1S3SG 2TSSA 4IL2A 5TZVA 3SN4A 1WUFA 5L83A 4K8DA 2WPEA 7ICIA 2ZUDA 3RNEC 3N7SC 2ASJA 5AEKB 3D2DA 2QVHA 1KRHA 3GSYA 4NM1A 5KFCA 1MI0A 4M00A 3H4BA 3JVAA 1TIFA 3M6KA 3QE9Y 2EANA 4RT3A 2HHWA 4G0NB 3P0WA 9ICVA 3EA6A 2QKNA 2NCNA 1AWDA 2WX0A 2Q85A 2ZW0A 3WK6A 3TAPA 4WAFA 4ARCA 3LVWA 2FI1A 3ZDDA 3FXGA 4DXAB 2RR9A 1EWCA 3N7RC 3C0RB 1K51A 4QWAA 1A5RA 1M6IA 1R6WA 4RFBA 1LB2B 5AKZA 4GFJA 1PFDA 3UGBB 5J2CA 7ICKA 3AEFB 2ASDA 1JCKB 3IAS1 1ISNA 3A1QB 3MHSD 3DH9A 4ZYSA 1EWYC 1JWSD 3DBRI 5LXHA 2BWES 2KJ5A 4DQRA 3C23A 1DIQA 4ZRIA 3FCPA 2UYZB 2WXHA 4C8KA 4F4KA 1V85A 2FUHB 2J4XA 4PZFA 1E9IA 2N0SB 1L3TA 4GYPC 5KG0A 2KKCA 3SD5A 1AW7A 1RXWA 4YG2A 2PE6B 1Z1VA 2WB1F 5IILA 3AEBB 4PZNA 3BYTB 4R63A 2J3NA 3A0BU 3GFKB 9ICRA 1MSWD 4PZOA 2ZXIA 4M04A 4H4ZA 1V2YA 3D47A 2MA9B 2PVOD 3GD6A 4JLCA 3GE3C 2RPVA 1ZRMA 4C56C 3LDZE 3LB8A 5I1WA 4I2GA 2BB5A 5AK5A 3ZJTA 4S17A 3ZUNA 4K2SA 3N4EA 2RHFA 3VTUA 4HLEA 5AI5A 3FVDA 2CS4A 5E6NA 2R8IA 2RPQA 2KHVA 4LJOB 2G4DB 2KFZA 5ALHA 3AE5B 3D2JA 3S1DA 3DJJA 1V1PA 1E9MA 2M0AA 3POPA 3TFRA 4B9VA 4JWUC 2SEBD 5U1OA 3N1XC 2GSHA 5FKAC 2DZMA 2EQ6A 4DYEA 3KYDD 1SXEA 2MCNB 1SJDA 4ECYA 2GBRA 4DL5A 5L1IA 4MGYE 1S5LU 3AU5A 5G5HA 4P7IA 5KFXA 1FECA 2EQ7A 2XC9A 1EC8A 2XH4A 3N28A 1CJEA 1Y56A 4K3BA 1J8CA 2FMPA 2F8KA 5LXIB 4NLNA 3C19A 4URKA 5H92C 5ALMA 3VCCA 3V7LA 4GOCA 4DQSA 3KJMA 1WI0A 4IDIA 5J0UA 3RJJA 4PS7A 3NFUA 3VDGA 4XQ8A 1N60A 4QZBA 3RJKA 2NR2A 3BYYB 1ZUD2 2I2YA 4BFRA 5U25A 3STPA 3P42A 1TK8A 5KG4A 9ICUA 3RF9A 3TMPB 5KFRA 5J2FA 2L76A 2WX1A 2PSNA 3EECA 1NEKB 3L08A 5J29A 2AQ0A 2QLTA 1B9RA 1KJTA 4EZ6A 1Q1OA 2Y5PA 4PWCA 2HXTA 3EC8A 1WVFA 3DEDA 3HRDD 2CU3A 4FHJA 2QPMA 3DGBA 4KVGB 1COKA 1F1HA 3NRZB 3EANA 2L0TA 3EJBB 3NASA 1ELSA 1WXSA 3BZCA 4EUTA 2KVZA 2B21A 4Q43A 3TL5A 2KKVA 5E6PA 2ZW1A 2EZYA 2LKYA 1ZQ1C 3RAXA 2OZTA 3MTNB 3T6CA 2BB6A 4WQMA 1DK3A 2GMIC 5HR7A 3H8WA 3MFIA 5AM5A 4DHGA 1KW4A 3FV9A 2WXGA 4M6WA 2KMAA 5HHHA 4J9SA 5KG2A 2X38A 4WJQA 2E5AA 4ED7A 3TANA 4PGXA 2EDUA 3GD3A 2ZC8A 3B1LX 4Y2SA 2IOHA 2KMDA 5EE1A 9ICSA 3RB4A 5CHWA 3VRBB 3L5OA 4ML8A 4CQNA 1C7YA 2FMQA 4H50A 3IDWA 4FJZA 2L5YA 1MVKA 2K0PA 2WU2B 1XPYA 5KFVA 1VCBA 3WCQA 2LMRA 2WXIA 2A8XA 3CGDA 3UXNA 3ZRFA 3W8ZA 4BWMA 2X8XX 1ZQCA 2RDGA 5DDMA 2XY5A 1KSPA 1WRIA 2LJIA 3WKAA 2IJ0A 3ZVVA 3G6VA 4RT2A 1N61C 1C20A 2NBWB 3UMGA 2Y4GA 4ED1A 4P0PB 1SZHA 5L95C 3S1EA 3PZ7A 4F4WA 3KWVA 1UQVA 3OHAA 4MEYA 4KIKB 1Q0WB 2NRZA 2X8HA 1T0QC 5ALXA 3HKZF 3ZDTA 4RNNA 4GDLB 2HVHA 5AKLA 3C29A 2Y0SF 4C8OA 3GP7A 4X57B 1JROA 1MDRA 2WAQF 2IGHA 2A4ZA 3ZNZB 2JEJA 3FWAA 4Y2VA 3RB0A 1PK3A 3EPIA 4C80A 3Q8LA 4EZKA 3SZ2A 1WM2A 4IHCA 2R8KA 4YVZA 1D6EC 4FULA 2VANA 1EF1A 2PS2A 2N9LA 3LVVA 5AKYA 1XO3A 3DDCB 1X9SA 4O1NA 2O6VA 2K8BB 2E5SA 5BYRA 3UF8A 4F8CB 2ZZ0A 2IPIA 2JZBA 4DSEA 4W9FA 5JRBA 2UVWA 3NZSA 2AH5A 3ZVHB 4MKSA 2XI9A 1GAQB 3S5SA 3RJEA 3AE6B 1KDHA 4UD8A 3F2DA 1OQYA 4OVUA 3U9IA 4JV0A 4JN8A 4M52A 3LYYA 1QSSA 4L1BA 4ANWA 4YD1A 4Y2TA 2I6XA 2K39A 3A33B 5IAAC 3H7VA 5E6OA 1WXMA 2OWOA 3TJ4A 4KN7A 4NM2A 1WXVA 1ZKQA 2UU7A 3MR5A 3BIID 4EELA 4PT5A 1YZ6A 2GR2A 3ZLHA 5CA7A 1K50A 1NI3A 4OJOA 1MRAA 4DN1A 5KFWA 2ESEA 1TZOA 4RM9A 4WWNA 3RFZB 7ICPA 2B6GA 1RWSA 2L32A 3D32A 1ROEA 1SB3B 1SJAA 2NRVA 1HJPA 4RGOS 4EQSA 4Z6DA 3HHMA 2KJ6A 2KQ4X 3W1SC 1T3QA 4OJ5A 1RFAA 1UGJA 2LXAA 3S1CA 5ER0A 4A3RA 5D49A 2W8KA 3DESA 3LDAA 4I2AA 1ZQPA 1N2XA 1WRDB 4NJ8A 3Q6BA 4F5PA 4I2JA 7ICFA 2O6VB 1WXAA 1YZ7A 4R64A 2AQ1B 3AN1A 1MFWA 4MEXA 1E7VA 2KMCA 3RUIB 3NVYB 1GREA 4BBNF 5HKHA 4KITB 2DLBA 2KFJA 2RMMA 4DO9A 1X2GA 3KHRA 5LNK1 5ALUA 3K9PB 1UUPA 4LA1A 1TYGB 3E0FA 4ADWA 4HYRA 3I5JC 3DERA 3H8JA 2Z59B 2E1FA 3LADA 3QU9A 2PCEA 3CF6E 3RJ8A 3GIMA 1ZQOA 2JWZA 3PX4A 3AI5A 1ZQBA 1J7AA 1ZQGA 5KT5A 9ICMA 4EZLA 4H1ZA 4KLJA 1Z1BA 3R0UA 3RTVA 1LXDA 5HMRA 2ON8A 1Z4OA 3N20C 3D2SA 1JEHA 4RNOA 4KV2A 4BKSD 3ALRA 3URHA 3PSPA 4YMMA 2J0MA 1CEZA 1FM0D 2VRRB 4GMVA 4JGHB 5I1VA 4HNLA 4NXZA 3TI0A 3GD4A 3PW4A 5GMVA 4D2KA 5FJPA 5JHAA 3Q14C 4IRDA 3X0WA 2FCSA 2KSOB 5KFQA 1NZBA 2I9GA 5BOFA 1IPGA 1UT8A 1I4XA 3MWCA 2XIDA 4HCPB 4USAA 3TKAA 2GBJA 3A1QA 4I2DA 3BOXA 5AKHA 2WPFA 1KKXA 3TJIA 3UINB 3Q8PB 3KUZA 2VZKB 1VD2A 1KKOA 1L7PA 4J3ZA 5AM4A 2REXA 2KANA 2LPEA 3CIRB 4NWIA 5B5EU 3T4WA 2YX8A 4OJ6A 4MEMA 2UWQA 3QPEA 2IY0B 3RBEA 4H4TA 4DFPA 4EQRA 5T14A 3JPQA 5AZGA 3QNMA 1RXVA 2EKEC 4OVZA 5C23A 2ASQA 3VC5A 2C3DA 1NDDA 2W8LA 1QT9A 3DCGA 4ED0A 5BMIA 4PVJA 1ZQMA 1E0ZA 1HTQA 1MNSA 1NHSA 2AL2B 4G8TA 5HI1A 1WMHA 2I1QA 4F2SA 7ICHA 4ZA0A 1VZ8A 3CYMA 4QZ9A 1PYWD 2LI6A 1V59A 1D5XC 1H8CA 3NVVA 4XE0A 4XZ4A 9ICEA 2ISPA 4NY8A 4AYBC 1UELA 2C9WB 2QC8A 3A4SC 3BWUD 1L7YA 3HUIA 5C0YA 1ZQTA 2AKMA 3QEAZ 1MQ3A 2WNMA 1NU5A 4H19A 3MSYA 1QLUA 3HWTA 4HEA1 3ES8A 4EZJA 1NELA 3QQ8B 1KF6B 1BNPA 5KT3A 4XGAB 3PO4A 3PSIA 3SD7A 4YWSA 5KHQA 4EQWA 9ICNA 2BVHA 3F53A 1VR9A 1ZPSA 2MJDA 4J9NA 1TTNA 4H4XA 3M6ZA 4F72A 5KFOA 3JPRA 3CRXA 4AJWA 1E0YA 2PGWA 5G2NA 4MF2A 4BOZB 2R2QA 2KV2A 4GYPA 1F52A 1T94A 4KT2A 4XC2A 3ZD9A 3DWMA 4N9F4 3SQPA 1ZK7A 1D5MC 4YSXB 4QJFB 1JOAA 3R7RA 5FJTA 4JL9A 5FS8A 4BOSC 2C7HA 1GSNA 4TQ0A 1E8XA 1SV4A 3GRSA 4XX5A 4FDCB 4KN4A 2KACA 2GL5A 4O3RA 2HTME 3APDA 5D3DA 3P4RB 3ZRCA 2BS2B 5FR6A 5TSSA 4AOFA 2GOLA 2MRLA 1B1ZA 4GLSC 5AI8A 5GTHU 1KFTA 4X2PA 2OM6A 2LFIA 4FS1A 4C8MA 1NNLA 1YN4A 3QX7A 2DZIA 2VH1A 1PK1A 1TE2A 3HKZC 4OJPA 2H88B 2AQ2B 4KX3A 2DPJA 2I5HA 2BCVA 5L1JA 4C00A 3GIJA 2N9KA 4MF8A 1Q46A 4B9SA 2BS3B 1E10A 1M94A 4C4VB 4PYZA 4DK5A 4OALA 2ZADA 3J81j 4YMOA 3KWLA 2FUG1 1GESA 5LLIA 1NVID 2WXKA 4ARIA 3A7AA 4BKTA 3ZO5B 3I1YA 4C4RA 3I76A 3RJIA 2INCC 2PTZA 2L00B 1Q8KA 4KSLC 3ISBA 1S7MA 1JPDX 1ZR6A 2IDYA 2FLPA 1BKHA 5KTQA 1WXQA 2JZZA 4OW0A 4DL6A 2KHQA 4M47A 3D2NA 5KFBA 1H38A 1WF9A 2BGFA 5CR0A 3RNMA 4FS2A 1ZX9A 4KPRA 2K60A 1L7OA 5FK9C 2LGXA 4P16A 5IKCM 2WHEA 2G5IB 4O3OA 1MHHE 2MBOA 3PM9A 1Q1WA 3N1ZC 2X99A 1N63A 2F77X 2KJ9A 4UB4A 4KLHA 5DGAA 1SL1A 4MM3B 3VR8B 5JHBA 2OZ8A 5BYSA 5J17A 2CR5A 1JQ4A 1DK2A 5KT2A 5AKJA 2Y3AA 2FPMA 1BT0A 3AQFA 2KWVB 2PPHA 5ALWA 2HI0A 5DDYA 3U30A 1ZYQA 5J04A 2CJNA 2HW3A 4KZCA 2QKQA 4YN4A 2D5GA 3RYTA 2NQWA 4QIWC 4J9OA 2WTFA 3TACB 4I6PA 3M7DA 2ZZBA 8ICEA 7ICNA 2ZIXA 2DYBA 2F8LA 4O3QA 3TWBA 1T6BX 1A6SA 3RJAA 3T5LA 1F2RC 5AM0A 2R2OA 2AL1A 3ZD8A 4HCDA 4IM0A 4EMWA 3Q69A 1ZJMA 3PMNA 5ADZA 4MH0E 4DS5A 4KKIA 5AI4A 1S1QB 2LGIA 3RNBC 1T3QC 2QB0A 3PW5A 1TGZB 5J8YC 2XK5B 2WP5A 3W5UB 3DBLI 1P0RA 1L0XB 1XXGA 3DVGY 2VFTA 2C3CA 4AWJA 4WJ3B 3A9JA 5HHZA 1NK4A 3RB3A 2Y1IA 1RYUA 1N61A 1U4AA 2PODA 2NTSA 3BS5A 5FS6A 2EMSA 2ZJ8A 1WG8A 3K75D 4CHKA 4E71A 2JHDA 3URYA 1GC7A 3LB8C 3SR6B 3H4KA 2BYFA 2KNJA 2G4SA 3SYZA 3BQ2A 3AULA 3JVZX 3PFRA 1NENB 2FJ6A 5F9NA 4JV2A 5EE3A 5AI9A 3AE9B 1HUZA 2NPTA 5KFIA 4XYCA 1JALA 1IXRA 4O5EA 2W9CB 1NJYA 2IO3B 1S9FA 5D6JB 3WAMA 2W3RA 2Y5CA 3MBYA 2KZMA 9ICTA 3PW0A 2RD0A 5J2IA 1S0NA 3NRWA 3RH6A 4K1WA 5EDSA 5G5HB 4EYIB 3RNFC 3ZNGC 1F44A 1HSKA 2AXRA 1RYSA 5K8EA 3FC4A 4HXDA 2AQ4A 4IR9A 4KLOA 3QCAA 4CF3A 3R66C 9ICLA 4KGRA 3MR3A 4F5NA 3D2HA 4E6MA 3VA8A 4NLBA 5IIIA 3NZGA 1ZXIC 1WR6E 4DNAA 1MOKA 1YX6B 3VRAB 3DFYA 4RZRA 3L8KA 2P3HA 4RQMA 3C2MA 4DS4A 3HM6X 1WGDA 3AEAB 3B08A 4CF4A 1TK5A 2ZTDA 5AK4A 1K1QA 1V80A 2B76B 2M1MA 3ALBA 2VJ5A 1COOA 3C8YA 1B4FA 4O3PA 4P0QA 1NK6A 1YJ1A 3LWLA 5ALFA 1SE9A 1STEA 1RQNA 2WB1C 4RH6A 2X8GA 4WURA 3VFCA 3C5GA 2GR0A 2JV3A 1PGXA 1ZE3D 4DEZA 4RU9A 1V1OA 4HDQA 4IWQA 3LK9A 5HR6A 4ELTA 1XT9B 3Q2AC 2QARA 4JWNA 4HPPA 2EKIA 5CWRA 3BJSA 1DZNA 1IYXA 4NY0A 2BPFA 5HFYA 5FMHA 1EXNA 1A77A 4QZEA 1X6IA 1UBQA 3RZWC 1QF6A 2KFNA 3ZDBA 1N5WA 4B95A 3PX0A 1MA7A 2J53A 3MKCA 3IN5A 4BXOB 3AEGB 5CHFA 2MBEA 1URJA 1I4PA 3Q3MC 7ICJA 3V61A 3AECB 2ZTEA 3I9V1 3KD3A 2RQ5A 2BQQA 1L7MA 3VH3B 2NRWA 2BF8B 4JB3A 3VC8A 3SFDB 3TX1A 1JCTA 1XLPA 1QLTA 4IS7A 9ICCA 2XH7A 2KFKB 3BZDB 1BPXA 2KHWB 3I57A 3BSMA 3LJ3A 4KEMA 3VC6A 3L0WB 1Z00A 4DL3A 2QB1A 4KLUA 1CK1A 1VJ5A 2GO7A 2DF4B 1DOYA 3EJEB 2RABA 3UCDA 1FEAA 1WGYA 2MBQA 4I27A 2K8AA 3BY4B 4YR2A 3UJFA 4IR1A 2IPKD 1N62C 4DXFA 2NVUI 2YMLA 3M9NB 5AE2A 4N6EB 5KFDA 3U8ZA 2Y3RA 1RVKA 3E2EA 5J0YA 4ELVA 3AUOA 4O3SA 4KX6B 1RPLA 3I3TB 1ZD3A 3IV6A 4FO6A 1Z00B 5I4DA 1SL0A 4HROA 3AEEB 1JXEA 1S8OA 1Z3EB 4WQOB 3H7PB 4AQ7A 3AQEA 4TQSA 2MSNA 5G5GA 2V6OA 1YQ4B 2VFUA 2HCFA 3PO5A 2KTFA 4H4YA 4MACA 3VTVA 3OJSA 2NRXA 3RJGA 8ICJA 1R4NI 1TAQA 3DBHB 4MDKE 4FE3A 4PWBA 5KVIA 3PR4A 3IVFA 1RM6B 4EEWA 1F5SA 1H4RA 1OGWA 4KMUA 4ZRJA 4EM3A 2WDWA 1ZD2P 3TARA 2N7JA 3TEWA 3V3XA 3CMMB 3D6JA 2KOXA 1HZ6A 4O0IA 3E56A 1QQ6A 1ZQYA 3JPPA 1AYFA 2AYOB 3Q3FA 2G07A 2PLSA 2FPKA 5AKGA 1TAUA 2K25A 1BGXT 4Y2PA 3WKCA 3ZW3A 7ICRA 5KFZA 2XVTA 2AAQA 3A0HU 4LNNA 1NK7A 1OTRB 3B0AA 4B9NA 1YIWA 1Q3VA 2WDQB 3B2FA 3IHPC 4MGZE 3KFUF 5J0QA 4RQ2A 1L6NA 1NK8A 1OFFA 2BCRA 3JSVB 2LRWA 5T8IA 5ALEA 3ONSA 4UATA 1XANA 2IBIB 2KEYA 1BPYA 3NS1B 2PU0A 4H4WA 3DHGC 4J9RA 4HCLA 1BPBA 1MN8A 3M9OB 3N30A 5C1ZA 2HJ1A 9ICKA 1DOQA 2PJHA 4DSLA 7ICOA 3EPGA 5J0PA 3ZKJC 2DPIA 4DHZB 2P35A 4IM2A 2GQUA 3RAQA 1XO0A 1KOTA 1NZPA 3ZYYX 2K8HA 3V05A 2V4QA 2ZVNA 4JPSA 4IL0A 2GGGA 4Z6EA 1WUEA 1JI7A 3NTUA 2P13A 4DLEA 5BPCA 2ZEQA 4E3CA 1F0MA 3R0KA 1QKZA 2W7PA 4JWMA 1ZMDA 3HX0A 3C21A 5KFTA 2KN4A 3RRGA 2KLCA 1CI4A 1V97A 4RQ4A 2P66A 4W9DA 3V60A 3JYUA 1W1RA 3DWGC 2KTRA 2ZXHA 5L1MA 5ALOA 1R7SA 4RQ7A 5IO9A 1ET6A 3GIIA 5FXEA 4B0EA 1WJ4A 1N5WC 2QDEA 4E74A 3FG2P 4UAYA 3S6JA 1TS3A 2WDTB 1ZY8A 4NZLB 3G6YA 3GS2A 3M8RA 4RGMA 1HXYD 1I4HA 4QZGA 3QU7A 1ZQWA 1DRGA 1V1PB 2AX5A 1E8HA 3BDPA 1BPZA 2PMZC 4ANUA 1EM7A 4J9MA 1Z2MA 2OCEA 4LTUA 3PSTA 1IGDA 3AE4B 2ICIA 3APFA 3VUWA 1L2NA 2Z8LA 3C1ZA 3B0YA 2IHNA 3DVNU 4EEKA 2K9XA 5DBAA 1J19A 3A9KB 2XSXA 4Z6CA 4I2HA 2FE9A 2MAXA 3GILA 1ECQA 4IT1A 2V3SA 5KFGA 1FCCC 2J7QB 2Q0ZX 2NO4A 1XD3B 2WS3B 2IA6A 4J9QA 3PV1A 4WWPA 4EC3A 4Y2JA 4CDGA 4NL9A 3HM3A 3R1ZA 4RM8A 4WJOA 3M95A 1K4QA 2MUTA 2FCNA 4RF1A 1AARA 1WMHB 1WIAA 2KWUB 1ZQFA 2ZCBA 5JCNA 3ORYA 3AL0B 4GN1A 3IAM1 2CRXA 4P0PA 5KG3A 1MC8A 3JW7A 3KBBA 3MGHA 2AGPA 2LMCA 3IT6B 3DOWA 4TUSA 3QUTA 9ICHA 5KL8B 3CNHA 4UB3A 4ECRA 1N6ZA 4XDCA 4F3OA 4NAWB 2KWCA 4LJPB 5H8YE 9ICIA 3SQIA 2QHOA 2V4IB 3ZJUA 1K52A 3Q8BA 2PA6A 3JPTA 4CE6A 2O2VA 2PU1A 2D07B 4A90A 3QX1A 3B2GA 1IBXA 3EUB3 3WK9A 1PGBA 3RNCC 1NPXA 2UVVA 5F3XB 3N6HA 4O9MA 1UWMA 5H2FU 2ZCCA 3RBDA 2YTUA 2JR5A 5ALLA 4Z1YA 1SKSA 2HOFA 3DQVA 2HSZA 4GRTA 1YEYA 1HUOA 5KFMA 2HHXA 4EBDA 3ML8A 4G3XB 3QUCA 1SF0A 1PUZA 5DG8A 2KIVA 4FI4A 2OXOA 3EZ5A 2W55A 4XA5A 2XO7A 4K4GA 3QARA 4M8NA 1C77A 1XHCA 2M56B 3RRHA 1FIQB 1XO1A 2JRIB 1L6VA 2JPHA 4TVYA 4MH8A 3F5AA 3H7PA 1L3SA 4EEYA 1P1AA 2FBWB 1A76A 4EM4A 4DSIA 2KTQA 3ICXA 3MGVA 4F5QA 8ICOA 5DQHA 2QIEB 1SJBA 5KFUA 1WGKA 1WCNA 1GOZA 3SEIA 1LO5D 1V9JA 3W1YA 2KZ3A 5DG7A 5TR5A 1DTNA 4ICVA 2N9XA 3Q8QB 2ZJAA 3R3MA 2ZJ5A 1MBBA 1L3VA 3NO1A 5KFJA 3P4SB 5AK6A 2O2VB 2C7NB 2WF9A 3PHWB 5DPSA 4OHJA 3SENA 2JWUA 5KFLA 3R8BA 1U9LA 4JUZA 2PE9A 3MJWA 4GXKA 2FMSA 1UZXB 2G1EA 2MLBA 4PYTA 2WBAA 2PLIA 5FXDA 3TFSA 3QUBA 4RQNA 8ICGA 2CHWA 2WU5B 3PPAA 4IQVA 2ZG6A 5J0OA 4EWJA 2G9HD 2KMMA 1BNOA 4KLFA 2GR3A 5E79U 2GH5A 5AZHA 1UWXA 2W0HA 3NG0A 2RP5A 8ICXA 4MFFA 2W43A 4GMEA 3DHHC 4GISA 4OZBA 4Q2JA 1PDZA 4TSSA 4A35A 1AHVA 3R11A 1ECWA 5BOMA 2PTYA 5HG2A 2ZIVA 2DAFA 3I63C 2YB1A 4GDKB 4J9KA 4HK2A 2MJEA 4DDID 1NHQA 2NV3A 2G45B 3SEBA 4DWIA 2D6FC 1E6EB 1R4MB 1P7DA 4IQTA 4BX9C 4IC7B 5AE1A 3H8MA 4JQWC 4Z17A 1I4GA 4KDIC 2KDIA 3M3JA 3RJFA 4OJLA 2P0IA 3KUCB 4K7UA 1X1MA 2WXJA 1YD8U 3V6HA 1S0OA 3CWIA 3RCZA 3P2BA 4A55A 1RDFA 3CW2C 4GSWA 2DWQA 3VR9B 2R9ZA 2GH1A 2LI5A 3ZXVA 2OJWA 1QOFA 1N62A 1IYFA 5IIJA 3FYHA 3MQTA 3WAOA 4M9JA 3TADC 1MDLA 5L6FA 2OFJA 3F2CA 5AICA 1T3NA 4ASWC 1NK9A 3DPDA 1QOGA 3SAHA 1YMHE 1Z5SB 3K1ZA 1TS5A 3ES7A 4R65A 1TKDA 4Q8EA 3TEYA 1W1OA 4H4SA 4MELA 2Z7JA 2FYMA 2DQNB 3DEEA 5IIOA 5AE3A 2NBVB 5AHXA 4TUUA 4KSKC 1NK0A 4H4VA 3QIJA 2Y08A 4ACOA 2OHFA 1OUQA 2HHTA 2GGIA 1XCQL 2XBBC 5ALYA 5J18A 3VAWA 4B9KA 3OG5A 2PIAA 3KLSX 2K4EA 8ICIA 2YVCA 1GG3A 1HE8A 2KX3A 1V86A 2KDBA 3FW7A 4HDOA 2WXRA 2BQ3A 1WGGA 1JPMA 1YT3A 2E8PA 8ICBA 4NQKE 1JIHA 4ECXA 1TYTA 1FHUA 3BW7A 2XN9C 3H8SA 2EZZA 4YP3A 2PKEA 2VA8A 4E5TA 2LM4A 5DPTA 2PLPA 2TPRA 5HQXA 4YTPB 1ONEA 3SAGA 1K8RB 2OO6A 4BJQA 2V9WA 4I2CA 2JZ3B 8ICCA 4OZCA 3IFWB 2W9AA 3V72A 4WIPA 2EQ8A 4PL2A 2OEDA 3PHXB 4DQPA 1CQVA 2WXNA 2KG5A 5IIMA 4IWPA 1NYQA 4LDTB 1GEUA 1W1LA 4M0XA 1FFUC 3RITA 1EC9A 4YR0A 4JV1A 2LGYA 3A7RA 2CHXA 3HW2A 4LNKA 4FBUA 2G06A 5HHIA 1FMAD 3GB1A 1MBTA 2CKHB 3FM9A 4MSMB 1EBGA 8ICQA 1P9DU 3RPFC 2J6SA 3NVZB 3VTEA 3AEVA 1LPFA 3FJ4A 1A0PA 3UPQA 1XQQA 2OX4A 4MGGA 3UQAA 3C28A 3MDCA 1XS9D 1W1JA 4I2FA 3B97A 4ZOHC 1ZQNA 1GRTA 2DKZA 3SMVA 3X23A 1V5TA 3TOYA 4RQ8A 3L5KA 4P4PA 4CNQA 3HPFA 2W9MA 1XEEA 3V6KA 2P6RA 1UBIA 3PT2B 4FHKA 2LWPA 3UXOA 2PPGA 3GO2A 3B9JB 3T5KA 3KH0A 4DDGD 4J9LA 4I2IA 4BURA 1UF0A 1YX5B 2QMTA 2XH2A 1P98A 3DBHI 1X2IA 4YD2A 1QSYA 2ZIVB 4S0RA 1X6JA 3BJYA 3PG6A 3MFGA 3CK5A 3AU4A 1X40A 3ZDCA 3QFAA 3B9JA 3RFAA 4O5CA 2MBBB 1L7NA 4AJYB 3AE2B 4K4IA 8ICWA 3NS1A 2GBNA 3RMKC 2WOWA 1ZQDA 2BDUA 4FXCA 1DXSA 3M1YA 4PL1A 3MC9A 1YJJA 4FBTA 3Q8AA 4UB5A 1C4AA 4BBNC 3ZLFA 2OG9A 2O3GA 5KFPA 3H8AA 3GQCA 2MNRA 3Q8KA 3BVGA 3UJ2A 3S2AA 1YN3A 3THVA 2D3AA 3SSZA 4RPZA 1H2IA 2F1IA 4UAZA 5FXPA 3MFHA 4QWBA 4HVBA 4KWSA 3PLUA 4ZOHB 2XGZA 2KVCA 1LVHA 1J2MA 3H6NA 1X2HA 3UJEA 3M9MB 5CTRC 3NS8A 5D2MB 2IMWP 3FAHA 3MP9A 5ALIA 3NVZA 1GRBA 5JXVA 2V3BA 2FKPA 3I4KA 2DKXA 3DV9A 5ALZA 1KL9A 2N4FA 4FP1A 3LAEA 4EBCA 1ZOYB 4EOYA 4RF0A 3RR8A 1ZRNA 5JTIA 5ALVA 4B9LA 1XU4A 3R25A 2KKPA 1WZ3A 2AJQA 1WE7A 5AM1A 3WKBA 1V5OA 2IYDB 4W9HA 1P7FA 1QLNA 1KTQA 4YR3A 4TV3A 1FFUA 3IHQB 2LVOA 5AUKA 1SV0A 1ZQEA 4UB6U 2RDHA 4K7ZA 3RR7A 4ZH4A 1JWBD 2BVCA 2PVGC 1ONFA 1MJDA 3N6JA 4PHDA 2JMGA 1BPEA 4HJGE 5CB1A 4KLQA 3Q45A 1RZTA 1V38A 2K6QA 3M63B 3IG8A 2GGJA 2HXUA 3NZ3A 1X9XA 3PW7A 5ENLA 1E5WA 2OQHA 1W1QA 1ACCA 3T79A 4DQOC 2E8OA 1N63C 1GERA 3ZNID 4IQWA 3W1SA 2CDUA 2ZIUA 2JF5A 2YQUA 1EUVB 4BV6A 3JSVA 4IQUA 2IHMA 2VFVA 4M0WB 2AXTU 2C28A 4RQ1A 2GWSA 1F3PA 4L2YA 3MABA 2YMMA 1UT5A 4U7CA 4DWFA 2KLGA 3N97B 1KLVA 5DB7A 3BZKA 3CP8A 4UBCA 3NGDA 3NHEB 4M9HA 3NY5A 3H40A 1WY8A 1WWTA 3PRMB 1FEZA 3N32A 1NDAA 2IO1B 2INPE 2RK5A 3W9CB 4EMJA 1WWUA 1RG6A 5J2BA 2MU2A 1GB4A 2KD0A 2XCAA 2EMTA 2WXLA 2INDC 3K9OB 2KSOA 1JDFA 8ICRA 2IO2B 3DK9A 1ZQSA 3EHVA 3U7DA 5K4LA 3HILA 4IRKA 2E6XA 3PVLA 5DQGA 5JUMA 3Q8SB 4FA6A 3Q8EA 2JRHA 1L5UA 3DG3A 4JIOU 5DLFA 5FXFA 2KIWA 3H1UA 4J9PA 2CHZA 3AB5A 3P63A 4JX1C 4XWWA 5KFNA 1KLUD 4ECZA 1HQRD 4TQRA 4YL8A 4NAMA 3UIOB 3UQBA 2M4NA 3VCBA 4XWTA 3QK0A 4DSFA 1PGAA 3AE8B 3PREA 4IKGA 2OPJA 2WOIA 4NLZA 1LQBA 4REZA 1DNCA 2Q4TA 5JCLA 1IG6A 1SXDA 4KLMA 2AU0A 1D7YA 4YMNA 3DG7A 3A4RA 4P1CC 2JZPA 2KWDA 2CJOA 3EAOA 2NQLA 3EUB2 4M01A 1CZPA 5D46A 2MX2A 4FZLA 2W7OA 4DQIA 1WJUA 8ICHA 3H0RB 1EU3A 1QOAA 2K3UA 3UQ0A 2YEPB 3ECIA 4YWGG 1TY0A 2N1VA 1GRHA 3TAQA 2JX5A 1LKYA 2BW2A 4YXMA 2JYTA 4GC6A 1WVEA 2WP9B 4LCDE 3LWMA 1TKGA 4NEWA 3UGVA 1P3QU 2PMVA 4EZ9A 2BS4B 1U49A 2E8NA 3WK5A 4J03A 4HG0A 5C2TB 1WGRA 3N3KB 3AMZA 2KOBA 2KX0A 5J0SA 1MO9A 2JRZA 1HEZE 4G7FA 2FDRA 2JH7A 3K1RB 4C7ZA 3R2TA 2OQYA 4Y2YA 1TZ1A 4NJ7A 1BQGA 1GUAB 2KC1A 3TSSA 1PK1B 4US8A 2CXYA 1SWWA 1TKYA 4B6WA 3G6XA 3SR6A 2KQ7A 3L3FX 3J9CA 4XUSA 5JCKA 2Q5WD 3U7ZA 2QDFA 1ZQLA 1JXLA 2GB1A 3WK8A 3EEZA 1SJED 1QLBB 2G3QB 2PKOA 2BGWA 2QDDA 1SL2A 5BMGA 4DL7A 5IDZA 3GE8C 3H70A 3LLBA 1UGMA 2KK0A 5DGBA 1X9WA 4DBGA 2VZKD 4YWOA 2F44A 3L10B 5KFAA 4NPNA 1TY2A 4IP5A 1YQBA 2W82A 3VCNA 3EFCA 2WOVA 3PRZA 1MG4A 4G3IA 3QWZB 5ALTA 4E4UA 3CGEA 2DW6A 1UH6A 2Z0EB 1ZQZA 8ICLA 3FILA 5AKEA 1IV8A 3Q3OC 2KXJA 1EU4A 3PX6A 3VUYA 2E1EA 3Q8RB 3KW5B 1GB1A 5C5JA 3DVGX 4FN2A 2HNEA 5DB9A 3NVWA 3ISCA 3IP4B 3NRZA 4GDLA 3RNAC 4IUMB 5DG9A 2WF6A 4DF8A 1SE3A 3IC9A 3II4A 3GY1A 3HW8A 3NXLA 2EXRA 1ZOLA 2CPRA 5G5GB 1RAXA 2KE7A 1RM6C 2LZ6A 2I5QA 2RDJA 9ICQA 2LHEA 3D46A 3DDMA 4FX9A 1S0MA 1OQRA 1YJIA 1SJCA 3V6JA 1SWVA 2HHQA 3UMBA 5TR3A 1IP9A 2E8MA 3BS5B 2DYOA 4ICAA 5KT4A 1QZEA 4GGQA 1XC9A 4DL2A 4ED8A 4UB2A 5IIKA 1VRAB 4JE3B 2F76X 1XWLA 2YMPA 8ICAA 3MY9A 5J2AA 3DHIC 3HIZA 4ITKA 1W6TA 2PTXA 2DZJA 2KJ8A 4P4MA 3EFUA 1F9CA 1T7PA 3Q8MA 1KQQA 5D94A 1SGHA 3L17A 2IOFK 2W04A 3V62A 3FILB 5KT7A 1Q3UA 5DQIA 2KVSA 4GIVA 3T3FA 2NYVA 5FJOA 3ZVIA 4GXIA 1KKRA 2P4PA 2PFOA 1QQ5A 3UIPB 3P93A 6ENLA 3HJEA 1LV5A 2FLLA 7ICLA 3MR6A 2V0GA 2YVSA 1QH9A 2FCQA 4ECTA 3I99A 4BXOA 2P3ZA 5ALNA 2UUUA 2NPXA 4RQ5A 3UQ2A 1DOXA 3TQPA 2QCZA 3ZJVA 3GV7B 1LGRA 3OGUA 2AHOB 5KG6A 2IZVB 2LD9A 2LM1A 4YSZB 3W8WA 4GB9A 3SN0A 2OH2A 4MLAA 5ALJA 2SAKA 2KYWA 2KDEB 1ZQJA 1BVSA 3IRUA 2BDPA 4QIWF 2Y9UA 2WF5A 3FDSA 4QZIA 3AE7B 4IWOA 4YTNB 2IGGA 3DIPA 3UXLA 4K7SA 4LVSA 1E7PB 3CSFA 1K1SA 4GU2A 4JAYA 5DKWA 3DVNV 1R4NB 2F3NA 1XS2A 4EKUA 5FR3A 4R3DA 1AROP 5FS7A 2D3DA 4QZ8A 4EYHB 4W9LA 3WIMA 2KVRA 1BWCA 2XEWA 3L16A 3ISDA 2OAIA 1XSLA 5DPWA 4K4HA 1LM8B 3PWGA 2P6UA 3DK8A 3LYSA 5DB6A 2R61A 1TFRA 5ALPA 2I1JA 3QHTA 4MGIE 3TJPA 2YMQA 3GC2A 3R10A 2KN7A 3RCYA 2R8GA 3DK4A 3I6EA 2DAJA 4GLXA 2UUVA 3Q3JA 2RLTA 2O6VD 3FW8A 3RH5A 4BWJA 1C78A 1R0MA 4HCHA 5J0XA 2DZKA 4QZHA 3O0FA 3RO6A 3DBSA 2W9CA 2HBJA 3MHZA 4ENLA 2QEJC 2BC0A 1A70A 1C4CA 1BXTA 3ONNA 1T5XD 4DWDA 3TEXA 1VLBA 3RB6A 1QQRA 2WDRB 3Q8CA 4MGKE 3RT3B 3N9YC 2Y1JA 3QA8A 4F5RA 2BKFA 2MH7A 2G5HB 4A9AA 1J97A 3HT3A 1AN8A 1XLNA 3EJDB 4DL4A 4QZAA 4FJVB 3FKYA 2WDVB 2XH0A 2IY1B 3AU2A 3MDAA 4NQLB 4ED3A 3ZXRA 3P4QB 1OXJA 5KAIU 3IM1A 1SJHD 2K8CB 1SSNA 2RRDA 1WFYA 1VZ7A 3THUA 3UMCA 2EAPA 1KTKA 2JVCA 2NRTA 1D8LA 4CO7A 2CU1A 3V5FA 5KVHA 4HJKA 5CP2A 9ICGA 1S10A 1YNTE 1NJWA 4CRXA 2VFSA 2W03A 4QWEA 3GRTA 4GGBA 3NUHB 9ICPA 3APCA 1TE6A 1K53A 2HJ8A 1ZQXA 2XY6A 4DSKA 9ICAA 1OQQA 3DBLB 4X5VA 2L7RA 4FLHA 2KTRB 3KHGA 4I6NB 5L6GA 4M9GA 2FPLA 4KX5A 2JZBB 3BQTA 2J0KA 1GXFA 4GIRA 2M0NA 2QARB 1ZQAA 2PFNA 2K8BA 2PEAA 3Q4DA 4H4PA 1WYWB 1GRAA 1EF5A 4UAVA 3TBLD 1L4ZB 3BVZA 3RZFA 2L52A 4KLEA 1M4VA 2LHDA 3AH7A 4HPLB 4W9EA 5KHOA 1G6JA 1DGJA 4TQ1A 2KICA 2M8SA 4WJPA 3D9XA 3UXKA 1MQ2A 5JH5C 3ZGZA 4AP4C 4RGNA 2J42A 4H2AA 4HPNA 1XLOA 3B0XA 3ZDMC 3ENEA 3Q8FA 4KKJA 1O03A 3ZTCA 3UCCA 1KN5A 2R18A 3T5HA 2LRUA 1U45A 2FE8A 4DSJA 4NJ6A 3DGHA 3RR1A 3TADA 3AEDB 1ZDLA 5MPOA 4AYBF 1FHVA 2FCMA 3EYZA 2AGQA 2VH2A 5KNIA 1NJZA 2KFKA 5BOLA 2V4LA 4K3CA 1N56A 3SHQA 3WALA 4MHVA 4GR1A 1F0XA 1KFDA 4QW8A 1E8FA 1O08A 3MGIA 2WF7A 1HIWA 2H3QA 3QLDA 2XGQA 4F4ZA 3PK7A 3ML9A 4F4YA 4BZAA 4MJSB 2HDEA 3OTRA 5ALSA 3PZDA 4PVEA 3TEZA 2WXQA 3AM9A 4CF5A 2C22A 1L4DB 2WWZA 2MHJA 2N9EB 5D7GA 4ECSA 4JMUA 4K7WA 2LYBA 5CRXA 4WAAA 1DXLA 3Q3NC 1F9JA 1GO3F 3WU2U 1FCLA 1UPHA 2B3AA 1SIJA 3I28A 4F8RA 3IJQA 2K22A 4ZCWA 4H83A 1QTMA 5DPRA 1OEYJ 3GIKA 4JN7A 1ZP0B 2BPGA 3VFKA 3ZLGA 4C7YA 4DHJD 3IT4B 4UQGA 4I28A 1D8YA 2M17A 3PLVA 4MT5A 4C8LA 2IOFA 5DBCA 4BKGA 2FAZA 5ALRA 1EBHA 1GV4A 2MA1A 4MFAA 1PQSA 3L4PA 1Q1RA 2P88A 2YVFA 2OZ3A 2P8CA 2K89A 1XCTL 4YCXA 3PSFA 4KZ0A 4FZMA 5IP4D 4ICUA 4EFOA 2GOWA 4PVKA 3EKGA 3QN3A 1E8YA 1KLGD 3TW9A 2ZZPB 3KOOA 2JEIA 1KBUA 2WAQC 3NJTA 5EE9A 4II3B 4I2BA 1NOMA 2GLSA 2MP2B 1HTOA 4LNIA 2XGPA 2K5PA 2MBHA 3DG6A 5TISU 4JB1A 5ALKA 3GDXA 2HBMA 3P3BA 1ZGUB 3OJ4B 2JXXA 4KMOB 4DFDA 2KJHB 2NO5A 4GDKA 1W1SA 3OZYA 5J0RA 4BDPA 2BCPA 4OZAA 3W2DA 2NVKX 1NKEA 2PTLA 4QZFA 2GGHA 4JQ9A 1DGSA 1WJ6A 1DIIA 2GQTA 4P6VF 3RH4A 1WZ0A 2D3BA 1FD6A 2ZZCA 1I7HA 2V3AA 2XY7A 1FEHA 3KKAC 1Y8RC 3QC8B 4W9KA 4Q45A 1QSLA 5KFEA 2KQSA 4DXGA 4K1RB 2BKEA 1JWAD 1XDIA 3WA0A 2ZJDA 2OOBB 7ICSA 2GBMA 1J2NA 3M8SA 4BCAA 8ICFA 2ZUBA 2J52A 3AV8A 3ETLA 2JH1A 5KG7A 1UXYA 5FJUA 4NLCA 2I1KA 1C4PA 4UW9A 2ZIUB 3IXSA 4YT0B 3NZUA 1HA5A 2BVFA 5JCIA 2WPCA 3SV3A 9ICJA 1WSPA 1ZQRA 1WCLA 2P8BA 2JQRB 1SB3C 1KM7A 1T0YA 8ICVA 3EWAA 2FNJB 4GXBA 4M9LA 2C7MB 2WXMA 4PVHA 3KZIU 2WLBA 8ICTA 2NTTA 2GDQA 3OJ3A 5KFHA 3RJHA 1VZ6A 2ZIWB 5GXGB 3V6CB 3VUXA 3QZ7A 4GC7A 3OPSA 3AXCA 5AK3A 5D4BA 1TYPA 5EU9A 1NHRA 2WYQA 2YAUA 4IOIE 2C60A 4PS3A 2KNBA 3WANA 4WWOA 3U26A 2MEKA 2XICA 2W54A 4TMAB 3QFBA 4GFIA 5J0TA 5DLGA 2MBRA 1QILA 2A1JB 3VVWB 4JK1A 4ZRQA 2B0CA 4DLGA 2OKTA 1J7BA 1T8EA 1ZQVA 1MG8A 3PW2A 3TSHA 3I6TA 9ICBA 5AIAA 2BWFA 1U47A 5L1LA 2AGOA 2BCUA 2BCQA 4MM3A 4IL6U 2INNE 2XNAC 7ICTA 1UD7A 3C0PA 1R4MI 3HRDC 2R2ZA 2LXCA 1E90A 1XF5L 2GBKA 2H3VA 2HQMA 2BYEA 5AM3A 3VDZA 3C1YA 3UI3A 2I0KA 3PWIA 2VJ4A 9ICXA 2FIFA 2F1JA 5FS9A 3QU2A 2ISOA 4UDUC 4OD0A 4F4XA 3OLMD 4J3OD 3JPOA 1WX7A 1I42A 2K8CA 3RRAA 1WUDA 3KLJA 3PVXA 2EAMA 4LNOA 4PJ0U 4RGTA 4IP4A 5KT6A 3BS7A 5J2DA 1D9FA 8ICMA 1UA0A 4ECQA 1XNSA 2PP1A 4DQQA 2DUYA 1JUDA 2Y0SC 5IOIA 1KFYB 2OJRA 4M2YA 3UJSA 1L5PA 4YXDB 3MC8A 2YVJA 1FPYA 2DFLA 5J2JA 1IUEA 3OWEB 4YQWA 4HYKA 3KQ4A 2QJJA 3RN9C 2D3GA 4EX6A 4QZDA 3HSUA 3OSPA 1JRPA 4WH4A 2ZVOA 5EOZA 2C2EA 1V8CA 1BPDA 4HWIB 4RQ0A 2RDIA 4W9CA 5L9XA 1C79A 1NYRA 2D3CA 4TKNA 4A6GA 1JMLA 5IA7A 4M02A 1VAOA 5J2RA 4DF4A 4RMAA 4ZYNA 4B9MA 1YQ3B 1FFVC 4B9TA 5KFSA 4C4TA 1L0YB 3QXGA 3F5EA 2MQJA 2CFYA 2AKZA 1IIPA 3QKEA 1RRBA 3KTQA 1PUTA 2I38A 1Q10A 3QAQA 5DCNA 1E8GA 4F2RA 1KH0A 4PYUA 3SI8A 9ICWA 1I4QA 4XLOA 4XDDA
chains in the Genus database with same CATH topology
1K51A 4AS1A 1DZNA 1P7EA 2LUMA 4RFBA 5HFYA 1PFDA 1EWCA 1QF6A 3IAS1 3AEFB 1N5WA 1JCKB 2J53A 1WYGA 1WWTA 4ZYSA 1EWYC 3AEGB 2RK5A 1JWSD 2INPE 3W9CB 3AE1B 1ZDVA 1I4PA 1GB4A 1DIQA 2L1AA 3AECB 2WXLA 3I9V1 2WXHA 2J4XA 4PZFA 3BK1A 2N0SB 1AW7A 2E6XA 3AEBB 3Q8EA 3SFDB 3TX1A 1XLPA 2WXOA 3BYTB 1IBXB 1QLTA 5FXFA 2P3HA 3BZDB 3I57A 2BVGA 1ZDXA 3AB5A 3P63A 4JX1C 4XWWA 1KLUD 1CK1A 1HQRD 4WWMA 1DOYA 2PVOD 4NAMA 3VQIA 4XWTA 2RPVA 1PGAA 3AE8B 4IKGA 4C56C 1HZ5A 4REZA 5I1WA 2BB5A 3ZJTA 2IPKD 1N62C 4DXFA 4HKQA 1F2RI 2DYMA 5AE2A 4N6EB 2Y3RA 2JZPA 2KWDA 3D2JA 3AE5B 2CJOA 2V3NA 3S1DA 1VDVA 3EUB2 4KX6B 1V1PA 1CZPA 1E9MA 2M0AA 3POPA 5I4DA 4HROA 3AEEB 4JWUC 2SEBD 1QOAA 1EU3A 2K3UA 2M19A 4AQ7A 2YEPB 4YWGG 5G5GA 1TY0A 1YQ4B 5FKAC 2BYTA 2JX5A 2VFUA 1FNUA 2BW2A 4MACA 1QOBA 2JYTA 1RYJA 2WP9B 1WVEA 4PWBA 1TKGA 3BK2A 1BUIC 1RM6B 4BC9A 2PMVA 5G5HA 2BS4B 3ETRA 1TS2A 3AE3B 3MC0B 2WDWA 1CJEA 1Y56A 2N7JA 3V3XA 5C2TB 3TEWA 4HG0A 1ESFA 2PW9A 3MJ5A 1HZ6A 3AMZA 1YN5A 3E56A 1XLQA 5H92C 1AYFA 1HEZE 3KJMA 2PLSA 4IDIA 4C7ZA 3ETRB 3R2TA 4HKZE 3FW9A 3BYYB 1N60A 3TSSA 1ZUD2 4US8A 2I2YA 3PO0A 3P42A 1TKYA 3J9CA 3SR6A 2WDQB 3B2FA 3LXFA 2Q5WD 1ENFA 3U7ZA 2GB1A 1NEKB 1C76A 1OFFA 1SJED 2Y5PA 1QLBB 1B9RA 4PWCA 2PKOA 3EGRA 5T8IA 1WVFA 3DEDA 5BMGA 3HRDD 1TKEA 2CU3A 2QPMA 3NS1B 5I1VA 3NRZB 3LLBA 2JSVX 2ACZB 2VZKD 1SBBB 1TY2A 2VFRA 2ZW1A 4YSYB 2W82A 2LEKA 1W1KA 2GQUA 3ZYYX 2BB6A 4WQMA 3V05A 2Q4WA 4JPSA 3PZ8A 2WXGA 2V3PA 2X38A 4BBYA 2E5AA 3FILA 2P13A 1I4RA 1QKZA 1EU4A 3VRBB 5EE1A 2KN4A 1GB1A 1ET9A 4ML8A 3HVZA 4CQNA 2JU6X 1V97A 1W1RA 3NVWA 1MVKA 2WU2B 2K0PA 3NRZA 3DWGC 3U4EG 1R7SA 3WCQA 2WXIA 1L6UA 1ET6A 1SE3A 5FXEA 3W8ZA 1AHUA 4B0EA 1N5WC 2RDGA 2EXRA 2AQ3B 1TS3A 1WRIA 2LJIA 2IJ0A 4LK0M 5G5GB 4NZLB 3GS2A 1RM6C 1N61C 4RGMA 3BVMA 1HXYD 2LHEA 1OQRA 1YJIA 1I4HA 2Y4GA 1V1PB 2AX5A 1E8HA 1SE4A 3S1EA 3PZ7A 4US9A 2DYOA 3KWVA 4N59A 1VJKA 1EM7A 2GI9A 4LTUA 3AE4B 1IGDA 2ICIA 1VRAB 4JE3B 2Z8LA 4ITKA 4GDLB 3GP7A 2K9XA 1JROA 1AHZA 2IGHA 3FWAA 4C80A 4B0MA 2QSDA 2IGDA 1D6EC 3FILB 1FCCC 5BMHA 2N9LA 2WS3B 4O1NA 1XO3A 5BYRA 4EC3A 3A7UA 2IPIA 5EE0A 2P4PA 2DBYA 2JYEA 2R8DA 4RF1A 2V0GA 1GAQB 2YVSA 3AE6B 4UD8A 3W5VB 3I99A 3IAM1 3LYYA 4L1BA 2UUUA 1RFKA 1DOXA 2EELA 4XDDA 3ZJVA 2LMCA 3IT6B 4YSZB 3W8WA 4XDCA 3H8HA 4NAWB 4MLAA 2SAKA 5H8YE 3BIID 3SFEB 2V4IB 4PT5A 1K52A 1ZXHA 3AE7B 3Q8BA 4KGTA 3ZJUA 4YTNB 1K50A 2IGGA 1NI3A 4A90A 3PQBA 3B2GA 1IBXA 3EUB3 1PGBA 1TZOA 1E7PB 2H89B 4JAYA 3RFZB 2L32A 1RWSA 1ROEA 1SB3B 4RGOS 3TUOA 1UWMA 3E9SA 4A6QA 2KQ4X 3S1CA 1T3QA 1UGJA 2L83A 5FR3A 4R3DA 1FXAA 1SF0A 2OAIA 2W55A 2AQ1B 3AN1A 1C77A 2M56B 2R61A 1FIQB 3NVYB 1L6VA 4TVYA 2DLBA 4MH8A 2RMMA 3O13A 1X2GA 5LNK1 2UUVA 1UUPA 3FW8A 1TYGB 1C78A 2FBWB 3W8XA 2QIEB 3MHZA 1WGKA 2QEJC 1GOZA 1LO5D 1A70A 1C4CA 1BXTA 4TVWA 3RJ8A 1T5XD 4HRSA 4KGSA 3TEXA 1VLBA 3Q8CA 1QQRA 2WDRB 2VAOA 1J7AA 1MBBA 3N9YC 3P4SB 2MH7A 1TS4A 4A9AA 1AN8A 1XLNA 1FFVA 5HMRA 4OHJA 2WDVB 2ON8A 2JWUA 3T3OA 3R8BA 3P4QB 1SJHD 1SSNA 1N5XA 1VZ7A 2G1EA 4PYTA 1KTKA 1FM0D 5C3JB 5FXDA 2PLIA 2WU5B 1YNTE 2VFSA 3U52E 1W1MA 3NUHB 1DOIA 2G9HD 2KMMA 4D2KA 1K53A 1UWXA 1OQQA 1JWUD 2BTEA 1I4XA 5L6GA 4OZBA 4Q2JA 4TSSA 4USAA 1AHVA 2VZKB 5HG2A 1L4ZB 3BVZA 4GDKB 1MHXA 2L52A 1M4VA 2LHDA 3AH7A 3CIRB 1DGJA 4TQ1A 2MJEA 3SEBA 1E6EB 1FO4A 3ZGZA 4RGNA 5AE1A 2J42A 4H2AA 1XLOA 1I4GA 3S1FA 1ZXIA 1FNVA 3Q8FA 4KKJA 4OVZA 4L23A 2WXJA 1QT9A 5BMIA 4PVJA 2FE8A 1E0ZA 3CWIA 3AEDB 4A55A 5HI1A 5MPOA 1IGCA 2DWQA 3VR9B 1GPXA 1QOFA 1L0VB 1VZ8A 1N62A 3R2IA 1FRDA 1PYWD 3T3NA 1D5XC 2BBCA 3NVVA 4XE0A 1F0XA 2E3TA 1BMLC 3BWUD 3HUIA 2QJLA 1E8FA 5L6FA 4N58A 2WNMA 1QOGA 1YMHE 2BT6A 1TS5A 1QLUA 1I19A 4HEA1 5AWVA 2HDEA 3TEYA 1W1OA 4PVEA 1KF6B 3TEZA 2WXQA 1D4BA 5AE3A 3AM9A 1N60C 1L4DB 5D7GA 1D5ZC 2ONQA 2Y08A 2OHFA 2BVHA 1FRRA 1ZPSA 1VR9A 4RNAA 1FCLA 1XCQL 2MJDA 1SIJA 2K22A 2PIAA 3KLSX 1E0YA 1ZP0B 4C7YA 4DNSA 3HVDA 3IT4B 3DWMA 3FW7A 2WXRA 1D5MC 4YSXB 4MT5A 4TQ0A 3P1MA 3L4PA 2KACA 3BW7A 2XN9C 1JW9D 2HTME 5D3DA 1XCTL 3P4RB 2BS2B 5TSSA 4A8XC 3NVWB 4PVKA 1B1ZA 2PLPA 1KLGD 4GLSC 5AUIA 2YEPF 2LFIA 3ABVB 4YTPB 5EE9A 3JS8A 1SE2A 1YN4A 4ZHOA 5HQXA 2H88B 2K5PA 4OZCA 4LLGM 2AQ2B 4JB1A 4WIPA 2N9KA 2OEDA 1CQVA 2WXNA 2BS3B 4RCOA 1E10A 1NYQA 1W1SA 1W1LA 4OALA 3KWLA 2FUG1 1SEBD 4OZAA 3W2DA 1FFUC 1SXTA 2PTLA 1NVID 5D79A 1C9FA 2WXKA 3A7RA 4ARIA 3A7AA 1F0ZA 2W3SA 1DIIA 2GQTA 4P6VF 1FD6A 1FMAD 1I7HA 3GB1A 1F77A 1FEHA 1MPEA 2WXFA 1MBTA 1ZR6A 2IDYA 4OW0A 1WXQA 4DXGA 3U2SC 1JWAD 3RPFC 2NMQA 3NVZB 3VTEA 4BCAA 2J52A 3AV8A 2JXTA 1UXYA 5FK9C 1C4PA 3IXSA 4YT0B 4P16A 1HA5A 4ZHPA 1W1JA 4ZRPA 2BVFA 1MHHE 4ZOHC 1WSPA 2Y3SA 2JQRB 5E6JA 3PM9A 1SB3C 5D3IB 1N63A 1JWMD 4M0WA 2WQYB 4MM3B 3VR8B 2WXMA 4PVHA 5BYSA 2WLBA 1JQ4A 2NTTA 2Y3AA 2KDMA 1VZ6A 5GXGB 1XEEA 2CJNA 3B9JB 4IOIE 2D5GA 2NQWA 3NVYA 2QMTA 5HHDG 2MEKA 4TMAB 2W54A 3R07C 3RJAA 1T6BX 2MBRA 3MFGA 1FNWA 1QILA 1F2RC 3B9JA 3NVVB 4ZRQA 3AE2B 1J7BA 1UNSA 3NS1A 3TSHA 3Q69A 3TSJA 4FXCA 4YTMB 5ADZA 3Q8AA 1YJJA 4JWSC 1C4AA 4KKIA 2INNE 2LGIA 2QILA 2XNAC 1T3QC 4O95A 2GRIA 3C0PA 3HRDC 2O3GA 3W5UB 2R2ZA 3BVGA 1L0XB 1XF5L 1XXGA 3P4PB 2VFTA 1YN3A 3UI3A 5HHZA 2I0KA 5FXPA 2WXPA 1N61A 1TJEA 4UDUC 2NTSA 4J3OD 4ZOHB 4RGTA 3URYA 3LB8C 3DQ0A 3SR6B 4BC7A 1X2HA 3FAHA 3MP9A 5BYQA 1NENB 1DYQA 1KFYB 3NVZA 2KAJA 5JXVA 5EE3A 1L5PA 3AE9B 4EE2A 4YXDB 1ZOYB 3LAEA 1JALA 4RF0A 1VQZA 3ZQ4A 4NJCA 2W3RA 2Y5CA 1IUEA 3OWEB 3KQ4A 1FXIA 1J7CA 5G5HB 2AXRA 1HSKA 1JRPA 4WH4A 3HSUA 1P7FA 5K8EA 1FIQA 3FC4A 1V8CA 1FFUA 5AUKA 4KGRA 3D2HA 2MJ3A 2RDHA 1JWBD 1PDXA 1ZXIC 2PVGC 1C79A 3VRAB 1NYRA 1JMLA 4HJGE 2TSSA 3AEAB 1VAOA 3NZ3A 2B76B 1YQ3B 1FFVC 3D2DA 1KRHA 1W1QA 1ACCA 3GSYA 3C8YA 1L0YB 1MI0A 1STEA 4DQOC 4RH6A 1N63C 1PUTA 3EA6A 2I38A 4WURA 3W1SA 2QKNA 1AWDA 1Q10A 2Q85A 2ZW0A 4ARCA 4WAFA 1ZE3D 1PGXA 1E8GA 1KH0A 2VFVA 1V1OA 1I4QA 4L2YA 4XLOA 2EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZN A;  1PFD A;  1QF6 A;  3AEF B;  1N5W A;  1WYG A;  1WWT A;  1EWY C;  3AEG B;  2RK5 A;  3W9C B;  3AE1 B;  1DIQ A;  3AEC B;  4PZF A;  2N0S B;  3AEB B;  3SFD B;  3TX1 A;  1XLP A;  1QLT A;  5FXF A;  2P3H A;  2BVG A;  3AB5 A;  3P63 A;  4JX1 C;  4WWM A;  1DOY A;  2PVO D;  3AE8 B;  1N62 C;  5AE2 A;  4N6E B;  3D2J A;  3AE5 B;  2CJO A;  3S1D A;  1VDV A;  3EUB 2;  4KX6 B;  1CZP A;  1E9M A;  4HRO A;  3AEE B;  4JWU C;  1QOA A;  2M19 A;  5G5G A;  1YQ4 B;  2VFU A;  2JX5 A;  1QOB A;  1WVE A;  1RYJ A;  2WP9 B;  4PWB A;  1TKG A;  1RM6 B;  4BC9 A;  5G5H A;  2BS4 B;  3ETR A;  3AE3 B;  1CJE A;  4HG0 A;  5C2T B;  3AMZ A;  1XLQ A;  5H92 C;  1AYF A;  3KJM A;  2PLS A;  4IDI A;  4C7Z A;  3ETR B;  3FW9 A;  1N60 A;  1ZUD 2;  4US8 A;  3PO0 A;  1TKY A;  3SR6 A;  2WDQ B;  3B2F A;  3LXF A;  2Q5W D;  1NEK B;  1OFF A;  1B9R A;  1QLB B;  4PWC A;  2PKO A;  1WVF A;  3DED A;  3HRD D;  2QPM A;  1TKE A;  2CU3 A;  3NS1 B;  3NRZ B;  3LLB A;  2ACZ B;  2VFR A;  4YSY B;  1W1K A;  2LEK A;  2GQU A;  3ZYY X;  4WQM A;  2Q4W A;  4BBY A;  2E5A A;  2P13 A;  3VRB B;  5EE1 A;  4ML8 A;  3HVZ A;  1V97 A;  1W1R A;  3NVW A;  3DWG C;  2WU2 B;  3NRZ A;  1R7S A;  3WCQ A;  1L6U A;  5FXE A;  3W8Z A;  1AHU A;  1N5W C;  2EXR A;  1WRI A;  5G5G B;  1RM6 C;  1N61 C;  1OQR A;  1YJI A;  2AX5 A;  1E8H A;  3S1E A;  4US9 A;  4N59 A;  1VJK A;  4LTU A;  3AE4 B;  4ITK A;  2K9X A;  1JRO A;  1AHZ A;  3FWA A;  4C80 A;  2WS3 B;  1XO3 A;  4EC3 A;  3A7U A;  5EE0 A;  2P4P A;  2DBY A;  2R8D A;  1GAQ B;  2YVS A;  3AE6 B;  4UD8 A;  3W5V B;  3I99 A;  1RFK A;  1DOX A;  4YSZ B;  3W8W A;  4MLA A;  5H8Y E;  3BII D;  3SFE B;  3AE7 B;  4YTN B;  1NI3 A;  3B2G A;  3EUB 3;  1E7P B;  2H89 B;  4JAY A;  1RWS A;  1ROE A;  1SB3 B;  1UWM A;  3S1C A;  1T3Q A;  2L83 A;  1FXA A;  1SF0 A;  2OAI A;  2W55 A;  3AN1 A;  2M56 B;  3NVY B;  1FIQ B;  1L6V A;  4TVY A;  1X2G A;  3FW8 A;  1TYG B;  2FBW B;  3W8X A;  2QIE B;  1WGK A;  1A70 A;  4TVW A;  4HRS A;  1VLB A;  2VAO A;  2WDR B;  1J7A A;  1MBB A;  3P4S B;  2MH7 A;  4A9A A;  1XLN A;  1FFV A;  5HMR A;  2WDV B;  3P4Q B;  1N5X A;  2G1E A;  4PYT A;  1FM0 D;  5C3J B;  5FXD A;  2PLI A;  2WU5 B;  2VFS A;  1W1M A;  1DOI A;  2KMM A;  1OQQ A;  4USA A;  1AHV A;  2L52 A;  3CIR B;  3AH7 A;  1DGJ A;  2MJE A;  1E6E B;  1FO4 A;  5AE1 A;  1XLO A;  3S1F A;  1ZXI A;  1QT9 A;  4PVJ A;  1E0Z A;  3CWI A;  3AED B;  5MPO A;  2DWQ A;  3VR9 B;  1GPX A;  1QOF A;  1L0V B;  1N62 A;  1FRD A;  3NVV A;  1F0X A;  2E3T A;  3HUI A;  1E8F A;  2QJL A;  4N58 A;  1QOG A;  2BT6 A;  1QLU A;  1I19 A;  1W1O A;  4PVE A;  1KF6 B;  5AE3 A;  3AM9 A;  1N60 C;  2OHF A;  2BVH A;  1FRR A;  2MJD A;  1SIJ A;  2K22 A;  2PIA A;  1E0Y A;  1ZP0 B;  4C7Y A;  4DNS A;  3DWM A;  3FW7 A;  4YSX B;  3P1M A;  3L4P A;  3BW7 A;  1JW9 D;  2HTM E;  3P4R B;  2BS2 B;  3NVW B;  4PVK A;  5AUI A;  5HQX A;  3ABV B;  4YTP B;  5EE9 A;  3JS8 A;  4ZHO A;  2H88 B;  2K5P A;  4JB1 A;  2BS3 B;  1E10 A;  1W1S A;  1NYQ A;  1W1L A;  4OAL A;  3KWL A;  1FFU C;  1NVI D;  5D79 A;  3A7R A;  3A7A A;  1DII A;  2GQT A;  1F0Z A;  2W3S A;  4P6V F;  1FMA D;  1I7H A;  1MBT A;  1ZR6 A;  1WXQ A;  1JWA D;  3RPF C;  4BCA A;  3NVZ B;  3VTE A;  3AV8 A;  1UXY A;  4YT0 B;  4ZHP A;  1W1J A;  2BVF A;  4ZOH C;  2JQR B;  3PM9 A;  1SB3 C;  1N63 A;  2WQY B;  3VR8 B;  4PVH A;  2WLB A;  1JQ4 A;  5GXG B;  2CJN A;  3B9J B;  2NQW A;  3NVY A;  2W54 A;  3R07 C;  2MBR A;  3NVV B;  3B9J A;  3AE2 B;  1J7B A;  3NS1 A;  3TSH A;  3TSJ A;  4FXC A;  4YTM B;  5ADZ A;  1YJJ A;  4JWS C;  1T3Q C;  4O95 A;  2O3G A;  3C0P A;  3HRD C;  3W5U B;  2R2Z A;  3P4P B;  2VFT A;  5HHZ A;  2I0K A;  5FXP A;  1N61 A;  1TJE A;  4ZOH B;  3LB8 C;  3DQ0 A;  3SR6 B;  4BC7 A;  1X2H A;  3FAH A;  1NEN B;  1KFY B;  3NVZ A;  2KAJ A;  5EE3 A;  1L5P A;  3AE9 B;  4YXD B;  3LAE A;  1ZOY B;  1JAL A;  1VQZ A;  2W3R A;  2Y5C A;  1IUE A;  1FXI A;  1J7C A;  5G5H B;  2AXR A;  1HSK A;  1JRP A;  1FIQ A;  3FC4 A;  1V8C A;  1FFU A;  5AUK A;  3D2H A;  2MJ3 A;  1JWB D;  1PDX A;  1ZXI C;  2PVG C;  3VRA B;  1NYR A;  3AEA B;  1VAO A;  2B76 B;  1YQ3 B;  1FFV C;  3D2D A;  1KRH A;  1W1Q A;  3GSY A;  1N63 C;  1PUT A;  2QKN A;  1AWD A;  2Q85 A;  1E8G A;  2VFV A;  4XLO A;  2EKI A; 
#chains in the Genus database with same CATH topology
 4BGD A;  4AS1 A;  4QWC A;  1P7E A;  2LUM A;  4II2 B;  3H0L B;  2FID A;  4DFK A;  1V49 A;  1ZQU A;  2OLA A;  3TWA A;  3GV5 B;  1WYG A;  2C2D A;  3KHL A;  4DHJ B;  3V6E B;  2JEF A;  3AE1 B;  1ZDV A;  5JRT A;  2L1A A;  7ICU A;  3KHH A;  2OVL A;  2ES6 A;  5HML A;  3UXP A;  4KLI A;  2ZUC A;  3BK1 A;  2R8H A;  3O0H A;  2K1F A;  3GZN I;  4DCC A;  2Z0D B;  8ICZ A;  2WXO A;  3TCA A;  1IBX B;  2BVG A;  3H4D A;  1ZDX A;  3PGE A;  4FAD A;  3DEQ A;  5F9L A;  4WWM A;  4R8U B;  2HZG A;  4KLD A;  3VQI A;  5GRT A;  3V5C A;  2PI5 A;  4UAW A;  3ZNH B;  1HZ5 A;  4HNC A;  4GIB A;  3SU8 X;  2C5L C;  4HKQ A;  3A9J B;  1F2R I;  2DYM A;  5CHG A;  1TKK A;  5EWG A;  4PH5 A;  2HHS A;  4HCN B;  3GU3 A;  1WH3 A;  2MWS B;  3VH4 B;  3JZU A;  4NL9 C;  1V81 A;  3V7K A;  2L8J A;  4QWD A;  2V3N A;  1VDV A;  1KN0 A;  1NJX A;  4BKS A;  3HP6 A;  2OYY A;  3SAF A;  5BO4 B;  2LVP A;  2W11 A;  4UAR A;  1X42 A;  1UHU A;  4Z6F A;  5AKK A;  2M19 A;  2POZ A;  3T9P A;  2BYT A;  1FNU A;  2ZIX B;  1QOB A;  1RYJ A;  5ALG A;  4M0A A;  3PZP A;  1K5O A;  4P1B C;  4E8G A;  5KG5 A;  4KLL A;  2KN5 A;  4G9B A;  3PY8 A;  3BK2 A;  1BUI C;  3DBR B;  4MFC A;  4BC9 A;  3PV8 A;  3ETR A;  1TS2 A;  3AE3 B;  3MC0 B;  3OAW A;  1D9D A;  3RGT A;  2MSE D;  2X50 A;  1ESF A;  5AI0 A;  2PW9 A;  3MJ5 A;  1YN5 A;  4KLG A;  1XLQ A;  2N9P C;  1SKW A;  4JDR A;  1D3Z A;  4M6W B;  3ETR B;  2A5U A;  2MW5 A;  2LUE A;  4HKZ E;  4MJS A;  4OVV A;  4EEN A;  3QTP A;  3FW9 A;  4P4O A;  1F8W A;  3SQS A;  3KKA A;  2KC2 A;  2N7E A;  3PO0 A;  1TAM A;  3QJZ A;  3GOE A;  3LXF A;  2LYA A;  1TV9 A;  1ENF A;  2BQR A;  4NAW A;  4DOB A;  1C76 A;  4NNJ B;  2F2A B;  2D10 A;  3UJR A;  3EGR A;  1GC6 A;  2HBK A;  1L8P A;  1TKE A;  3MZN A;  2JSV X;  4PS8 A;  2ACZ B;  8ICP A;  3H12 A;  7ICG A;  1M6Y A;  4F5O A;  3CST A;  1KD0 A;  1SBB B;  4ANV A;  2VFR A;  4YSY B;  1W1K A;  4RPY A;  2LEK A;  4HPM B;  4LDT D;  3MUC A;  1YQZ A;  9ICF A;  2QGY A;  3CB3 A;  4LII A;  2JK6 A;  2RSU A;  2GQW A;  4B9U A;  5ALD A;  2Q4W A;  3QEB Z;  1QCK A;  3PZ8 A;  2JGA A;  4WJN A;  4F1S A;  1L3U A;  2V3P A;  4BBY A;  3V3W A;  2HHV A;  3AU6 A;  2QJN A;  2WHI A;  1B43 A;  1I4R A;  3L13 A;  1NKB A;  2IO0 B;  2NBU A;  4KLS A;  1CUK A;  1CMX B;  4Q8F A;  1ET9 A;  3HVZ A;  1X9M A;  2JU6 X;  2HMX A;  4F91 B;  3FYY A;  2Y9T A;  3U4E G;  3KZX A;  4ED6 A;  4LZD A;  3PR5 B;  1KFS A;  1S0V A;  2L3Z A;  4DFJ A;  1L6U A;  1NKC A;  2C2R A;  4G50 A;  1AHU A;  1T4G A;  1U48 A;  3NOB A;  5KFF A;  3LXD A;  2KZR A;  4RQ3 A;  2AQ3 B;  2WP6 A;  1XSN A;  2DX5 B;  4LK0 M;  2MUC A;  3CXO A;  3TCS A;  2GR1 A;  3BVM A;  3NUQ A;  2QQ6 A;  2BPC A;  1PZN A;  4C8N A;  3PML A;  3SV4 A;  4QNL A;  4ECU A;  7ICQ A;  4E0D A;  2N1W A;  1SE4 A;  3BIN A;  3V4B A;  2QAE A;  5IN7 A;  4US9 A;  4N59 A;  1VJK A;  2GI9 A;  3OSN A;  2H3Z A;  2EAO A;  4ED2 A;  8ICK A;  2RGF A;  3RI7 C;  4J56 A;  3ZVH A;  2LHT A;  1V6E A;  4C0Z A;  2BC1 A;  3CAW A;  5BOE A;  3N4F A;  1AHZ A;  4P0Q B;  1JRU A;  1Y88 A;  3K1G A;  4F71 A;  2BZF A;  5JCM A;  3PSE B;  2BR0 A;  2DHZ A;  4B0M A;  2QSD A;  8ICY A;  3KVF B;  2YVG A;  4CGZ A;  5J2H A;  2IGD A;  4MSQ B;  3MC1 A;  5J2G A;  5BMH A;  1PDY A;  2K4H A;  1JMS A;  3HPO A;  3VHT C;  4OO1 J;  2JEG A;  3A7U A;  2BYV E;  3T9L A;  3C5F A;  4YXJ A;  5EE0 A;  3T5J A;  4KTQ A;  2D11 A;  1QQ7 A;  2DBY A;  3BQ7 A;  1LVL A;  5AKI A;  2JYE A;  2ZIW A;  5AZF A;  4ANX A;  2R8D A;  1RLF A;  5B66 U;  2W9N A;  4IM3 A;  7ENL A;  4Y2Q A;  1TVA A;  4O5K A;  4RQ6 A;  3CXB A;  3W5V B;  1SZP A;  5KFY A;  3IG5 A;  1RFK A;  2ZTC A;  1EBD A;  2EEL A;  2NPT B;  3ZI4 A;  3PNC A;  3QU4 A;  7ICV A;  3H8H A;  4G11 A;  3SBF A;  4A8E A;  4F93 B;  5J8Y A;  1ZQQ A;  3SFE B;  2GRT A;  1ZXH A;  2V1Y A;  4KGT A;  4YFK A;  3ZLZ A;  4I29 A;  7ICM A;  1KRP A;  8ICU A;  3PQB A;  4TUP A;  2DNF A;  3IK4 A;  2H3I A;  4DX3 A;  4TUQ A;  4IRC A;  2H89 B;  2HOI A;  1RQL A;  3H7S A;  2AL3 A;  3TUO A;  2ATL A;  2FLN A;  2KD1 A;  3E9S A;  4A6Q A;  2WFA A;  4PK1 A;  2F1H A;  2L83 A;  4UB1 A;  1EC7 A;  1JN3 A;  2EH9 A;  4F50 A;  7ICE A;  5CHV C;  1WJN A;  2QB0 B;  2XK5 A;  5EBK A;  1FXA A;  2PFP A;  2BHN A;  2EQY A;  2J6T A;  1ZMC A;  2EZX A;  4UBB A;  2ODG A;  3PRP B;  5L1K A;  1ZQK A;  2O56 A;  3N4M B;  4J57 A;  2OEH A;  2KJR A;  5FP0 A;  3O13 A;  4FFD A;  1GET A;  2G09 A;  2YY6 A;  4Y2X A;  3W8X A;  4PGY A;  2D2Q A;  2ZNV B;  4EMI A;  3N1Y C;  2LBO A;  5KAF U;  5J2K A;  4TVW A;  3U4F A;  1B22 A;  4HRS A;  4KGS A;  1NHP A;  3WKE A;  3RUL A;  2VAO A;  3CYJ A;  2L05 A;  1HEK A;  5EWF A;  4DXK A;  4M6U A;  2GLE A;  2LVQ A;  2WF8 A;  4RUA A;  1TS4 A;  3T8M A;  4ROP A;  2LGD A;  2M9N A;  4QZC A;  5J2E A;  4LZG A;  1FFV A;  1ZJN A;  4P2H A;  3T3O A;  4U6P A;  4EQX A;  4C4S A;  1N5X A;  4TUR A;  2VA3 A;  4NEV A;  3SDL C;  4F7Z A;  2J6U A;  5C3J B;  2YQE A;  1H6V A;  3U52 E;  1W1M A;  2ASL A;  1P43 A;  2F5Z A;  1B0X A;  2YN4 A;  1DOI A;  2AEH A;  1E8W A;  2J0J A;  3O65 B;  4M8M A;  3VTW A;  1WM3 A;  4FBJ B;  1KEJ A;  4B6J A;  4J1O A;  1JWU D;  2BTE A;  4GXJ A;  2YB4 A;  4Y2U A;  8ICN A;  3TTE A;  3D2Q A;  5G55 A;  3ZTD A;  5JZE B;  3IBE A;  4H4Q A;  4HAI A;  2V4R A;  4GGH A;  4DOA A;  4M9N A;  2KZZ A;  1MHX A;  1NBF C;  3R7Q A;  1ZD5 A;  5EWE A;  3GZN B;  3EF6 A;  5KFK A;  1LKY B;  4DOC A;  2HVI A;  2G08 A;  1FO4 A;  2UVU A;  2ALZ A;  1EO6 A;  3S1F A;  4J6I A;  1ZXI A;  1FNV A;  1V9P A;  4AP9 A;  5DB8 A;  2DEN B;  2KO3 A;  4L23 A;  3IJI A;  2R8J A;  1FEB A;  2H5X A;  1IM4 A;  4IC9 A;  3OC4 A;  2HE7 A;  3WK7 A;  5HMM A;  1IGC A;  2ZPN A;  5A0L A;  1WGH A;  4FJY A;  1GPX A;  1L0V B;  4KLT A;  2KP7 A;  1Z19 A;  1SIF A;  3M62 B;  1ZKH A;  3R2I A;  4CYE A;  1FRD A;  3T3N A;  1WWV A;  2HDO A;  2BBC A;  2A1J A;  2E3T A;  1FXT B;  1T0S C;  4DHZ E;  1BML C;  2MRP A;  2QJL A;  2VIX A;  4N58 A;  4PPX A;  2JT4 B;  2BT6 A;  1I19 A;  3S47 A;  4W9I A;  2KT7 A;  5AWV A;  2EQ9 A;  3JPS A;  1PVR A;  3KYC D;  1X66 A;  2V9H A;  2PP0 A;  3F2B A;  1D4B A;  1N60 C;  2K4I A;  2ONE A;  1ZQH A;  4R66 A;  1D5Z C;  1N48 A;  2ONQ A;  4H4U A;  4UAS A;  2HBL A;  3E58 A;  4RPX A;  1ZET A;  4Y2R A;  4NLG A;  4PHA A;  4K81 A;  4KIK A;  3VXW A;  1FRR A;  1TBE A;  4RNA A;  1C3T A;  3H0M B;  4K8G A;  2AWT A;  5JU5 A;  3OW1 A;  2PI4 A;  1PVQ A;  2JY6 A;  3PS6 A;  1D8B A;  3K4G A;  3RD2 A;  1S77 D;  3CGC A;  3TQ1 A;  4ZRK A;  1GJZ A;  5ALQ A;  2PTW A;  4PHP A;  4DNS A;  5HP4 A;  3HVD A;  3PTF C;  2A1A A;  5GTI U;  2HOQ A;  2AL6 A;  2KK8 A;  2JXJ A;  1TK0 A;  1GRF A;  3OTQ A;  1I35 A;  3P1M A;  5KG1 A;  3SJN A;  2JUO A;  5FJR A;  2H3F A;  3DFH A;  2ZNV C;  3OHB A;  1L8L A;  2D8C A;  2MUT B;  1JW9 D;  2M0X A;  1AQ6 A;  4A8X C;  3NVW B;  1BZL A;  1LFD A;  4EX7 A;  5AUI A;  4F92 B;  4HN8 A;  2YEP F;  3ABV B;  4A20 A;  3JS8 A;  1SE2 A;  4ZHO A;  3H9D A;  2Y5B B;  1E8Z A;  2HHU A;  2CN1 A;  3QYP A;  1OEP A;  1NK5 A;  4LLG M;  2BPS A;  4NLK A;  4A3O A;  2KDF B;  1MUC A;  4RCO A;  1L8O A;  3QZ8 A;  3DGZ A;  1WX8 A;  4EBE A;  2A19 A;  1RYR A;  1SEB D;  1SXT A;  3DDH A;  2PXI A;  2ZPY A;  5D79 A;  1C9F A;  4H2H A;  4JHM A;  4MMW A;  2PGE A;  1F0Z A;  2W3S A;  3A9K A;  4ACF A;  1STZ A;  2DGZ A;  3KUM A;  2G0A A;  1UA1 A;  4A3P A;  2UVR A;  4I6L B;  1F77 A;  2PFQ A;  1MPE A;  2WXF A;  4ZDV A;  3OP2 A;  4PHE A;  3ZIM A;  1C1Y B;  1U4B A;  3U2S C;  2WGS A;  2NMQ A;  2IBK A;  4W9G A;  3MR2 A;  2JXT A;  1OJT A;  4QAY A;  2N1R A;  2BKR B;  1NI2 A;  5IIN A;  2PP3 A;  2L0F A;  3WK4 A;  1WR1 A;  1ED1 A;  3QU5 A;  1S76 D;  2HD5 B;  3DJG X;  4ZHP A;  4ZRP A;  1CRX A;  4FZN A;  3RNG C;  2Y3S A;  2VA2 A;  5E6J A;  1OW5 A;  5D3I B;  4IZG A;  1JWM D;  4M0W A;  2WQY B;  4BAX A;  2LJ5 A;  1SGG A;  1T0R C;  3WAP A;  2XCP A;  3ZDA A;  2KDM A;  2QJM A;  3H7I A;  4F4R A;  9ICO A;  1ZW7 A;  4R8U A;  4KDL B;  1YOV B;  2W9B B;  3UM9 A;  3NVY A;  4O3N A;  3EW9 A;  5HHD G;  3IG3 A;  3JPN A;  4C4V A;  1GRG A;  4BVU C;  3C2K A;  5J0W A;  1XSP A;  2W9B A;  2RDB C;  4W9J A;  3R07 C;  1FNW A;  3NVV B;  2LAS A;  4ECW A;  1J0G A;  4Q44 A;  3ED5 A;  3OJU A;  1KLN A;  3CT2 A;  2O6K A;  1UNS A;  3Q6J A;  2MP2 A;  2A3V A;  1GNU A;  3TSJ A;  4PGQ A;  4YTM B;  1WE6 A;  5CJ7 A;  4JWS C;  2AL2 A;  4UB8 U;  4O95 A;  5DBB A;  2QIL A;  3ENL A;  1ZQI A;  2RDX A;  2GRI A;  1OEY A;  1TT5 B;  3CGB A;  4UAU A;  3P4P B;  3T8Q A;  1JX4 A;  2BQU A;  3SN1 A;  4ECV A;  3N7P D;  3ZDE A;  1E7U A;  2BCS A;  2WXP A;  4OCZ A;  3GZF A;  2DW7 A;  1TJE A;  2HTH A;  3L54 A;  3GV8 B;  4CCH A;  3OPX A;  3V7J A;  4RUC A;  4NV0 A;  1WX9 A;  3KUD B;  2NS5 A;  1Q5W B;  3HK0 A;  2GGE A;  4H4R A;  4E4F A;  3DQ0 A;  4BC7 A;  2N7D A;  3OZM A;  2YLM A;  5BYQ A;  1PVP A;  1AOG A;  5KL1 B;  1DYQ A;  4DFM A;  3BQ0 A;  2KAJ A;  4RNM A;  1TZZ A;  4AUQ C;  4ELU A;  5CX3 A;  4EE2 A;  2DL0 A;  2VKQ A;  2PMZ F;  1SKR A;  1VQZ A;  3ZQ4 A;  4KPL A;  4NJC A;  1KCZ A;  1UCV A;  5AIB A;  4IG7 B;  4IW0 A;  3C2L A;  2K6D B;  3WKD A;  3TIX A;  1FXI A;  2CHR A;  3IJL A;  1Z4N A;  1SV0 C;  4O3M A;  5CEH A;  1J7C A;  4APN A;  8ICS A;  5AI6 A;  4LJX A;  1P48 A;  4I2E A;  3QUQ A;  1ZD4 A;  4QW9 A;  4BUG A;  1FIQ A;  2X8C A;  4LNF A;  4XRH A;  2MJ3 A;  2LYH A;  5AM2 A;  3BQ1 A;  1PDX A;  2LGS A;  2K4P A;  3JW0 X;  3R9K A;  5HNK A;  2PMQ A;  5AKX A;  1S97 A;  1S3S G;  2TSS A;  4IL2 A;  5TZV A;  3SN4 A;  1WUF A;  5L83 A;  4K8D A;  2WPE A;  7ICI A;  2ZUD A;  3RNE C;  3N7S C;  2ASJ A;  5AEK B;  3D2D A;  2QVH A;  1KRH A;  3GSY A;  4NM1 A;  5KFC A;  1MI0 A;  4M00 A;  3H4B A;  3JVA A;  1TIF A;  3M6K A;  3QE9 Y;  2EAN A;  4RT3 A;  2HHW A;  4G0N B;  3P0W A;  9ICV A;  3EA6 A;  2QKN A;  2NCN A;  1AWD A;  2WX0 A;  2Q85 A;  2ZW0 A;  3WK6 A;  3TAP A;  4WAF A;  4ARC A;  3LVW A;  2FI1 A;  3ZDD A;  3FXG A;  4DXA B;  2RR9 A;  1EWC A;  3N7R C;  3C0R B;  1K51 A;  4QWA A;  1A5R A;  1M6I A;  1R6W A;  4RFB A;  1LB2 B;  5AKZ A;  4GFJ A;  1PFD A;  3UGB B;  5J2C A;  7ICK A;  3AEF B;  2ASD A;  1JCK B;  3IAS 1;  1ISN A;  3A1Q B;  3MHS D;  3DH9 A;  4ZYS A;  1EWY C;  1JWS D;  3DBR I;  5LXH A;  2BWE S;  2KJ5 A;  4DQR A;  3C23 A;  1DIQ A;  4ZRI A;  3FCP A;  2UYZ B;  2WXH A;  4C8K A;  4F4K A;  1V85 A;  2FUH B;  2J4X A;  4PZF A;  1E9I A;  2N0S B;  1L3T A;  4GYP C;  5KG0 A;  2KKC A;  3SD5 A;  1AW7 A;  1RXW A;  4YG2 A;  2PE6 B;  1Z1V A;  2WB1 F;  5IIL A;  3AEB B;  4PZN A;  3BYT B;  4R63 A;  2J3N A;  3A0B U;  3GFK B;  9ICR A;  1MSW D;  4PZO A;  2ZXI A;  4M04 A;  4H4Z A;  1V2Y A;  3D47 A;  2MA9 B;  2PVO D;  3GD6 A;  4JLC A;  3GE3 C;  2RPV A;  1ZRM A;  4C56 C;  3LDZ E;  3LB8 A;  5I1W A;  4I2G A;  2BB5 A;  5AK5 A;  3ZJT A;  4S17 A;  3ZUN A;  4K2S A;  3N4E A;  2RHF A;  3VTU A;  4HLE A;  5AI5 A;  3FVD A;  2CS4 A;  5E6N A;  2R8I A;  2RPQ A;  2KHV A;  4LJO B;  2G4D B;  2KFZ A;  5ALH A;  3AE5 B;  3D2J A;  3S1D A;  3DJJ A;  1V1P A;  1E9M A;  2M0A A;  3POP A;  3TFR A;  4B9V A;  4JWU C;  2SEB D;  5U1O A;  3N1X C;  2GSH A;  5FKA C;  2DZM A;  2EQ6 A;  4DYE A;  3KYD D;  1SXE A;  2MCN B;  1SJD A;  4ECY A;  2GBR A;  4DL5 A;  5L1I A;  4MGY E;  1S5L U;  3AU5 A;  5G5H A;  4P7I A;  5KFX A;  1FEC A;  2EQ7 A;  2XC9 A;  1EC8 A;  2XH4 A;  3N28 A;  1CJE A;  1Y56 A;  4K3B A;  1J8C A;  2FMP A;  2F8K A;  5LXI B;  4NLN A;  3C19 A;  4URK A;  5H92 C;  5ALM A;  3VCC A;  3V7L A;  4GOC A;  4DQS A;  3KJM A;  1WI0 A;  4IDI A;  5J0U A;  3RJJ A;  4PS7 A;  3NFU A;  3VDG A;  4XQ8 A;  1N60 A;  4QZB A;  3RJK A;  2NR2 A;  3BYY B;  1ZUD 2;  2I2Y A;  4BFR A;  5U25 A;  3STP A;  3P42 A;  1TK8 A;  5KG4 A;  9ICU A;  3RF9 A;  3TMP B;  5KFR A;  5J2F A;  2L76 A;  2WX1 A;  2PSN A;  3EEC A;  1NEK B;  3L08 A;  5J29 A;  2AQ0 A;  2QLT A;  1B9R A;  1KJT A;  4EZ6 A;  1Q1O A;  2Y5P A;  4PWC A;  2HXT A;  3EC8 A;  1WVF A;  3DED A;  3HRD D;  2CU3 A;  4FHJ A;  2QPM A;  3DGB A;  4KVG B;  1COK A;  1F1H A;  3NRZ B;  3EAN A;  2L0T A;  3EJB B;  3NAS A;  1ELS A;  1WXS A;  3BZC A;  4EUT A;  2KVZ A;  2B21 A;  4Q43 A;  3TL5 A;  2KKV A;  5E6P A;  2ZW1 A;  2EZY A;  2LKY A;  1ZQ1 C;  3RAX A;  2OZT A;  3MTN B;  3T6C A;  2BB6 A;  4WQM A;  1DK3 A;  2GMI C;  5HR7 A;  3H8W A;  3MFI A;  5AM5 A;  4DHG A;  1KW4 A;  3FV9 A;  2WXG A;  4M6W A;  2KMA A;  5HHH A;  4J9S A;  5KG2 A;  2X38 A;  4WJQ A;  2E5A A;  4ED7 A;  3TAN A;  4PGX A;  2EDU A;  3GD3 A;  2ZC8 A;  3B1L X;  4Y2S A;  2IOH A;  2KMD A;  5EE1 A;  9ICS A;  3RB4 A;  5CHW A;  3VRB B;  3L5O A;  4ML8 A;  4CQN A;  1C7Y A;  2FMQ A;  4H50 A;  3IDW A;  4FJZ A;  2L5Y A;  1MVK A;  2K0P A;  2WU2 B;  1XPY A;  5KFV A;  1VCB A;  3WCQ A;  2LMR A;  2WXI A;  2A8X A;  3CGD A;  3UXN A;  3ZRF A;  3W8Z A;  4BWM A;  2X8X X;  1ZQC A;  2RDG A;  5DDM A;  2XY5 A;  1KSP A;  1WRI A;  2LJI A;  3WKA A;  2IJ0 A;  3ZVV A;  3G6V A;  4RT2 A;  1N61 C;  1C20 A;  2NBW B;  3UMG A;  2Y4G A;  4ED1 A;  4P0P B;  1SZH A;  5L95 C;  3S1E A;  3PZ7 A;  4F4W A;  3KWV A;  1UQV A;  3OHA A;  4MEY A;  4KIK B;  1Q0W B;  2NRZ A;  2X8H A;  1T0Q C;  5ALX A;  3HKZ F;  3ZDT A;  4RNN A;  4GDL B;  2HVH A;  5AKL A;  3C29 A;  2Y0S F;  4C8O A;  3GP7 A;  4X57 B;  1JRO A;  1MDR A;  2WAQ F;  2IGH A;  2A4Z A;  3ZNZ B;  2JEJ A;  3FWA A;  4Y2V A;  3RB0 A;  1PK3 A;  3EPI A;  4C80 A;  3Q8L A;  4EZK A;  3SZ2 A;  1WM2 A;  4IHC A;  2R8K A;  4YVZ A;  1D6E C;  4FUL A;  2VAN A;  1EF1 A;  2PS2 A;  2N9L A;  3LVV A;  5AKY A;  1XO3 A;  3DDC B;  1X9S A;  4O1N A;  2O6V A;  2K8B B;  2E5S A;  5BYR A;  3UF8 A;  4F8C B;  2ZZ0 A;  2IPI A;  2JZB A;  4DSE A;  4W9F A;  5JRB A;  2UVW A;  3NZS A;  2AH5 A;  3ZVH B;  4MKS A;  2XI9 A;  1GAQ B;  3S5S A;  3RJE A;  3AE6 B;  1KDH A;  4UD8 A;  3F2D A;  1OQY A;  4OVU A;  3U9I A;  4JV0 A;  4JN8 A;  4M52 A;  3LYY A;  1QSS A;  4L1B A;  4ANW A;  4YD1 A;  4Y2T A;  2I6X A;  2K39 A;  3A33 B;  5IAA C;  3H7V A;  5E6O A;  1WXM A;  2OWO A;  3TJ4 A;  4KN7 A;  4NM2 A;  1WXV A;  1ZKQ A;  2UU7 A;  3MR5 A;  3BII D;  4EEL A;  4PT5 A;  1YZ6 A;  2GR2 A;  3ZLH A;  5CA7 A;  1K50 A;  1NI3 A;  4OJO A;  1MRA A;  4DN1 A;  5KFW A;  2ESE A;  1TZO A;  4RM9 A;  4WWN A;  3RFZ B;  7ICP A;  2B6G A;  1RWS A;  2L32 A;  3D32 A;  1ROE A;  1SB3 B;  1SJA A;  2NRV A;  1HJP A;  4RGO S;  4EQS A;  4Z6D A;  3HHM A;  2KJ6 A;  2KQ4 X;  3W1S C;  1T3Q A;  4OJ5 A;  1RFA A;  1UGJ A;  2LXA A;  3S1C A;  5ER0 A;  4A3R A;  5D49 A;  2W8K A;  3DES A;  3LDA A;  4I2A A;  1ZQP A;  1N2X A;  1WRD B;  4NJ8 A;  3Q6B A;  4F5P A;  4I2J A;  7ICF A;  2O6V B;  1WXA A;  1YZ7 A;  4R64 A;  2AQ1 B;  3AN1 A;  1MFW A;  4MEX A;  1E7V A;  2KMC A;  3RUI B;  3NVY B;  1GRE A;  4BBN F;  5HKH A;  4KIT B;  2DLB A;  2KFJ A;  2RMM A;  4DO9 A;  1X2G A;  3KHR A;  5LNK 1;  5ALU A;  3K9P B;  1UUP A;  4LA1 A;  1TYG B;  3E0F A;  4ADW A;  4HYR A;  3I5J C;  3DER A;  3H8J A;  2Z59 B;  2E1F A;  3LAD A;  3QU9 A;  2PCE A;  3CF6 E;  3RJ8 A;  3GIM A;  1ZQO A;  2JWZ A;  3PX4 A;  3AI5 A;  1ZQB A;  1J7A A;  1ZQG A;  5KT5 A;  9ICM A;  4EZL A;  4H1Z A;  4KLJ A;  1Z1B A;  3R0U A;  3RTV A;  1LXD A;  5HMR A;  2ON8 A;  1Z4O A;  3N20 C;  3D2S A;  1JEH A;  4RNO A;  4KV2 A;  4BKS D;  3ALR A;  3URH A;  3PSP A;  4YMM A;  2J0M A;  1CEZ A;  1FM0 D;  2VRR B;  4GMV A;  4JGH B;  5I1V A;  4HNL A;  4NXZ A;  3TI0 A;  3GD4 A;  3PW4 A;  5GMV A;  4D2K A;  5FJP A;  5JHA A;  3Q14 C;  4IRD A;  3X0W A;  2FCS A;  2KSO B;  5KFQ A;  1NZB A;  2I9G A;  5BOF A;  1IPG A;  1UT8 A;  1I4X A;  3MWC A;  2XID A;  4HCP B;  4USA A;  3TKA A;  2GBJ A;  3A1Q A;  4I2D A;  3BOX A;  5AKH A;  2WPF A;  1KKX A;  3TJI A;  3UIN B;  3Q8P B;  3KUZ A;  2VZK B;  1VD2 A;  1KKO A;  1L7P A;  4J3Z A;  5AM4 A;  2REX A;  2KAN A;  2LPE A;  3CIR B;  4NWI A;  5B5E U;  3T4W A;  2YX8 A;  4OJ6 A;  4MEM A;  2UWQ A;  3QPE A;  2IY0 B;  3RBE A;  4H4T A;  4DFP A;  4EQR A;  5T14 A;  3JPQ A;  5AZG A;  3QNM A;  1RXV A;  2EKE C;  4OVZ A;  5C23 A;  2ASQ A;  3VC5 A;  2C3D A;  1NDD A;  2W8L A;  1QT9 A;  3DCG A;  4ED0 A;  5BMI A;  4PVJ A;  1ZQM A;  1E0Z A;  1HTQ A;  1MNS A;  1NHS A;  2AL2 B;  4G8T A;  5HI1 A;  1WMH A;  2I1Q A;  4F2S A;  7ICH A;  4ZA0 A;  1VZ8 A;  3CYM A;  4QZ9 A;  1PYW D;  2LI6 A;  1V59 A;  1D5X C;  1H8C A;  3NVV A;  4XE0 A;  4XZ4 A;  9ICE A;  2ISP A;  4NY8 A;  4AYB C;  1UEL A;  2C9W B;  2QC8 A;  3A4S C;  3BWU D;  1L7Y A;  3HUI A;  5C0Y A;  1ZQT A;  2AKM A;  3QEA Z;  1MQ3 A;  2WNM A;  1NU5 A;  4H19 A;  3MSY A;  1QLU A;  3HWT A;  4HEA 1;  3ES8 A;  4EZJ A;  1NEL A;  3QQ8 B;  1KF6 B;  1BNP A;  5KT3 A;  4XGA B;  3PO4 A;  3PSI A;  3SD7 A;  4YWS A;  5KHQ A;  4EQW A;  9ICN A;  2BVH A;  3F53 A;  1VR9 A;  1ZPS A;  2MJD A;  4J9N A;  1TTN A;  4H4X A;  3M6Z A;  4F72 A;  5KFO A;  3JPR A;  3CRX A;  4AJW A;  1E0Y A;  2PGW A;  5G2N A;  4MF2 A;  4BOZ B;  2R2Q A;  2KV2 A;  4GYP A;  1F52 A;  1T94 A;  4KT2 A;  4XC2 A;  3ZD9 A;  3DWM A;  4N9F 4;  3SQP A;  1ZK7 A;  1D5M C;  4YSX B;  4QJF B;  1JOA A;  3R7R A;  5FJT A;  4JL9 A;  5FS8 A;  4BOS C;  2C7H A;  1GSN A;  4TQ0 A;  1E8X A;  1SV4 A;  3GRS A;  4XX5 A;  4FDC B;  4KN4 A;  2KAC A;  2GL5 A;  4O3R A;  2HTM E;  3APD A;  5D3D A;  3P4R B;  3ZRC A;  2BS2 B;  5FR6 A;  5TSS A;  4AOF A;  2GOL A;  2MRL A;  1B1Z A;  4GLS C;  5AI8 A;  5GTH U;  1KFT A;  4X2P A;  2OM6 A;  2LFI A;  4FS1 A;  4C8M A;  1NNL A;  1YN4 A;  3QX7 A;  2DZI A;  2VH1 A;  1PK1 A;  1TE2 A;  3HKZ C;  4OJP A;  2H88 B;  2AQ2 B;  4KX3 A;  2DPJ A;  2I5H A;  2BCV A;  5L1J A;  4C00 A;  3GIJ A;  2N9K A;  4MF8 A;  1Q46 A;  4B9S A;  2BS3 B;  1E10 A;  1M94 A;  4C4V B;  4PYZ A;  4DK5 A;  4OAL A;  2ZAD A;  3J81 j;  4YMO A;  3KWL A;  2FUG 1;  1GES A;  5LLI A;  1NVI D;  2WXK A;  4ARI A;  3A7A A;  4BKT A;  3ZO5 B;  3I1Y A;  4C4R A;  3I76 A;  3RJI A;  2INC C;  2PTZ A;  2L00 B;  1Q8K A;  4KSL C;  3ISB A;  1S7M A;  1JPD X;  1ZR6 A;  2IDY A;  2FLP A;  1BKH A;  5KTQ A;  1WXQ A;  2JZZ A;  4OW0 A;  4DL6 A;  2KHQ A;  4M47 A;  3D2N A;  5KFB A;  1H38 A;  1WF9 A;  2BGF A;  5CR0 A;  3RNM A;  4FS2 A;  1ZX9 A;  4KPR A;  2K60 A;  1L7O A;  5FK9 C;  2LGX A;  4P16 A;  5IKC M;  2WHE A;  2G5I B;  4O3O A;  1MHH E;  2MBO A;  3PM9 A;  1Q1W A;  3N1Z C;  2X99 A;  1N63 A;  2F77 X;  2KJ9 A;  4UB4 A;  4KLH A;  5DGA A;  1SL1 A;  4MM3 B;  3VR8 B;  5JHB A;  2OZ8 A;  5BYS A;  5J17 A;  2CR5 A;  1JQ4 A;  1DK2 A;  5KT2 A;  5AKJ A;  2Y3A A;  2FPM A;  1BT0 A;  3AQF A;  2KWV B;  2PPH A;  5ALW A;  2HI0 A;  5DDY A;  3U30 A;  1ZYQ A;  5J04 A;  2CJN A;  2HW3 A;  4KZC A;  2QKQ A;  4YN4 A;  2D5G A;  3RYT A;  2NQW A;  4QIW C;  4J9O A;  2WTF A;  3TAC B;  4I6P A;  3M7D A;  2ZZB A;  8ICE A;  7ICN A;  2ZIX A;  2DYB A;  2F8L A;  4O3Q A;  3TWB A;  1T6B X;  1A6S A;  3RJA A;  3T5L A;  1F2R C;  5AM0 A;  2R2O A;  2AL1 A;  3ZD8 A;  4HCD A;  4IM0 A;  4EMW A;  3Q69 A;  1ZJM A;  3PMN A;  5ADZ A;  4MH0 E;  4DS5 A;  4KKI A;  5AI4 A;  1S1Q B;  2LGI A;  3RNB C;  1T3Q C;  2QB0 A;  3PW5 A;  1TGZ B;  5J8Y C;  2XK5 B;  2WP5 A;  3W5U B;  3DBL I;  1P0R A;  1L0X B;  1XXG A;  3DVG Y;  2VFT A;  2C3C A;  4AWJ A;  4WJ3 B;  3A9J A;  5HHZ A;  1NK4 A;  3RB3 A;  2Y1I A;  1RYU A;  1N61 A;  1U4A A;  2POD A;  2NTS A;  3BS5 A;  5FS6 A;  2EMS A;  2ZJ8 A;  1WG8 A;  3K75 D;  4CHK A;  4E71 A;  2JHD A;  3URY A;  1GC7 A;  3LB8 C;  3SR6 B;  3H4K A;  2BYF A;  2KNJ A;  2G4S A;  3SYZ A;  3BQ2 A;  3AUL A;  3JVZ X;  3PFR A;  1NEN B;  2FJ6 A;  5F9N A;  4JV2 A;  5EE3 A;  5AI9 A;  3AE9 B;  1HUZ A;  2NPT A;  5KFI A;  4XYC A;  1JAL A;  1IXR A;  4O5E A;  2W9C B;  1NJY A;  2IO3 B;  1S9F A;  5D6J B;  3WAM A;  2W3R A;  2Y5C A;  3MBY A;  2KZM A;  9ICT A;  3PW0 A;  2RD0 A;  5J2I A;  1S0N A;  3NRW A;  3RH6 A;  4K1W A;  5EDS A;  5G5H B;  4EYI B;  3RNF C;  3ZNG C;  1F44 A;  1HSK A;  2AXR A;  1RYS A;  5K8E A;  3FC4 A;  4HXD A;  2AQ4 A;  4IR9 A;  4KLO A;  3QCA A;  4CF3 A;  3R66 C;  9ICL A;  4KGR A;  3MR3 A;  4F5N A;  3D2H A;  4E6M A;  3VA8 A;  4NLB A;  5III A;  3NZG A;  1ZXI C;  1WR6 E;  4DNA A;  1MOK A;  1YX6 B;  3VRA B;  3DFY A;  4RZR A;  3L8K A;  2P3H A;  4RQM A;  3C2M A;  4DS4 A;  3HM6 X;  1WGD A;  3AEA B;  3B08 A;  4CF4 A;  1TK5 A;  2ZTD A;  5AK4 A;  1K1Q A;  1V80 A;  2B76 B;  2M1M A;  3ALB A;  2VJ5 A;  1COO A;  3C8Y A;  1B4F A;  4O3P A;  4P0Q A;  1NK6 A;  1YJ1 A;  3LWL A;  5ALF A;  1SE9 A;  1STE A;  1RQN A;  2WB1 C;  4RH6 A;  2X8G A;  4WUR A;  3VFC A;  3C5G A;  2GR0 A;  2JV3 A;  1PGX A;  1ZE3 D;  4DEZ A;  4RU9 A;  1V1O A;  4HDQ A;  4IWQ A;  3LK9 A;  5HR6 A;  4ELT A;  1XT9 B;  3Q2A C;  2QAR A;  4JWN A;  4HPP A;  2EKI A;  5CWR A;  3BJS A;  1DZN A;  1IYX A;  4NY0 A;  2BPF A;  5HFY A;  5FMH A;  1EXN A;  1A77 A;  4QZE A;  1X6I A;  1UBQ A;  3RZW C;  1QF6 A;  2KFN A;  3ZDB A;  1N5W A;  4B95 A;  3PX0 A;  1MA7 A;  2J53 A;  3MKC A;  3IN5 A;  4BXO B;  3AEG B;  5CHF A;  2MBE A;  1URJ A;  1I4P A;  3Q3M C;  7ICJ A;  3V61 A;  3AEC B;  2ZTE A;  3I9V 1;  3KD3 A;  2RQ5 A;  2BQQ A;  1L7M A;  3VH3 B;  2NRW A;  2BF8 B;  4JB3 A;  3VC8 A;  3SFD B;  3TX1 A;  1JCT A;  1XLP A;  1QLT A;  4IS7 A;  9ICC A;  2XH7 A;  2KFK B;  3BZD B;  1BPX A;  2KHW B;  3I57 A;  3BSM A;  3LJ3 A;  4KEM A;  3VC6 A;  3L0W B;  1Z00 A;  4DL3 A;  2QB1 A;  4KLU A;  1CK1 A;  1VJ5 A;  2GO7 A;  2DF4 B;  1DOY A;  3EJE B;  2RAB A;  3UCD A;  1FEA A;  1WGY A;  2MBQ A;  4I27 A;  2K8A A;  3BY4 B;  4YR2 A;  3UJF A;  4IR1 A;  2IPK D;  1N62 C;  4DXF A;  2NVU I;  2YML A;  3M9N B;  5AE2 A;  4N6E B;  5KFD A;  3U8Z A;  2Y3R A;  1RVK A;  3E2E A;  5J0Y A;  4ELV A;  3AUO A;  4O3S A;  4KX6 B;  1RPL A;  3I3T B;  1ZD3 A;  3IV6 A;  4FO6 A;  1Z00 B;  5I4D A;  1SL0 A;  4HRO A;  3AEE B;  1JXE A;  1S8O A;  1Z3E B;  4WQO B;  3H7P B;  4AQ7 A;  3AQE A;  4TQS A;  2MSN A;  5G5G A;  2V6O A;  1YQ4 B;  2VFU A;  2HCF A;  3PO5 A;  2KTF A;  4H4Y A;  4MAC A;  3VTV A;  3OJS A;  2NRX A;  3RJG A;  8ICJ A;  1R4N I;  1TAQ A;  3DBH B;  4MDK E;  4FE3 A;  4PWB A;  5KVI A;  3PR4 A;  3IVF A;  1RM6 B;  4EEW A;  1F5S A;  1H4R A;  1OGW A;  4KMU A;  4ZRJ A;  4EM3 A;  2WDW A;  1ZD2 P;  3TAR A;  2N7J A;  3TEW A;  3V3X A;  3CMM B;  3D6J A;  2KOX A;  1HZ6 A;  4O0I A;  3E56 A;  1QQ6 A;  1ZQY A;  3JPP A;  1AYF A;  2AYO B;  3Q3F A;  2G07 A;  2PLS A;  2FPK A;  5AKG A;  1TAU A;  2K25 A;  1BGX T;  4Y2P A;  3WKC A;  3ZW3 A;  7ICR A;  5KFZ A;  2XVT A;  2AAQ A;  3A0H U;  4LNN A;  1NK7 A;  1OTR B;  3B0A A;  4B9N A;  1YIW A;  1Q3V A;  2WDQ B;  3B2F A;  3IHP C;  4MGZ E;  3KFU F;  5J0Q A;  4RQ2 A;  1L6N A;  1NK8 A;  1OFF A;  2BCR A;  3JSV B;  2LRW A;  5T8I A;  5ALE A;  3ONS A;  4UAT A;  1XAN A;  2IBI B;  2KEY A;  1BPY A;  3NS1 B;  2PU0 A;  4H4W A;  3DHG C;  4J9R A;  4HCL A;  1BPB A;  1MN8 A;  3M9O B;  3N30 A;  5C1Z A;  2HJ1 A;  9ICK A;  1DOQ A;  2PJH A;  4DSL A;  7ICO A;  3EPG A;  5J0P A;  3ZKJ C;  2DPI A;  4DHZ B;  2P35 A;  4IM2 A;  2GQU A;  3RAQ A;  1XO0 A;  1KOT A;  1NZP A;  3ZYY X;  2K8H A;  3V05 A;  2V4Q A;  2ZVN A;  4JPS A;  4IL0 A;  2GGG A;  4Z6E A;  1WUE A;  1JI7 A;  3NTU A;  2P13 A;  4DLE A;  5BPC A;  2ZEQ A;  4E3C A;  1F0M A;  3R0K A;  1QKZ A;  2W7P A;  4JWM A;  1ZMD A;  3HX0 A;  3C21 A;  5KFT A;  2KN4 A;  3RRG A;  2KLC A;  1CI4 A;  1V97 A;  4RQ4 A;  2P66 A;  4W9D A;  3V60 A;  3JYU A;  1W1R A;  3DWG C;  2KTR A;  2ZXH A;  5L1M A;  5ALO A;  1R7S A;  4RQ7 A;  5IO9 A;  1ET6 A;  3GII A;  5FXE A;  4B0E A;  1WJ4 A;  1N5W C;  2QDE A;  4E74 A;  3FG2 P;  4UAY A;  3S6J A;  1TS3 A;  2WDT B;  1ZY8 A;  4NZL B;  3G6Y A;  3GS2 A;  3M8R A;  4RGM A;  1HXY D;  1I4H A;  4QZG A;  3QU7 A;  1ZQW A;  1DRG A;  1V1P B;  2AX5 A;  1E8H A;  3BDP A;  1BPZ A;  2PMZ C;  4ANU A;  1EM7 A;  4J9M A;  1Z2M A;  2OCE A;  4LTU A;  3PST A;  1IGD A;  3AE4 B;  2ICI A;  3APF A;  3VUW A;  1L2N A;  2Z8L A;  3C1Z A;  3B0Y A;  2IHN A;  3DVN U;  4EEK A;  2K9X A;  5DBA A;  1J19 A;  3A9K B;  2XSX A;  4Z6C A;  4I2H A;  2FE9 A;  2MAX A;  3GIL A;  1ECQ A;  4IT1 A;  2V3S A;  5KFG A;  1FCC C;  2J7Q B;  2Q0Z X;  2NO4 A;  1XD3 B;  2WS3 B;  2IA6 A;  4J9Q A;  3PV1 A;  4WWP A;  4EC3 A;  4Y2J A;  4CDG A;  4NL9 A;  3HM3 A;  3R1Z A;  4RM8 A;  4WJO A;  3M95 A;  1K4Q A;  2MUT A;  2FCN A;  4RF1 A;  1AAR A;  1WMH B;  1WIA A;  2KWU B;  1ZQF A;  2ZCB A;  5JCN A;  3ORY A;  3AL0 B;  4GN1 A;  3IAM 1;  2CRX A;  4P0P A;  5KG3 A;  1MC8 A;  3JW7 A;  3KBB A;  3MGH A;  2AGP A;  2LMC A;  3IT6 B;  3DOW A;  4TUS A;  3QUT A;  9ICH A;  5KL8 B;  3CNH A;  4UB3 A;  4ECR A;  1N6Z A;  4XDC A;  4F3O A;  4NAW B;  2KWC A;  4LJP B;  5H8Y E;  9ICI A;  3SQI A;  2QHO A;  2V4I B;  3ZJU A;  1K52 A;  3Q8B A;  2PA6 A;  3JPT A;  4CE6 A;  2O2V A;  2PU1 A;  2D07 B;  4A90 A;  3QX1 A;  3B2G A;  1IBX A;  3EUB 3;  3WK9 A;  1PGB A;  3RNC C;  1NPX A;  2UVV A;  5F3X B;  3N6H A;  4O9M A;  1UWM A;  5H2F U;  2ZCC A;  3RBD A;  2YTU A;  2JR5 A;  5ALL A;  4Z1Y A;  1SKS A;  2HOF A;  3DQV A;  2HSZ A;  4GRT A;  1YEY A;  1HUO A;  5KFM A;  2HHX A;  4EBD A;  3ML8 A;  4G3X B;  3QUC A;  1SF0 A;  1PUZ A;  5DG8 A;  2KIV A;  4FI4 A;  2OXO A;  3EZ5 A;  2W55 A;  4XA5 A;  2XO7 A;  4K4G A;  3QAR A;  4M8N A;  1C77 A;  1XHC A;  2M56 B;  3RRH A;  1FIQ B;  1XO1 A;  2JRI B;  1L6V A;  2JPH A;  4TVY A;  4MH8 A;  3F5A A;  3H7P A;  1L3S A;  4EEY A;  1P1A A;  2FBW B;  1A76 A;  4EM4 A;  4DSI A;  2KTQ A;  3ICX A;  3MGV A;  4F5Q A;  8ICO A;  5DQH A;  2QIE B;  1SJB A;  5KFU A;  1WGK A;  1WCN A;  1GOZ A;  3SEI A;  1LO5 D;  1V9J A;  3W1Y A;  2KZ3 A;  5DG7 A;  5TR5 A;  1DTN A;  4ICV A;  2N9X A;  3Q8Q B;  2ZJA A;  3R3M A;  2ZJ5 A;  1MBB A;  1L3V A;  3NO1 A;  5KFJ A;  3P4S B;  5AK6 A;  2O2V B;  2C7N B;  2WF9 A;  3PHW B;  5DPS A;  4OHJ A;  3SEN A;  2JWU A;  5KFL A;  3R8B A;  1U9L A;  4JUZ A;  2PE9 A;  3MJW A;  4GXK A;  2FMS A;  1UZX B;  2G1E A;  2MLB A;  4PYT A;  2WBA A;  2PLI A;  5FXD A;  3TFS A;  3QUB A;  4RQN A;  8ICG A;  2CHW A;  2WU5 B;  3PPA A;  4IQV A;  2ZG6 A;  5J0O A;  4EWJ A;  2G9H D;  2KMM A;  1BNO A;  4KLF A;  2GR3 A;  5E79 U;  2GH5 A;  5AZH A;  1UWX A;  2W0H A;  3NG0 A;  2RP5 A;  8ICX A;  4MFF A;  2W43 A;  4GME A;  3DHH C;  4GIS A;  4OZB A;  4Q2J A;  1PDZ A;  4TSS A;  4A35 A;  1AHV A;  3R11 A;  1ECW A;  5BOM A;  2PTY A;  5HG2 A;  2ZIV A;  2DAF A;  3I63 C;  2YB1 A;  4GDK B;  4J9K A;  4HK2 A;  2MJE A;  4DDI D;  1NHQ A;  2NV3 A;  2G45 B;  3SEB A;  4DWI A;  2D6F C;  1E6E B;  1R4M B;  1P7D A;  4IQT A;  4BX9 C;  4IC7 B;  5AE1 A;  3H8M A;  4JQW C;  4Z17 A;  1I4G A;  4KDI C;  2KDI A;  3M3J A;  3RJF A;  4OJL A;  2P0I A;  3KUC B;  4K7U A;  1X1M A;  2WXJ A;  1YD8 U;  3V6H A;  1S0O A;  3CWI A;  3RCZ A;  3P2B A;  4A55 A;  1RDF A;  3CW2 C;  4GSW A;  2DWQ A;  3VR9 B;  2R9Z A;  2GH1 A;  2LI5 A;  3ZXV A;  2OJW A;  1QOF A;  1N62 A;  1IYF A;  5IIJ A;  3FYH A;  3MQT A;  3WAO A;  4M9J A;  3TAD C;  1MDL A;  5L6F A;  2OFJ A;  3F2C A;  5AIC A;  1T3N A;  4ASW C;  1NK9 A;  3DPD A;  1QOG A;  3SAH A;  1YMH E;  1Z5S B;  3K1Z A;  1TS5 A;  3ES7 A;  4R65 A;  1TKD A;  4Q8E A;  3TEY A;  1W1O A;  4H4S A;  4MEL A;  2Z7J A;  2FYM A;  2DQN B;  3DEE A;  5IIO A;  5AE3 A;  2NBV B;  5AHX A;  4TUU A;  4KSK C;  1NK0 A;  4H4V A;  3QIJ A;  2Y08 A;  4ACO A;  2OHF A;  1OUQ A;  2HHT A;  2GGI A;  1XCQ L;  2XBB C;  5ALY A;  5J18 A;  3VAW A;  4B9K A;  3OG5 A;  2PIA A;  3KLS X;  2K4E A;  8ICI A;  2YVC A;  1GG3 A;  1HE8 A;  2KX3 A;  1V86 A;  2KDB A;  3FW7 A;  4HDO A;  2WXR A;  2BQ3 A;  1WGG A;  1JPM A;  1YT3 A;  2E8P A;  8ICB A;  4NQK E;  1JIH A;  4ECX A;  1TYT A;  1FHU A;  3BW7 A;  2XN9 C;  3H8S A;  2EZZ A;  4YP3 A;  2PKE A;  2VA8 A;  4E5T A;  2LM4 A;  5DPT A;  2PLP A;  2TPR A;  5HQX A;  4YTP B;  1ONE A;  3SAG A;  1K8R B;  2OO6 A;  4BJQ A;  2V9W A;  4I2C A;  2JZ3 B;  8ICC A;  4OZC A;  3IFW B;  2W9A A;  3V72 A;  4WIP A;  2EQ8 A;  4PL2 A;  2OED A;  3PHX B;  4DQP A;  1CQV A;  2WXN A;  2KG5 A;  5IIM A;  4IWP A;  1NYQ A;  4LDT B;  1GEU A;  1W1L A;  4M0X A;  1FFU C;  3RIT A;  1EC9 A;  4YR0 A;  4JV1 A;  2LGY A;  3A7R A;  2CHX A;  3HW2 A;  4LNK A;  4FBU A;  2G06 A;  5HHI A;  1FMA D;  3GB1 A;  1MBT A;  2CKH B;  3FM9 A;  4MSM B;  1EBG A;  8ICQ A;  1P9D U;  3RPF C;  2J6S A;  3NVZ B;  3VTE A;  3AEV A;  1LPF A;  3FJ4 A;  1A0P A;  3UPQ A;  1XQQ A;  2OX4 A;  4MGG A;  3UQA A;  3C28 A;  3MDC A;  1XS9 D;  1W1J A;  4I2F A;  3B97 A;  4ZOH C;  1ZQN A;  1GRT A;  2DKZ A;  3SMV A;  3X23 A;  1V5T A;  3TOY A;  4RQ8 A;  3L5K A;  4P4P A;  4CNQ A;  3HPF A;  2W9M A;  1XEE A;  3V6K A;  2P6R A;  1UBI A;  3PT2 B;  4FHK A;  2LWP A;  3UXO A;  2PPG A;  3GO2 A;  3B9J B;  3T5K A;  3KH0 A;  4DDG D;  4J9L A;  4I2I A;  4BUR A;  1UF0 A;  1YX5 B;  2QMT A;  2XH2 A;  1P98 A;  3DBH I;  1X2I A;  4YD2 A;  1QSY A;  2ZIV B;  4S0R A;  1X6J A;  3BJY A;  3PG6 A;  3MFG A;  3CK5 A;  3AU4 A;  1X40 A;  3ZDC A;  3QFA A;  3B9J A;  3RFA A;  4O5C A;  2MBB B;  1L7N A;  4AJY B;  3AE2 B;  4K4I A;  8ICW A;  3NS1 A;  2GBN A;  3RMK C;  2WOW A;  1ZQD A;  2BDU A;  4FXC A;  1DXS A;  3M1Y A;  4PL1 A;  3MC9 A;  1YJJ A;  4FBT A;  3Q8A A;  4UB5 A;  1C4A A;  4BBN C;  3ZLF A;  2OG9 A;  2O3G A;  5KFP A;  3H8A A;  3GQC A;  2MNR A;  3Q8K A;  3BVG A;  3UJ2 A;  3S2A A;  1YN3 A;  3THV A;  2D3A A;  3SSZ A;  4RPZ A;  1H2I A;  2F1I A;  4UAZ A;  5FXP A;  3MFH A;  4QWB A;  4HVB A;  4KWS A;  3PLU A;  4ZOH B;  2XGZ A;  2KVC A;  1LVH A;  1J2M A;  3H6N A;  1X2H A;  3UJE A;  3M9M B;  5CTR C;  3NS8 A;  5D2M B;  2IMW P;  3FAH A;  3MP9 A;  5ALI A;  3NVZ A;  1GRB A;  5JXV A;  2V3B A;  2FKP A;  3I4K A;  2DKX A;  3DV9 A;  5ALZ A;  1KL9 A;  2N4F A;  4FP1 A;  3LAE A;  4EBC A;  1ZOY B;  4EOY A;  4RF0 A;  3RR8 A;  1ZRN A;  5JTI A;  5ALV A;  4B9L A;  1XU4 A;  3R25 A;  2KKP A;  1WZ3 A;  2AJQ A;  1WE7 A;  5AM1 A;  3WKB A;  1V5O A;  2IYD B;  4W9H A;  1P7F A;  1QLN A;  1KTQ A;  4YR3 A;  4TV3 A;  1FFU A;  3IHQ B;  2LVO A;  5AUK A;  1SV0 A;  1ZQE A;  4UB6 U;  2RDH A;  4K7Z A;  3RR7 A;  4ZH4 A;  1JWB D;  2BVC A;  2PVG C;  1ONF A;  1MJD A;  3N6J A;  4PHD A;  2JMG A;  1BPE A;  4HJG E;  5CB1 A;  4KLQ A;  3Q45 A;  1RZT A;  1V38 A;  2K6Q A;  3M63 B;  3IG8 A;  2GGJ A;  2HXU A;  3NZ3 A;  1X9X A;  3PW7 A;  5ENL A;  1E5W A;  2OQH A;  1W1Q A;  1ACC A;  3T79 A;  4DQO C;  2E8O A;  1N63 C;  1GER A;  3ZNI D;  4IQW A;  3W1S A;  2CDU A;  2ZIU A;  2JF5 A;  2YQU A;  1EUV B;  4BV6 A;  3JSV A;  4IQU A;  2IHM A;  2VFV A;  4M0W B;  2AXT U;  2C28 A;  4RQ1 A;  2GWS A;  1F3P A;  4L2Y A;  3MAB A;  2YMM A;  1UT5 A;  4U7C A;  4DWF A;  2KLG A;  3N97 B;  1KLV A;  5DB7 A;  3BZK A;  3CP8 A;  4UBC A;  3NGD A;  3NHE B;  4M9H A;  3NY5 A;  3H40 A;  1WY8 A;  1WWT A;  3PRM B;  1FEZ A;  3N32 A;  1NDA A;  2IO1 B;  2INP E;  2RK5 A;  3W9C B;  4EMJ A;  1WWU A;  1RG6 A;  5J2B A;  2MU2 A;  1GB4 A;  2KD0 A;  2XCA A;  2EMT A;  2WXL A;  2IND C;  3K9O B;  2KSO A;  1JDF A;  8ICR A;  2IO2 B;  3DK9 A;  1ZQS A;  3EHV A;  3U7D A;  5K4L A;  3HIL A;  4IRK A;  2E6X A;  3PVL A;  5DQG A;  5JUM A;  3Q8S B;  4FA6 A;  3Q8E A;  2JRH A;  1L5U A;  3DG3 A;  4JIO U;  5DLF A;  5FXF A;  2KIW A;  3H1U A;  4J9P A;  2CHZ A;  3AB5 A;  3P63 A;  4JX1 C;  4XWW A;  5KFN A;  1KLU D;  4ECZ A;  1HQR D;  4TQR A;  4YL8 A;  4NAM A;  3UIO B;  3UQB A;  2M4N A;  3VCB A;  4XWT A;  3QK0 A;  4DSF A;  1PGA A;  3AE8 B;  3PRE A;  4IKG A;  2OPJ A;  2WOI A;  4NLZ A;  1LQB A;  4REZ A;  1DNC A;  2Q4T A;  5JCL A;  1IG6 A;  1SXD A;  4KLM A;  2AU0 A;  1D7Y A;  4YMN A;  3DG7 A;  3A4R A;  4P1C C;  2JZP A;  2KWD A;  2CJO A;  3EAO A;  2NQL A;  3EUB 2;  4M01 A;  1CZP A;  5D46 A;  2MX2 A;  4FZL A;  2W7O A;  4DQI A;  1WJU A;  8ICH A;  3H0R B;  1EU3 A;  1QOA A;  2K3U A;  3UQ0 A;  2YEP B;  3ECI A;  4YWG G;  1TY0 A;  2N1V A;  1GRH A;  3TAQ A;  2JX5 A;  1LKY A;  2BW2 A;  4YXM A;  2JYT A;  4GC6 A;  1WVE A;  2WP9 B;  4LCD E;  3LWM A;  1TKG A;  4NEW A;  3UGV A;  1P3Q U;  2PMV A;  4EZ9 A;  2BS4 B;  1U49 A;  2E8N A;  3WK5 A;  4J03 A;  4HG0 A;  5C2T B;  1WGR A;  3N3K B;  3AMZ A;  2KOB A;  2KX0 A;  5J0S A;  1MO9 A;  2JRZ A;  1HEZ E;  4G7F A;  2FDR A;  2JH7 A;  3K1R B;  4C7Z A;  3R2T A;  2OQY A;  4Y2Y A;  1TZ1 A;  4NJ7 A;  1BQG A;  1GUA B;  2KC1 A;  3TSS A;  1PK1 B;  4US8 A;  2CXY A;  1SWW A;  1TKY A;  4B6W A;  3G6X A;  3SR6 A;  2KQ7 A;  3L3F X;  3J9C A;  4XUS A;  5JCK A;  2Q5W D;  3U7Z A;  2QDF A;  1ZQL A;  1JXL A;  2GB1 A;  3WK8 A;  3EEZ A;  1SJE D;  1QLB B;  2G3Q B;  2PKO A;  2BGW A;  2QDD A;  1SL2 A;  5BMG A;  4DL7 A;  5IDZ A;  3GE8 C;  3H70 A;  3LLB A;  1UGM A;  2KK0 A;  5DGB A;  1X9W A;  4DBG A;  2VZK D;  4YWO A;  2F44 A;  3L10 B;  5KFA A;  4NPN A;  1TY2 A;  4IP5 A;  1YQB A;  2W82 A;  3VCN A;  3EFC A;  2WOV A;  3PRZ A;  1MG4 A;  4G3I A;  3QWZ B;  5ALT A;  4E4U A;  3CGE A;  2DW6 A;  1UH6 A;  2Z0E B;  1ZQZ A;  8ICL A;  3FIL A;  5AKE A;  1IV8 A;  3Q3O C;  2KXJ A;  1EU4 A;  3PX6 A;  3VUY A;  2E1E A;  3Q8R B;  3KW5 B;  1GB1 A;  5C5J A;  3DVG X;  4FN2 A;  2HNE A;  5DB9 A;  3NVW A;  3ISC A;  3IP4 B;  3NRZ A;  4GDL A;  3RNA C;  4IUM B;  5DG9 A;  2WF6 A;  4DF8 A;  1SE3 A;  3IC9 A;  3II4 A;  3GY1 A;  3HW8 A;  3NXL A;  2EXR A;  1ZOL A;  2CPR A;  5G5G B;  1RAX A;  2KE7 A;  1RM6 C;  2LZ6 A;  2I5Q A;  2RDJ A;  9ICQ A;  2LHE A;  3D46 A;  3DDM A;  4FX9 A;  1S0M A;  1OQR A;  1YJI A;  1SJC A;  3V6J A;  1SWV A;  2HHQ A;  3UMB A;  5TR3 A;  1IP9 A;  2E8M A;  3BS5 B;  2DYO A;  4ICA A;  5KT4 A;  1QZE A;  4GGQ A;  1XC9 A;  4DL2 A;  4ED8 A;  4UB2 A;  5IIK A;  1VRA B;  4JE3 B;  2F76 X;  1XWL A;  2YMP A;  8ICA A;  3MY9 A;  5J2A A;  3DHI C;  3HIZ A;  4ITK A;  1W6T A;  2PTX A;  2DZJ A;  2KJ8 A;  4P4M A;  3EFU A;  1F9C A;  1T7P A;  3Q8M A;  1KQQ A;  5D94 A;  1SGH A;  3L17 A;  2IOF K;  2W04 A;  3V62 A;  3FIL B;  5KT7 A;  1Q3U A;  5DQI A;  2KVS A;  4GIV A;  3T3F A;  2NYV A;  5FJO A;  3ZVI A;  4GXI A;  1KKR A;  2P4P A;  2PFO A;  1QQ5 A;  3UIP B;  3P93 A;  6ENL A;  3HJE A;  1LV5 A;  2FLL A;  7ICL A;  3MR6 A;  2V0G A;  2YVS A;  1QH9 A;  2FCQ A;  4ECT A;  3I99 A;  4BXO A;  2P3Z A;  5ALN A;  2UUU A;  2NPX A;  4RQ5 A;  3UQ2 A;  1DOX A;  3TQP A;  2QCZ A;  3ZJV A;  3GV7 B;  1LGR A;  3OGU A;  2AHO B;  5KG6 A;  2IZV B;  2LD9 A;  2LM1 A;  4YSZ B;  3W8W A;  4GB9 A;  3SN0 A;  2OH2 A;  4MLA A;  5ALJ A;  2SAK A;  2KYW A;  2KDE B;  1ZQJ A;  1BVS A;  3IRU A;  2BDP A;  4QIW F;  2Y9U A;  2WF5 A;  3FDS A;  4QZI A;  3AE7 B;  4IWO A;  4YTN B;  2IGG A;  3DIP A;  3UXL A;  4K7S A;  4LVS A;  1E7P B;  3CSF A;  1K1S A;  4GU2 A;  4JAY A;  5DKW A;  3DVN V;  1R4N B;  2F3N A;  1XS2 A;  4EKU A;  5FR3 A;  4R3D A;  1ARO P;  5FS7 A;  2D3D A;  4QZ8 A;  4EYH B;  4W9L A;  3WIM A;  2KVR A;  1BWC A;  2XEW A;  3L16 A;  3ISD A;  2OAI A;  1XSL A;  5DPW A;  4K4H A;  1LM8 B;  3PWG A;  2P6U A;  3DK8 A;  3LYS A;  5DB6 A;  2R61 A;  1TFR A;  5ALP A;  2I1J A;  3QHT A;  4MGI E;  3TJP A;  2YMQ A;  3GC2 A;  3R10 A;  2KN7 A;  3RCY A;  2R8G A;  3DK4 A;  3I6E A;  2DAJ A;  4GLX A;  2UUV A;  3Q3J A;  2RLT A;  2O6V D;  3FW8 A;  3RH5 A;  4BWJ A;  1C78 A;  1R0M A;  4HCH A;  5J0X A;  2DZK A;  4QZH A;  3O0F A;  3RO6 A;  3DBS A;  2W9C A;  2HBJ A;  3MHZ A;  4ENL A;  2QEJ C;  2BC0 A;  1A70 A;  1C4C A;  1BXT A;  3ONN A;  1T5X D;  4DWD A;  3TEX A;  1VLB A;  3RB6 A;  1QQR A;  2WDR B;  3Q8C A;  4MGK E;  3RT3 B;  3N9Y C;  2Y1J A;  3QA8 A;  4F5R A;  2BKF A;  2MH7 A;  2G5H B;  4A9A A;  1J97 A;  3HT3 A;  1AN8 A;  1XLN A;  3EJD B;  4DL4 A;  4QZA A;  4FJV B;  3FKY A;  2WDV B;  2XH0 A;  2IY1 B;  3AU2 A;  3MDA A;  4NQL B;  4ED3 A;  3ZXR A;  3P4Q B;  1OXJ A;  5KAI U;  3IM1 A;  1SJH D;  2K8C B;  1SSN A;  2RRD A;  1WFY A;  1VZ7 A;  3THU A;  3UMC A;  2EAP A;  1KTK A;  2JVC A;  2NRT A;  1D8L A;  4CO7 A;  2CU1 A;  3V5F A;  5KVH A;  4HJK A;  5CP2 A;  9ICG A;  1S10 A;  1YNT E;  1NJW A;  4CRX A;  2VFS A;  2W03 A;  4QWE A;  3GRT A;  4GGB A;  3NUH B;  9ICP A;  3APC A;  1TE6 A;  1K53 A;  2HJ8 A;  1ZQX A;  2XY6 A;  4DSK A;  9ICA A;  1OQQ A;  3DBL B;  4X5V A;  2L7R A;  4FLH A;  2KTR B;  3KHG A;  4I6N B;  5L6G A;  4M9G A;  2FPL A;  4KX5 A;  2JZB B;  3BQT A;  2J0K A;  1GXF A;  4GIR A;  2M0N A;  2QAR B;  1ZQA A;  2PFN A;  2K8B A;  2PEA A;  3Q4D A;  4H4P A;  1WYW B;  1GRA A;  1EF5 A;  4UAV A;  3TBL D;  1L4Z B;  3BVZ A;  3RZF A;  2L52 A;  4KLE A;  1M4V A;  2LHD A;  3AH7 A;  4HPL B;  4W9E A;  5KHO A;  1G6J A;  1DGJ A;  4TQ1 A;  2KIC A;  2M8S A;  4WJP A;  3D9X A;  3UXK A;  1MQ2 A;  5JH5 C;  3ZGZ A;  4AP4 C;  4RGN A;  2J42 A;  4H2A A;  4HPN A;  1XLO A;  3B0X A;  3ZDM C;  3ENE A;  3Q8F A;  4KKJ A;  1O03 A;  3ZTC A;  3UCC A;  1KN5 A;  2R18 A;  3T5H A;  2LRU A;  1U45 A;  2FE8 A;  4DSJ A;  4NJ6 A;  3DGH A;  3RR1 A;  3TAD A;  3AED B;  1ZDL A;  5MPO A;  4AYB F;  1FHV A;  2FCM A;  3EYZ A;  2AGQ A;  2VH2 A;  5KNI A;  1NJZ A;  2KFK A;  5BOL A;  2V4L A;  4K3C A;  1N56 A;  3SHQ A;  3WAL A;  4MHV A;  4GR1 A;  1F0X A;  1KFD A;  4QW8 A;  1E8F A;  1O08 A;  3MGI A;  2WF7 A;  1HIW A;  2H3Q A;  3QLD A;  2XGQ A;  4F4Z A;  3PK7 A;  3ML9 A;  4F4Y A;  4BZA A;  4MJS B;  2HDE A;  3OTR A;  5ALS A;  3PZD A;  4PVE A;  3TEZ A;  2WXQ A;  3AM9 A;  4CF5 A;  2C22 A;  1L4D B;  2WWZ A;  2MHJ A;  2N9E B;  5D7G A;  4ECS A;  4JMU A;  4K7W A;  2LYB A;  5CRX A;  4WAA A;  1DXL A;  3Q3N C;  1F9J A;  1GO3 F;  3WU2 U;  1FCL A;  1UPH A;  2B3A A;  1SIJ A;  3I28 A;  4F8R A;  3IJQ A;  2K22 A;  4ZCW A;  4H83 A;  1QTM A;  5DPR A;  1OEY J;  3GIK A;  4JN7 A;  1ZP0 B;  2BPG A;  3VFK A;  3ZLG A;  4C7Y A;  4DHJ D;  3IT4 B;  4UQG A;  4I28 A;  1D8Y A;  2M17 A;  3PLV A;  4MT5 A;  4C8L A;  2IOF A;  5DBC A;  4BKG A;  2FAZ A;  5ALR A;  1EBH A;  1GV4 A;  2MA1 A;  4MFA A;  1PQS A;  3L4P A;  1Q1R A;  2P88 A;  2YVF A;  2OZ3 A;  2P8C A;  2K89 A;  1XCT L;  4YCX A;  3PSF A;  4KZ0 A;  4FZM A;  5IP4 D;  4ICU A;  4EFO A;  2GOW A;  4PVK A;  3EKG A;  3QN3 A;  1E8Y A;  1KLG D;  3TW9 A;  2ZZP B;  3KOO A;  2JEI A;  1KBU A;  2WAQ C;  3NJT A;  5EE9 A;  4II3 B;  4I2B A;  1NOM A;  2GLS A;  2MP2 B;  1HTO A;  4LNI A;  2XGP A;  2K5P A;  2MBH A;  3DG6 A;  5TIS U;  4JB1 A;  5ALK A;  3GDX A;  2HBM A;  3P3B A;  1ZGU B;  3OJ4 B;  2JXX A;  4KMO B;  4DFD A;  2KJH B;  2NO5 A;  4GDK A;  1W1S A;  3OZY A;  5J0R A;  4BDP A;  2BCP A;  4OZA A;  3W2D A;  2NVK X;  1NKE A;  2PTL A;  4QZF A;  2GGH A;  4JQ9 A;  1DGS A;  1WJ6 A;  1DII A;  2GQT A;  4P6V F;  3RH4 A;  1WZ0 A;  2D3B A;  1FD6 A;  2ZZC A;  1I7H A;  2V3A A;  2XY7 A;  1FEH A;  3KKA C;  1Y8R C;  3QC8 B;  4W9K A;  4Q45 A;  1QSL A;  5KFE A;  2KQS A;  4DXG A;  4K1R B;  2BKE A;  1JWA D;  1XDI A;  3WA0 A;  2ZJD A;  2OOB B;  7ICS A;  2GBM A;  1J2N A;  3M8S A;  4BCA A;  8ICF A;  2ZUB A;  2J52 A;  3AV8 A;  3ETL A;  2JH1 A;  5KG7 A;  1UXY A;  5FJU A;  4NLC A;  2I1K A;  1C4P A;  4UW9 A;  2ZIU B;  3IXS A;  4YT0 B;  3NZU A;  1HA5 A;  2BVF A;  5JCI A;  2WPC A;  3SV3 A;  9ICJ A;  1WSP A;  1ZQR A;  1WCL A;  2P8B A;  2JQR B;  1SB3 C;  1KM7 A;  1T0Y A;  8ICV A;  3EWA A;  2FNJ B;  4GXB A;  4M9L A;  2C7M B;  2WXM A;  4PVH A;  3KZI U;  2WLB A;  8ICT A;  2NTT A;  2GDQ A;  3OJ3 A;  5KFH A;  3RJH A;  1VZ6 A;  2ZIW B;  5GXG B;  3V6C B;  3VUX A;  3QZ7 A;  4GC7 A;  3OPS A;  3AXC A;  5AK3 A;  5D4B A;  1TYP A;  5EU9 A;  1NHR A;  2WYQ A;  2YAU A;  4IOI E;  2C60 A;  4PS3 A;  2KNB A;  3WAN A;  4WWO A;  3U26 A;  2MEK A;  2XIC A;  2W54 A;  4TMA B;  3QFB A;  4GFI A;  5J0T A;  5DLG A;  2MBR A;  1QIL A;  2A1J B;  3VVW B;  4JK1 A;  4ZRQ A;  2B0C A;  4DLG A;  2OKT A;  1J7B A;  1T8E A;  1ZQV A;  1MG8 A;  3PW2 A;  3TSH A;  3I6T A;  9ICB A;  5AIA A;  2BWF A;  1U47 A;  5L1L A;  2AGO A;  2BCU A;  2BCQ A;  4MM3 A;  4IL6 U;  2INN E;  2XNA C;  7ICT A;  1UD7 A;  3C0P A;  1R4M I;  3HRD C;  2R2Z A;  2LXC A;  1E90 A;  1XF5 L;  2GBK A;  2H3V A;  2HQM A;  2BYE A;  5AM3 A;  3VDZ A;  3C1Y A;  3UI3 A;  2I0K A;  3PWI A;  2VJ4 A;  9ICX A;  2FIF A;  2F1J A;  5FS9 A;  3QU2 A;  2ISO A;  4UDU C;  4OD0 A;  4F4X A;  3OLM D;  4J3O D;  3JPO A;  1WX7 A;  1I42 A;  2K8C A;  3RRA A;  1WUD A;  3KLJ A;  3PVX A;  2EAM A;  4LNO A;  4PJ0 U;  4RGT A;  4IP4 A;  5KT6 A;  3BS7 A;  5J2D A;  1D9F A;  8ICM A;  1UA0 A;  4ECQ A;  1XNS A;  2PP1 A;  4DQQ A;  2DUY A;  1JUD A;  2Y0S C;  5IOI A;  1KFY B;  2OJR A;  4M2Y A;  3UJS A;  1L5P A;  4YXD B;  3MC8 A;  2YVJ A;  1FPY A;  2DFL A;  5J2J A;  1IUE A;  3OWE B;  4YQW A;  4HYK A;  3KQ4 A;  2QJJ A;  3RN9 C;  2D3G A;  4EX6 A;  4QZD A;  3HSU A;  3OSP A;  1JRP A;  4WH4 A;  2ZVO A;  5EOZ A;  2C2E A;  1V8C A;  1BPD A;  4HWI B;  4RQ0 A;  2RDI A;  4W9C A;  5L9X A;  1C79 A;  1NYR A;  2D3C A;  4TKN A;  4A6G A;  1JML A;  5IA7 A;  4M02 A;  1VAO A;  5J2R A;  4DF4 A;  4RMA A;  4ZYN A;  4B9M A;  1YQ3 B;  1FFV C;  4B9T A;  5KFS A;  4C4T A;  1L0Y B;  3QXG A;  3F5E A;  2MQJ A;  2CFY A;  2AKZ A;  1IIP A;  3QKE A;  1RRB A;  3KTQ A;  1PUT A;  2I38 A;  1Q10 A;  3QAQ A;  5DCN A;  1E8G A;  4F2R A;  1KH0 A;  4PYU A;  3SI8 A;  9ICW A;  1I4Q A;  4XLO A;  4XDD A; 
#chains in the Genus database with same CATH homology
 1K51 A;  4AS1 A;  1DZN A;  1P7E A;  2LUM A;  4RFB A;  5HFY A;  1PFD A;  1EWC A;  1QF6 A;  3IAS 1;  3AEF B;  1N5W A;  1JCK B;  2J53 A;  1WYG A;  1WWT A;  4ZYS A;  1EWY C;  3AEG B;  2RK5 A;  1JWS D;  2INP E;  3W9C B;  3AE1 B;  1ZDV A;  1I4P A;  1GB4 A;  1DIQ A;  2L1A A;  3AEC B;  2WXL A;  3I9V 1;  2WXH A;  2J4X A;  4PZF A;  3BK1 A;  2N0S B;  1AW7 A;  2E6X A;  3AEB B;  3Q8E A;  3SFD B;  3TX1 A;  1XLP A;  2WXO A;  3BYT B;  1IBX B;  1QLT A;  5FXF A;  2P3H A;  3BZD B;  3I57 A;  2BVG A;  1ZDX A;  3AB5 A;  3P63 A;  4JX1 C;  4XWW A;  1KLU D;  1CK1 A;  1HQR D;  4WWM A;  1DOY A;  2PVO D;  4NAM A;  3VQI A;  4XWT A;  2RPV A;  1PGA A;  3AE8 B;  4IKG A;  4C56 C;  1HZ5 A;  4REZ A;  5I1W A;  2BB5 A;  3ZJT A;  2IPK D;  1N62 C;  4DXF A;  4HKQ A;  1F2R I;  2DYM A;  5AE2 A;  4N6E B;  2Y3R A;  2JZP A;  2KWD A;  3D2J A;  3AE5 B;  2CJO A;  2V3N A;  3S1D A;  1VDV A;  3EUB 2;  4KX6 B;  1V1P A;  1CZP A;  1E9M A;  2M0A A;  3POP A;  5I4D A;  4HRO A;  3AEE B;  4JWU C;  2SEB D;  1QOA A;  1EU3 A;  2K3U A;  2M19 A;  4AQ7 A;  2YEP B;  4YWG G;  5G5G A;  1TY0 A;  1YQ4 B;  5FKA C;  2BYT A;  2JX5 A;  2VFU A;  1FNU A;  2BW2 A;  4MAC A;  1QOB A;  2JYT A;  1RYJ A;  2WP9 B;  1WVE A;  4PWB A;  1TKG A;  3BK2 A;  1BUI C;  1RM6 B;  4BC9 A;  2PMV A;  5G5H A;  2BS4 B;  3ETR A;  1TS2 A;  3AE3 B;  3MC0 B;  2WDW A;  1CJE A;  1Y56 A;  2N7J A;  3V3X A;  5C2T B;  3TEW A;  4HG0 A;  1ESF A;  2PW9 A;  3MJ5 A;  1HZ6 A;  3AMZ A;  1YN5 A;  3E56 A;  1XLQ A;  5H92 C;  1AYF A;  1HEZ E;  3KJM A;  2PLS A;  4IDI A;  4C7Z A;  3ETR B;  3R2T A;  4HKZ E;  3FW9 A;  3BYY B;  1N60 A;  3TSS A;  1ZUD 2;  4US8 A;  2I2Y A;  3PO0 A;  3P42 A;  1TKY A;  3J9C A;  3SR6 A;  2WDQ B;  3B2F A;  3LXF A;  2Q5W D;  1ENF A;  3U7Z A;  2GB1 A;  1NEK B;  1C76 A;  1OFF A;  1SJE D;  2Y5P A;  1QLB B;  1B9R A;  4PWC A;  2PKO A;  3EGR A;  5T8I A;  1WVF A;  3DED A;  5BMG A;  3HRD D;  1TKE A;  2CU3 A;  2QPM A;  3NS1 B;  5I1V A;  3NRZ B;  3LLB A;  2JSV X;  2ACZ B;  2VZK D;  1SBB B;  1TY2 A;  2VFR A;  2ZW1 A;  4YSY B;  2W82 A;  2LEK A;  1W1K A;  2GQU A;  3ZYY X;  2BB6 A;  4WQM A;  3V05 A;  2Q4W A;  4JPS A;  3PZ8 A;  2WXG A;  2V3P A;  2X38 A;  4BBY A;  2E5A A;  3FIL A;  2P13 A;  1I4R A;  1QKZ A;  1EU4 A;  3VRB B;  5EE1 A;  2KN4 A;  1GB1 A;  1ET9 A;  4ML8 A;  3HVZ A;  4CQN A;  2JU6 X;  1V97 A;  1W1R A;  3NVW A;  1MVK A;  2WU2 B;  2K0P A;  3NRZ A;  3DWG C;  3U4E G;  1R7S A;  3WCQ A;  2WXI A;  1L6U A;  1ET6 A;  1SE3 A;  5FXE A;  3W8Z A;  1AHU A;  4B0E A;  1N5W C;  2RDG A;  2EXR A;  2AQ3 B;  1TS3 A;  1WRI A;  2LJI A;  2IJ0 A;  4LK0 M;  5G5G B;  4NZL B;  3GS2 A;  1RM6 C;  1N61 C;  4RGM A;  3BVM A;  1HXY D;  2LHE A;  1OQR A;  1YJI A;  1I4H A;  2Y4G A;  1V1P B;  2AX5 A;  1E8H A;  1SE4 A;  3S1E A;  3PZ7 A;  4US9 A;  2DYO A;  3KWV A;  4N59 A;  1VJK A;  1EM7 A;  2GI9 A;  4LTU A;  3AE4 B;  1IGD A;  2ICI A;  1VRA B;  4JE3 B;  2Z8L A;  4ITK A;  4GDL B;  3GP7 A;  2K9X A;  1JRO A;  1AHZ A;  2IGH A;  3FWA A;  4C80 A;  4B0M A;  2QSD A;  2IGD A;  1D6E C;  3FIL B;  1FCC C;  5BMH A;  2N9L A;  2WS3 B;  4O1N A;  1XO3 A;  5BYR A;  4EC3 A;  3A7U A;  2IPI A;  5EE0 A;  2P4P A;  2DBY A;  2JYE A;  2R8D A;  4RF1 A;  2V0G A;  1GAQ B;  2YVS A;  3AE6 B;  4UD8 A;  3W5V B;  3I99 A;  3IAM 1;  3LYY A;  4L1B A;  2UUU A;  1RFK A;  1DOX A;  2EEL A;  4XDD A;  3ZJV A;  2LMC A;  3IT6 B;  4YSZ B;  3W8W A;  4XDC A;  3H8H A;  4NAW B;  4MLA A;  2SAK A;  5H8Y E;  3BII D;  3SFE B;  2V4I B;  4PT5 A;  1K52 A;  1ZXH A;  3AE7 B;  3Q8B A;  4KGT A;  3ZJU A;  4YTN B;  1K50 A;  2IGG A;  1NI3 A;  4A90 A;  3PQB A;  3B2G A;  1IBX A;  3EUB 3;  1PGB A;  1TZO A;  1E7P B;  2H89 B;  4JAY A;  3RFZ B;  2L32 A;  1RWS A;  1ROE A;  1SB3 B;  4RGO S;  3TUO A;  1UWM A;  3E9S A;  4A6Q A;  2KQ4 X;  3S1C A;  1T3Q A;  1UGJ A;  2L83 A;  5FR3 A;  4R3D A;  1FXA A;  1SF0 A;  2OAI A;  2W55 A;  2AQ1 B;  3AN1 A;  1C77 A;  2M56 B;  2R61 A;  1FIQ B;  3NVY B;  1L6V A;  4TVY A;  2DLB A;  4MH8 A;  2RMM A;  3O13 A;  1X2G A;  5LNK 1;  2UUV A;  1UUP A;  3FW8 A;  1TYG B;  1C78 A;  2FBW B;  3W8X A;  2QIE B;  3MHZ A;  1WGK A;  2QEJ C;  1GOZ A;  1LO5 D;  1A70 A;  1C4C A;  1BXT A;  4TVW A;  3RJ8 A;  1T5X D;  4HRS A;  4KGS A;  3TEX A;  1VLB A;  3Q8C A;  1QQR A;  2WDR B;  2VAO A;  1J7A A;  1MBB A;  3N9Y C;  3P4S B;  2MH7 A;  1TS4 A;  4A9A A;  1AN8 A;  1XLN A;  1FFV A;  5HMR A;  4OHJ A;  2WDV B;  2ON8 A;  2JWU A;  3T3O A;  3R8B A;  3P4Q B;  1SJH D;  1SSN A;  1N5X A;  1VZ7 A;  2G1E A;  4PYT A;  1KTK A;  1FM0 D;  5C3J B;  5FXD A;  2PLI A;  2WU5 B;  1YNT E;  2VFS A;  3U52 E;  1W1M A;  3NUH B;  1DOI A;  2G9H D;  2KMM A;  4D2K A;  1K53 A;  1UWX A;  1OQQ A;  1JWU D;  2BTE A;  1I4X A;  5L6G A;  4OZB A;  4Q2J A;  4TSS A;  4USA A;  1AHV A;  2VZK B;  5HG2 A;  1L4Z B;  3BVZ A;  4GDK B;  1MHX A;  2L52 A;  1M4V A;  2LHD A;  3AH7 A;  3CIR B;  1DGJ A;  4TQ1 A;  2MJE A;  3SEB A;  1E6E B;  1FO4 A;  3ZGZ A;  4RGN A;  5AE1 A;  2J42 A;  4H2A A;  1XLO A;  1I4G A;  3S1F A;  1ZXI A;  1FNV A;  3Q8F A;  4KKJ A;  4OVZ A;  4L23 A;  2WXJ A;  1QT9 A;  5BMI A;  4PVJ A;  2FE8 A;  1E0Z A;  3CWI A;  3AED B;  4A55 A;  5HI1 A;  5MPO A;  1IGC A;  2DWQ A;  3VR9 B;  1GPX A;  1QOF A;  1L0V B;  1VZ8 A;  1N62 A;  3R2I A;  1FRD A;  1PYW D;  3T3N A;  1D5X C;  2BBC A;  3NVV A;  4XE0 A;  1F0X A;  2E3T A;  1BML C;  3BWU D;  3HUI A;  2QJL A;  1E8F A;  5L6F A;  4N58 A;  2WNM A;  1QOG A;  1YMH E;  2BT6 A;  1TS5 A;  1QLU A;  1I19 A;  4HEA 1;  5AWV A;  2HDE A;  3TEY A;  1W1O A;  4PVE A;  1KF6 B;  3TEZ A;  2WXQ A;  1D4B A;  5AE3 A;  3AM9 A;  1N60 C;  1L4D B;  5D7G A;  1D5Z C;  2ONQ A;  2Y08 A;  2OHF A;  2BVH A;  1FRR A;  1ZPS A;  1VR9 A;  4RNA A;  1FCL A;  1XCQ L;  2MJD A;  1SIJ A;  2K22 A;  2PIA A;  3KLS X;  1E0Y A;  1ZP0 B;  4C7Y A;  4DNS A;  3HVD A;  3IT4 B;  3DWM A;  3FW7 A;  2WXR A;  1D5M C;  4YSX B;  4MT5 A;  4TQ0 A;  3P1M A;  3L4P A;  2KAC A;  3BW7 A;  2XN9 C;  1JW9 D;  2HTM E;  5D3D A;  1XCT L;  3P4R B;  2BS2 B;  5TSS A;  4A8X C;  3NVW B;  4PVK A;  1B1Z A;  2PLP A;  1KLG D;  4GLS C;  5AUI A;  2YEP F;  2LFI A;  3ABV B;  4YTP B;  5EE9 A;  3JS8 A;  1SE2 A;  1YN4 A;  4ZHO A;  5HQX A;  2H88 B;  2K5P A;  4OZC A;  4LLG M;  2AQ2 B;  4JB1 A;  4WIP A;  2N9K A;  2OED A;  1CQV A;  2WXN A;  2BS3 B;  4RCO A;  1E10 A;  1NYQ A;  1W1S A;  1W1L A;  4OAL A;  3KWL A;  2FUG 1;  1SEB D;  4OZA A;  3W2D A;  1FFU C;  1SXT A;  2PTL A;  1NVI D;  5D79 A;  1C9F A;  2WXK A;  3A7R A;  4ARI A;  3A7A A;  1F0Z A;  2W3S A;  1DII A;  2GQT A;  4P6V F;  1FD6 A;  1FMA D;  1I7H A;  3GB1 A;  1F77 A;  1FEH A;  1MPE A;  2WXF A;  1MBT A;  1ZR6 A;  2IDY A;  4OW0 A;  1WXQ A;  4DXG A;  3U2S C;  1JWA D;  3RPF C;  2NMQ A;  3NVZ B;  3VTE A;  4BCA A;  2J52 A;  3AV8 A;  2JXT A;  1UXY A;  5FK9 C;  1C4P A;  3IXS A;  4YT0 B;  4P16 A;  1HA5 A;  4ZHP A;  1W1J A;  4ZRP A;  2BVF A;  1MHH E;  4ZOH C;  1WSP A;  2Y3S A;  2JQR B;  5E6J A;  3PM9 A;  1SB3 C;  5D3I B;  1N63 A;  1JWM D;  4M0W A;  2WQY B;  4MM3 B;  3VR8 B;  2WXM A;  4PVH A;  5BYS A;  2WLB A;  1JQ4 A;  2NTT A;  2Y3A A;  2KDM A;  1VZ6 A;  5GXG B;  1XEE A;  2CJN A;  3B9J B;  4IOI E;  2D5G A;  2NQW A;  3NVY A;  2QMT A;  5HHD G;  2MEK A;  4TMA B;  2W54 A;  3R07 C;  3RJA A;  1T6B X;  2MBR A;  3MFG A;  1FNW A;  1QIL A;  1F2R C;  3B9J A;  3NVV B;  4ZRQ A;  3AE2 B;  1J7B A;  1UNS A;  3NS1 A;  3TSH A;  3Q69 A;  3TSJ A;  4FXC A;  4YTM B;  5ADZ A;  3Q8A A;  1YJJ A;  4JWS C;  1C4A A;  4KKI A;  2INN E;  2LGI A;  2QIL A;  2XNA C;  1T3Q C;  4O95 A;  2GRI A;  3C0P A;  3HRD C;  2O3G A;  3W5U B;  2R2Z A;  3BVG A;  1L0X B;  1XF5 L;  1XXG A;  3P4P B;  2VFT A;  1YN3 A;  3UI3 A;  5HHZ A;  2I0K A;  5FXP A;  2WXP A;  1N61 A;  1TJE A;  4UDU C;  2NTS A;  4J3O D;  4ZOH B;  4RGT A;  3URY A;  3LB8 C;  3DQ0 A;  3SR6 B;  4BC7 A;  1X2H A;  3FAH A;  3MP9 A;  5BYQ A;  1NEN B;  1DYQ A;  1KFY B;  3NVZ A;  2KAJ A;  5JXV A;  5EE3 A;  1L5P A;  3AE9 B;  4EE2 A;  4YXD B;  1ZOY B;  3LAE A;  1JAL A;  4RF0 A;  1VQZ A;  3ZQ4 A;  4NJC A;  2W3R A;  2Y5C A;  1IUE A;  3OWE B;  3KQ4 A;  1FXI A;  1J7C A;  5G5H B;  2AXR A;  1HSK A;  1JRP A;  4WH4 A;  3HSU A;  1P7F A;  5K8E A;  1FIQ A;  3FC4 A;  1V8C A;  1FFU A;  5AUK A;  4KGR A;  3D2H A;  2MJ3 A;  2RDH A;  1JWB D;  1PDX A;  1ZXI C;  2PVG C;  1C79 A;  3VRA B;  1NYR A;  1JML A;  4HJG E;  2TSS A;  3AEA B;  1VAO A;  3NZ3 A;  2B76 B;  1YQ3 B;  1FFV C;  3D2D A;  1KRH A;  1W1Q A;  1ACC A;  3GSY A;  3C8Y A;  1L0Y B;  1MI0 A;  1STE A;  4DQO C;  4RH6 A;  1N63 C;  1PUT A;  3EA6 A;  2I38 A;  4WUR A;  3W1S A;  2QKN A;  1AWD A;  1Q10 A;  2Q85 A;  2ZW0 A;  4ARC A;  4WAF A;  1ZE3 D;  1PGX A;  1E8G A;  1KH0 A;  2VFV A;  1V1O A;  1I4Q A;  4L2Y A;  4XLO A;  2EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...