2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
1JW9D 1N60C 1EWYC 5ADZA 4N59A 3NS1A 3AE2B 1SB3C 3FWAA 1L6VA 1FMAD 3RPFC 1E10A 2BT6A 2BVHA 2DBYA 3AB5A 4PZFA 3SR6A 1PFDA 2BVGA 1W1MA 1N61A 3AEAB 3S1FA 3D2DA 1TKGA 3AE5B 3AE3B 1VDVA 4BC9A 1B9RA 3LAEA 3P4SB 5HMRA 2W55A 4US9A 1E8FA 4ML8A 4BBYA 1N60A 2G1EA 1I19A 1E8GA 3NVZA 1RM6B 3SFEB 2BS4B 1OFFA 4C7YA 3ABVB 1L6UA 3A7AA 1WRIA 1V8CA 3NVYB 1TKEA 1SF0A 1DIIA 4C80A 3CWIA 1NYRA 3TSHA 2WP9B 5GXGB 3AN1A 1J7CA 2H89B 1DOXA 1VAOA 2OAIA 3NVVA 4EC3A 2P3HA 5H92C 2ACZB 3AEEB 1GAQB 1QOGA 1RYJA 3D2HA 3AE8B 4FXCA 2PVOD 5G5GB 1WVEA 4N58A 1AYFA 2CU3A 1N62C 1AWDA 2E3TA 1E9MA 2AX5A 4USAA 1DOIA 1CJEA 4ZOHB 1ZXIA 1VJKA 3P4PB 1AHUA 1FRRA 5C2TB 4PVKA 3TSJA 3AH7A 3WCQA 2WQYB 1FXIA 1JQ4A 2R2ZA 1J7AA 1JALA 2M56B 5G5HA 1N62A 3AV8A 5FXFA 3I99A 2PKOA 1FFVC 2HTME 3NS1B 4UD8A 1WWTA 3FW9A 3B9JA 4WWMA 3AE7B 2FBWB 2LEKA 1SIJA 3SR6B 1PUTA 2R8DA 4YT0B 4HRSA 1QLUA 1OQQA 1YJJA 1RFKA 1E0YA 1UWMA 3W8ZA 3CIRB 4ITKA 4PVHA 4XLOA 1E8HA 4ZHOA 3BIID 3AEFB 3DQ0A 3NVZB 1FFVA 3EUB3 3HVZA 2B76B 4BC7A 2L52A 2N0SB 1SB3B 3NRZA 3B2FA 4N6EB 2OHFA 3TX1A 1PDXA 1QOAA 4TVWA 1KF6B 3HRDD 5AUIA 3L4PA 4HROA 2MH7A 3AEDB 3AE9B 1AHVA 1NEKB 2YVSA 2H88B 1JWBD 1E7PB 1F0ZA 2P13A 2O3GA 4YSZB 1NYQA 3A7RA 3PO0A 2NQWA 2KAJA 3VRAB 4PVJA 4YXDB 2PLSA 1T3QC 1FFUC 1TYGB 1ZXIC 1ROEA 1WGKA 1JROA 1FO4A 3AE6B 3LXFA 3W5VB 2PLIA 1QLBB 5AE3A 1WXQA 2K5PA 1JWAD 1UXYA 3S1CA 4US8A 2VFTA 4JWUC 2Q85A 3W8XA 4A9AA 2WS3B 1VLBA 2QPMA 4OALA 1I7HA 1XLOA 3NVYA 2P4PA 1XLPA 3EUB2 2MJ3A 1XO3A 2VFVA 1TJEA 4JB1A 1T3QA 1ZUD2 1FIQA 1FFUA 4ZHPA 4JX1C 5EE9A 5EE1A 3VTEA 5D79A 4JWSC 5G5HB 3DWGC 3P4QB 1E6EB 2Y5CA 4HG0A 2JX5A 3KJMA 3P4RB 3S1DA 4JAYA 3D2JA 2AXRA 1E0ZA 3B9JB 5AE2A 1QT9A 3NVWA 1W1LA 1DIQA 3AM9A 3LB8C 4TVYA 4MLAA 1YQ4B 1OQRA 3AECB 5HQXA 3ETRA 2K22A 2VFUA 2I0KA 2PIAA 3VRBB 1N63C 5C3JB 4YSYB 1W1RA 3PM9A 3KWLA 3GSYA 1WYGA 4PYTA 5AE1A 2GQUA 4C7ZA 3NRZB 2EKIA 2VAOA 3ZYYX 5AUKA 1QLTA 1V97A 1X2GA 1ZOYB 1VQZA 2W3SA 1N5WC 1NVID 3HUIA 5FXPA 3FAHA 1KRHA 1XLQA 1L5PA 4BCAA 1YJIA 4KX6B 2DWQA 2W3RA 1GPXA 3W9CB 1W1JA 1RM6C 3BW7A 1N63A 3W8WA 2WU5B 3DEDA 4PWCA 4IDIA 1DZNA 2W54A 1YQ3B 1WVFA 3NVVB 1X2HA 2WDVB 3W5UB 1W1KA 1L0VB 2GQTA 5HHZA 1ZR6A 1N5XA 1FRDA 2QJLA 1QOBA 1DGJA 2VFRA 1N5WA 1W1OA 2E5AA 2MBRA 1TKYA 2MJEA 3FC4A 4PVEA 1W1QA 2KMMA 2BVFA 2RK5A 3FW8A 1J7BA 3P63A 2WLBA 1R7SA 5FXDA 1FIQB 1MBTA 2MJDA 3JS8A 2M19A 4DNSA 2Q4WA 3AMZA 5H8YE 4ZOHC 2BS2B 3R07C 4PWBA 1FM0D 1FXAA 1NI3A 4P6VF 1XLNA 3SFDB 4LTUA 3C0PA 2BS3B 3VR8B 2K9XA 5EE0A 3DWMA 1F0XA 2JQRB 4YSXB 5FXEA 3A7UA 1QOFA 1JRPA 4YTNB 5G5GA 3S1EA 2QKNA 3NVWB 1A70A 1KFYB 3FW7A 4YTPB 3AE4B 1DOYA 3AEGB 1NENB 2EXRA 3ETRB 4O95A 2L83A 2Q5WD 1AHZA 1CZPA 2QIEB 2WDRB 1QF6A 1W1SA 4WQMA 5EE3A 2WU2B 4YTMB 2WDQB 1IUEA 1N61C 1HSKA 3B2GA 2CJNA 2CJOA 2PVGC 3HRDC 3LLBA 1RWSA 3P1MA 5MPOA 2VFSA 3AE1B 3AEBB 1MBBA 1ZP0B 3VR9B
chains in the Genus database with same CATH superfamily
1ZETA 1JW9D 3M62B 1N60C 2PTYA 2NRWA 3V7JA 3O65B 3Q8QB 2DKXA 4N59A 1Z00B 2PFNA 2PW9A 3DCGA 3N97B 2HOFA 3RJEA 4NM1A 5BYRA 3V60A 3UPQA 9ICBA 4OVZA 3TCSA 2N1WA 5AKXA 3GU3A 2KNBA 3ML9A 4W9KA 4K4IA 4J03A 4IRDA 2BVHA 1LKYB 3OW1A 3NZSA 2KDMA 2N4FA 7ICJA 4QZGA 2XIDA 2Y1IA 3M8RA 2BVGA 3APCA 1N61A 1S0OA 5J2HA 4MKSA 2HW3A 3HM3A 3S1FA 4I2BA 3AE5B 4IOIE 1Q10A 3H8MA 4Q44A 1SGGA 1E7VA 3URHA 2Y3AA 1STEA 2NVUI 1Y56A 4ED0A 3EJBB 3BQ0A 4KLLA 1XF5L 2QMTA 2ZTDA 5EDSA 5HMRA 1TE6A 4OJ6A 4QWDA 5KT5A 3PW2A 1MSWD 2X38A 3DV9A 1E8FA 2G08A 3IV6A 4JUZA 5KFTA 1N60A 3DBSA 1J2MA 3N32A 1BKHA 1Z4OA 2KZZA 1I19A 1IGCA 2UU7A 3ZUNA 4AOFA 3NVZA 4ANWA 2WDTB 3MKCA 4AS1A 1TS2A 3RGTA 4H4RA 4DFDA 4KEMA 3OJUA 2FLNA 2PMQA 4RQ5A 3GIIA 1RXVA 2NRZA 3LVWA 1OFFA 3DFHA 1PZNA 5L1LA 4DNAA 4HKZE 3CF6E 1ZQAA 3N30A 4BKTA 2HDOA 1V8CA 2ZUBA 5AM4A 2HBMA 2MRLA 5KFYA 3ZDAA 3N1YC 4ED7A 1T4GA 3AUOA 4EFOA 4ACFA 5KFJA 3H1UA 4EZKA 4QZ9A 3IN5A 4C80A 4GOCA 3GY1A 4WJQA 3ONNA 5KFFA 3JPNA 2LVOA 1OUQA 5ALXA 7ICPA 1WF9A 3QIJA 4OZAA 4IQWA 1VAOA 4MGYE 1Q1WA 3NVVA 3DGHA 5FS9A 1XANA 2P3HA 3PSIA 3KKAA 3RBDA 1NKCA 2D8CA 5KFXA 4H83A 1WGHA 3RNGC 1GAQB 1LO5D 3CXBA 4I2EA 3KTQA 3U4FA 1F44A 2V9WA 1PVPA 3AE8B 1X9WA 2RPQA 3KVFB 5AHXA 1UA1A 4RPYA 4YG2A 4I27A 2ZVOA 4WIPA 5DB9A 2JXXA 2OQYA 2BCVA 2E5SA 3C8YA 1WXAA 3ZVIA 4FXCA 4UBBA 5FS8A 5D3DA 2PVOD 2IOFK 1IBXA 4NPNA 1TKDA 3IK4A 1D8YA 4P1BC 3I1YA 4KV2A 3WKBA 5HHHA 1GRBA 2KT7A 1L8PA 2PTLA 9ICHA 4GXKA 1GRHA 1E9MA 5ALNA 4HN8A 4QZ8A 4XRHA 3RCZA 1JWSD 2Y0SF 1CJEA 2D07B 2YN4A 3APDA 4ZOHB 5DPSA 1MHHE 1Q1RA 2KP7A 2XCPA 4FN2A 3L5KA 3T5LA 3P0WA 1XWLA 3OSPA 5AKYA 4M0WB 4FFDA 4UAYA 1L0YB 3P4PB 3MQTA 3H4DA 1FRRA 3NFUA 4H50A 1ZDXA 7ICUA 4HNLA 4YXMA 4P1CC 1DNCA 3TSJA 2BZFA 4WH4A 4CE6A 7ICNA 4YWOA 3WCQA 1XEEA 1FXIA 2A5UA 2MP2A 3MY9A 1SZPA 2HXTA 3K75D 4ELTA 2AQ2B 5BOFA 1DTNA 2KEYA 4IP5A 2R2ZA 4DF8A 4Q2JA 4NQKE 1YQZA 2FDRA 4JV0A 4YP3A 4NLZA 5G5HA 4KTQA 2YY6A 2QJMA 5DB7A 3R2IA 3MGVA 1STZA 5AI6A 3I63C 4QAYA 2J0JA 2J42A 4Y2SA 3ZNID 2HXUA 2LGSA 4Z1YA 3TACB 4B9NA 2YEPF 3BVGA 3Q2AC 2XH4A 3GD6A 1L7MA 3NS1B 3PV8A 3P3BA 3PSFA 1IYXA 2DZIA 4C4SA 8ICEA 2CU1A 4DO9A 2K4IA 4B6JA 3ZO5B 2KXJA 2JHDA 2PPGA 3MBYA 1NK5A 4Q8FA 3GZNI 2HD5B 5JCLA 4ANVA 2HZGA 1ZQTA 2KN5A 3SR6B 2PCEA 3DK9A 2RP5A 5EWFA 7ENLA 4G11A 5FMHA 4LNKA 3QZ7A 1F9CA 5KG7A 2ONEA 2RMMA 2YVJA 2DUYA 2IHMA 3N1XC 1BUIC 1V5TA 1OQQA 1GC7A 2JGAA 2ZIVA 4ED3A 2P3ZA 5DKWA 2JEGA 4DSIA 2F3NA 2KFJA 3GS2A 2C2RA 4ZCWA 1K52A 2KJ5A 3J9CA 1O08A 4U7CA 3WK9A 2BCUA 4PPXA 4KIKB 4ITKA 7ICGA 3IHQB 3DERA 2KQ7A 5JZEB 3BIID 4F4ZA 4DSKA 7ICVA 3JPQA 2FLPA 1ZQ1C 3RJGA 4DHJD 2PP3A 1V81A 4NJ8A 3X0WA 1SB3B 3D9XA 2P6RA 3R7RA 2W0HA 3B2FA 3QPEA 2E1EA 1YX5B 1WXMA 3TEWA 3JW0X 1PDXA 3HPFA 4TKNA 2QLTA 2IGDA 2AL1A 2XH7A 3BSMA 4I2DA 2XC9A 3A9JA 4OZBA 1DOQA 1JI7A 1S0VA 4GC7A 3H12A 4GXJA 3HKZF 1B43A 4PHPA 4R8UB 2BCRA 4JL9A 3VH3B 1MG4A 4HVBA 2W9NA 4M02A 3VCCA 1LVLA 2KWCA 4GDLB 3ZTCA 2I1KA 5KVHA 2UUUA 1QH9A 5J2BA 1NEKB 1P9DU 3LWMA 1UF0A 2YVSA 2XK5B 4ZRJA 3SQPA 2ZW1A 3UJEA 2GOLA 4G9BA 5BPCA 3JPSA 4CHKA 4Z6FA 3EEZA 4KX3A 3PZ7A 2KAJA 3T8QA 4P0PB 4H4VA 2KNJA 3VRAB 4YL8A 5ALTA 1ZQDA 2UVWA 3PLVA 2M8SA 3QZ8A 3SZ2A 1KKOA 4P7IA 5EWEA 1TYGB 4KLMA 2SEBD 3AL0B 3MC0B 1XO0A 4EYHB 1NK7A 5IP4D 3Q8KA 5CHVC 5I1VA 3K1GA 4EMIA 1LXDA 3MGIA 1QLBB 3BS5A 4HCPB 2FUG1 3ONSA 3UGVA 2H3VA 1E8XA 1IM4A 2YMQA 3H7SA 3QK0A 4RGNA 1UXYA 5FJOA 4JN7A 4US8A 2ZPNA 5J2JA 2JXJA 1KL9A 3PO4A 1M4VA 2VIXA 2WB1C 4QWAA 4DL6A 3KHGA 2Q85A 4WAAA 4RNNA 2VA2A 3A9KB 1VLBA 3I3TB 4GXIA 5I4DA 1XHCA 4S0RA 3F5AA 3TJIA 2RPVA 4GIBA 2DFLA 9ICIA 2P4PA 4RH6A 1HUOA 2AL2A 3LJ3A 4IWOA 2A1AA 3PR4A 5KHQA 2Y08A 2IO1B 1XO3A 1D6EC 3WALA 1RRBA 3QUQA 1R4NB 5AM1A 2M0AA 1NKEA 4BJQA 1MC8A 1NJYA 2D2QA 2LPEA 3EHVA 5L6GA 2BYVE 2PKEA 3TEXA 5C23A 3UQBA 2MEKA 2V3PA 4X5VA 2K8CA 4OZCA 4MF8A 3UXLA 3G6XA 3DBHB 2I6XA 4GLSC 4ZHPA 4UAUA 4UB6U 2EAOA 5EE9A 4ICVA 2TSSA 3H8SA 5K8EA 1GEUA 2GLSA 5D79A 5BMIA 5J2EA 7ICMA 1KLUD 1EO6A 4JWSC 3WK8A 1WZ0A 2IY1B 4I6LB 3RT3B 2EQ7A 1UGMA 1NPXA 4HK2A 3VCNA 3D6JA 2ZIWB 2J4XA 9ICOA 1C76A 4HG0A 1ZQVA 1ZQZA 4QJFB 5DCNA 1WWUA 4KVGB 1HJPA 4Q43A 3KJMA 2WGSA 1X40A 2ZZPB 2X50A 5AKLA 1KKXA 1WX7A 4XE0A 4RPZA 1ZQRA 1WXVA 3S1DA 2QKQA 5KG0A 4XZ4A 2G4DB 2N7JA 4DXAB 3T9PA 3MR2A 5KHOA 2KSOA 2BQUA 3CMMB 7ICSA 2KK8A 5KVIA 2EZXA 3DK8A 4EM3A 5KFNA 3VUYA 3QFBA 5KG4A 2M1MA 4ECXA 2X8HA 1DIQA 2EDUA 4JGHB 1VJ5A 4M47A 4KGRA 4X57B 1JXLA 3BS7A 4PGYA 4PYUA 1P7EA 3SAFA 2DNFA 1GJZA 4K8DA 1W6TA 3ZQ4A 3ETRA 3Q69A 1F9JA 1I4XA 3MP9A 4AYBF 2YB4A 2PIAA 4BWJA 2NTSA 2WX0A 3H6NA 4YWGG 3V6EB 2I0KA 4JN8A 1HEKA 3DG3A 5C3JB 2WOIA 3GIJA 4M8MA 1WUDA 5D46A 5K4LA 2EZYA 1S5LU 4DHGA 4J9RA 3OJ4B 2FAZA 3WKEA 4NAMA 2PFQA 3GE3C 4RT3A 2JRHA 4C7ZA 3ZDTA 2GQUA 3NRZB 3RMKC 4ENLA 1VD2A 3GD3A 2VAOA 4M8NA 7ICOA 3ZYYX 1KKRA 3R10A 5ALMA 1C7YA 4P4MA 2XY5A 2FE8A 2N9PC 4ZRPA 3V62A 1PK1B 4NY8A 2F1HA 3VCBA 4ECVA 1ZOYB 2WXJA 4E71A 1PGXA 1UELA 5E6NA 2L00B 4CF4A 1AN8A 4KLFA 5KFVA 4GGBA 2KC1A 4MM3B 2N9XA 4H4YA 4NWIA 2E1FA 2UUVA 4Q8EA 3ENLA 4F5QA 5B66U 2IGGA 4BCAA 1UT8A 4RQ0A 3QU5A 1Z00A 2DWQA 5KFCA 3ZDBA 1BPBA 3UJFA 2D5GA 2W3RA 3W9CB 5C5JA 3AU4A 3Q8LA 3RJHA 2Z8LA 1ZQLA 2C7HA 2OXOA 3N1ZC 3CGCA 3DEDA 4PWCA 1EBDA 1LKYA 2KMDA 2D10A 4FS1A 2IDYA 3IJIA 3NTUA 5ALQA 3L08A 2HMXA 2AQ3B 4GU2A 4JWMA 3NVVB 4F1SA 2K6DB 2ZZBA 1SSNA 1YZ6A 2HI0A 3IRUA 3LK9A 3RJKA 4JLCA 2QAEA 2XGZA 1W1KA 3AXCA 3RRGA 1O03A 2ZXIA 4II3B 4GMEA 1MNSA 3EZ5A 1AROP 3PLUA 1W1OA 1I4RA 2QGYA 4BBNF 3T5HA 2N9KA 1SZHA 4A6QA 2WWZA 2JR5A 2AAQA 1QSSA 4I2HA 5J0TA 1GSNA 2AU0A 1W1QA 5FJUA 4EBCA 3SN4A 2HVIA 3ZW3A 2CR5A 5J2IA 3B1LX 1ZQNA 4H4QA 4CYEA 2W11A 1LVHA 2OKTA 2KJHB 5KFBA 2YX8A 3TFSA 2DYOA 3H0MB 5AK3A 1J7BA 2R9ZA 4F3OA 4I2CA 3P63A 3PX6A 3V4BA 2JY6A 1ZQPA 1ZDVA 3SENA 1GOZA 4EMWA 4UB1A 3PZDA 5IIOA 2M0NA 1JPMA 4GYPC 4M0XA 2MJDA 4QIWF 1WJ4A 4EOYA 3RITA 4URKA 3B97A 3JS8A 3U8ZA 4Y2QA 4B9UA 4TV3A 3SN0A 2GL5A 4L2YA 3ZD9A 4ZOHC 2BS2B 5DPRA 4LJXA 1CQVA 2BWES 1DXLA 3OZYA 3KW5B 1J8CA 1TS4A 5JH5C 1FXAA 1FPYA 2HHWA 2C22A 1NDAA 2HHQA 3RI7C 1E9IA 3C0PA 3MUCA 2LXCA 1WGDA 2P66A 1XDIA 2W8LA 5KAFU 2MHJA 3Q8BA 3HT3A 2LMCA 2NO5A 3KUZA 4KGTA 3CRXA 4DSFA 4M9LA 1D5ZC 1RYSA 1TAMA 3ZNZB 3T3OA 2M4NA 1UQVA 5D49A 1UBIA 1BPDA 3S1EA 4GYPA 3NVWB 3UF8A 4G50A 1A70A 3D32A 5AICA 4DL5A 2DQNB 4OJOA 2XEWA 4HJKA 3IBEA 3AE4B 4K7UA 1L4ZB 2RQ5A 4WAFA 1EC8A 5BMGA 1ZW7A 2KDEB 2KMAA 4Z6EA 4RQ7A 5J0PA 4MJSB 1L8OA 2QB1A 4RNMA 3MDAA 4DS4A 5L95C 4M0WA 3H0RB 1AHZA 4DQPA 1V9PA 3TJPA 1C1YB 1TBEA 1WX8A 1CZPA 2BDPA 4FJVB 2PS2A 2YMPA 2WXGA 2QIEB 3UIPB 4BFRA 1WUEA 2KKCA 2WDRB 2J6TA 3UINB 3ALBA 3KHHA 4CF5A 2GB1A 4KSLC 4RCOA 5EE3A 5IO9A 5DPWA 1ZQUA 3GO2A 5DBCA 1U4BA 5CWRA 2IYDB 2WU2B 9ICQA 2ALZA 2NR2A 4F5RA 3MJ5A 2XBBC 3ZVHB 3L0WB 4MGKE 3ZNGC 2PVGC 3PHWB 3P1MA 4DHZE 4EQRA 5G2NA 5AIBA 3PS6A 2BQQA 4ARCA 3NXLA 2EELA 2A8XA 4I28A 3TMPB 3RD2A 3CYJA 1OTRB 1S0NA 3TCAA 4BKSA 1XS2A 3LVVA 5KT3A 2QB0B 1U48A 4RM9A 2QJJA 2B0CA 3K9OB 5ADZA 1KLNA 3TJ4A 4BWMA 4LCDE 4FP1A 5AKZA 4QW9A 3NS1A 5KFAA 1I4QA 5L1KA 4GB9A 1SB3C 2KD1A 4E74A 1KEJA 3FWAA 2WAQC 1RZTA 3GP7A 3KUCB 2XI9A 3T79A 3RPFC 1U45A 2VANA 2BT6A 2PMZC 4DLGA 1WFYA 8ICWA 2X99A 4EX7A 5GMVA 4WWPA 4PZFA 3SR6A 3ZDDA 2XVTA 4W9CA 1PFDA 3U30A 1TZZA 4EBDA 4WQOB 3P42A 3RNBC 3GE8C 4Y2TA 5CR0A 1B22A 3OWEB 1WGGA 2J53A 4KGSA 4DOAA 3LDZE 3VDGA 4DS5A 7ICHA 4WJ3B 3TFRA 3M3JA 2W55A 4WWOA 4JPSA 5E6JA 3R0KA 1D5XC 4KLEA 3GQCA 3BQ1A 1BQGA 3ZLFA 1H4RA 4KIKA 1L7OA 2G1EA 4PGXA 3UCCA 3PPAA 2NYVA 3IP4B 3EFUA 1E8GA 2NRXA 2XSXA 2NRTA 1J97A 1MRAA 1CK1A 2SAKA 1RM6B 4F5PA 1YN4A 2DGZA 3OGUA 5ALIA 5ALOA 4YR2A 3QWZB 2VH2A 3UJSA 2BS4B 1TT5B 1NHSA 1T0RC 1S1QB 2LJIA 2PLPA 4NXZA 4CCHA 3ABVB 3O0HA 4FE3A 2AYOB 1UBQA 3LXDA 1Y8RC 3C21A 2NS5A 2DX5B 3B0AA 4GLXA 3U2SC 4R8UA 2NQLA 1TKEA 3BJSA 2BC0A 3WKAA 1S97A 4OHJA 4HLEA 1VR9A 4YMOA 4PZNA 1XXGA 1NYRA 1L6NA 3CWIA 5KFRA 5IAAC 1GRGA 4GDLA 4TURA 8ICUA 4DBGA 3MFIA 9ICUA 2MBQA 1I35A 2OAIA 3AN1A 2XK5A 4GFJA 3ZI4A 4EC3A 2LI6A 1RYRA 4H2HA 4RQ2A 5H92C 3POPA 1AW7A 2ACZB 3AEEB 4M2YA 4PS8A 1TIFA 3VTVA 4P0PA 4II2B 2HBKA 1TAQA 3RN9C 8ICMA 3D2HA 2V4LA 3VC8A 1SBBB 5B5EU 3FDSA 5HHIA 5CX3A 1YEYA 3KZXA 1ZQBA 4ZRIA 1NELA 4IHCA 2AGQA 1F0MA 2V3AA 2OLAA 2CHXA 4XUSA 3A4SC 2Y1JA 3FKYA 5G5GB 5JHBA 5L83A 1C4CA 4N58A 4A6GA 1AYFA 1AWDA 1UCVA 2E3TA 4DSJA 1SJHD 2B3AA 3UQ2A 3M9NB 4FA6A 3A9KA 2WF9A 4F4WA 4EX6A 2GRIA 2F1JA 5D7GA 3WKCA 3VH4B 2MUCA 1K8RB 4FHKA 2CHWA 1JPDX 4CQNA 1DRGA 3WANA 3CP8A 5DB6A 1VJKA 1BPZA 2Y5BB 5C2TB 1V80A 4KN7A 1GG3A 3I5JC 4BOZB 4PVKA 5AM5A 3PWIA 2YVCA 1K5OA 2W82A 2OVLA 3O13A 2KJ6A 3AH7A 4NL9C 3N3KB 5KFDA 1KFSA 2NBVB 2NVKX 3MABA 1XU4A 2ISOA 2A19A 2WQYB 2JZBA 1R4NI 2J6UA 4A35A 1JEHA 1JQ4A 5AK5A 4MFCA 5AIAA 5AM2A 2GOWA 3DHGC 1S3SG 4M9HA 1ACCA 1NDDA 5FKAC 3PSTA 3C1YA 1WY8A 4M6WB 3DBHI 4IWQA 2L8JA 5CEHA 4N9F4 4FX9A 2CN1A 3ZKJC 4BGDA 3AV8A 4HXDA 4TUPA 4LJOB 3Q3NC 3WU2U 5F9LA 2WXHA 2AL3A 5DG8A 8ICNA 1DGSA 3T3NA 3I99A 4GRTA 2WF6A 1XS9D 1C20A 1SE3A 4DDID 3DGZA 3DEEA 4UD8A 4NAWB 3PMNA 4MT5A 3UMGA 3IG5A 5KAIU 4PGQA 1QKZA 1WWTA 2KTFA 3I57A 4DWIA 2D6FC 2GQWA 3Q3OC 3RBEA 2FBWB 1MJDA 2WOWA 4TQSA 4NL9A 3S2AA 3IG3A 3BY4B 1PUTA 3QYPA 9ICAA 2D3AA 1S77D 1N48A 3NO1A 2LHTA 3O0FA 1NBFC 2GMIC 3S5SA 3QA8A 4LNFA 2BCPA 3BINA 3DGBA 3PWGA 2R18A 5KG3A 8ICFA 2MBEA 2MBOA 1E0YA 1KTQA 1MBBA 2OG9A 3R11A 4EQXA 3TI0A 2I38A 4LVSA 3PY8A 4F4XA 2BYEA 4RQ3A 5HG2A 4ED8A 4B0MA 1PDZA 3DOWA 4PVHA 2WNMA 1QQ5A 1E8HA 1G6JA 3Q3MC 1P48A 4E0DA 3ENEA 1IYFA 2DPIA 4OVVA 5E79U 1PVQA 3N7RC 2BB6A 1P43A 4H4XA 2BQ3A 1YN5A 1SKWA 3NRZA 3D46A 2ZCCA 3KKAC 1ZX9A 3IM1A 2OHFA 2JWUA 2RR9A 2WHIA 4GC6A 3RR1A 2HJ8A 3L3FX 1PK1A 1A77A 3RTVA 4O5CA 1QOAA 1QQRA 3QXGA 1KF6B 5IN7A 4RPXA 4HYRA 1ET9A 3AEDB 2GRTA 1WE7A 4MM3A 3PNCA 4J3OD 3IDWA 1ZKHA 2F44A 1RXWA 3R2TA 3KFUF 4MGZE 4Y2PA 3T5JA 2KDIA 1T6BX 1JWBD 1NNLA 2H88B 4IL6U 5D6JB 2EQ9A 3OTRA 2HHUA 4EENA 2KX3A 3H7VA 4J9NA 2LGDA 4YSZB 4ZYSA 3A7RA 5GRTA 1T94A 5KG2A 3PO0A 1R0MA 4H2AA 5I1WA 4NY0A 4R63A 1ZD2P 2XY7A 4MGIE 4QWCA 3ZXVA 3P93A 1MHXA 1T3QC 4OCZA 2INPE 2OH2A 2IJ0A 1FO4A 3AE6B 4M9JA 1KJTA 4YD2A 3U7ZA 2ES6A 3V5FA 3E58A 1C4AA 5AZFA 1COOA 2K5PA 5C0YA 3QCAA 3JZUA 2FYMA 1XNSA 1HZ6A 1XT9B 3N7PD 2VFTA 2PGEA 3QX1A 3HX0A 1ENFA 3C2KA 3KUDB 3V72A 1COKA 4RQ6A 3EPIA 1F77A 3W8XA 2EQ6A 1H8CA 8ICBA 2KLGA 2QPMA 3H70A 4OALA 1TVAA 3TOYA 1ZQGA 1WJNA 4DSLA 3SQSA 3NVYA 1JRUA 3KLJA 2K0PA 5GTHU 4LJPB 3EUB2 1JN3A 4QW8A 3DVGX 2JRIB 1ZDLA 2PJHA 1ZJMA 3ZIMA 2VFVA 4GIRA 4HDOA 2WDWA 3MFHA 4IM3A 3QEBZ 1T3QA 4G7FA 3IG8A 3M95A 1XPYA 2DYMA 2H3FA 3DVNU 5KFWA 3DJGX 1CUKA 1C77A 1L0XB 2E8OA 4JX1C 2BGFA 3V3XA 2R8GA 1T5XD 2BF8B 3VTEA 7ICLA 1M94A 3WK5A 2C28A 5CTRC 3SU8X 2K4HA 4KITB 4YD1A 2HHXA 2KV2A 3KOOA 4C8KA 4C4VA 1TKKA 2C7NB 3TEYA 2OZ3A 3ZJUA 2V3BA 1D8LA 3PRPB 3P4QB 4XQ8A 3ZLZA 4MMWA 7ICIA 1ZD4A 2L1AA 5KFQA 2EAMA 4KMOB 2PE6B 1NZPA 4TQ0A 3ES8A 1XO1A 1ZD5A 1TZ1A 5T8IA 3RR8A 3RZWC 2KD0A 4W9LA 2BYTA 4RT2A 1C79A 5J2CA 5J0RA 4DDGD 3TTEA 4ZRQA 1E0ZA 1BVSA 3B9JB 3PSPA 4UARA 1RDFA 2ZIUB 4F2RA 4DCCA 5AE2A 3GDXA 3C5FA 1UNSA 4ZYNA 3OSNA 2KQSA 4REZA 2ZIXB 1RFAA 2IOFA 2MUTB 3NVWA 1N56A 1OW5A 3GFKB 2K4EA 2G3QB 2L05A 4F4YA 2G5IB 3MC9A 2GGGA 3LB8C 2QDDA 4KMUA 4OW0A 4MLAA 9ICMA 5BOLA 1YQ4B 4M04A 1OQRA 4OD0A 3Q8CA 3KWVA 9ICNA 3C28A 2FPLA 3UMCA 1ZQIA 2K22A 5J0UA 2OEDA 4MJSA 3VRBB 2KC2A 2PMVA 7ICFA 3CK5A 1A6SA 1KLVA 1N63C 5F9NA 3FILB 2JUOA 4JV1A 3C19A 3FJ4A 4DYEA 2MLBA 2HOQA 3MHZA 1SJDA 2O2VB 3KWLA 2OPJA 4ED1A 2ICIA 4ANXA 4PYTA 4BKSD 4RUCA 5AE1A 2IO0B 4ADWA 3UXPA 2WPCA 3QTPA 1T3NA 8ICRA 2HDEA 2JWZA 5J2GA 5L1IA 1FNUA 2LZ6A 1PUZA 1H38A 2P88A 3S47A 3ZVHA 1SIFA 1ECQA 3CNHA 4DFJA 3EJEB 3CB3A 2DW6A 1D9DA 3A0HU 1X2GA 3TAQA 1C4PA 3RF9A 4DQRA 4UB3A 3M9OB 5ALEA 4JQWC 2PTZA 4E5TA 3FM9A 3TUOA 1GNUA 2KZ3A 3LB8A 1B1ZA 1IGDA 1WYWB 2E8PA 2K1FA 3HUIA 1MO9A 1F2RC 4A90A 2OCEA 2QB0A 4XA5A 2VRRB 1S76D 1KRHA 2PA6A 1L5PA 3DBLB 1QILA 1NK4A 1P1AA 1ZPSA 5U25A 4KX6B 2FUHB 1BT0A 4W9FA 1RM6C 1X6IA 1N63A 3W8WA 2OX4A 3MC1A 2MWSB 3NZ3A 2KFNA 2L7RA 1CMXB 1D3ZA 1ZMDA 1BZLA 2AL6A 1TYTA 3F5EA 4F8RA 4F50A 3HP6A 2EAPA 2CHZA 2Q4TA 3AEVA 2FNJB 4ZDVA 5GTIU 1L3UA 1PK3A 4H4SA 3PGEA 4EZ6A 4NV0A 4HCLA 4K7ZA 3BOXA 3BWUD 4NQLB 3H0LB 3ALRA 1N5XA 3HILA 1FECA 2QJLA 3TBLD 1QOBA 8ICYA 1VZ8A 1SV0C 1ZQOA 3PREA 3TL5A 4F4RA 2OJRA 5AEKB 1TS5A 2E5AA 2LM4A 2ZVNA 7ICKA 2OO6A 4E4FA 2JEJA 3II4A 3FC4A 4GDKB 2I1JA 4HPNA 4NEWA 3CYMA 2KMMA 1S0MA 3NUQA 1F2RI 5AI5A 3E9SA 3TW9A 1EXNA 3L16A 4BAXA 2OEHA 4LDTB 1TY2A 4QWBA 2KWDA 2WLBA 3UIOB 4IT1A 4TSSA 3UJ2A 2V4RA 4C8LA 4IRCA 1ONFA 4HCDA 3UMBA 1TTNA 5LLIA 1JWMD 3QJZA 3UQAA 1C9FA 1FIQB 4YCXA 1QSYA 4BXOB 3JYUA 3HSUA 2WHEA 3L10B 1FXTB 2Q4WA 3AMZA 5LXHA 1JOAA 3SQIA 1TY0A 3BYTB 5AI9A 1XCTL 4WJOA 4Q45A 1EBHA 5FS7A 5HKHA 4APNA 2P6UA 1NJXA 1SV0A 4PWBA 1QLNA 3RJ8A 3CSFA 1UH6A 4J9PA 2JZBB 2YQUA 1ZQQA 3PZPA 3QU2A 3Q14C 1ESFA 4F4KA 2RDGA 1NK8A 4O3SA 2IGHA 1NI3A 2WTFA 4P0QB 4RQ4A 3SFDB 2G07A 1WGRA 7ICTA 2N1RA 2BPFA 4FHJA 1T0QC 5EBKA 5EE0A 3QARA 4MHVA 1NZBA 1MQ2A 2WXLA 4YSXB 3TWBA 9ICSA 3HWTA 2E8MA 1QOFA 1V1OA 1JMSA 1RPLA 1BGXT 4R3DA 2W7OA 1EC9A 1ZJNA 3FG2P 3WAPA 1GETA 5G5GA 5JU5A 1GV4A 2QKNA 4PS3A 3SHQA 1WE6A 1ONEA 5CA7A 2PP1A 3MR5A 1PYWD 4B95A 4UAVA 5IDZA 3M7DA 3F2BA 2YEPB 1MA7A 1Z2MA 3AEGB 3VDZA 4RM8A 4F2SA 3GRTA 2MU2A 4CGZA 3TAPA 3EJDB 1NENB 6ENLA 2VJ5A 5FP0A 4M6UA 2LJ5A 3L8KA 5AWVA 2Q5WD 1Z19A 3PQBA 4O0IA 5JUMA 1FCCC 3EYZA 4H4UA 1NI2A 4GR1A 3I6EA 4RQ1A 1YJ1A 2CHRA 3FCPA 3OLMD 1ZY8A 1HEZE 2FE9A 3ISBA 3C29A 4QZHA 4QZAA 2WF8A 4B9TA 1FNVA 1V59A 3ZJTA 2AXTU 4OJ5A 1RLFA 3DVNV 9ICJA 2WPFA 3WK4A 1JUDA 2KFKA 2CFYA 3BZDB 4FO6A 3ZDEA 3Q8RB 4JMUA 3EF6A 2LM1A 3RAQA 5ALFA 3UXNA 3RH4A 5L1MA 4EEWA 2W03A 3D2NA 2I5QA 4M6WA 1UA0A 3KHLA 3RJJA 2XO7A 3AEBB 1MQ3A 4AQ7A 1C3TA 1PGBA 3MSYA 1LFDA 3A33B 3B08A 4KLDA 3WK7A 1ZRNA 2V1YA 2LUMA 2M0XA 2WXNA 5E6OA 3NUHB 4CNQA 5KTQA 1Z1VA 5D4BA 4P4PA 4Y2YA 3Q8MA 1YOVB 1TAUA 2XN9C 3AE2B 4JIOU 4NAWA 4PL1A 2KIWA 4RNAA 4DK5A 4J9KA 3N6JA 3AU2A 3S6JA 2JEFA 5J0XA 2ON8A 3PT2B 2Q0ZX 1TS3A 2DBYA 3BVZA 3T5KA 5AKKA 1FNWA 4M01A 2NRVA 2QDEA 1OJTA 1W1MA 2LHDA 2AKMA 3MWCA 5FJTA 5DGBA 3MJWA 8ICGA 1TKGA 3AE3B 3ZGZA 4BC9A 2KJRA 2Y3SA 2UYZB 2KVSA 2IO2B 2R8IA 2PI5A 3LAEA 3P4SB 1B0XA 2LRWA 8ICHA 3AU5A 3IT4B 4KZ0A 3RFZB 3QUCA 4ML8A 1NK0A 4C56C 4YQWA 4BBYA 5JXVA 5CHFA 4YWSA 4K4HA 4E8GA 1L3SA 1QZEA 1IG6A 4DWFA 1U4AA 5L9XA 1WXSA 2KDBA 3BK2A 2Y4GA 1YZ7A 2W9CA 2R8KA 1WM2A 4FS2A 3SFEB 2JZ3B 2KIVA 2DYBA 4FI4A 4C7YA 3SJNA 4PT5A 2W9AA 2KANA 4XWTA 2DW7A 1K1QA 2GR1A 3JVZX 5HFYA 3UI3A 4F5NA 5DLFA 1WRIA 3EGRA 3RNCC 3A7AA 2HHTA 4JHMA 9ICGA 3PX4A 2LMRA 5KT2A 2NCNA 3NVYB 2LGIA 1SF0A 4DL7A 2ZUCA 5KT6A 3D2QA 3ED5A 3NJTA 2PODA 5AKIA 2ASQA 2KMCA 2EKEC 3H7PB 3TSHA 8ICPA 1BXTA 1I4GA 3A4RA 4FJYA 3JPTA 3HVDA 1J7CA 2H89B 4BKGA 5ALDA 3RH6A 2FIFA 5J2RA 1V38A 1DK3A 1KFDA 1SV4A 2G4SA 2VJ4A 2V6OA 1ZQMA 5AKJA 4LLGM 1SJBA 4MGGA 1L2NA 5DLGA 5J29A 1QOGA 4KPLA 3SDLC 2GO7A 4KLTA 1Q1OA 1RYJA 1EU3A 4MSQB 2KOXA 4CRXA 4KLGA 3PHXB 4H4WA 4C4VB 4IR1A 2ONQA 4GN1A 2ZJDA 1VZ7A 3R3MA 4JWNA 4UASA 3UXOA 2C2DA 2FMQA 2FPKA 3QX7A 2YAUA 3DG6A 4Y2JA 2AHOB 1K51A 1WR6E 1WVEA 4K8GA 3C5GA 3N7SC 2CU3A 2LXAA 1WZ3A 1WR1A 1N62C 5KFMA 4EKUA 3DFYA 3RRAA 4UDUC 4C8MA 2AX5A 5JRTA 2KK0A 1DOIA 5JCKA 1T0YA 4G3IA 4PZOA 3U4EG 3D47A 2X8XX 2K89A 5CHWA 4ICAA 2MCNB 1ZXIA 2O6VB 2PU0A 3WKDA 1WH3A 2LKYA 3PFRA 2JK6A 3BQ2A 1TGZB 2GR3A 2V4QA 2WB1F 3BDPA 5AM0A 4DOCA 4MH0E 1TV9A 2LYBA 4PHEA 1CRXA 2TPRA 5U1OA 3GIKA 2BPSA 4XC2A 4BOSC 5ALVA 2W43A 2JVCA 2KG5A 3N4FA 1J7AA 2M56B 4HEA1 2CRXA 2KYWA 2C5LC 4EQWA 3C2LA 5AK4A 1N62A 1ZRMA 4Z6DA 1MG8A 1GREA 2KE7A 2R8HA 1X66A 4AP9A 3V05A 4I6NB 2BPGA 1L5UA 1L7NA 3F2CA 2C2EA 2PKOA 1JCKB 2WPEA 2GGJA 2BR0A 4PHDA 4ED6A 3DQVA 4KZCA 4UAWA 2BYFA 5DBBA 2MA9B 3BVMA 4Z6CA 2LGXA 4LNOA 4W9IA 3FW9A 4C00A 3L13A 5E6PA 3B9JA 5HNKA 4ECZA 4WWMA 2ZIUA 4XDDA 2LVPA 2LEKA 1T8EA 3KUMA 3WA0A 2O56A 2A4ZA 1SIJA 1YX6B 5BYQA 2ZIXA 2BHNA 2MUTA 2MRPA 3I9V1 1CEZA 4NZLB 2JU6X 1CI4A 1UGJA 2V0GA 1RYUA 1EF5A 2JT4B 4YT0B 1N6ZA 4NLGA 2NV3A 3AQFA 4HRSA 4A55A 2IPIA 3ZTDA 3QU4A 1V1PB 2BBCA 2ZCBA 4ECQA 4FJZA 3OHAA 2RABA 5DQGA 2W9MA 4DHZB 3GD4A 3CGEA 1WIAA 2D3CA 4FZNA 3SD5A 2F8KA 8ICLA 9ICTA 3NGDA 2JH1A 4Y2XA 4PYZA 5JCNA 3FILA 4RFBA 4KDIC 2OM6A 2Y9TA 4ZHOA 1UZXB 2CXYA 3TIXA 1NHRA 5HMLA 5J2FA 2O2VA 3Q4DA 4YMNA 4F72A 2HJ1A 3HVZA 2B76B 1J0GA 4BC7A 3OPXA 1Q46A 1V85A 2N0SB 4I2AA 1ZQYA 1QSLA 1KCZA 4DQQA 3BYYB 1TFRA 4N6EB 1JXEA 2BB5A 3PTFC 4O1NA 4TQRA 3QAQA 3IJLA 5BOEA 1KQQA 2HSZA 3ETLA 3GV7B 2C7MB 4TVWA 3HRDD 5AUIA 3DK4A 3L4PA 4HROA 2MH7A 2FMPA 5DQHA 2XICA 2IPKD 4JV2A 5D94A 3L5OA 2RD0A 2V3SA 3AE9B 3VTUA 5FR6A 1D7YA 2EMSA 2RRDA 3MR6A 2W8KA 5ALWA 1GRAA 3PX0A 4B0EA 1E7UA 4YVZA 3NS8A 2PFPA 4O9MA 3LADA 3UJRA 3Q8PB 4M9NA 3H7IA 1E7PB 1P7FA 1F0ZA 4QZDA 4KLSA 8ICOA 9ICEA 4NLNA 2P0IA 1F8WA 1PGAA 3DBLI 4KLOA 1FEBA 3QEAZ 3C2MA 3JPPA 3A1QB 5J17A 4J9LA 5T14A 4PVJA 4YXDB 4Y2RA 3EANA 4IM2A 3SYZA 5KFGA 3Q3JA 2F76X 2HCFA 4I2JA 1ROEA 1WGKA 1ZMCA 1ZQFA 3LXFA 4H4PA 5J04A 2J0KA 2PLIA 1E8YA 1QQ7A 2GI9A 5AE3A 4UATA 2EANA 1EWCA 2HQMA 1PQSA 2DAFA 4H4TA 4MH8A 1DYQA 2ODGA 4B9VA 2X8CA 1LPFA 4D2KA 4DN1A 2O6KA 2MW5A 2FLLA 4GDKA 3PW4A 5DBAA 1I7HA 3W1SA 4Y2VA 1XLOA 4EBEA 1XLPA 4PJ0U 4KDLB 4Y2UA 2QQ6A 3QUTA 2W7PA 1XCQL 2EH9A 2QJNA 4JDRA 4HNCA 2GBRA 1V6EA 4UB8U 2LBOA 4O3QA 4B9KA 5TR5A 1E5WA 5KFZA 2AJQA 2INNE 4KKIA 3QC8B 4JB1A 1X9MA 1FHUA 2WXKA 1ZUD2 1FIQA 4DFKA 3JSVB 3RJIA 7ICQA 3F53A 3QQ8B 4F5OA 4O3MA 4BXOA 4ELUA 2NPTB 1P98A 1S7MA 5EE1A 4J57A 1MVKA 1EC7A 5C1ZA 4E6MA 3OHBA 3V3WA 2V3NA 4L1BA 1A0PA 2G06A 1Q5WB 1T7PA 8ICZA 8ICIA 1GXFA 3SAGA 1Z1BA 5DQIA 5KFHA 2KFKB 3DWGC 2MBBB 4P0QA 2NO4A 3DVGY 3SEBA 1GRFA 4UW9A 1KFTA 3EC8A 2KHQA 2REXA 3P4RB 3IAM1 3IC9A 1WCLA 4DEZA 4WURA 4JAYA 3K4GA 3DDHA 1GO3F 4TMAB 1FEHA 3SMVA 4H19A 3N28A 2GBJA 5BO4B 1HIWA 4LNIA 1QT9A 3NY5A 2MA1A 5HMMA 3PW0A 3ZDCA 2ZUDA 2DZMA 3L54A 1QQ6A 3AM9A 4UBCA 3T3FA 1SJED 2LGYA 4DQOC 2XGPA 3SI8A 1V9JA 2BKRB 4BZAA 1MDRA 5ENLA 3ECIA 2WOVA 3PVLA 2FCQA 5FR3A 2LYHA 4WWNA 4HWIB 4DXGA 4AJYB 2KICA 1V5OA 2FMSA 4YSYB 3PM9A 1X42A 2YMMA 2HNEA 3QN3A 2RDIA 4UB4A 3GSYA 1WYGA 1A76A 1UD7A 8ICSA 4M9GA 1SE9A 3HKZC 5KFSA 3IFWB 3ZNHB 4KWSA 4BURA 4F71A 2EKIA 2I2YA 4DQIA 1IIPA 5F3XB 5J0SA 1BNOA 3RCYA 2XNAC 3TSSA 3Q8SB 3GRSA 1QTMA 2LVQA 2OWOA 2RDJA 4A3OA 4ECUA 2W3SA 1UT5A 2W9CB 1MDLA 1NVID 1YMHE 2AQ0A 3FAHA 2Y9UA 4E4UA 4G8TA 1XLQA 4MEMA 3Q45A 4UAZA 1VZ6A 1YJIA 2GR0A 4J9SA 4FDCB 1A5RA 2UVUA 4RZRA 1TK5A 3URYA 3RUIB 1W1JA 2F77X 2KKPA 1KM7A 3RRHA 2KDFB 2WU5B 4NLKA 4HPLB 3V61A 2QVHA 1RQNA 4IDIA 5ALJA 2W54A 4NJ6A 2PGWA 1XSPA 4XX5A 1FD6A 5DG7A 4WJPA 3IJQA 2XGQA 3I4KA 2WAQF 4W9HA 3MR3A 2R2OA 4B9MA 3W5UB 2PTXA 5JHAA 2GQTA 2ZJAA 5HHZA 5ALGA 2XH2A 4RF1A 2K8BB 2PMZF 4YR0A 3TKAA 1IPGA 1AOGA 3UGBB 4MFAA 5D2MB 2VFRA 5EU9A 4ECWA 2AEHA 1GUAB 1LV5A 3BQTA 3Q6BA 3UCDA 2K3UA 2MBRA 3HW8A 1D5MC 3X23A 5DB8A 1E90A 2LFIA 5JCIA 2BVFA 5ALHA 1KN0A 1L7PA 1XD3B 2KVZA 3PZ8A 3Q8EA 3FW8A 2YB1A 4IP4A 2QSDA 4NJ7A 2RDHA 4L23A 4Z17A 1JWUD 2DPJA 2GH1A 5AI0A 3F2DA 5J0WA 3IAS1 5KT4A 2ZW0A 5KL1B 5J2AA 3ISCA 2L3ZA 2WXPA 1UHUA 5FXDA 2PP0A 1X9SA 1RAXA 2A1JB 4B9LA 4HCHA 5J8YC 2XY6A 2M19A 3G6VA 4FULA 3VVWB 4DNSA 3MFGA 2KOBA 3H7PA 5H8YE 2BKEA 4ROPA 1JIHA 3P2BA 5JTIA 3R07C 4HJGE 2I1QA 1R6WA 4EQSA 8ICQA 4U6PA 2W9BB 2X8GA 3PVXA 3GILA 3V6KA 3KYCD 4EUTA 3CAWA 4XGAB 3R9KA 4C0ZA 1EM7A 2KTRB 4FADA 1HTOA 2WXFA 1ET6A 3VR8B 2WBAA 1VCBA 4QZBA 5KFKA 1KSPA 1EBGA 3TQPA 2D11A 2GBMA 1HE8A 1Q8KA 1BNPA 3PW7A 4EZJA 1JRPA 4YTNB 1ZKQA 4A3RA 2Z59B 2G45B 2JYEA 4PL2A 4C8OA 4GGHA 2D3DA 4QZCA 4AYBC 5IKCM 4K3CA 8ICKA 1C78A 2YLMA 3I76A 3KQ4A 4IC7B 2BKFA 1Q3UA 4ZA0A 5J8YA 1KRPA 5ALLA 1SXDA 3L17A 2WXIA 3OP2A 1WMHA 1WI0A 8ICAA 2QEJC 2B21A 3FW7A 2Y3RA 1DOYA 3HJEA 4FBJB 2DKZA 3SAHA 2FPMA 3GOEA 2OZTA 4FLHA 1BWCA 4J9OA 3V7LA 4O95A 1M6IA 1L4DB 1WM3A 2L83A 2O6VA 2QHOA 5HP4A 1K53A 2JSVX 4J1OA 4PHAA 4AJWA 5DDYA 1NOMA 2G09A 4QZEA 4R66A 2F8LA 4S17A 3NRWA 3EFCA 4OO1J 1LQBA 3HPOA 3VQIA 4IS7A 3WIMA 3H8HA 3LDAA 2WDQB 4YTMB 3NHEB 2JRZA 3CXOA 3GZFA 2Z0EB 1HSKA 4O5EA 4MELA 2CJNA 2CJOA 1UPHA 3HRDC 3RO6A 2IBIB 3HIZA 3LLBA 3NG0A 1T0SC 1GRTA 4NLBA 1WRDB 4YR3A 2VFSA 2BCQA 2QARB 1X9XA 2BTEA 2BC1A 3SSZA 4DFMA 4RU9A 1ZP0B 3VR9B 2QCZA 5KFLA 2DAJA 3U7DA 1E8ZA 1ED1A 4DHJB 2OZ8A 1SXTA 3K1ZA 2KN7A 1EWYC 1JX4A 3MHSD 2F2AB 1AARA 2WXOA 2LHEA 2BPCA 4UB5A 5AKHA 3M6ZA 1L6VA 1FMAD 4K1WA 9ICCA 1S8OA 4O3RA 5KFIA 2ZTCA 5EOZA 2PSNA 4UB2A 1E10A 3A0BU 4KLHA 2AQ1B 2HE7A 5H2FU 3ZRCA 5KFUA 1DXSA 4DL2A 2RGFA 2JYTA 2JZZA 5CB1A 3AB5A 2RDBC 4NJCA 3RNEC 2ASLA 2JXTA 4MF2A 1WCNA 2H3IA 4BBNC 3AEAB 1ZQKA 1HZ5A 3D2DA 2NBUA 1GB4A 1VDVA 3GC2A 1B9RA 2KJ8A 1V1PA 3V6JA 1WJ6A 1XSLA 4M52A 5ALYA 4US9A 4A20A 2PE9A 4GGQA 7ICRA 1HTQA 4R64A 1FHVA 3VFKA 4KLJA 1L3TA 2V4IB 4DX3A 3HM6X 1ECWA 5AKEA 5KL8B 4DF4A 3APFA 3RYTA 2KLCA 2WP5A 2M17A 1KW4A 1SXEA 2GLEA 2ZNVB 3N20C 2DLBA 5J2KA 2WXQA 3NOBA 3CT2A 3QKEA 2M9NA 3EA6A 4TUQA 3HK0A 4QIWC 4O3NA 4EE2A 5BMHA 4ICUA 5KNIA 4MDKE 2KX0A 1IXRA 1YN3A 1XC9A 2KWVB 4PK1A 2N9LA 1L6UA 3QU9A 1J2NA 2KZRA 3H4BA 4ECTA 3RNFC 2GSHA 3ISDA 2INCC 2YTUA 1NJWA 4WJNA 3VAWA 1DIIA 4GIVA 3B0YA 2LI5A 5LNK1 5DDMA 3CGDA 1SGHA 5KG1A 5IIKA 2WP9B 1K50A 2K8HA 4NLCA 4HCNB 3V5CA 4W9DA 5GXGB 5HR6A 3VHTC 3QU7A 1DOXA 2ASJA 2AGOA 5FK9C 1UWXA 5HR7A 1FEZA 3RJAA 4KPRA 3H8AA 4K7WA 2ZZ0A 3K9PB 2J0MA 5KFPA 3TANA 1NK9A 2ZJ8A 3A1QA 2HBLA 5CRXA 2YMLA 5AKGA 4K2SA 5TISU 2G9HD 3EPGA 3N4MB 9ICPA 5BYSA 2POZA 1L8LA 4FBUA 2ESEA 1SE2A 4LK0M 3IXSA 2KZMA 4IRKA 5LXIB 2RHFA 3FVDA 2IMWP 4K4GA 1D4BA 1EUVB 4AP4C 4LDTD 2R8JA 4O3PA 1XSNA 1ZD3A 4RGTA 1BPXA 4USAA 4F93B 1SEBD 2WF7A 3ZRFA 2EMTA 2ASDA 5AK6A 2PXIA 4HKQA 3M8SA 3EW9A 3PSEB 3DPDA 5HHDG 3R66C 3M1YA 3OJSA 3DBRB 2CDUA 4IG7B 1KTKA 2GBNA 3R8BA 2VZKB 1OEPA 3MZNA 4P2HA 1R4MB 1P3QU 2GR2A 2J52A 2OJWA 2V9HA 1AHUA 3EKGA 4YN4A 2N9EB 1D9FA 4M0AA 1GB1A 4DSEA 4JQ9A 2PPHA 4O5KA 1ZE3D 1FEAA 2Y5PA 2N7DA 1GESA 3RB4A 3JSVA 2R2QA 4LZDA 5IILA 2NPTA 2QDFA 1E8WA 2LYAA 4IQTA 3D2SA 2C60A 2NBWB 1YQBA 2VFUA 1JALA 2DZJA 1LM8B 2K4PA 5J0QA 2OQHA 1HA5A 3LYSA 3R7QA 7ICEA 4EELA 3Q8AA 4ZRKA 1KOTA 2H5XA 4H1ZA 2MSED 4NM2A 1MUCA 4KN4A 3QNMA 4ECRA 2PEAA 3IT6B 3RB0A 1Z4NA 2K25A 5FXFA 3OC4A 5TSSA 4RGMA 5KFEA 1SL2A 2HVHA 4EZLA 1NU5A 5TR3A 2VZKD 5KT7A 1FFVC 2FKPA 2HTME 2MQJA 2WP6A 3PW5A 5G55A 2AQ4A 1TK8A 2IO3B 1BMLC 2DHZA 3GB1A 4DXKA 2ZC8A 3BZCA 1ZGUB 1S10A 4IKGA 1ISNA 2CKHB 3EWAA 1LB2B 3AE7B 4BV6A 3BQ7A 2K60A 3VUWA 3V6CB 3K1RB 9ICKA 1D8BA 4B9SA 4NNJB 3H4KA 2R8DA 3H8JA 4KX5A 1ZQJA 1QLUA 2OFJA 3SD7A 1YJJA 5IA7A 1RFKA 3QLDA 4BVUC 3C0RB 1M6YA 1UWMA 1WX9A 4QZFA 4DOBA 2JV3A 3W8ZA 2LUEA 3CIRB 8ICCA 3HHMA 3DJJA 2HHSA 4TQ1A 2ZZCA 1N2XA 4XLOA 1OXJA 1SKRA 1ZK7A 5ALRA 1SL0A 4LZGA 4GSWA 2CS4A 5ALKA 2J3NA 3R25A 2P35A 4I2IA 4RUAA 1L7YA 1FFVA 3AEFB 3DQ0A 3NVZB 1MOKA 3EUB3 4RQMA 5FJPA 3DIPA 4CF3A 2L52A 4GMVA 1NJZA 5KFOA 1PDYA 1HQRD 1F52A 2KJ9A 3N9YC 3ZD8A 3TX1A 1V2YA 3DHIC 4LNNA 3TWAA 1QCKA 2ZG6A 2Z0DB 4UQGA 3Q8FA 5AI8A 2C3CA 1KN5A 4JK1A 3OJ3A 1I4HA 1LGRA 4FBTA 3SBFA 3SV4A 4DL4A 3KHRA 2YVFA 4XDCA 3VXWA 3AU6A 3U9IA 4MEYA 1AHVA 2HTHA 2YQEA 3NZUA 4ARIA 2BCSA 2VH1A 3ZJVA 3GV8B 5FS6A 4DLEA 2E6XA 2P13A 3RULA 3B0XA 3M6KA 4C4RA 1S9FA 2O3GA 3H9DA 1DK2A 1NYQA 4DL3A 3WK6A 3DEQA 4ANUA 3SV3A 1H2IA 3DDMA 2NQWA 8ICXA 4I6PA 4EYIB 2IBKA 3T9LA 1YT3A 4XWWA 4W9GA 1GC6A 3MDCA 4KSKC 5TZVA 2PLSA 3AI5A 2JPHA 2KN4A 2L0TA 3OG5A 1FFUC 1ZXIC 1JROA 4K3BA 3PV1A 2HHVA 1F5SA 2H3QA 2KHVA 3W5VB 3CW2C 3J81j 2MAXA 4KLQA 2K8BA 5BOMA 4HPMB 3DG7A 1WXQA 2QC8A 8ICVA 4EZ9A 4IQVA 2HBJA 2IOHA 1JWAD 4F8CB 1Z5SB 1IBXB 4K81A 3S1CA 2C9WB 2RSUA 3R0UA 2F1IA 2BDUA 4AUQC 2IHNA 1NK6A 2BQRA 1V49A 3MGHA 4JWUC 1HXYD 1SWVA 4A9AA 3DHHC 1ZQWA 2KVCA 4KLUA 1YNTE 2WS3B 2NMQA 4A8XC 2GBKA 3SEIA 3C23A 2PFOA 4EWJA 1AQ6A 3E56A 4YXJA 1UUPA 4RMAA 3M63B 5L1JA 2IY0B 2KACA 2MJ3A 5IIIA 2IZVB 2FCNA 4K7SA 2W04A 2KTQA 1WMHB 1RQLA 1Q3VA 3TEZA 2D3BA 1PVRA 1IP9A 1JDFA 3DH9A 3QE9Y 3KD3A 1TJEA 4EMJA 3Q3FA 1MN8A 4P4OA 3TADC 2A1JA 1FFUA 3RNAC 3ZDMC 2RDXA 1BPEA 3MTNB 2MP2B 1Y88A 2WYQA 2ZADA 1BPYA 2FIDA 5CJ7A 1V86A 1IV8A 2I5HA 4EEYA 5KG6A 5ALUA 4FZMA 2LRUA 2N1VA 1WSPA 2MNRA 5AM3A 5ALPA 3FYHA 1URJA 5G5HB 2JF5A 2VA8A 3RNMA 4OJPA 1FCLA 1WGYA 3RB3A 4RQ8A 3ES7A 5AI4A 3H40A 4J56A 3ZLHA 2KWUB 3JW7A 2W9BA 3CSTA 1E6EB 1RVKA 4IC9A 3QFAA 2Y5CA 9ICVA 2JX5A 2KTRA 4EEKA 3OTQA 3JVAA 2KFZA 3E0FA 1OQYA 3KLSX 3GZNB 4KKJA 1ZOLA 4LIIA 2DZKA 2R61A 5D3IB 2LASA 3C1ZA 3VTWA 1I42A 1U9LA 3D2JA 2GGIA 4AWJA 5JCMA 2AXRA 1P7DA 2ZTEA 3OZMA 3GIMA 3FYYA 2O6VD 1ZQHA 4W9JA 1X6JA 3DDCB 3VC6A 3KBBA 4MFFA 3TADA 2PTWA 4ECSA 3IHPC 1W1LA 5IIJA 2AWTA 2JZPA 3NZGA 2BVCA 2KO3A 2GGEA 2WFAA 2Z7JA 3UQ0A 1OEYJ 3RJFA 1OGWA 1U49A 3PK7A 4TVYA 1ZYQA 2ZIVB 2ZEQA 4HDQA 1JCTA 3EAOA 4HPPA 3AECB 5HQXA 4FZLA 1Z3EB 1MFWA 4IQUA 1TZOA 2LWPA 3W1YA 2WX1A 2XH0A 3BJYA 3VFCA 4I29A 1W1RA 4PH5A 2BWFA 4G0NB 5AZHA 3RZFA 4B6WA 5J0YA 4GISA 4BX9C 1TK0A 4NEVA 2DL0A 3T8MA 2MBHA 3NASA 4RQNA 1EF1A 4J3ZA 4CDGA 3RAXA 2FCMA 3QHTA 4GFIA 3PRMB 1WG8A 2XCAA 3BZKA 2FCSA 2J7QB 3PG6A 4IL2A 5J0OA 3JPRA 1VRAB 5AUKA 1QLTA 2EQ8A 4ACOA 2KHWB 1V97A 2AH5A 2AGPA 1ZQCA 4M00A 3HW2A 3ICXA 5EWGA 1VQZA 2JMGA 2QARA 3A9JB 5JRBA 3U52E 1MI0A 1ZQEA 1WUFA 4IL0A 1N5WC 2ISPA 3QUBA 3FV9A 4X2PA 2JH7A 3LYYA 5FXPA 4J9QA 4F7ZA 2C3DA 3STPA 1K1SA 2ZJ5A 5A0LA 1ZXHA 4OVUA 4IWPA 2ZNVC 3KYDD 4ASWC 3PMLA 4RF0A 1GPXA 3N4EA 3T4WA 3I28A 2G5HB 2ZXHA 3U26A 3BW7A 2GH5A 1HUZA 1YIWA 4I2FA 4A3PA 3T6CA 4JB3A 2ATLA 3Q6JA 1DZNA 2RLTA 1X1MA 1NHQA 3JPOA 4DWDA 1YQ3B 2P8BA 1WVFA 4YFKA 3FXGA 2ZPYA 3W1SC 5DGAA 3PO5A 4G3XB 5CHGA 1JMLA 1MPEA 2EQYA 3M9MB 1X2HA 4KT2A 2VKQA 1K4QA 4RGOS 5AZGA 5ER0A 2WDVB 9ICWA 2LD9A 1L0VB 1XQQA 2GGHA 4ELVA 1ZR6A 3BS5B 1FRDA 8ICTA 2NTTA 4IUMB 5IINA 2PI4A 4DXFA 2F5ZA 1DGJA 4E3CA 1N5WA 2FJ6A 4RNOA 3ZXRA 4ECYA 2KVRA 5L6FA 1TKYA 3E2EA 2Y0SC 2MJEA 3I6TA 4DFPA 4PVEA 3VA8A 4A8EA 2INDC 4MACA 1KBUA 1TYPA 2HOIA 3THVA 3VUXA 2RK5A 2DENB 4BDPA 4IZGA 4ZH4A 3TQ1A 4QNLA 2UWQA 1SJAA 2AL2B 2L0FA 2VA3A 3CGBA 2KQ4X 2EZZA 1KH0A 2B6GA 2MX2A 1ZQXA 3R1ZA 1SE4A 2GWSA 1Q0WB 1R7SA 1RG6A 1B4FA 4C8NA 3UXKA 2CPRA 4OJLA 5ALSA 1KLGD 4H4ZA 2K8CB 3IVFA 1MBTA 4O3OA 1F1HA 1ELSA 3OAWA 4IW0A 1SWWA 3ML8A 3N6HA 1L3VA 4KLIA 3W2DA 3LWLA 4XYCA 9ICLA 2K6QA 3ZVVA 2UVRA 1SKSA 2G0AA 4YMMA 2D3GA 1ZQSA 3PRZA 4HAIA 1FM0D 3AULA 4HYKA 4BUGA 1NHPA 3RB6A 5FJRA 3V6HA 3ZLGA 4ED2A 4P6VF 1XLNA 2L32A 5ALZA 5CP2A 4J6IA 4IM0A 4PS7A 4LTUA 4DQSA 2BS3B 4TUSA 3V7KA 1U47A 9ICFA 3KH0A 3WAMA 5J18A 2K9XA 3RH5A 1WWVA 2NPXA 4QWEA 3DWMA 1F0XA 4TUUA 2JQRB 2WXRA 2JEIA 5FXEA 1KD0A 3RFAA 4W9EA 1SJCA 3A7UA 2OOBB 3PR5B 4F91B 3SN1A 2WXMA 2KSOB 2MSNA 4MEXA 2BW2A 3THUA 2DF4B 3ORYA 1EU4A 3OPSA 2E8NA 3KZIU 4J9MA 2J6SA 1KFYB 2N7EA 1P0RA 8ICJA 5KG5A 2GDQA 3BK1A 3AQEA 2AKZA 4F92B 2KKVA 5IOIA 3TARA 2K8AA 4YTPB 2WF5A 5J2DA 4P16A 5DG9A 1F3PA 2H3ZA 1J19A 2UVVA 2P8CA 4IR9A 2EXRA 2QILA 1TE2A 1SL1A 3ETRB 2YVGA 3UM9A 3H8WA 4C4TA 1OEYA 2K39A 4QZIA 1GERA 4CO7A 2FI1A 1YD8U 3RR7A 2BGWA 1WJUA 4LA1A 2L5YA 1KDHA 1QF6A 3WAOA 3DBRI 1W1SA 4WQMA 2A3VA 9ICRA 1R4MI 4GXBA 2PU1A 1H6VA 1IUEA 1N61C 5IIMA 2IA6A 1I4PA 5HI1A 1X2IA 2ZIWA 4MSMB 4EM4A 4JE3B 3B2GA 4K1RB 3EECA 4I2GA 1RWSA 3VC5A 3G6YA 5MPOA 1NKBA 3AE1B 2L76A 3MC8A 3DESA 2OYYA 2I9GA 4R65A 3GV5B 9ICXA 5DPTA
chains in the Genus database with same CATH topology
1JW9D 1N60C 1SXTA 2LUMA 1EWYC 2WXNA 3NUHB 5ADZA 2WXOA 4N59A 2LHEA 2XN9C 2PW9A 3NS1A 1I4QA 3AE2B 4RNAA 5BYRA 1SB3C 3FWAA 1L6VA 1FMAD 3GP7A 4OVZA 3RPFC 1E10A 2ON8A 2BT6A 2AQ1B 1TS3A 2BVHA 2DBYA 3BVZA 1FNWA 2JYTA 2KDMA 3SR6A 3AB5A 4NJCA 4PZFA 1PFDA 2JXTA 2BVGA 1W1MA 2LHDA 3P42A 1N61A 3AEAB 1HZ5A 3S1FA 3D2DA 1TKGA 3AE5B 4IOIE 3AE3B 1Q10A 1VDVA 1GB4A 3OWEB 3ZGZA 4BC9A 1B9RA 2Y3SA 2Y3AA 1STEA 1V1PA 2J53A 4KGSA 1Y56A 3LAEA 3P4SB 1XF5L 2QMTA 5HMRA 3IT4B 3RFZB 5E6JA 2W55A 4JPSA 4US9A 1D5XC 2X38A 1E8FA 4ML8A 4C56C 4BBYA 1N60A 2G1EA 5JXVA 1I19A 2V4IB 1IGCA 1E8GA 3NVZA 4AS1A 1TS2A 2DLBA 2WXQA 1CK1A 3EA6A 2SAKA 1RM6B 1YN4A 3BK2A 2Y4GA 4EE2A 5BMHA 3SFEB 2BS4B 1OFFA 4C7YA 1YN3A 2LJIA 4PT5A 4HKZE 2PLPA 4XWTA 2N9LA 5HFYA 3ABVB 3UI3A 1L6UA 3A7AA 1WRIA 3EGRA 1V8CA 3NVYB 3U2SC 2LGIA 1TKEA 1SF0A 4OHJA 1DIIA 1VR9A 5LNK1 4C80A 1XXGA 3CWIA 1NYRA 3TSHA 1BXTA 2WP9B 1I4GA 1K50A 5GXGB 3AN1A 1J7CA 2H89B 3HVDA 4OZAA 1DOXA 1VAOA 2OAIA 3NVVA 5FK9C 4EC3A 1UWXA 2P3HA 3RJAA 5H92C 3POPA 1AW7A 4LLGM 2ACZB 3AEEB 1GAQB 1LO5D 1QOGA 1RYJA 1EU3A 3D2HA 3AE8B 1SBBB 2G9HD 4WIPA 5BYSA 2ONQA 3C8YA 1VZ7A 4FXCA 1SE2A 4LK0M 3IXSA 5D3DA 2PVOD 1IBXA 5G5GB 1K51A 1C4CA 1D4BA 1WVEA 4N58A 1AYFA 2CU3A 1N62C 1AWDA 2PTLA 2E3TA 1SJHD 1E9MA 2AX5A 4RGTA 4UDUC 4USAA 1SEBD 1DOIA 1JWSD 1CJEA 3U4EG 2GRIA 4HKQA 4ZOHB 1MHHE 5D7GA 5HHDG 1ZXIA 1KTKA 3R8BA 4CQNA 2VZKB 2J52A 1L0YB 1VJKA 3P4PB 1AHUA 1FRRA 5C2TB 1ZDXA 4PVKA 2W82A 1GB1A 3O13A 3TSJA 1ZE3D 3AH7A 2Y5PA 4WH4A 3WCQA 1XEEA 1FXIA 2WQYB 2AQ2B 1JQ4A 2R2ZA 2VFUA 1J7AA 1JALA 2M56B 1ACCA 4HEA1 4Q2JA 5FKAC 1HA5A 3Q8AA 5G5HA 1N62A 3R2IA 3IT6B 3AV8A 5FXFA 5TSSA 2J42A 2WXHA 4RGMA 3V05A 2VZKD 3T3NA 3I99A 2PKOA 2YEPF 1JCKB 1SE3A 3BVGA 2HTME 1FFVC 3NS1B 4UD8A 4NAWB 4MT5A 1BMLC 3I57A 1QKZA 3BVMA 1WWTA 3FW9A 3GB1A 3B9JA 4WWMA 4IKGA 3AE7B 4XDDA 2FBWB 2LEKA 1SIJA 5BYQA 3SR6B 3I9V1 1PUTA 4NZLB 2JU6X 2V0GA 1UGJA 2RMMA 2R8DA 4YT0B 1BUIC 4HRSA 4A55A 1QLUA 1OQQA 2IPIA 1YJJA 1V1PB 2BBCA 1RFKA 1E0YA 1UWMA 1MBBA 3GS2A 2I38A 3W8ZA 1K52A 3CIRB 3J9CA 4TQ1A 5HG2A 4B0MA 4ITKA 4PVHA 2WNMA 4XLOA 3FILA 4RFBA 1E8HA 4ZHOA 3BIID 3AEFB 3DQ0A 3NVZB 1FFVA 3EUB3 3HVZA 2B76B 2BB6A 4BC7A 2L52A 2N0SB 1YN5A 1SB3B 3NRZA 3B2FA 1HQRD 3BYYB 2JWUA 2OHFA 3N9YC 4N6EB 3TEWA 3TX1A 1PDXA 2BB5A 4O1NA 2IGDA 3Q8FA 1QOAA 1QQRA 4TVWA 1KF6B 3HRDD 4OZBA 5AUIA 3L4PA 1I4HA 2MH7A 4HROA 1ET9A 2IPKD 3AEDB 3AE9B 4XDCA 4J3OD 1AHVA 4GDLB 2UUUA 3R2TA 4B0EA 4ARIA 1NEKB 2YVSA 1T6BX 1JWBD 2H88B 3ZJVA 1E7PB 1P7FA 1F0ZA 2E6XA 2P13A 2ZW1A 2O3GA 1PGAA 4YSZB 1NYQA 4ZYSA 3A7RA 3PZ7A 3PO0A 2NQWA 2KAJA 4H2AA 3VRAB 5I1WA 4PVJA 4XWWA 4YXDB 1MHXA 2PLSA 1T3QC 2INPE 2KN4A 1FFUC 1TYGB 2SEBD 3MC0B 1ZXIC 1ROEA 1WGKA 1JROA 1FO4A 2IJ0A 3AE6B 3LXFA 5I1VA 3W5VB 3U7ZA 2PLIA 1C4AA 1QLBB 2GI9A 2FUG1 5AE3A 1WXQA 2K5PA 1JWAD 1IBXB 1UXYA 1EWCA 4RGNA 3S1CA 4MH8A 4US8A 1DYQA 1HZ6A 2VFTA 1ENFA 1M4VA 4JWUC 1F77A 1HXYD 4D2KA 2Q85A 4A9AA 3W8XA 1YNTE 2WS3B 1VLBA 2NMQA 5I4DA 4A8XC 2QPMA 1I7HA 3W1SA 4OALA 1XLOA 2RPVA 3E56A 3NVYA 2P4PA 1UUPA 4RH6A 1XLPA 2K0PA 3EUB2 2KACA 2MJ3A 2Y08A 1XCQL 1XO3A 1D6EC 3TEZA 2M0AA 5L6GA 2VFVA 2INNE 1TJEA 4KKIA 3TEXA 4JB1A 2WDWA 1T3QA 2WXKA 1ZUD2 2MEKA 2V3PA 1FIQA 1FFUA 2DYMA 4OZCA 1C77A 1L0XB 4GLSC 4ZHPA 4JX1C 5EE9A 5EE1A 3V3XA 2TSSA 1MVKA 1T5XD 3VTEA 5K8EA 5D79A 5BMIA 1KLUD 1WSPA 4JWSC 2V3NA 5G5HB 4L1BA 1FCLA 3TEYA 2J4XA 3ZJUA 3DWGC 3P4QB 1E6EB 1C76A 2L1AA 2Y5CA 4TQ0A 2JX5A 3SEBA 4HG0A 3KLSX 3KJMA 4KKJA 3P4RB 3IAM1 5T8IA 2R61A 4XE0A 5D3IB 2BYTA 4WURA 3S1DA 1C79A 3D2JA 4JAYA 2N7JA 4ZRQA 4TMAB 1E0ZA 1FEHA 2AXRA 3B9JB 5AE2A 1UNSA 4REZA 1QT9A 3NVWA 1W1LA 1DIQA 2JZPA 3AM9A 1SJED 3LB8C 4DQOC 4KGRA 4TVYA 4OW0A 1P7EA 4MLAA 1YQ4B 5FR3A 1OQRA 3AECB 3Q8CA 5HQXA 3ETRA 2K22A 3KWVA 1I4XA 1TZOA 2OEDA 3MP9A 2PIAA 2NTSA 3Q69A 4YWGG 3VRBB 3ZQ4A 4DXGA 2I0KA 2PMVA 1N63C 3FILB 5C3JB 4YSYB 1W1RA 3PM9A 3MHZA 3KWLA 3GSYA 1WYGA 2ICIA 4PYTA 5AE1A 4NAMA 2GQUA 4C7ZA 3NRZB 2HDEA 2EKIA 1FNUA 2I2YA 2VAOA 3ZYYX 1VRAB 2FE8A 4ZRPA 5AUKA 1QLTA 2XNAC 3TSSA 1V97A 1X2GA 1C4PA 1ZOYB 2WXJA 1PGXA 1VQZA 1AN8A 3U52E 2W3SA 1MI0A 3TUOA 1N5WC 1B1ZA 1IGDA 1NVID 1YMHE 3HUIA 4MM3B 3LYYA 1F2RC 4A90A 5FXPA 3FAHA 2UUVA 1XLQA 1KRHA 1L5PA 1ZXHA 1QILA 2IGGA 1ZPSA 1VZ6A 1YJIA 4BCAA 4KX6B 2DWQA 2D5GA 2W3RA 4RF0A 1GPXA 3URYA 3W9CB 1W1JA 1RM6C 3BW7A 1N63A 3W8WA 2Z8LA 2WU5B 3NZ3A 3DEDA 4PWCA 4IDIA 1DZNA 2W54A 1YQ3B 2IDYA 1WVFA 1FD6A 1JMLA 2AQ3B 3NVVB 1MPEA 1X2HA 1SSNA 4RGOS 2WDVB 3W5UB 1W1KA 1L0VB 3BWUD 2GQTA 5HHZA 4RF1A 1ZR6A 1N5XA 1FRDA 2QJLA 2NTTA 4DXFA 1QOBA 1DGJA 1VZ8A 2VFRA 1N5WA 1W1OA 1I4RA 1TS5A 2N9KA 2E5AA 2K3UA 2MBRA 1TKYA 4A6QA 5L6FA 1D5MC 2MJEA 3FC4A 4GDKB 4PVEA 4MACA 2LFIA 1W1QA 2KMMA 2BVFA 2RK5A 3Q8EA 1F2RI 3PZ8A 3FW8A 3E9SA 2QSDA 2RDHA 4L23A 1JWUD 2DYOA 1J7BA 2KQ4X 1KH0A 3P63A 3IAS1 1TY2A 2KWDA 2WLBA 1SE4A 2ZW0A 1R7SA 1ZDVA 4TSSA 1GOZA 2WXPA 5FXDA 3VR9B 1KLGD 1JWMD 1C9FA 1FIQB 1MBTA 2MJDA 3JS8A 2M19A 3HSUA 4DNSA 3MFGA 2Q4WA 3AMZA 5H8YE 3W2DA 1TY0A 3BYTB 1XCTL 4L2YA 4ZOHC 2BS2B 1CQVA 3R07C 4PWBA 4HJGE 1FM0D 1TS4A 3RJ8A 1FXAA 1ESFA 2RDGA 2IGHA 1NI3A 4P6VF 1XLNA 2L32A 1EM7A 3SFDB 4LTUA 3C0PA 2BS3B 1ET6A 2WXFA 3VR8B 2K9XA 3Q8BA 5EE0A 2LMCA 3DWMA 4KGTA 1F0XA 2JQRB 2WXLA 2WXRA 4YSXB 5FXEA 3A7UA 1D5ZC 1V1OA 1QOFA 1JRPA 2WXMA 4YTNB 4R3DA 3T3OA 2JYEA 2BW2A 5G5GA 1EU4A 3S1EA 2QKNA 1C78A 3NVWB 3KQ4A 1A70A 1KFYB 1PYWD 2WXIA 3BK1A 3FW7A 2QEJC 2Y3RA 4YTPB 3AE4B 1DOYA 2YEPB 1L4ZB 3AEGB 4P16A 4WAFA 5BMGA 1NENB 2EXRA 2QILA 3ETRB 4O95A 5AWVA 1L4DB 2L83A 2Q5WD 4M0WA 1K53A 1AHZA 2JSVX 3PQBA 1FCCC 1CZPA 2WXGA 2QIEB 2WDRB 1QF6A 3VQIA 1HEZE 4RCOA 2GB1A 4WQMA 1W1SA 5EE3A 1FNVA 2WU2B 3H8HA 2WDQB 4YTMB 3ZJTA 1IUEA 1N61C 1I4PA 3MJ5A 5HI1A 4JE3B 1HSKA 3BZDB 3B2GA 2CJNA 2CJOA 2PVGC 3HRDC 3LLBA 1RWSA 3P1MA 5MPOA 2VFSA 3AE1B 2BTEA 4AQ7A 3AEBB 4ARCA 1ZP0B 2EELA 1PGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JW9 D;  1N60 C;  1EWY C;  5ADZ A;  4N59 A;  3NS1 A;  3AE2 B;  1SB3 C;  3FWA A;  1L6V A;  1FMA D;  3RPF C;  1E10 A;  2BT6 A;  2BVH A;  2DBY A;  3AB5 A;  4PZF A;  3SR6 A;  1PFD A;  2BVG A;  1W1M A;  1N61 A;  3AEA B;  3S1F A;  3D2D A;  1TKG A;  3AE5 B;  3AE3 B;  1VDV A;  4BC9 A;  1B9R A;  3LAE A;  3P4S B;  5HMR A;  2W55 A;  4US9 A;  1E8F A;  4ML8 A;  4BBY A;  1N60 A;  2G1E A;  1I19 A;  1E8G A;  3NVZ A;  1RM6 B;  3SFE B;  2BS4 B;  1OFF A;  4C7Y A;  3ABV B;  1L6U A;  3A7A A;  1WRI A;  1V8C A;  3NVY B;  1TKE A;  1SF0 A;  1DII A;  4C80 A;  3CWI A;  1NYR A;  3TSH A;  2WP9 B;  5GXG B;  3AN1 A;  1J7C A;  2H89 B;  1DOX A;  1VAO A;  2OAI A;  3NVV A;  4EC3 A;  2P3H A;  5H92 C;  2ACZ B;  3AEE B;  1GAQ B;  1QOG A;  1RYJ A;  3D2H A;  3AE8 B;  4FXC A;  2PVO D;  5G5G B;  1WVE A;  4N58 A;  1AYF A;  2CU3 A;  1N62 C;  1AWD A;  2E3T A;  1E9M A;  2AX5 A;  4USA A;  1DOI A;  1CJE A;  4ZOH B;  1ZXI A;  1VJK A;  3P4P B;  1AHU A;  1FRR A;  5C2T B;  4PVK A;  3TSJ A;  3AH7 A;  3WCQ A;  2WQY B;  1FXI A;  1JQ4 A;  2R2Z A;  1J7A A;  1JAL A;  2M56 B;  5G5H A;  1N62 A;  3AV8 A;  5FXF A;  3I99 A;  2PKO A;  1FFV C;  2HTM E;  3NS1 B;  4UD8 A;  1WWT A;  3FW9 A;  3B9J A;  4WWM A;  3AE7 B;  2FBW B;  2LEK A;  1SIJ A;  3SR6 B;  1PUT A;  2R8D A;  4YT0 B;  4HRS A;  1QLU A;  1OQQ A;  1YJJ A;  1RFK A;  1E0Y A;  1UWM A;  3W8Z A;  3CIR B;  4ITK A;  4PVH A;  4XLO A;  1E8H A;  4ZHO A;  3BII D;  3AEF B;  3DQ0 A;  3NVZ B;  1FFV A;  3EUB 3;  3HVZ A;  2B76 B;  4BC7 A;  2L52 A;  2N0S B;  1SB3 B;  3NRZ A;  3B2F A;  4N6E B;  2OHF A;  3TX1 A;  1PDX A;  1QOA A;  4TVW A;  1KF6 B;  3HRD D;  5AUI A;  3L4P A;  4HRO A;  2MH7 A;  3AED B;  3AE9 B;  1AHV A;  1NEK B;  2YVS A;  2H88 B;  1JWB D;  1E7P B;  1F0Z A;  2P13 A;  2O3G A;  4YSZ B;  1NYQ A;  3A7R A;  3PO0 A;  2NQW A;  2KAJ A;  3VRA B;  4PVJ A;  4YXD B;  2PLS A;  1T3Q C;  1FFU C;  1TYG B;  1ZXI C;  1ROE A;  1WGK A;  1JRO A;  1FO4 A;  3AE6 B;  3LXF A;  3W5V B;  2PLI A;  1QLB B;  5AE3 A;  1WXQ A;  2K5P A;  1JWA D;  1UXY A;  3S1C A;  4US8 A;  2VFT A;  4JWU C;  2Q85 A;  3W8X A;  4A9A A;  2WS3 B;  1VLB A;  2QPM A;  4OAL A;  1I7H A;  1XLO A;  3NVY A;  2P4P A;  1XLP A;  3EUB 2;  2MJ3 A;  1XO3 A;  2VFV A;  1TJE A;  4JB1 A;  1T3Q A;  1ZUD 2;  1FIQ A;  1FFU A;  4ZHP A;  4JX1 C;  5EE9 A;  5EE1 A;  3VTE A;  5D79 A;  4JWS C;  5G5H B;  3DWG C;  3P4Q B;  1E6E B;  2Y5C A;  4HG0 A;  2JX5 A;  3KJM A;  3P4R B;  3S1D A;  4JAY A;  3D2J A;  2AXR A;  1E0Z A;  3B9J B;  5AE2 A;  1QT9 A;  3NVW A;  1W1L A;  1DIQ A;  3AM9 A;  3LB8 C;  4TVY A;  4MLA A;  1YQ4 B;  1OQR A;  3AEC B;  5HQX A;  3ETR A;  2K22 A;  2VFU A;  2I0K A;  2PIA A;  3VRB B;  1N63 C;  5C3J B;  4YSY B;  1W1R A;  3PM9 A;  3KWL A;  3GSY A;  1WYG A;  4PYT A;  5AE1 A;  2GQU A;  4C7Z A;  3NRZ B;  2EKI A;  2VAO A;  3ZYY X;  5AUK A;  1QLT A;  1V97 A;  1X2G A;  1ZOY B;  1VQZ A;  2W3S A;  1N5W C;  1NVI D;  3HUI A;  5FXP A;  3FAH A;  1KRH A;  1XLQ A;  1L5P A;  4BCA A;  1YJI A;  4KX6 B;  2DWQ A;  2W3R A;  1GPX A;  3W9C B;  1W1J A;  1RM6 C;  3BW7 A;  1N63 A;  3W8W A;  2WU5 B;  3DED A;  4PWC A;  4IDI A;  1DZN A;  2W54 A;  1YQ3 B;  1WVF A;  3NVV B;  1X2H A;  2WDV B;  3W5U B;  1W1K A;  1L0V B;  2GQT A;  5HHZ A;  1ZR6 A;  1N5X A;  1FRD A;  2QJL A;  1QOB A;  1DGJ A;  2VFR A;  1N5W A;  1W1O A;  2E5A A;  2MBR A;  1TKY A;  2MJE A;  3FC4 A;  4PVE A;  1W1Q A;  2KMM A;  2BVF A;  2RK5 A;  3FW8 A;  1J7B A;  3P63 A;  2WLB A;  1R7S A;  5FXD A;  1FIQ B;  1MBT A;  2MJD A;  3JS8 A;  2M19 A;  4DNS A;  2Q4W A;  3AMZ A;  5H8Y E;  4ZOH C;  2BS2 B;  3R07 C;  4PWB A;  1FM0 D;  1FXA A;  1NI3 A;  4P6V F;  1XLN A;  3SFD B;  4LTU A;  3C0P A;  2BS3 B;  3VR8 B;  2K9X A;  5EE0 A;  3DWM A;  1F0X A;  2JQR B;  4YSX B;  5FXE A;  3A7U A;  1QOF A;  1JRP A;  4YTN B;  5G5G A;  3S1E A;  2QKN A;  3NVW B;  1A70 A;  1KFY B;  3FW7 A;  4YTP B;  3AE4 B;  1DOY A;  3AEG B;  1NEN B;  2EXR A;  3ETR B;  4O95 A;  2L83 A;  2Q5W D;  1AHZ A;  1CZP A;  2QIE B;  2WDR B;  1QF6 A;  1W1S A;  4WQM A;  5EE3 A;  2WU2 B;  4YTM B;  2WDQ B;  1IUE A;  1N61 C;  1HSK A;  3B2G A;  2CJN A;  2CJO A;  2PVG C;  3HRD C;  3LLB A;  1RWS A;  3P1M A;  5MPO A;  2VFS A;  3AE1 B;  3AEB B;  1MBB A;  1ZP0 B;  3VR9 B; 
#chains in the Genus database with same CATH topology
 1ZET A;  1JW9 D;  3M62 B;  1N60 C;  2PTY A;  2NRW A;  3V7J A;  3O65 B;  3Q8Q B;  2DKX A;  4N59 A;  1Z00 B;  2PFN A;  2PW9 A;  3DCG A;  3N97 B;  2HOF A;  3RJE A;  4NM1 A;  5BYR A;  3V60 A;  3UPQ A;  9ICB A;  4OVZ A;  3TCS A;  2N1W A;  5AKX A;  3GU3 A;  2KNB A;  3ML9 A;  4W9K A;  4K4I A;  4J03 A;  4IRD A;  2BVH A;  1LKY B;  3OW1 A;  3NZS A;  2KDM A;  2N4F A;  7ICJ A;  4QZG A;  2XID A;  2Y1I A;  3M8R A;  2BVG A;  3APC A;  1N61 A;  1S0O A;  5J2H A;  4MKS A;  2HW3 A;  3HM3 A;  3S1F A;  4I2B A;  3AE5 B;  4IOI E;  1Q10 A;  3H8M A;  4Q44 A;  1SGG A;  1E7V A;  3URH A;  2Y3A A;  1STE A;  2NVU I;  1Y56 A;  4ED0 A;  3EJB B;  3BQ0 A;  4KLL A;  1XF5 L;  2QMT A;  2ZTD A;  5EDS A;  5HMR A;  1TE6 A;  4OJ6 A;  4QWD A;  5KT5 A;  3PW2 A;  1MSW D;  2X38 A;  3DV9 A;  1E8F A;  2G08 A;  3IV6 A;  4JUZ A;  5KFT A;  1N60 A;  3DBS A;  1J2M A;  3N32 A;  1BKH A;  1Z4O A;  2KZZ A;  1I19 A;  1IGC A;  2UU7 A;  3ZUN A;  4AOF A;  3NVZ A;  4ANW A;  2WDT B;  3MKC A;  4AS1 A;  1TS2 A;  3RGT A;  4H4R A;  4DFD A;  4KEM A;  3OJU A;  2FLN A;  2PMQ A;  4RQ5 A;  3GII A;  1RXV A;  2NRZ A;  3LVW A;  1OFF A;  3DFH A;  1PZN A;  5L1L A;  4DNA A;  4HKZ E;  3CF6 E;  1ZQA A;  3N30 A;  4BKT A;  2HDO A;  1V8C A;  2ZUB A;  5AM4 A;  2HBM A;  2MRL A;  5KFY A;  3ZDA A;  3N1Y C;  4ED7 A;  1T4G A;  3AUO A;  4EFO A;  4ACF A;  5KFJ A;  3H1U A;  4EZK A;  4QZ9 A;  3IN5 A;  4C80 A;  4GOC A;  3GY1 A;  4WJQ A;  3ONN A;  5KFF A;  3JPN A;  2LVO A;  1OUQ A;  5ALX A;  7ICP A;  1WF9 A;  3QIJ A;  4OZA A;  4IQW A;  1VAO A;  4MGY E;  1Q1W A;  3NVV A;  3DGH A;  5FS9 A;  1XAN A;  2P3H A;  3PSI A;  3KKA A;  3RBD A;  1NKC A;  2D8C A;  5KFX A;  4H83 A;  1WGH A;  3RNG C;  1GAQ B;  1LO5 D;  3CXB A;  4I2E A;  3KTQ A;  3U4F A;  1F44 A;  2V9W A;  1PVP A;  3AE8 B;  1X9W A;  2RPQ A;  3KVF B;  5AHX A;  1UA1 A;  4RPY A;  4YG2 A;  4I27 A;  2ZVO A;  4WIP A;  5DB9 A;  2JXX A;  2OQY A;  2BCV A;  2E5S A;  3C8Y A;  1WXA A;  3ZVI A;  4FXC A;  4UBB A;  5FS8 A;  5D3D A;  2PVO D;  2IOF K;  1IBX A;  4NPN A;  1TKD A;  3IK4 A;  1D8Y A;  4P1B C;  3I1Y A;  4KV2 A;  3WKB A;  5HHH A;  1GRB A;  2KT7 A;  1L8P A;  2PTL A;  9ICH A;  4GXK A;  1GRH A;  1E9M A;  5ALN A;  4HN8 A;  4QZ8 A;  4XRH A;  3RCZ A;  1JWS D;  2Y0S F;  1CJE A;  2D07 B;  2YN4 A;  3APD A;  4ZOH B;  5DPS A;  1MHH E;  1Q1R A;  2KP7 A;  2XCP A;  4FN2 A;  3L5K A;  3T5L A;  3P0W A;  1XWL A;  3OSP A;  5AKY A;  4M0W B;  4FFD A;  4UAY A;  1L0Y B;  3P4P B;  3MQT A;  3H4D A;  1FRR A;  3NFU A;  4H50 A;  1ZDX A;  7ICU A;  4HNL A;  4YXM A;  4P1C C;  1DNC A;  3TSJ A;  2BZF A;  4WH4 A;  4CE6 A;  7ICN A;  4YWO A;  3WCQ A;  1XEE A;  1FXI A;  2A5U A;  2MP2 A;  3MY9 A;  1SZP A;  2HXT A;  3K75 D;  4ELT A;  2AQ2 B;  5BOF A;  1DTN A;  2KEY A;  4IP5 A;  2R2Z A;  4DF8 A;  4Q2J A;  4NQK E;  1YQZ A;  2FDR A;  4JV0 A;  4YP3 A;  4NLZ A;  5G5H A;  4KTQ A;  2YY6 A;  2QJM A;  5DB7 A;  3R2I A;  3MGV A;  1STZ A;  5AI6 A;  3I63 C;  4QAY A;  2J0J A;  2J42 A;  4Y2S A;  3ZNI D;  2HXU A;  2LGS A;  4Z1Y A;  3TAC B;  4B9N A;  2YEP F;  3BVG A;  3Q2A C;  2XH4 A;  3GD6 A;  1L7M A;  3NS1 B;  3PV8 A;  3P3B A;  3PSF A;  1IYX A;  2DZI A;  4C4S A;  8ICE A;  2CU1 A;  4DO9 A;  2K4I A;  4B6J A;  3ZO5 B;  2KXJ A;  2JHD A;  2PPG A;  3MBY A;  1NK5 A;  4Q8F A;  3GZN I;  2HD5 B;  5JCL A;  4ANV A;  2HZG A;  1ZQT A;  2KN5 A;  3SR6 B;  2PCE A;  3DK9 A;  2RP5 A;  5EWF A;  7ENL A;  4G11 A;  5FMH A;  4LNK A;  3QZ7 A;  1F9C A;  5KG7 A;  2ONE A;  2RMM A;  2YVJ A;  2DUY A;  2IHM A;  3N1X C;  1BUI C;  1V5T A;  1OQQ A;  1GC7 A;  2JGA A;  2ZIV A;  4ED3 A;  2P3Z A;  5DKW A;  2JEG A;  4DSI A;  2F3N A;  2KFJ A;  3GS2 A;  2C2R A;  4ZCW A;  1K52 A;  2KJ5 A;  3J9C A;  1O08 A;  4U7C A;  3WK9 A;  2BCU A;  4PPX A;  4KIK B;  4ITK A;  7ICG A;  3IHQ B;  3DER A;  2KQ7 A;  5JZE B;  3BII D;  4F4Z A;  4DSK A;  7ICV A;  3JPQ A;  2FLP A;  1ZQ1 C;  3RJG A;  4DHJ D;  2PP3 A;  1V81 A;  4NJ8 A;  3X0W A;  1SB3 B;  3D9X A;  2P6R A;  3R7R A;  2W0H A;  3B2F A;  3QPE A;  2E1E A;  1YX5 B;  1WXM A;  3TEW A;  3JW0 X;  1PDX A;  3HPF A;  4TKN A;  2QLT A;  2IGD A;  2AL1 A;  2XH7 A;  3BSM A;  4I2D A;  2XC9 A;  3A9J A;  4OZB A;  1DOQ A;  1JI7 A;  1S0V A;  4GC7 A;  3H12 A;  4GXJ A;  3HKZ F;  1B43 A;  4PHP A;  4R8U B;  2BCR A;  4JL9 A;  3VH3 B;  1MG4 A;  4HVB A;  2W9N A;  4M02 A;  3VCC A;  1LVL A;  2KWC A;  4GDL B;  3ZTC A;  2I1K A;  5KVH A;  2UUU A;  1QH9 A;  5J2B A;  1NEK B;  1P9D U;  3LWM A;  1UF0 A;  2YVS A;  2XK5 B;  4ZRJ A;  3SQP A;  2ZW1 A;  3UJE A;  2GOL A;  4G9B A;  5BPC A;  3JPS A;  4CHK A;  4Z6F A;  3EEZ A;  4KX3 A;  3PZ7 A;  2KAJ A;  3T8Q A;  4P0P B;  4H4V A;  2KNJ A;  3VRA B;  4YL8 A;  5ALT A;  1ZQD A;  2UVW A;  3PLV A;  2M8S A;  3QZ8 A;  3SZ2 A;  1KKO A;  4P7I A;  5EWE A;  1TYG B;  4KLM A;  2SEB D;  3AL0 B;  3MC0 B;  1XO0 A;  4EYH B;  1NK7 A;  5IP4 D;  3Q8K A;  5CHV C;  5I1V A;  3K1G A;  4EMI A;  1LXD A;  3MGI A;  1QLB B;  3BS5 A;  4HCP B;  2FUG 1;  3ONS A;  3UGV A;  2H3V A;  1E8X A;  1IM4 A;  2YMQ A;  3H7S A;  3QK0 A;  4RGN A;  1UXY A;  5FJO A;  4JN7 A;  4US8 A;  2ZPN A;  5J2J A;  2JXJ A;  1KL9 A;  3PO4 A;  1M4V A;  2VIX A;  2WB1 C;  4QWA A;  4DL6 A;  3KHG A;  2Q85 A;  4WAA A;  4RNN A;  2VA2 A;  3A9K B;  1VLB A;  3I3T B;  4GXI A;  5I4D A;  1XHC A;  4S0R A;  3F5A A;  3TJI A;  2RPV A;  4GIB A;  2DFL A;  9ICI A;  2P4P A;  4RH6 A;  1HUO A;  2AL2 A;  3LJ3 A;  4IWO A;  2A1A A;  3PR4 A;  5KHQ A;  2Y08 A;  2IO1 B;  1XO3 A;  1D6E C;  3WAL A;  1RRB A;  3QUQ A;  1R4N B;  5AM1 A;  2M0A A;  1NKE A;  4BJQ A;  1MC8 A;  1NJY A;  2D2Q A;  2LPE A;  3EHV A;  5L6G A;  2BYV E;  2PKE A;  3TEX A;  5C23 A;  3UQB A;  2MEK A;  2V3P A;  4X5V A;  2K8C A;  4OZC A;  4MF8 A;  3UXL A;  3G6X A;  3DBH B;  2I6X A;  4GLS C;  4ZHP A;  4UAU A;  4UB6 U;  2EAO A;  5EE9 A;  4ICV A;  2TSS A;  3H8S A;  5K8E A;  1GEU A;  2GLS A;  5D79 A;  5BMI A;  5J2E A;  7ICM A;  1KLU D;  1EO6 A;  4JWS C;  3WK8 A;  1WZ0 A;  2IY1 B;  4I6L B;  3RT3 B;  2EQ7 A;  1UGM A;  1NPX A;  4HK2 A;  3VCN A;  3D6J A;  2ZIW B;  2J4X A;  9ICO A;  1C76 A;  4HG0 A;  1ZQV A;  1ZQZ A;  4QJF B;  5DCN A;  1WWU A;  4KVG B;  1HJP A;  4Q43 A;  3KJM A;  2WGS A;  1X40 A;  2ZZP B;  2X50 A;  5AKL A;  1KKX A;  1WX7 A;  4XE0 A;  4RPZ A;  1ZQR A;  1WXV A;  3S1D A;  2QKQ A;  5KG0 A;  4XZ4 A;  2G4D B;  2N7J A;  4DXA B;  3T9P A;  3MR2 A;  5KHO A;  2KSO A;  2BQU A;  3CMM B;  7ICS A;  2KK8 A;  5KVI A;  2EZX A;  3DK8 A;  4EM3 A;  5KFN A;  3VUY A;  3QFB A;  5KG4 A;  2M1M A;  4ECX A;  2X8H A;  1DIQ A;  2EDU A;  4JGH B;  1VJ5 A;  4M47 A;  4KGR A;  4X57 B;  1JXL A;  3BS7 A;  4PGY A;  4PYU A;  1P7E A;  3SAF A;  2DNF A;  1GJZ A;  4K8D A;  1W6T A;  3ZQ4 A;  3ETR A;  3Q69 A;  1F9J A;  1I4X A;  3MP9 A;  4AYB F;  2YB4 A;  2PIA A;  4BWJ A;  2NTS A;  2WX0 A;  3H6N A;  4YWG G;  3V6E B;  2I0K A;  4JN8 A;  1HEK A;  3DG3 A;  5C3J B;  2WOI A;  3GIJ A;  4M8M A;  1WUD A;  5D46 A;  5K4L A;  2EZY A;  1S5L U;  4DHG A;  4J9R A;  3OJ4 B;  2FAZ A;  3WKE A;  4NAM A;  2PFQ A;  3GE3 C;  4RT3 A;  2JRH A;  4C7Z A;  3ZDT A;  2GQU A;  3NRZ B;  3RMK C;  4ENL A;  1VD2 A;  3GD3 A;  2VAO A;  4M8N A;  7ICO A;  3ZYY X;  1KKR A;  3R10 A;  5ALM A;  1C7Y A;  4P4M A;  2XY5 A;  2FE8 A;  2N9P C;  4ZRP A;  3V62 A;  1PK1 B;  4NY8 A;  2F1H A;  3VCB A;  4ECV A;  1ZOY B;  2WXJ A;  4E71 A;  1PGX A;  1UEL A;  5E6N A;  2L00 B;  4CF4 A;  1AN8 A;  4KLF A;  5KFV A;  4GGB A;  2KC1 A;  4MM3 B;  2N9X A;  4H4Y A;  4NWI A;  2E1F A;  2UUV A;  4Q8E A;  3ENL A;  4F5Q A;  5B66 U;  2IGG A;  4BCA A;  1UT8 A;  4RQ0 A;  3QU5 A;  1Z00 A;  2DWQ A;  5KFC A;  3ZDB A;  1BPB A;  3UJF A;  2D5G A;  2W3R A;  3W9C B;  5C5J A;  3AU4 A;  3Q8L A;  3RJH A;  2Z8L A;  1ZQL A;  2C7H A;  2OXO A;  3N1Z C;  3CGC A;  3DED A;  4PWC A;  1EBD A;  1LKY A;  2KMD A;  2D10 A;  4FS1 A;  2IDY A;  3IJI A;  3NTU A;  5ALQ A;  3L08 A;  2HMX A;  2AQ3 B;  4GU2 A;  4JWM A;  3NVV B;  4F1S A;  2K6D B;  2ZZB A;  1SSN A;  1YZ6 A;  2HI0 A;  3IRU A;  3LK9 A;  3RJK A;  4JLC A;  2QAE A;  2XGZ A;  1W1K A;  3AXC A;  3RRG A;  1O03 A;  2ZXI A;  4II3 B;  4GME A;  1MNS A;  3EZ5 A;  1ARO P;  3PLU A;  1W1O A;  1I4R A;  2QGY A;  4BBN F;  3T5H A;  2N9K A;  1SZH A;  4A6Q A;  2WWZ A;  2JR5 A;  2AAQ A;  1QSS A;  4I2H A;  5J0T A;  1GSN A;  2AU0 A;  1W1Q A;  5FJU A;  4EBC A;  3SN4 A;  2HVI A;  3ZW3 A;  2CR5 A;  5J2I A;  3B1L X;  1ZQN A;  4H4Q A;  4CYE A;  2W11 A;  1LVH A;  2OKT A;  2KJH B;  5KFB A;  2YX8 A;  3TFS A;  2DYO A;  3H0M B;  5AK3 A;  1J7B A;  2R9Z A;  4F3O A;  4I2C A;  3P63 A;  3PX6 A;  3V4B A;  2JY6 A;  1ZQP A;  1ZDV A;  3SEN A;  1GOZ A;  4EMW A;  4UB1 A;  3PZD A;  5IIO A;  2M0N A;  1JPM A;  4GYP C;  4M0X A;  2MJD A;  4QIW F;  1WJ4 A;  4EOY A;  3RIT A;  4URK A;  3B97 A;  3JS8 A;  3U8Z A;  4Y2Q A;  4B9U A;  4TV3 A;  3SN0 A;  2GL5 A;  4L2Y A;  3ZD9 A;  4ZOH C;  2BS2 B;  5DPR A;  4LJX A;  1CQV A;  2BWE S;  1DXL A;  3OZY A;  3KW5 B;  1J8C A;  1TS4 A;  5JH5 C;  1FXA A;  1FPY A;  2HHW A;  2C22 A;  1NDA A;  2HHQ A;  3RI7 C;  1E9I A;  3C0P A;  3MUC A;  2LXC A;  1WGD A;  2P66 A;  1XDI A;  2W8L A;  5KAF U;  2MHJ A;  3Q8B A;  3HT3 A;  2LMC A;  2NO5 A;  3KUZ A;  4KGT A;  3CRX A;  4DSF A;  4M9L A;  1D5Z C;  1RYS A;  1TAM A;  3ZNZ B;  3T3O A;  2M4N A;  1UQV A;  5D49 A;  1UBI A;  1BPD A;  3S1E A;  4GYP A;  3NVW B;  3UF8 A;  4G50 A;  1A70 A;  3D32 A;  5AIC A;  4DL5 A;  2DQN B;  4OJO A;  2XEW A;  4HJK A;  3IBE A;  3AE4 B;  4K7U A;  1L4Z B;  2RQ5 A;  4WAF A;  1EC8 A;  5BMG A;  1ZW7 A;  2KDE B;  2KMA A;  4Z6E A;  4RQ7 A;  5J0P A;  4MJS B;  1L8O A;  2QB1 A;  4RNM A;  3MDA A;  4DS4 A;  5L95 C;  4M0W A;  3H0R B;  1AHZ A;  4DQP A;  1V9P A;  3TJP A;  1C1Y B;  1TBE A;  1WX8 A;  1CZP A;  2BDP A;  4FJV B;  2PS2 A;  2YMP A;  2WXG A;  2QIE B;  3UIP B;  4BFR A;  1WUE A;  2KKC A;  2WDR B;  2J6T A;  3UIN B;  3ALB A;  3KHH A;  4CF5 A;  2GB1 A;  4KSL C;  4RCO A;  5EE3 A;  5IO9 A;  5DPW A;  1ZQU A;  3GO2 A;  5DBC A;  1U4B A;  5CWR A;  2IYD B;  2WU2 B;  9ICQ A;  2ALZ A;  2NR2 A;  4F5R A;  3MJ5 A;  2XBB C;  3ZVH B;  3L0W B;  4MGK E;  3ZNG C;  2PVG C;  3PHW B;  3P1M A;  4DHZ E;  4EQR A;  5G2N A;  5AIB A;  3PS6 A;  2BQQ A;  4ARC A;  3NXL A;  2EEL A;  2A8X A;  4I28 A;  3TMP B;  3RD2 A;  3CYJ A;  1OTR B;  1S0N A;  3TCA A;  4BKS A;  1XS2 A;  3LVV A;  5KT3 A;  2QB0 B;  1U48 A;  4RM9 A;  2QJJ A;  2B0C A;  3K9O B;  5ADZ A;  1KLN A;  3TJ4 A;  4BWM A;  4LCD E;  4FP1 A;  5AKZ A;  4QW9 A;  3NS1 A;  5KFA A;  1I4Q A;  5L1K A;  4GB9 A;  1SB3 C;  2KD1 A;  4E74 A;  1KEJ A;  3FWA A;  2WAQ C;  1RZT A;  3GP7 A;  3KUC B;  2XI9 A;  3T79 A;  3RPF C;  1U45 A;  2VAN A;  2BT6 A;  2PMZ C;  4DLG A;  1WFY A;  8ICW A;  2X99 A;  4EX7 A;  5GMV A;  4WWP A;  4PZF A;  3SR6 A;  3ZDD A;  2XVT A;  4W9C A;  1PFD A;  3U30 A;  1TZZ A;  4EBD A;  4WQO B;  3P42 A;  3RNB C;  3GE8 C;  4Y2T A;  5CR0 A;  1B22 A;  3OWE B;  1WGG A;  2J53 A;  4KGS A;  4DOA A;  3LDZ E;  3VDG A;  4DS5 A;  7ICH A;  4WJ3 B;  3TFR A;  3M3J A;  2W55 A;  4WWO A;  4JPS A;  5E6J A;  3R0K A;  1D5X C;  4KLE A;  3GQC A;  3BQ1 A;  1BQG A;  3ZLF A;  1H4R A;  4KIK A;  1L7O A;  2G1E A;  4PGX A;  3UCC A;  3PPA A;  2NYV A;  3IP4 B;  3EFU A;  1E8G A;  2NRX A;  2XSX A;  2NRT A;  1J97 A;  1MRA A;  1CK1 A;  2SAK A;  1RM6 B;  4F5P A;  1YN4 A;  2DGZ A;  3OGU A;  5ALI A;  5ALO A;  4YR2 A;  3QWZ B;  2VH2 A;  3UJS A;  2BS4 B;  1TT5 B;  1NHS A;  1T0R C;  1S1Q B;  2LJI A;  2PLP A;  4NXZ A;  4CCH A;  3ABV B;  3O0H A;  4FE3 A;  2AYO B;  1UBQ A;  3LXD A;  1Y8R C;  3C21 A;  2NS5 A;  2DX5 B;  3B0A A;  4GLX A;  3U2S C;  4R8U A;  2NQL A;  1TKE A;  3BJS A;  2BC0 A;  3WKA A;  1S97 A;  4OHJ A;  4HLE A;  1VR9 A;  4YMO A;  4PZN A;  1XXG A;  1NYR A;  1L6N A;  3CWI A;  5KFR A;  5IAA C;  1GRG A;  4GDL A;  4TUR A;  8ICU A;  4DBG A;  3MFI A;  9ICU A;  2MBQ A;  1I35 A;  2OAI A;  3AN1 A;  2XK5 A;  4GFJ A;  3ZI4 A;  4EC3 A;  2LI6 A;  1RYR A;  4H2H A;  4RQ2 A;  5H92 C;  3POP A;  1AW7 A;  2ACZ B;  3AEE B;  4M2Y A;  4PS8 A;  1TIF A;  3VTV A;  4P0P A;  4II2 B;  2HBK A;  1TAQ A;  3RN9 C;  8ICM A;  3D2H A;  2V4L A;  3VC8 A;  1SBB B;  5B5E U;  3FDS A;  5HHI A;  5CX3 A;  1YEY A;  3KZX A;  1ZQB A;  4ZRI A;  1NEL A;  4IHC A;  2AGQ A;  1F0M A;  2V3A A;  2OLA A;  2CHX A;  4XUS A;  3A4S C;  2Y1J A;  3FKY A;  5G5G B;  5JHB A;  5L83 A;  1C4C A;  4N58 A;  4A6G A;  1AYF A;  1AWD A;  1UCV A;  2E3T A;  4DSJ A;  1SJH D;  2B3A A;  3UQ2 A;  3M9N B;  4FA6 A;  3A9K A;  2WF9 A;  4F4W A;  4EX6 A;  2GRI A;  2F1J A;  5D7G A;  3WKC A;  3VH4 B;  2MUC A;  1K8R B;  4FHK A;  2CHW A;  1JPD X;  4CQN A;  1DRG A;  3WAN A;  3CP8 A;  5DB6 A;  1VJK A;  1BPZ A;  2Y5B B;  5C2T B;  1V80 A;  4KN7 A;  1GG3 A;  3I5J C;  4BOZ B;  4PVK A;  5AM5 A;  3PWI A;  2YVC A;  1K5O A;  2W82 A;  2OVL A;  3O13 A;  2KJ6 A;  3AH7 A;  4NL9 C;  3N3K B;  5KFD A;  1KFS A;  2NBV B;  2NVK X;  3MAB A;  1XU4 A;  2ISO A;  2A19 A;  2WQY B;  2JZB A;  1R4N I;  2J6U A;  4A35 A;  1JEH A;  1JQ4 A;  5AK5 A;  4MFC A;  5AIA A;  5AM2 A;  2GOW A;  3DHG C;  1S3S G;  4M9H A;  1ACC A;  1NDD A;  5FKA C;  3PST A;  3C1Y A;  1WY8 A;  4M6W B;  3DBH I;  4IWQ A;  2L8J A;  5CEH A;  4N9F 4;  4FX9 A;  2CN1 A;  3ZKJ C;  4BGD A;  3AV8 A;  4HXD A;  4TUP A;  4LJO B;  3Q3N C;  3WU2 U;  5F9L A;  2WXH A;  2AL3 A;  5DG8 A;  8ICN A;  1DGS A;  3T3N A;  3I99 A;  4GRT A;  2WF6 A;  1XS9 D;  1C20 A;  1SE3 A;  4DDI D;  3DGZ A;  3DEE A;  4UD8 A;  4NAW B;  3PMN A;  4MT5 A;  3UMG A;  3IG5 A;  5KAI U;  4PGQ A;  1QKZ A;  1WWT A;  2KTF A;  3I57 A;  4DWI A;  2D6F C;  2GQW A;  3Q3O C;  3RBE A;  2FBW B;  1MJD A;  2WOW A;  4TQS A;  4NL9 A;  3S2A A;  3IG3 A;  3BY4 B;  1PUT A;  3QYP A;  9ICA A;  2D3A A;  1S77 D;  1N48 A;  3NO1 A;  2LHT A;  3O0F A;  1NBF C;  2GMI C;  3S5S A;  3QA8 A;  4LNF A;  2BCP A;  3BIN A;  3DGB A;  3PWG A;  2R18 A;  5KG3 A;  8ICF A;  2MBE A;  2MBO A;  1E0Y A;  1KTQ A;  1MBB A;  2OG9 A;  3R11 A;  4EQX A;  3TI0 A;  2I38 A;  4LVS A;  3PY8 A;  4F4X A;  2BYE A;  4RQ3 A;  5HG2 A;  4ED8 A;  4B0M A;  1PDZ A;  3DOW A;  4PVH A;  2WNM A;  1QQ5 A;  1E8H A;  1G6J A;  3Q3M C;  1P48 A;  4E0D A;  3ENE A;  1IYF A;  2DPI A;  4OVV A;  5E79 U;  1PVQ A;  3N7R C;  2BB6 A;  1P43 A;  4H4X A;  2BQ3 A;  1YN5 A;  1SKW A;  3NRZ A;  3D46 A;  2ZCC A;  3KKA C;  1ZX9 A;  3IM1 A;  2OHF A;  2JWU A;  2RR9 A;  2WHI A;  4GC6 A;  3RR1 A;  2HJ8 A;  3L3F X;  1PK1 A;  1A77 A;  3RTV A;  4O5C A;  1QOA A;  1QQR A;  3QXG A;  1KF6 B;  5IN7 A;  4RPX A;  4HYR A;  1ET9 A;  3AED B;  2GRT A;  1WE7 A;  4MM3 A;  3PNC A;  4J3O D;  3IDW A;  1ZKH A;  2F44 A;  1RXW A;  3R2T A;  3KFU F;  4MGZ E;  4Y2P A;  3T5J A;  2KDI A;  1T6B X;  1JWB D;  1NNL A;  2H88 B;  4IL6 U;  5D6J B;  2EQ9 A;  3OTR A;  2HHU A;  4EEN A;  2KX3 A;  3H7V A;  4J9N A;  2LGD A;  4YSZ B;  4ZYS A;  3A7R A;  5GRT A;  1T94 A;  5KG2 A;  3PO0 A;  1R0M A;  4H2A A;  5I1W A;  4NY0 A;  4R63 A;  1ZD2 P;  2XY7 A;  4MGI E;  4QWC A;  3ZXV A;  3P93 A;  1MHX A;  1T3Q C;  4OCZ A;  2INP E;  2OH2 A;  2IJ0 A;  1FO4 A;  3AE6 B;  4M9J A;  1KJT A;  4YD2 A;  3U7Z A;  2ES6 A;  3V5F A;  3E58 A;  1C4A A;  5AZF A;  1COO A;  2K5P A;  5C0Y A;  3QCA A;  3JZU A;  2FYM A;  1XNS A;  1HZ6 A;  1XT9 B;  3N7P D;  2VFT A;  2PGE A;  3QX1 A;  3HX0 A;  1ENF A;  3C2K A;  3KUD B;  3V72 A;  1COK A;  4RQ6 A;  3EPI A;  1F77 A;  3W8X A;  2EQ6 A;  1H8C A;  8ICB A;  2KLG A;  2QPM A;  3H70 A;  4OAL A;  1TVA A;  3TOY A;  1ZQG A;  1WJN A;  4DSL A;  3SQS A;  3NVY A;  1JRU A;  3KLJ A;  2K0P A;  5GTH U;  4LJP B;  3EUB 2;  1JN3 A;  4QW8 A;  3DVG X;  2JRI B;  1ZDL A;  2PJH A;  1ZJM A;  3ZIM A;  2VFV A;  4GIR A;  4HDO A;  2WDW A;  3MFH A;  4IM3 A;  3QEB Z;  1T3Q A;  4G7F A;  3IG8 A;  3M95 A;  1XPY A;  2DYM A;  2H3F A;  3DVN U;  5KFW A;  3DJG X;  1CUK A;  1C77 A;  1L0X B;  2E8O A;  4JX1 C;  2BGF A;  3V3X A;  2R8G A;  1T5X D;  2BF8 B;  3VTE A;  7ICL A;  1M94 A;  3WK5 A;  2C28 A;  5CTR C;  3SU8 X;  2K4H A;  4KIT B;  4YD1 A;  2HHX A;  2KV2 A;  3KOO A;  4C8K A;  4C4V A;  1TKK A;  2C7N B;  3TEY A;  2OZ3 A;  3ZJU A;  2V3B A;  1D8L A;  3PRP B;  3P4Q B;  4XQ8 A;  3ZLZ A;  4MMW A;  7ICI A;  1ZD4 A;  2L1A A;  5KFQ A;  2EAM A;  4KMO B;  2PE6 B;  1NZP A;  4TQ0 A;  3ES8 A;  1XO1 A;  1ZD5 A;  1TZ1 A;  5T8I A;  3RR8 A;  3RZW C;  2KD0 A;  4W9L A;  2BYT A;  4RT2 A;  1C79 A;  5J2C A;  5J0R A;  4DDG D;  3TTE A;  4ZRQ A;  1E0Z A;  1BVS A;  3B9J B;  3PSP A;  4UAR A;  1RDF A;  2ZIU B;  4F2R A;  4DCC A;  5AE2 A;  3GDX A;  3C5F A;  1UNS A;  4ZYN A;  3OSN A;  2KQS A;  4REZ A;  2ZIX B;  1RFA A;  2IOF A;  2MUT B;  3NVW A;  1N56 A;  1OW5 A;  3GFK B;  2K4E A;  2G3Q B;  2L05 A;  4F4Y A;  2G5I B;  3MC9 A;  2GGG A;  3LB8 C;  2QDD A;  4KMU A;  4OW0 A;  4MLA A;  9ICM A;  5BOL A;  1YQ4 B;  4M04 A;  1OQR A;  4OD0 A;  3Q8C A;  3KWV A;  9ICN A;  3C28 A;  2FPL A;  3UMC A;  1ZQI A;  2K22 A;  5J0U A;  2OED A;  4MJS A;  3VRB B;  2KC2 A;  2PMV A;  7ICF A;  3CK5 A;  1A6S A;  1KLV A;  1N63 C;  5F9N A;  3FIL B;  2JUO A;  4JV1 A;  3C19 A;  3FJ4 A;  4DYE A;  2MLB A;  2HOQ A;  3MHZ A;  1SJD A;  2O2V B;  3KWL A;  2OPJ A;  4ED1 A;  2ICI A;  4ANX A;  4PYT A;  4BKS D;  4RUC A;  5AE1 A;  2IO0 B;  4ADW A;  3UXP A;  2WPC A;  3QTP A;  1T3N A;  8ICR A;  2HDE A;  2JWZ A;  5J2G A;  5L1I A;  1FNU A;  2LZ6 A;  1PUZ A;  1H38 A;  2P88 A;  3S47 A;  3ZVH A;  1SIF A;  1ECQ A;  3CNH A;  4DFJ A;  3EJE B;  3CB3 A;  2DW6 A;  1D9D A;  3A0H U;  1X2G A;  3TAQ A;  1C4P A;  3RF9 A;  4DQR A;  4UB3 A;  3M9O B;  5ALE A;  4JQW C;  2PTZ A;  4E5T A;  3FM9 A;  3TUO A;  1GNU A;  2KZ3 A;  3LB8 A;  1B1Z A;  1IGD A;  1WYW B;  2E8P A;  2K1F A;  3HUI A;  1MO9 A;  1F2R C;  4A90 A;  2OCE A;  2QB0 A;  4XA5 A;  2VRR B;  1S76 D;  1KRH A;  2PA6 A;  1L5P A;  3DBL B;  1QIL A;  1NK4 A;  1P1A A;  1ZPS A;  5U25 A;  4KX6 B;  2FUH B;  1BT0 A;  4W9F A;  1RM6 C;  1X6I A;  1N63 A;  3W8W A;  2OX4 A;  3MC1 A;  2MWS B;  3NZ3 A;  2KFN A;  2L7R A;  1CMX B;  1D3Z A;  1ZMD A;  1BZL A;  2AL6 A;  1TYT A;  3F5E A;  4F8R A;  4F50 A;  3HP6 A;  2EAP A;  2CHZ A;  2Q4T A;  3AEV A;  2FNJ B;  4ZDV A;  5GTI U;  1L3U A;  1PK3 A;  4H4S A;  3PGE A;  4EZ6 A;  4NV0 A;  4HCL A;  4K7Z A;  3BOX A;  3BWU D;  4NQL B;  3H0L B;  3ALR A;  1N5X A;  3HIL A;  1FEC A;  2QJL A;  3TBL D;  1QOB A;  8ICY A;  1VZ8 A;  1SV0 C;  1ZQO A;  3PRE A;  3TL5 A;  4F4R A;  2OJR A;  5AEK B;  1TS5 A;  2E5A A;  2LM4 A;  2ZVN A;  7ICK A;  2OO6 A;  4E4F A;  2JEJ A;  3II4 A;  3FC4 A;  4GDK B;  2I1J A;  4HPN A;  4NEW A;  3CYM A;  2KMM A;  1S0M A;  3NUQ A;  1F2R I;  5AI5 A;  3E9S A;  3TW9 A;  1EXN A;  3L16 A;  4BAX A;  2OEH A;  4LDT B;  1TY2 A;  4QWB A;  2KWD A;  2WLB A;  3UIO B;  4IT1 A;  4TSS A;  3UJ2 A;  2V4R A;  4C8L A;  4IRC A;  1ONF A;  4HCD A;  3UMB A;  1TTN A;  5LLI A;  1JWM D;  3QJZ A;  3UQA A;  1C9F A;  1FIQ B;  4YCX A;  1QSY A;  4BXO B;  3JYU A;  3HSU A;  2WHE A;  3L10 B;  1FXT B;  2Q4W A;  3AMZ A;  5LXH A;  1JOA A;  3SQI A;  1TY0 A;  3BYT B;  5AI9 A;  1XCT L;  4WJO A;  4Q45 A;  1EBH A;  5FS7 A;  5HKH A;  4APN A;  2P6U A;  1NJX A;  1SV0 A;  4PWB A;  1QLN A;  3RJ8 A;  3CSF A;  1UH6 A;  4J9P A;  2JZB B;  2YQU A;  1ZQQ A;  3PZP A;  3QU2 A;  3Q14 C;  1ESF A;  4F4K A;  2RDG A;  1NK8 A;  4O3S A;  2IGH A;  1NI3 A;  2WTF A;  4P0Q B;  4RQ4 A;  3SFD B;  2G07 A;  1WGR A;  7ICT A;  2N1R A;  2BPF A;  4FHJ A;  1T0Q C;  5EBK A;  5EE0 A;  3QAR A;  4MHV A;  1NZB A;  1MQ2 A;  2WXL A;  4YSX B;  3TWB A;  9ICS A;  3HWT A;  2E8M A;  1QOF A;  1V1O A;  1JMS A;  1RPL A;  1BGX T;  4R3D A;  2W7O A;  1EC9 A;  1ZJN A;  3FG2 P;  3WAP A;  1GET A;  5G5G A;  5JU5 A;  1GV4 A;  2QKN A;  4PS3 A;  3SHQ A;  1WE6 A;  1ONE A;  5CA7 A;  2PP1 A;  3MR5 A;  1PYW D;  4B95 A;  4UAV A;  5IDZ A;  3M7D A;  3F2B A;  2YEP B;  1MA7 A;  1Z2M A;  3AEG B;  3VDZ A;  4RM8 A;  4F2S A;  3GRT A;  2MU2 A;  4CGZ A;  3TAP A;  3EJD B;  1NEN B;  6ENL A;  2VJ5 A;  5FP0 A;  4M6U A;  2LJ5 A;  3L8K A;  5AWV A;  2Q5W D;  1Z19 A;  3PQB A;  4O0I A;  5JUM A;  1FCC C;  3EYZ A;  4H4U A;  1NI2 A;  4GR1 A;  3I6E A;  4RQ1 A;  1YJ1 A;  2CHR A;  3FCP A;  3OLM D;  1ZY8 A;  1HEZ E;  2FE9 A;  3ISB A;  3C29 A;  4QZH A;  4QZA A;  2WF8 A;  4B9T A;  1FNV A;  1V59 A;  3ZJT A;  2AXT U;  4OJ5 A;  1RLF A;  3DVN V;  9ICJ A;  2WPF A;  3WK4 A;  1JUD A;  2KFK A;  2CFY A;  3BZD B;  4FO6 A;  3ZDE A;  3Q8R B;  4JMU A;  3EF6 A;  2LM1 A;  3RAQ A;  5ALF A;  3UXN A;  3RH4 A;  5L1M A;  4EEW A;  2W03 A;  3D2N A;  2I5Q A;  4M6W A;  1UA0 A;  3KHL A;  3RJJ A;  2XO7 A;  3AEB B;  1MQ3 A;  4AQ7 A;  1C3T A;  1PGB A;  3MSY A;  1LFD A;  3A33 B;  3B08 A;  4KLD A;  3WK7 A;  1ZRN A;  2V1Y A;  2LUM A;  2M0X A;  2WXN A;  5E6O A;  3NUH B;  4CNQ A;  5KTQ A;  1Z1V A;  5D4B A;  4P4P A;  4Y2Y A;  3Q8M A;  1YOV B;  1TAU A;  2XN9 C;  3AE2 B;  4JIO U;  4NAW A;  4PL1 A;  2KIW A;  4RNA A;  4DK5 A;  4J9K A;  3N6J A;  3AU2 A;  3S6J A;  2JEF A;  5J0X A;  2ON8 A;  3PT2 B;  2Q0Z X;  1TS3 A;  2DBY A;  3BVZ A;  3T5K A;  5AKK A;  1FNW A;  4M01 A;  2NRV A;  2QDE A;  1OJT A;  1W1M A;  2LHD A;  2AKM A;  3MWC A;  5FJT A;  5DGB A;  3MJW A;  8ICG A;  1TKG A;  3AE3 B;  3ZGZ A;  4BC9 A;  2KJR A;  2Y3S A;  2UYZ B;  2KVS A;  2IO2 B;  2R8I A;  2PI5 A;  3LAE A;  3P4S B;  1B0X A;  2LRW A;  8ICH A;  3AU5 A;  3IT4 B;  4KZ0 A;  3RFZ B;  3QUC A;  4ML8 A;  1NK0 A;  4C56 C;  4YQW A;  4BBY A;  5JXV A;  5CHF A;  4YWS A;  4K4H A;  4E8G A;  1L3S A;  1QZE A;  1IG6 A;  4DWF A;  1U4A A;  5L9X A;  1WXS A;  2KDB A;  3BK2 A;  2Y4G A;  1YZ7 A;  2W9C A;  2R8K A;  1WM2 A;  4FS2 A;  3SFE B;  2JZ3 B;  2KIV A;  2DYB A;  4FI4 A;  4C7Y A;  3SJN A;  4PT5 A;  2W9A A;  2KAN A;  4XWT A;  2DW7 A;  1K1Q A;  2GR1 A;  3JVZ X;  5HFY A;  3UI3 A;  4F5N A;  5DLF A;  1WRI A;  3EGR A;  3RNC C;  3A7A A;  2HHT A;  4JHM A;  9ICG A;  3PX4 A;  2LMR A;  5KT2 A;  2NCN A;  3NVY B;  2LGI A;  1SF0 A;  4DL7 A;  2ZUC A;  5KT6 A;  3D2Q A;  3ED5 A;  3NJT A;  2POD A;  5AKI A;  2ASQ A;  2KMC A;  2EKE C;  3H7P B;  3TSH A;  8ICP A;  1BXT A;  1I4G A;  3A4R A;  4FJY A;  3JPT A;  3HVD A;  1J7C A;  2H89 B;  4BKG A;  5ALD A;  3RH6 A;  2FIF A;  5J2R A;  1V38 A;  1DK3 A;  1KFD A;  1SV4 A;  2G4S A;  2VJ4 A;  2V6O A;  1ZQM A;  5AKJ A;  4LLG M;  1SJB A;  4MGG A;  1L2N A;  5DLG A;  5J29 A;  1QOG A;  4KPL A;  3SDL C;  2GO7 A;  4KLT A;  1Q1O A;  1RYJ A;  1EU3 A;  4MSQ B;  2KOX A;  4CRX A;  4KLG A;  3PHX B;  4H4W A;  4C4V B;  4IR1 A;  2ONQ A;  4GN1 A;  2ZJD A;  1VZ7 A;  3R3M A;  4JWN A;  4UAS A;  3UXO A;  2C2D A;  2FMQ A;  2FPK A;  3QX7 A;  2YAU A;  3DG6 A;  4Y2J A;  2AHO B;  1K51 A;  1WR6 E;  1WVE A;  4K8G A;  3C5G A;  3N7S C;  2CU3 A;  2LXA A;  1WZ3 A;  1WR1 A;  1N62 C;  5KFM A;  4EKU A;  3DFY A;  3RRA A;  4UDU C;  4C8M A;  2AX5 A;  5JRT A;  2KK0 A;  1DOI A;  5JCK A;  1T0Y A;  4G3I A;  4PZO A;  3U4E G;  3D47 A;  2X8X X;  2K89 A;  5CHW A;  4ICA A;  2MCN B;  1ZXI A;  2O6V B;  2PU0 A;  3WKD A;  1WH3 A;  2LKY A;  3PFR A;  2JK6 A;  3BQ2 A;  1TGZ B;  2GR3 A;  2V4Q A;  2WB1 F;  3BDP A;  5AM0 A;  4DOC A;  4MH0 E;  1TV9 A;  2LYB A;  4PHE A;  1CRX A;  2TPR A;  5U1O A;  3GIK A;  2BPS A;  4XC2 A;  4BOS C;  5ALV A;  2W43 A;  2JVC A;  2KG5 A;  3N4F A;  1J7A A;  2M56 B;  4HEA 1;  2CRX A;  2KYW A;  2C5L C;  4EQW A;  3C2L A;  5AK4 A;  1N62 A;  1ZRM A;  4Z6D A;  1MG8 A;  1GRE A;  2KE7 A;  2R8H A;  1X66 A;  4AP9 A;  3V05 A;  4I6N B;  2BPG A;  1L5U A;  1L7N A;  3F2C A;  2C2E A;  2PKO A;  1JCK B;  2WPE A;  2GGJ A;  2BR0 A;  4PHD A;  4ED6 A;  3DQV A;  4KZC A;  4UAW A;  2BYF A;  5DBB A;  2MA9 B;  3BVM A;  4Z6C A;  2LGX A;  4LNO A;  4W9I A;  3FW9 A;  4C00 A;  3L13 A;  5E6P A;  3B9J A;  5HNK A;  4ECZ A;  4WWM A;  2ZIU A;  4XDD A;  2LVP A;  2LEK A;  1T8E A;  3KUM A;  3WA0 A;  2O56 A;  2A4Z A;  1SIJ A;  1YX6 B;  5BYQ A;  2ZIX A;  2BHN A;  2MUT A;  2MRP A;  3I9V 1;  1CEZ A;  4NZL B;  2JU6 X;  1CI4 A;  1UGJ A;  2V0G A;  1RYU A;  1EF5 A;  2JT4 B;  4YT0 B;  1N6Z A;  4NLG A;  2NV3 A;  3AQF A;  4HRS A;  4A55 A;  2IPI A;  3ZTD A;  3QU4 A;  1V1P B;  2BBC A;  2ZCB A;  4ECQ A;  4FJZ A;  3OHA A;  2RAB A;  5DQG A;  2W9M A;  4DHZ B;  3GD4 A;  3CGE A;  1WIA A;  2D3C A;  4FZN A;  3SD5 A;  2F8K A;  8ICL A;  9ICT A;  3NGD A;  2JH1 A;  4Y2X A;  4PYZ A;  5JCN A;  3FIL A;  4RFB A;  4KDI C;  2OM6 A;  2Y9T A;  4ZHO A;  1UZX B;  2CXY A;  3TIX A;  1NHR A;  5HML A;  5J2F A;  2O2V A;  3Q4D A;  4YMN A;  4F72 A;  2HJ1 A;  3HVZ A;  2B76 B;  1J0G A;  4BC7 A;  3OPX A;  1Q46 A;  1V85 A;  2N0S B;  4I2A A;  1ZQY A;  1QSL A;  1KCZ A;  4DQQ A;  3BYY B;  1TFR A;  4N6E B;  1JXE A;  2BB5 A;  3PTF C;  4O1N A;  4TQR A;  3QAQ A;  3IJL A;  5BOE A;  1KQQ A;  2HSZ A;  3ETL A;  3GV7 B;  2C7M B;  4TVW A;  3HRD D;  5AUI A;  3DK4 A;  3L4P A;  4HRO A;  2MH7 A;  2FMP A;  5DQH A;  2XIC A;  2IPK D;  4JV2 A;  5D94 A;  3L5O A;  2RD0 A;  2V3S A;  3AE9 B;  3VTU A;  5FR6 A;  1D7Y A;  2EMS A;  2RRD A;  3MR6 A;  2W8K A;  5ALW A;  1GRA A;  3PX0 A;  4B0E A;  1E7U A;  4YVZ A;  3NS8 A;  2PFP A;  4O9M A;  3LAD A;  3UJR A;  3Q8P B;  4M9N A;  3H7I A;  1E7P B;  1P7F A;  1F0Z A;  4QZD A;  4KLS A;  8ICO A;  9ICE A;  4NLN A;  2P0I A;  1F8W A;  1PGA A;  3DBL I;  4KLO A;  1FEB A;  3QEA Z;  3C2M A;  3JPP A;  3A1Q B;  5J17 A;  4J9L A;  5T14 A;  4PVJ A;  4YXD B;  4Y2R A;  3EAN A;  4IM2 A;  3SYZ A;  5KFG A;  3Q3J A;  2F76 X;  2HCF A;  4I2J A;  1ROE A;  1WGK A;  1ZMC A;  1ZQF A;  3LXF A;  4H4P A;  5J04 A;  2J0K A;  2PLI A;  1E8Y A;  1QQ7 A;  2GI9 A;  5AE3 A;  4UAT A;  2EAN A;  1EWC A;  2HQM A;  1PQS A;  2DAF A;  4H4T A;  4MH8 A;  1DYQ A;  2ODG A;  4B9V A;  2X8C A;  1LPF A;  4D2K A;  4DN1 A;  2O6K A;  2MW5 A;  2FLL A;  4GDK A;  3PW4 A;  5DBA A;  1I7H A;  3W1S A;  4Y2V A;  1XLO A;  4EBE A;  1XLP A;  4PJ0 U;  4KDL B;  4Y2U A;  2QQ6 A;  3QUT A;  2W7P A;  1XCQ L;  2EH9 A;  2QJN A;  4JDR A;  4HNC A;  2GBR A;  1V6E A;  4UB8 U;  2LBO A;  4O3Q A;  4B9K A;  5TR5 A;  1E5W A;  5KFZ A;  2AJQ A;  2INN E;  4KKI A;  3QC8 B;  4JB1 A;  1X9M A;  1FHU A;  2WXK A;  1ZUD 2;  1FIQ A;  4DFK A;  3JSV B;  3RJI A;  7ICQ A;  3F53 A;  3QQ8 B;  4F5O A;  4O3M A;  4BXO A;  4ELU A;  2NPT B;  1P98 A;  1S7M A;  5EE1 A;  4J57 A;  1MVK A;  1EC7 A;  5C1Z A;  4E6M A;  3OHB A;  3V3W A;  2V3N A;  4L1B A;  1A0P A;  2G06 A;  1Q5W B;  1T7P A;  8ICZ A;  8ICI A;  1GXF A;  3SAG A;  1Z1B A;  5DQI A;  5KFH A;  2KFK B;  3DWG C;  2MBB B;  4P0Q A;  2NO4 A;  3DVG Y;  3SEB A;  1GRF A;  4UW9 A;  1KFT A;  3EC8 A;  2KHQ A;  2REX A;  3P4R B;  3IAM 1;  3IC9 A;  1WCL A;  4DEZ A;  4WUR A;  4JAY A;  3K4G A;  3DDH A;  1GO3 F;  4TMA B;  1FEH A;  3SMV A;  4H19 A;  3N28 A;  2GBJ A;  5BO4 B;  1HIW A;  4LNI A;  1QT9 A;  3NY5 A;  2MA1 A;  5HMM A;  3PW0 A;  3ZDC A;  2ZUD A;  2DZM A;  3L54 A;  1QQ6 A;  3AM9 A;  4UBC A;  3T3F A;  1SJE D;  2LGY A;  4DQO C;  2XGP A;  3SI8 A;  1V9J A;  2BKR B;  4BZA A;  1MDR A;  5ENL A;  3ECI A;  2WOV A;  3PVL A;  2FCQ A;  5FR3 A;  2LYH A;  4WWN A;  4HWI B;  4DXG A;  4AJY B;  2KIC A;  1V5O A;  2FMS A;  4YSY B;  3PM9 A;  1X42 A;  2YMM A;  2HNE A;  3QN3 A;  2RDI A;  4UB4 A;  3GSY A;  1WYG A;  1A76 A;  1UD7 A;  8ICS A;  4M9G A;  1SE9 A;  3HKZ C;  5KFS A;  3IFW B;  3ZNH B;  4KWS A;  4BUR A;  4F71 A;  2EKI A;  2I2Y A;  4DQI A;  1IIP A;  5F3X B;  5J0S A;  1BNO A;  3RCY A;  2XNA C;  3TSS A;  3Q8S B;  3GRS A;  1QTM A;  2LVQ A;  2OWO A;  2RDJ A;  4A3O A;  4ECU A;  2W3S A;  1UT5 A;  2W9C B;  1MDL A;  1NVI D;  1YMH E;  2AQ0 A;  3FAH A;  2Y9U A;  4E4U A;  4G8T A;  1XLQ A;  4MEM A;  3Q45 A;  4UAZ A;  1VZ6 A;  1YJI A;  2GR0 A;  4J9S A;  4FDC B;  1A5R A;  2UVU A;  4RZR A;  1TK5 A;  3URY A;  3RUI B;  1W1J A;  2F77 X;  2KKP A;  1KM7 A;  3RRH A;  2KDF B;  2WU5 B;  4NLK A;  4HPL B;  3V61 A;  2QVH A;  1RQN A;  4IDI A;  5ALJ A;  2W54 A;  4NJ6 A;  2PGW A;  1XSP A;  4XX5 A;  1FD6 A;  5DG7 A;  4WJP A;  3IJQ A;  2XGQ A;  3I4K A;  2WAQ F;  4W9H A;  3MR3 A;  2R2O A;  4B9M A;  3W5U B;  2PTX A;  5JHA A;  2GQT A;  2ZJA A;  5HHZ A;  5ALG A;  2XH2 A;  4RF1 A;  2K8B B;  2PMZ F;  4YR0 A;  3TKA A;  1IPG A;  1AOG A;  3UGB B;  4MFA A;  5D2M B;  2VFR A;  5EU9 A;  4ECW A;  2AEH A;  1GUA B;  1LV5 A;  3BQT A;  3Q6B A;  3UCD A;  2K3U A;  2MBR A;  3HW8 A;  1D5M C;  3X23 A;  5DB8 A;  1E90 A;  2LFI A;  5JCI A;  2BVF A;  5ALH A;  1KN0 A;  1L7P A;  1XD3 B;  2KVZ A;  3PZ8 A;  3Q8E A;  3FW8 A;  2YB1 A;  4IP4 A;  2QSD A;  4NJ7 A;  2RDH A;  4L23 A;  4Z17 A;  1JWU D;  2DPJ A;  2GH1 A;  5AI0 A;  3F2D A;  5J0W A;  3IAS 1;  5KT4 A;  2ZW0 A;  5KL1 B;  5J2A A;  3ISC A;  2L3Z A;  2WXP A;  1UHU A;  5FXD A;  2PP0 A;  1X9S A;  1RAX A;  2A1J B;  4B9L A;  4HCH A;  5J8Y C;  2XY6 A;  2M19 A;  3G6V A;  4FUL A;  3VVW B;  4DNS A;  3MFG A;  2KOB A;  3H7P A;  5H8Y E;  2BKE A;  4ROP A;  1JIH A;  3P2B A;  5JTI A;  3R07 C;  4HJG E;  2I1Q A;  1R6W A;  4EQS A;  8ICQ A;  4U6P A;  2W9B B;  2X8G A;  3PVX A;  3GIL A;  3V6K A;  3KYC D;  4EUT A;  3CAW A;  4XGA B;  3R9K A;  4C0Z A;  1EM7 A;  2KTR B;  4FAD A;  1HTO A;  2WXF A;  1ET6 A;  3VR8 B;  2WBA A;  1VCB A;  4QZB A;  5KFK A;  1KSP A;  1EBG A;  3TQP A;  2D11 A;  2GBM A;  1HE8 A;  1Q8K A;  1BNP A;  3PW7 A;  4EZJ A;  1JRP A;  4YTN B;  1ZKQ A;  4A3R A;  2Z59 B;  2G45 B;  2JYE A;  4PL2 A;  4C8O A;  4GGH A;  2D3D A;  4QZC A;  4AYB C;  5IKC M;  4K3C A;  8ICK A;  1C78 A;  2YLM A;  3I76 A;  3KQ4 A;  4IC7 B;  2BKF A;  1Q3U A;  4ZA0 A;  5J8Y A;  1KRP A;  5ALL A;  1SXD A;  3L17 A;  2WXI A;  3OP2 A;  1WMH A;  1WI0 A;  8ICA A;  2QEJ C;  2B21 A;  3FW7 A;  2Y3R A;  1DOY A;  3HJE A;  4FBJ B;  2DKZ A;  3SAH A;  2FPM A;  3GOE A;  2OZT A;  4FLH A;  1BWC A;  4J9O A;  3V7L A;  4O95 A;  1M6I A;  1L4D B;  1WM3 A;  2L83 A;  2O6V A;  2QHO A;  5HP4 A;  1K53 A;  2JSV X;  4J1O A;  4PHA A;  4AJW A;  5DDY A;  1NOM A;  2G09 A;  4QZE A;  4R66 A;  2F8L A;  4S17 A;  3NRW A;  3EFC A;  4OO1 J;  1LQB A;  3HPO A;  3VQI A;  4IS7 A;  3WIM A;  3H8H A;  3LDA A;  2WDQ B;  4YTM B;  3NHE B;  2JRZ A;  3CXO A;  3GZF A;  2Z0E B;  1HSK A;  4O5E A;  4MEL A;  2CJN A;  2CJO A;  1UPH A;  3HRD C;  3RO6 A;  2IBI B;  3HIZ A;  3LLB A;  3NG0 A;  1T0S C;  1GRT A;  4NLB A;  1WRD B;  4YR3 A;  2VFS A;  2BCQ A;  2QAR B;  1X9X A;  2BTE A;  2BC1 A;  3SSZ A;  4DFM A;  4RU9 A;  1ZP0 B;  3VR9 B;  2QCZ A;  5KFL A;  2DAJ A;  3U7D A;  1E8Z A;  1ED1 A;  4DHJ B;  2OZ8 A;  1SXT A;  3K1Z A;  2KN7 A;  1EWY C;  1JX4 A;  3MHS D;  2F2A B;  1AAR A;  2WXO A;  2LHE A;  2BPC A;  4UB5 A;  5AKH A;  3M6Z A;  1L6V A;  1FMA D;  4K1W A;  9ICC A;  1S8O A;  4O3R A;  5KFI A;  2ZTC A;  5EOZ A;  2PSN A;  4UB2 A;  1E10 A;  3A0B U;  4KLH A;  2AQ1 B;  2HE7 A;  5H2F U;  3ZRC A;  5KFU A;  1DXS A;  4DL2 A;  2RGF A;  2JYT A;  2JZZ A;  5CB1 A;  3AB5 A;  2RDB C;  4NJC A;  3RNE C;  2ASL A;  2JXT A;  4MF2 A;  1WCN A;  2H3I A;  4BBN C;  3AEA B;  1ZQK A;  1HZ5 A;  3D2D A;  2NBU A;  1GB4 A;  1VDV A;  3GC2 A;  1B9R A;  2KJ8 A;  1V1P A;  3V6J A;  1WJ6 A;  1XSL A;  4M52 A;  5ALY A;  4US9 A;  4A20 A;  2PE9 A;  4GGQ A;  7ICR A;  1HTQ A;  4R64 A;  1FHV A;  3VFK A;  4KLJ A;  1L3T A;  2V4I B;  4DX3 A;  3HM6 X;  1ECW A;  5AKE A;  5KL8 B;  4DF4 A;  3APF A;  3RYT A;  2KLC A;  2WP5 A;  2M17 A;  1KW4 A;  1SXE A;  2GLE A;  2ZNV B;  3N20 C;  2DLB A;  5J2K A;  2WXQ A;  3NOB A;  3CT2 A;  3QKE A;  2M9N A;  3EA6 A;  4TUQ A;  3HK0 A;  4QIW C;  4O3N A;  4EE2 A;  5BMH A;  4ICU A;  5KNI A;  4MDK E;  2KX0 A;  1IXR A;  1YN3 A;  1XC9 A;  2KWV B;  4PK1 A;  2N9L A;  1L6U A;  3QU9 A;  1J2N A;  2KZR A;  3H4B A;  4ECT A;  3RNF C;  2GSH A;  3ISD A;  2INC C;  2YTU A;  1NJW A;  4WJN A;  3VAW A;  1DII A;  4GIV A;  3B0Y A;  2LI5 A;  5LNK 1;  5DDM A;  3CGD A;  1SGH A;  5KG1 A;  5IIK A;  2WP9 B;  1K50 A;  2K8H A;  4NLC A;  4HCN B;  3V5C A;  4W9D A;  5GXG B;  5HR6 A;  3VHT C;  3QU7 A;  1DOX A;  2ASJ A;  2AGO A;  5FK9 C;  1UWX A;  5HR7 A;  1FEZ A;  3RJA A;  4KPR A;  3H8A A;  4K7W A;  2ZZ0 A;  3K9P B;  2J0M A;  5KFP A;  3TAN A;  1NK9 A;  2ZJ8 A;  3A1Q A;  2HBL A;  5CRX A;  2YML A;  5AKG A;  4K2S A;  5TIS U;  2G9H D;  3EPG A;  3N4M B;  9ICP A;  5BYS A;  2POZ A;  1L8L A;  4FBU A;  2ESE A;  1SE2 A;  4LK0 M;  3IXS A;  2KZM A;  4IRK A;  5LXI B;  2RHF A;  3FVD A;  2IMW P;  4K4G A;  1D4B A;  1EUV B;  4AP4 C;  4LDT D;  2R8J A;  4O3P A;  1XSN A;  1ZD3 A;  4RGT A;  1BPX A;  4USA A;  4F93 B;  1SEB D;  2WF7 A;  3ZRF A;  2EMT A;  2ASD A;  5AK6 A;  2PXI A;  4HKQ A;  3M8S A;  3EW9 A;  3PSE B;  3DPD A;  5HHD G;  3R66 C;  3M1Y A;  3OJS A;  3DBR B;  2CDU A;  4IG7 B;  1KTK A;  2GBN A;  3R8B A;  2VZK B;  1OEP A;  3MZN A;  4P2H A;  1R4M B;  1P3Q U;  2GR2 A;  2J52 A;  2OJW A;  2V9H A;  1AHU A;  3EKG A;  4YN4 A;  2N9E B;  1D9F A;  4M0A A;  1GB1 A;  4DSE A;  4JQ9 A;  2PPH A;  4O5K A;  1ZE3 D;  1FEA A;  2Y5P A;  2N7D A;  1GES A;  3RB4 A;  3JSV A;  2R2Q A;  4LZD A;  5IIL A;  2NPT A;  2QDF A;  1E8W A;  2LYA A;  4IQT A;  3D2S A;  2C60 A;  2NBW B;  1YQB A;  2VFU A;  1JAL A;  2DZJ A;  1LM8 B;  2K4P A;  5J0Q A;  2OQH A;  1HA5 A;  3LYS A;  3R7Q A;  7ICE A;  4EEL A;  3Q8A A;  4ZRK A;  1KOT A;  2H5X A;  4H1Z A;  2MSE D;  4NM2 A;  1MUC A;  4KN4 A;  3QNM A;  4ECR A;  2PEA A;  3IT6 B;  3RB0 A;  1Z4N A;  2K25 A;  5FXF A;  3OC4 A;  5TSS A;  4RGM A;  5KFE A;  1SL2 A;  2HVH A;  4EZL A;  1NU5 A;  5TR3 A;  2VZK D;  5KT7 A;  1FFV C;  2FKP A;  2HTM E;  2MQJ A;  2WP6 A;  3PW5 A;  5G55 A;  2AQ4 A;  1TK8 A;  2IO3 B;  1BML C;  2DHZ A;  3GB1 A;  4DXK A;  2ZC8 A;  3BZC A;  1ZGU B;  1S10 A;  4IKG A;  1ISN A;  2CKH B;  3EWA A;  1LB2 B;  3AE7 B;  4BV6 A;  3BQ7 A;  2K60 A;  3VUW A;  3V6C B;  3K1R B;  9ICK A;  1D8B A;  4B9S A;  4NNJ B;  3H4K A;  2R8D A;  3H8J A;  4KX5 A;  1ZQJ A;  1QLU A;  2OFJ A;  3SD7 A;  1YJJ A;  5IA7 A;  1RFK A;  3QLD A;  4BVU C;  3C0R B;  1M6Y A;  1UWM A;  1WX9 A;  4QZF A;  4DOB A;  2JV3 A;  3W8Z A;  2LUE A;  3CIR B;  8ICC A;  3HHM A;  3DJJ A;  2HHS A;  4TQ1 A;  2ZZC A;  1N2X A;  4XLO A;  1OXJ A;  1SKR A;  1ZK7 A;  5ALR A;  1SL0 A;  4LZG A;  4GSW A;  2CS4 A;  5ALK A;  2J3N A;  3R25 A;  2P35 A;  4I2I A;  4RUA A;  1L7Y A;  1FFV A;  3AEF B;  3DQ0 A;  3NVZ B;  1MOK A;  3EUB 3;  4RQM A;  5FJP A;  3DIP A;  4CF3 A;  2L52 A;  4GMV A;  1NJZ A;  5KFO A;  1PDY A;  1HQR D;  1F52 A;  2KJ9 A;  3N9Y C;  3ZD8 A;  3TX1 A;  1V2Y A;  3DHI C;  4LNN A;  3TWA A;  1QCK A;  2ZG6 A;  2Z0D B;  4UQG A;  3Q8F A;  5AI8 A;  2C3C A;  1KN5 A;  4JK1 A;  3OJ3 A;  1I4H A;  1LGR A;  4FBT A;  3SBF A;  3SV4 A;  4DL4 A;  3KHR A;  2YVF A;  4XDC A;  3VXW A;  3AU6 A;  3U9I A;  4MEY A;  1AHV A;  2HTH A;  2YQE A;  3NZU A;  4ARI A;  2BCS A;  2VH1 A;  3ZJV A;  3GV8 B;  5FS6 A;  4DLE A;  2E6X A;  2P13 A;  3RUL A;  3B0X A;  3M6K A;  4C4R A;  1S9F A;  2O3G A;  3H9D A;  1DK2 A;  1NYQ A;  4DL3 A;  3WK6 A;  3DEQ A;  4ANU A;  3SV3 A;  1H2I A;  3DDM A;  2NQW A;  8ICX A;  4I6P A;  4EYI B;  2IBK A;  3T9L A;  1YT3 A;  4XWW A;  4W9G A;  1GC6 A;  3MDC A;  4KSK C;  5TZV A;  2PLS A;  3AI5 A;  2JPH A;  2KN4 A;  2L0T A;  3OG5 A;  1FFU C;  1ZXI C;  1JRO A;  4K3B A;  3PV1 A;  2HHV A;  1F5S A;  2H3Q A;  2KHV A;  3W5V B;  3CW2 C;  3J81 j;  2MAX A;  4KLQ A;  2K8B A;  5BOM A;  4HPM B;  3DG7 A;  1WXQ A;  2QC8 A;  8ICV A;  4EZ9 A;  4IQV A;  2HBJ A;  2IOH A;  1JWA D;  4F8C B;  1Z5S B;  1IBX B;  4K81 A;  3S1C A;  2C9W B;  2RSU A;  3R0U A;  2F1I A;  2BDU A;  4AUQ C;  2IHN A;  1NK6 A;  2BQR A;  1V49 A;  3MGH A;  4JWU C;  1HXY D;  1SWV A;  4A9A A;  3DHH C;  1ZQW A;  2KVC A;  4KLU A;  1YNT E;  2WS3 B;  2NMQ A;  4A8X C;  2GBK A;  3SEI A;  3C23 A;  2PFO A;  4EWJ A;  1AQ6 A;  3E56 A;  4YXJ A;  1UUP A;  4RMA A;  3M63 B;  5L1J A;  2IY0 B;  2KAC A;  2MJ3 A;  5III A;  2IZV B;  2FCN A;  4K7S A;  2W04 A;  2KTQ A;  1WMH B;  1RQL A;  1Q3V A;  3TEZ A;  2D3B A;  1PVR A;  1IP9 A;  1JDF A;  3DH9 A;  3QE9 Y;  3KD3 A;  1TJE A;  4EMJ A;  3Q3F A;  1MN8 A;  4P4O A;  3TAD C;  2A1J A;  1FFU A;  3RNA C;  3ZDM C;  2RDX A;  1BPE A;  3MTN B;  2MP2 B;  1Y88 A;  2WYQ A;  2ZAD A;  1BPY A;  2FID A;  5CJ7 A;  1V86 A;  1IV8 A;  2I5H A;  4EEY A;  5KG6 A;  5ALU A;  4FZM A;  2LRU A;  2N1V A;  1WSP A;  2MNR A;  5AM3 A;  5ALP A;  3FYH A;  1URJ A;  5G5H B;  2JF5 A;  2VA8 A;  3RNM A;  4OJP A;  1FCL A;  1WGY A;  3RB3 A;  4RQ8 A;  3ES7 A;  5AI4 A;  3H40 A;  4J56 A;  3ZLH A;  2KWU B;  3JW7 A;  2W9B A;  3CST A;  1E6E B;  1RVK A;  4IC9 A;  3QFA A;  2Y5C A;  9ICV A;  2JX5 A;  2KTR A;  4EEK A;  3OTQ A;  3JVA A;  2KFZ A;  3E0F A;  1OQY A;  3KLS X;  3GZN B;  4KKJ A;  1ZOL A;  4LII A;  2DZK A;  2R61 A;  5D3I B;  2LAS A;  3C1Z A;  3VTW A;  1I42 A;  1U9L A;  3D2J A;  2GGI A;  4AWJ A;  5JCM A;  2AXR A;  1P7D A;  2ZTE A;  3OZM A;  3GIM A;  3FYY A;  2O6V D;  1ZQH A;  4W9J A;  1X6J A;  3DDC B;  3VC6 A;  3KBB A;  4MFF A;  3TAD A;  2PTW A;  4ECS A;  3IHP C;  1W1L A;  5IIJ A;  2AWT A;  2JZP A;  3NZG A;  2BVC A;  2KO3 A;  2GGE A;  2WFA A;  2Z7J A;  3UQ0 A;  1OEY J;  3RJF A;  1OGW A;  1U49 A;  3PK7 A;  4TVY A;  1ZYQ A;  2ZIV B;  2ZEQ A;  4HDQ A;  1JCT A;  3EAO A;  4HPP A;  3AEC B;  5HQX A;  4FZL A;  1Z3E B;  1MFW A;  4IQU A;  1TZO A;  2LWP A;  3W1Y A;  2WX1 A;  2XH0 A;  3BJY A;  3VFC A;  4I29 A;  1W1R A;  4PH5 A;  2BWF A;  4G0N B;  5AZH A;  3RZF A;  4B6W A;  5J0Y A;  4GIS A;  4BX9 C;  1TK0 A;  4NEV A;  2DL0 A;  3T8M A;  2MBH A;  3NAS A;  4RQN A;  1EF1 A;  4J3Z A;  4CDG A;  3RAX A;  2FCM A;  3QHT A;  4GFI A;  3PRM B;  1WG8 A;  2XCA A;  3BZK A;  2FCS A;  2J7Q B;  3PG6 A;  4IL2 A;  5J0O A;  3JPR A;  1VRA B;  5AUK A;  1QLT A;  2EQ8 A;  4ACO A;  2KHW B;  1V97 A;  2AH5 A;  2AGP A;  1ZQC A;  4M00 A;  3HW2 A;  3ICX A;  5EWG A;  1VQZ A;  2JMG A;  2QAR A;  3A9J B;  5JRB A;  3U52 E;  1MI0 A;  1ZQE A;  1WUF A;  4IL0 A;  1N5W C;  2ISP A;  3QUB A;  3FV9 A;  4X2P A;  2JH7 A;  3LYY A;  5FXP A;  4J9Q A;  4F7Z A;  2C3D A;  3STP A;  1K1S A;  2ZJ5 A;  5A0L A;  1ZXH A;  4OVU A;  4IWP A;  2ZNV C;  3KYD D;  4ASW C;  3PML A;  4RF0 A;  1GPX A;  3N4E A;  3T4W A;  3I28 A;  2G5H B;  2ZXH A;  3U26 A;  3BW7 A;  2GH5 A;  1HUZ A;  1YIW A;  4I2F A;  4A3P A;  3T6C A;  4JB3 A;  2ATL A;  3Q6J A;  1DZN A;  2RLT A;  1X1M A;  1NHQ A;  3JPO A;  4DWD A;  1YQ3 B;  2P8B A;  1WVF A;  4YFK A;  3FXG A;  2ZPY A;  3W1S C;  5DGA A;  3PO5 A;  4G3X B;  5CHG A;  1JML A;  1MPE A;  2EQY A;  3M9M B;  1X2H A;  4KT2 A;  2VKQ A;  1K4Q A;  4RGO S;  5AZG A;  5ER0 A;  2WDV B;  9ICW A;  2LD9 A;  1L0V B;  1XQQ A;  2GGH A;  4ELV A;  1ZR6 A;  3BS5 B;  1FRD A;  8ICT A;  2NTT A;  4IUM B;  5IIN A;  2PI4 A;  4DXF A;  2F5Z A;  1DGJ A;  4E3C A;  1N5W A;  2FJ6 A;  4RNO A;  3ZXR A;  4ECY A;  2KVR A;  5L6F A;  1TKY A;  3E2E A;  2Y0S C;  2MJE A;  3I6T A;  4DFP A;  4PVE A;  3VA8 A;  4A8E A;  2IND C;  4MAC A;  1KBU A;  1TYP A;  2HOI A;  3THV A;  3VUX A;  2RK5 A;  2DEN B;  4BDP A;  4IZG A;  4ZH4 A;  3TQ1 A;  4QNL A;  2UWQ A;  1SJA A;  2AL2 B;  2L0F A;  2VA3 A;  3CGB A;  2KQ4 X;  2EZZ A;  1KH0 A;  2B6G A;  2MX2 A;  1ZQX A;  3R1Z A;  1SE4 A;  2GWS A;  1Q0W B;  1R7S A;  1RG6 A;  1B4F A;  4C8N A;  3UXK A;  2CPR A;  4OJL A;  5ALS A;  1KLG D;  4H4Z A;  2K8C B;  3IVF A;  1MBT A;  4O3O A;  1F1H A;  1ELS A;  3OAW A;  4IW0 A;  1SWW A;  3ML8 A;  3N6H A;  1L3V A;  4KLI A;  3W2D A;  3LWL A;  4XYC A;  9ICL A;  2K6Q A;  3ZVV A;  2UVR A;  1SKS A;  2G0A A;  4YMM A;  2D3G A;  1ZQS A;  3PRZ A;  4HAI A;  1FM0 D;  3AUL A;  4HYK A;  4BUG A;  1NHP A;  3RB6 A;  5FJR A;  3V6H A;  3ZLG A;  4ED2 A;  4P6V F;  1XLN A;  2L32 A;  5ALZ A;  5CP2 A;  4J6I A;  4IM0 A;  4PS7 A;  4LTU A;  4DQS A;  2BS3 B;  4TUS A;  3V7K A;  1U47 A;  9ICF A;  3KH0 A;  3WAM A;  5J18 A;  2K9X A;  3RH5 A;  1WWV A;  2NPX A;  4QWE A;  3DWM A;  1F0X A;  4TUU A;  2JQR B;  2WXR A;  2JEI A;  5FXE A;  1KD0 A;  3RFA A;  4W9E A;  1SJC A;  3A7U A;  2OOB B;  3PR5 B;  4F91 B;  3SN1 A;  2WXM A;  2KSO B;  2MSN A;  4MEX A;  2BW2 A;  3THU A;  2DF4 B;  3ORY A;  1EU4 A;  3OPS A;  2E8N A;  3KZI U;  4J9M A;  2J6S A;  1KFY B;  2N7E A;  1P0R A;  8ICJ A;  5KG5 A;  2GDQ A;  3BK1 A;  3AQE A;  2AKZ A;  4F92 B;  2KKV A;  5IOI A;  3TAR A;  2K8A A;  4YTP B;  2WF5 A;  5J2D A;  4P16 A;  5DG9 A;  1F3P A;  2H3Z A;  1J19 A;  2UVV A;  2P8C A;  4IR9 A;  2EXR A;  2QIL A;  1TE2 A;  1SL1 A;  3ETR B;  2YVG A;  3UM9 A;  3H8W A;  4C4T A;  1OEY A;  2K39 A;  4QZI A;  1GER A;  4CO7 A;  2FI1 A;  1YD8 U;  3RR7 A;  2BGW A;  1WJU A;  4LA1 A;  2L5Y A;  1KDH A;  1QF6 A;  3WAO A;  3DBR I;  1W1S A;  4WQM A;  2A3V A;  9ICR A;  1R4M I;  4GXB A;  2PU1 A;  1H6V A;  1IUE A;  1N61 C;  5IIM A;  2IA6 A;  1I4P A;  5HI1 A;  1X2I A;  2ZIW A;  4MSM B;  4EM4 A;  4JE3 B;  3B2G A;  4K1R B;  3EEC A;  4I2G A;  1RWS A;  3VC5 A;  3G6Y A;  5MPO A;  1NKB A;  3AE1 B;  2L76 A;  3MC8 A;  3DES A;  2OYY A;  2I9G A;  4R65 A;  3GV5 B;  9ICX A;  5DPT A; 
#chains in the Genus database with same CATH homology
 1JW9 D;  1N60 C;  1SXT A;  2LUM A;  1EWY C;  2WXN A;  3NUH B;  5ADZ A;  2WXO A;  4N59 A;  2LHE A;  2XN9 C;  2PW9 A;  3NS1 A;  1I4Q A;  3AE2 B;  4RNA A;  5BYR A;  1SB3 C;  3FWA A;  1L6V A;  1FMA D;  3GP7 A;  4OVZ A;  3RPF C;  1E10 A;  2ON8 A;  2BT6 A;  2AQ1 B;  1TS3 A;  2BVH A;  2DBY A;  3BVZ A;  1FNW A;  2JYT A;  2KDM A;  3SR6 A;  3AB5 A;  4NJC A;  4PZF A;  1PFD A;  2JXT A;  2BVG A;  1W1M A;  2LHD A;  3P42 A;  1N61 A;  3AEA B;  1HZ5 A;  3S1F A;  3D2D A;  1TKG A;  3AE5 B;  4IOI E;  3AE3 B;  1Q10 A;  1VDV A;  1GB4 A;  3OWE B;  3ZGZ A;  4BC9 A;  1B9R A;  2Y3S A;  2Y3A A;  1STE A;  1V1P A;  2J53 A;  4KGS A;  1Y56 A;  3LAE A;  3P4S B;  1XF5 L;  2QMT A;  5HMR A;  3IT4 B;  3RFZ B;  5E6J A;  2W55 A;  4JPS A;  4US9 A;  1D5X C;  2X38 A;  1E8F A;  4ML8 A;  4C56 C;  4BBY A;  1N60 A;  2G1E A;  5JXV A;  1I19 A;  2V4I B;  1IGC A;  1E8G A;  3NVZ A;  4AS1 A;  1TS2 A;  2DLB A;  2WXQ A;  1CK1 A;  3EA6 A;  2SAK A;  1RM6 B;  1YN4 A;  3BK2 A;  2Y4G A;  4EE2 A;  5BMH A;  3SFE B;  2BS4 B;  1OFF A;  4C7Y A;  1YN3 A;  2LJI A;  4PT5 A;  4HKZ E;  2PLP A;  4XWT A;  2N9L A;  5HFY A;  3ABV B;  3UI3 A;  1L6U A;  3A7A A;  1WRI A;  3EGR A;  1V8C A;  3NVY B;  3U2S C;  2LGI A;  1TKE A;  1SF0 A;  4OHJ A;  1DII A;  1VR9 A;  5LNK 1;  4C80 A;  1XXG A;  3CWI A;  1NYR A;  3TSH A;  1BXT A;  2WP9 B;  1I4G A;  1K50 A;  5GXG B;  3AN1 A;  1J7C A;  2H89 B;  3HVD A;  4OZA A;  1DOX A;  1VAO A;  2OAI A;  3NVV A;  5FK9 C;  4EC3 A;  1UWX A;  2P3H A;  3RJA A;  5H92 C;  3POP A;  1AW7 A;  4LLG M;  2ACZ B;  3AEE B;  1GAQ B;  1LO5 D;  1QOG A;  1RYJ A;  1EU3 A;  3D2H A;  3AE8 B;  1SBB B;  2G9H D;  4WIP A;  5BYS A;  2ONQ A;  3C8Y A;  1VZ7 A;  4FXC A;  1SE2 A;  4LK0 M;  3IXS A;  5D3D A;  2PVO D;  1IBX A;  5G5G B;  1K51 A;  1C4C A;  1D4B A;  1WVE A;  4N58 A;  1AYF A;  2CU3 A;  1N62 C;  1AWD A;  2PTL A;  2E3T A;  1SJH D;  1E9M A;  2AX5 A;  4RGT A;  4UDU C;  4USA A;  1SEB D;  1DOI A;  1JWS D;  1CJE A;  3U4E G;  2GRI A;  4HKQ A;  4ZOH B;  1MHH E;  5D7G A;  5HHD G;  1ZXI A;  1KTK A;  3R8B A;  4CQN A;  2VZK B;  2J52 A;  1L0Y B;  1VJK A;  3P4P B;  1AHU A;  1FRR A;  5C2T B;  1ZDX A;  4PVK A;  2W82 A;  1GB1 A;  3O13 A;  3TSJ A;  1ZE3 D;  3AH7 A;  2Y5P A;  4WH4 A;  3WCQ A;  1XEE A;  1FXI A;  2WQY B;  2AQ2 B;  1JQ4 A;  2R2Z A;  2VFU A;  1J7A A;  1JAL A;  2M56 B;  1ACC A;  4HEA 1;  4Q2J A;  5FKA C;  1HA5 A;  3Q8A A;  5G5H A;  1N62 A;  3R2I A;  3IT6 B;  3AV8 A;  5FXF A;  5TSS A;  2J42 A;  2WXH A;  4RGM A;  3V05 A;  2VZK D;  3T3N A;  3I99 A;  2PKO A;  2YEP F;  1JCK B;  1SE3 A;  3BVG A;  2HTM E;  1FFV C;  3NS1 B;  4UD8 A;  4NAW B;  4MT5 A;  1BML C;  3I57 A;  1QKZ A;  3BVM A;  1WWT A;  3FW9 A;  3GB1 A;  3B9J A;  4WWM A;  4IKG A;  3AE7 B;  4XDD A;  2FBW B;  2LEK A;  1SIJ A;  5BYQ A;  3SR6 B;  3I9V 1;  1PUT A;  4NZL B;  2JU6 X;  2V0G A;  1UGJ A;  2RMM A;  2R8D A;  4YT0 B;  1BUI C;  4HRS A;  4A55 A;  1QLU A;  1OQQ A;  2IPI A;  1YJJ A;  1V1P B;  2BBC A;  1RFK A;  1E0Y A;  1UWM A;  1MBB A;  3GS2 A;  2I38 A;  3W8Z A;  1K52 A;  3CIR B;  3J9C A;  4TQ1 A;  5HG2 A;  4B0M A;  4ITK A;  4PVH A;  2WNM A;  4XLO A;  3FIL A;  4RFB A;  1E8H A;  4ZHO A;  3BII D;  3AEF B;  3DQ0 A;  3NVZ B;  1FFV A;  3EUB 3;  3HVZ A;  2B76 B;  2BB6 A;  4BC7 A;  2L52 A;  2N0S B;  1YN5 A;  1SB3 B;  3NRZ A;  3B2F A;  1HQR D;  3BYY B;  2JWU A;  2OHF A;  3N9Y C;  4N6E B;  3TEW A;  3TX1 A;  1PDX A;  2BB5 A;  4O1N A;  2IGD A;  3Q8F A;  1QOA A;  1QQR A;  4TVW A;  1KF6 B;  3HRD D;  4OZB A;  5AUI A;  3L4P A;  1I4H A;  2MH7 A;  4HRO A;  1ET9 A;  2IPK D;  3AED B;  3AE9 B;  4XDC A;  4J3O D;  1AHV A;  4GDL B;  2UUU A;  3R2T A;  4B0E A;  4ARI A;  1NEK B;  2YVS A;  1T6B X;  1JWB D;  2H88 B;  3ZJV A;  1E7P B;  1P7F A;  1F0Z A;  2E6X A;  2P13 A;  2ZW1 A;  2O3G A;  1PGA A;  4YSZ B;  1NYQ A;  4ZYS A;  3A7R A;  3PZ7 A;  3PO0 A;  2NQW A;  2KAJ A;  4H2A A;  3VRA B;  5I1W A;  4PVJ A;  4XWW A;  4YXD B;  1MHX A;  2PLS A;  1T3Q C;  2INP E;  2KN4 A;  1FFU C;  1TYG B;  2SEB D;  3MC0 B;  1ZXI C;  1ROE A;  1WGK A;  1JRO A;  1FO4 A;  2IJ0 A;  3AE6 B;  3LXF A;  5I1V A;  3W5V B;  3U7Z A;  2PLI A;  1C4A A;  1QLB B;  2GI9 A;  2FUG 1;  5AE3 A;  1WXQ A;  2K5P A;  1JWA D;  1IBX B;  1UXY A;  1EWC A;  4RGN A;  3S1C A;  4MH8 A;  4US8 A;  1DYQ A;  1HZ6 A;  2VFT A;  1ENF A;  1M4V A;  4JWU C;  1F77 A;  1HXY D;  4D2K A;  2Q85 A;  4A9A A;  3W8X A;  1YNT E;  2WS3 B;  1VLB A;  2NMQ A;  5I4D A;  4A8X C;  2QPM A;  1I7H A;  3W1S A;  4OAL A;  1XLO A;  2RPV A;  3E56 A;  3NVY A;  2P4P A;  1UUP A;  4RH6 A;  1XLP A;  2K0P A;  3EUB 2;  2KAC A;  2MJ3 A;  2Y08 A;  1XCQ L;  1XO3 A;  1D6E C;  3TEZ A;  2M0A A;  5L6G A;  2VFV A;  2INN E;  1TJE A;  4KKI A;  3TEX A;  4JB1 A;  2WDW A;  1T3Q A;  2WXK A;  1ZUD 2;  2MEK A;  2V3P A;  1FIQ A;  1FFU A;  2DYM A;  4OZC A;  1C77 A;  1L0X B;  4GLS C;  4ZHP A;  4JX1 C;  5EE9 A;  5EE1 A;  3V3X A;  2TSS A;  1MVK A;  1T5X D;  3VTE A;  5K8E A;  5D79 A;  5BMI A;  1KLU D;  1WSP A;  4JWS C;  2V3N A;  5G5H B;  4L1B A;  1FCL A;  3TEY A;  2J4X A;  3ZJU A;  3DWG C;  3P4Q B;  1E6E B;  1C76 A;  2L1A A;  2Y5C A;  4TQ0 A;  2JX5 A;  3SEB A;  4HG0 A;  3KLS X;  3KJM A;  4KKJ A;  3P4R B;  3IAM 1;  5T8I A;  2R61 A;  4XE0 A;  5D3I B;  2BYT A;  4WUR A;  3S1D A;  1C79 A;  3D2J A;  4JAY A;  2N7J A;  4ZRQ A;  4TMA B;  1E0Z A;  1FEH A;  2AXR A;  3B9J B;  5AE2 A;  1UNS A;  4REZ A;  1QT9 A;  3NVW A;  1W1L A;  1DIQ A;  2JZP A;  3AM9 A;  1SJE D;  3LB8 C;  4DQO C;  4KGR A;  4TVY A;  4OW0 A;  1P7E A;  4MLA A;  1YQ4 B;  5FR3 A;  1OQR A;  3AEC B;  3Q8C A;  5HQX A;  3ETR A;  2K22 A;  3KWV A;  1I4X A;  1TZO A;  2OED A;  3MP9 A;  2PIA A;  2NTS A;  3Q69 A;  4YWG G;  3VRB B;  3ZQ4 A;  4DXG A;  2I0K A;  2PMV A;  1N63 C;  3FIL B;  5C3J B;  4YSY B;  1W1R A;  3PM9 A;  3MHZ A;  3KWL A;  3GSY A;  1WYG A;  2ICI A;  4PYT A;  5AE1 A;  4NAM A;  2GQU A;  4C7Z A;  3NRZ B;  2HDE A;  2EKI A;  1FNU A;  2I2Y A;  2VAO A;  3ZYY X;  1VRA B;  2FE8 A;  4ZRP A;  5AUK A;  1QLT A;  2XNA C;  3TSS A;  1V97 A;  1X2G A;  1C4P A;  1ZOY B;  2WXJ A;  1PGX A;  1VQZ A;  1AN8 A;  3U52 E;  2W3S A;  1MI0 A;  3TUO A;  1N5W C;  1B1Z A;  1IGD A;  1NVI D;  1YMH E;  3HUI A;  4MM3 B;  3LYY A;  1F2R C;  4A90 A;  5FXP A;  3FAH A;  2UUV A;  1XLQ A;  1KRH A;  1L5P A;  1ZXH A;  1QIL A;  2IGG A;  1ZPS A;  1VZ6 A;  1YJI A;  4BCA A;  4KX6 B;  2DWQ A;  2D5G A;  2W3R A;  4RF0 A;  1GPX A;  3URY A;  3W9C B;  1W1J A;  1RM6 C;  3BW7 A;  1N63 A;  3W8W A;  2Z8L A;  2WU5 B;  3NZ3 A;  3DED A;  4PWC A;  4IDI A;  1DZN A;  2W54 A;  1YQ3 B;  2IDY A;  1WVF A;  1FD6 A;  1JML A;  2AQ3 B;  3NVV B;  1MPE A;  1X2H A;  1SSN A;  4RGO S;  2WDV B;  3W5U B;  1W1K A;  1L0V B;  3BWU D;  2GQT A;  5HHZ A;  4RF1 A;  1ZR6 A;  1N5X A;  1FRD A;  2QJL A;  2NTT A;  4DXF A;  1QOB A;  1DGJ A;  1VZ8 A;  2VFR A;  1N5W A;  1W1O A;  1I4R A;  1TS5 A;  2N9K A;  2E5A A;  2K3U A;  2MBR A;  1TKY A;  4A6Q A;  5L6F A;  1D5M C;  2MJE A;  3FC4 A;  4GDK B;  4PVE A;  4MAC A;  2LFI A;  1W1Q A;  2KMM A;  2BVF A;  2RK5 A;  3Q8E A;  1F2R I;  3PZ8 A;  3FW8 A;  3E9S A;  2QSD A;  2RDH A;  4L23 A;  1JWU D;  2DYO A;  1J7B A;  2KQ4 X;  1KH0 A;  3P63 A;  3IAS 1;  1TY2 A;  2KWD A;  2WLB A;  1SE4 A;  2ZW0 A;  1R7S A;  1ZDV A;  4TSS A;  1GOZ A;  2WXP A;  5FXD A;  3VR9 B;  1KLG D;  1JWM D;  1C9F A;  1FIQ B;  1MBT A;  2MJD A;  3JS8 A;  2M19 A;  3HSU A;  4DNS A;  3MFG A;  2Q4W A;  3AMZ A;  5H8Y E;  3W2D A;  1TY0 A;  3BYT B;  1XCT L;  4L2Y A;  4ZOH C;  2BS2 B;  1CQV A;  3R07 C;  4PWB A;  4HJG E;  1FM0 D;  1TS4 A;  3RJ8 A;  1FXA A;  1ESF A;  2RDG A;  2IGH A;  1NI3 A;  4P6V F;  1XLN A;  2L32 A;  1EM7 A;  3SFD B;  4LTU A;  3C0P A;  2BS3 B;  1ET6 A;  2WXF A;  3VR8 B;  2K9X A;  3Q8B A;  5EE0 A;  2LMC A;  3DWM A;  4KGT A;  1F0X A;  2JQR B;  2WXL A;  2WXR A;  4YSX B;  5FXE A;  3A7U A;  1D5Z C;  1V1O A;  1QOF A;  1JRP A;  2WXM A;  4YTN B;  4R3D A;  3T3O A;  2JYE A;  2BW2 A;  5G5G A;  1EU4 A;  3S1E A;  2QKN A;  1C78 A;  3NVW B;  3KQ4 A;  1A70 A;  1KFY B;  1PYW D;  2WXI A;  3BK1 A;  3FW7 A;  2QEJ C;  2Y3R A;  4YTP B;  3AE4 B;  1DOY A;  2YEP B;  1L4Z B;  3AEG B;  4P16 A;  4WAF A;  5BMG A;  1NEN B;  2EXR A;  2QIL A;  3ETR B;  4O95 A;  5AWV A;  1L4D B;  2L83 A;  2Q5W D;  4M0W A;  1K53 A;  1AHZ A;  2JSV X;  3PQB A;  1FCC C;  1CZP A;  2WXG A;  2QIE B;  2WDR B;  1QF6 A;  3VQI A;  1HEZ E;  4RCO A;  2GB1 A;  4WQM A;  1W1S A;  5EE3 A;  1FNV A;  2WU2 B;  3H8H A;  2WDQ B;  4YTM B;  3ZJT A;  1IUE A;  1N61 C;  1I4P A;  3MJ5 A;  5HI1 A;  4JE3 B;  1HSK A;  3BZD B;  3B2G A;  2CJN A;  2CJO A;  2PVG C;  3HRD C;  3LLB A;  1RWS A;  3P1M A;  5MPO A;  2VFS A;  3AE1 B;  2BTE A;  4AQ7 A;  3AEB B;  4ARC A;  1ZP0 B;  2EEL A;  1PGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...