2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
4KX6B 3L4PA 2K9XA 3W5VB 1N5XA 1KFYB 3HRDC 3WCQA 3P4PB 5AE1A 3LXFA 2MJ3A 1XLQA 1L5PA 3JS8A 2QPMA 1TKEA 1E10A 1JALA 3NVZB 4YTNB 3A7AA 1L0VB 5EE9A 1WGKA 2O3GA 2KMMA 3NVYA 5AE2A 3NVVA 3HVZA 1X2GA 2WLBA 1XO3A 1VAOA 3SFEB 1SB3C 3S1FA 1V8CA 3NVZA 2R8DA 1J7AA 3AE4B 4TVWA 3P63A 2EXRA 2OHFA 4C7YA 2BVFA 4HROA 5C2TB 1PFDA 1SIJA 3D2HA 2E5AA 5G5HB 4MLAA 3DEDA 1N60A 4JWUC 1QOBA 3NRZB 5HMRA 1ZXIA 4N58A 2WDRB 2JX5A 1FFUC 1WVEA 1E0YA 1PDXA 3D2JA 3EUB3 2PLSA 1N63C 1ZOYB 3DWMA 3AEAB 4FXCA 3NRZA 1FIQB 2Y5CA 3LB8C 4PWCA 4YSXB 1L6VA 1T3QA 1YQ4B 1VQZA 5GXGB 1F0XA 3FWAA 2MJDA 2CU3A 1W1LA 3AE3B 1V97A 3FC4A 1FIQA 1L6UA 2W55A 1TKGA 3EUB2 3AE1B 3BIID 1ZR6A 3FAHA 2BVHA 4US9A 1QOGA 2WDVB 5FXEA 2Q5WD 1DGJA 2P3HA 2DWQA 3RPFC 1MBTA 2E3TA 1XLPA 2WP9B 3CWIA 2BS2B 3SR6B 2N0SB 3FW8A 4OALA 1E8HA 2B76B 4O95A 1QLTA 1AHVA 3A7RA 3NVVB 1I7HA 3W8XA 3S1EA 2AXRA 4USAA 3TSJA 5ADZA 4YSZB 1JQ4A 2H88B 3DWGC 1AHUA 1N61A 1E8GA 3VRBB 4JWSC 2MBRA 1F0ZA 3SR6A 2ACZB 4PVKA 5AUIA 1QT9A 4A9AA 1WYGA 1FXAA 2VAOA 1R7SA 1JRPA 5EE0A 1YJJA 2R2ZA 4JX1C 5HHZA 4ZOHC 2GQUA 3AE6B 1NEKB 1TYGB 2BT6A 3PO0A 5FXPA 2L83A 1B9RA 1A70A 2AX5A 3PM9A 3B9JB 1WWTA 4TVYA 1J7CA 2DBYA 4HG0A 1W1JA 2L52A 3P4QB 2HTME 3A7UA 4PVJA 1GAQB 1FFVC 1N5WA 1NENB 4WQMA 2OAIA 2WU2B 3B2FA 1FM0D 3AEBB 3B9JA 2M19A 2PKOA 1OQQA 5H92C 1N62C 1SB3B 5D79A 4ML8A 4PWBA 2JQRB 3AN1A 3P1MA 2VFVA 1TJEA 2FBWB 3AE5B 3S1CA 1E0ZA 1VLBA 2PVOD 4YTMB 1I19A 3FW7A 4PVEA 4PYTA 3VTEA 2PIAA 3C0PA 2QKNA 4DNSA 4BC7A 1DIIA 2VFUA 1E6EB 4ITKA 4BCAA 1NVID 3W5UB 5FXFA 1W1KA 5G5GB 2LEKA 1DOYA 1EWYC 1RYJA 5MPOA 5AE3A 1QOAA 2BS3B 1JWAD 4P6VF 4C7ZA 1JROA 1W1RA 1FRRA 2I0KA 1FFUA 1N60C 1ZP0B 1J7BA 3BW7A 1WRIA 1W1QA 5G5GA 1ZXIC 1N63A 3TX1A 3D2DA 3W8ZA 1DZNA 2CJNA 3ABVB 2RK5A 2W3SA 1QF6A 2K22A 1UWMA 1YQ3B 2BS4B 3CIRB 2KAJA 1E7PB 1E8FA 1OFFA 2EKIA 2M56B 4PZFA 2G1EA 3AECB 2K5PA 1RM6B 4US8A 1GPXA 1W1SA 1W1OA 3NVWB 3P4RB 4HRSA 4EC3A 1KF6B 1T3QC 3AEEB 3DQ0A 2WU5B 2VFSA 3S1DA 3AEDB 2P4PA 2MJEA 1AWDA 1AHZA 5H8YE 3AEFB 2MH7A 1JWBD 2VFTA 3AE2B 1AYFA 4JAYA 3NVWA 1CZPA 3AV8A 3LAEA 4ZHPA 2Q4WA 3I99A 1FXIA 3W8WA 1SF0A 3AM9A 1DIQA 2Q85A 3AE7B 2CJOA 4WWMA 4ZHOA 2QIEB 3AE9B 5HQXA 1W1MA 3TSHA 1QLBB 2NQWA 2BVGA 3R07C 1ROEA 2GQTA 3ZYYX 3GSYA 1FRDA 2H89B 1XLNA 1VDVA 3ETRB 3AB5A 4ZOHB 2YVSA 3FW9A 3P4SB 1DOIA 4C80A 4LTUA 1PUTA 1MBBA 1OQRA 1XLOA 3KWLA 5G5HA 5AUKA 1X2HA 4N6EB 1N61C 2W54A 2QJLA 1QOFA 4IDIA 1IUEA 1NYQA 1RFKA 3B2GA 3NS1B 3ETRA 1TKYA 1QLUA 1KRHA 3KJMA 4JB1A 1E9MA 3AEGB 1WVFA 4YTPB 1NYRA 5EE3A 4UD8A 3AE8B 4YT0B 3W9CB 5FXDA 1YJIA 3SFDB 1DOXA 1VJKA 3HRDD 4BBYA 2VFRA 3VR8B 3HUIA 4YSYB 1HSKA 4PVHA 3NS1A 1FMAD 1NI3A 4N59A 2PLIA 4XLOA 4YXDB 5C3JB 1ZUD2 1RM6C 2W3RA 1WXQA 2WQYB 1FFVA 2P13A 2PVGC 2WDQB 3AMZA 1RWSA 3VRAB 5EE1A 2WS3B 4BC9A 1JW9D 1FO4A 3VR9B 1UXYA 3LLBA 1N5WC 1N62A 3AH7A 1CJEA 3NVYB
chains in the Genus database with same CATH superfamily
2ASDA 3GZNI 3UGBB 3V62A 3HRDC 3FM9A 3T3OA 3HM6X 3LXFA 2XIDA 5L1KA 4W9FA 1RQNA 1WG8A 3DBLB 1L5PA 2KX3A 3BYYB 4GDKA 1GESA 2CHRA 4HCDA 1WR6E 5FJUA 2C22A 1JN3A 5J2IA 4TQ1A 1TKEA 3DHGC 3M63B 3WKAA 1U48A 3SD7A 4MH8A 3TEYA 5LXHA 3D46A 1KKRA 2FPLA 4UB5A 2WXJA 3CB3A 2VJ4A 3PR4A 1C4AA 4OCZA 4LIIA 4FE3A 2EQ6A 2KDMA 3ETLA 5KT4A 2V4QA 1QLNA 4AJYB 1ZW7A 2KDFB 2XI9A 1BT0A 2RP5A 5AK4A 5CWRA 2WLBA 1Z00B 2PI4A 5CX3A 4BAXA 1JOAA 5KFIA 4Z6EA 5CA7A 3G6VA 1SKRA 1QQRA 2L1AA 1GB4A 4GC7A 3H8SA 4BOSC 4AS1A 1ZD5A 3KUZA 4RPZA 2JZ3B 2KKPA 2K3UA 2LJIA 1L0XB 3R9KA 1X9SA 4GXJA 1NJXA 3V6KA 3T3NA 2HMXA 3HP6A 5J0UA 3DH9A 2KD0A 5JU5A 3V61A 4DDGD 2FLLA 3Q8BA 2PU0A 4FDCB 4QZDA 1SSNA 5AZGA 3FVDA 3JPQA 2NR2A 4C7YA 4HROA 3N7SC 2G06A 2BCRA 4KLMA 1Z00A 4JWMA 1PFDA 1SIJA 1EUVB 1XEEA 1UBIA 3I9V1 2WXQA 3NG0A 4DDID 4MLAA 2E5AA 3RF9A 1F2RC 4JWUC 3DEDA 3ECIA 1UHUA 1UQVA 4UAVA 2CPRA 5HMRA 4BFRA 5TZVA 3OHAA 2YMPA 3TANA 2XEWA 1UA0A 2JX5A 3L17A 2C2EA 2OH2A 2L0TA 2N9PC 3E9SA 3JVZX 5G2NA 2YTUA 3VVWB 4YWSA 3GD4A 2H3QA 2MWSB 4NAWB 2KNBA 5I4DA 5KFKA 4DFKA 4H2AA 3IP4B 8ICVA 2P0IA 2PLSA 2DUYA 2IGDA 1E9IA 1OXJA 2MUCA 3POPA 3PX0A 4YFKA 7ICRA 3UXOA 4HEA1 3TFRA 2EELA 2F44A 1X2IA 1X9XA 4F5PA 4H4WA 1FIQB 4BKGA 1EXNA 2Y5CA 1D7YA 4RNMA 3P2BA 4MM3B 3R25A 2LXAA 3BDPA 2IBIB 3JSVB 2R8HA 2H3IA 1JXEA 2W03A 3TACB 1Z1BA 4PL2A 3M6ZA 4R8UB 3BK1A 2KIWA 2VH2A 2WXOA 8ICLA 4KT2A 4LNOA 1VQZA 5FKAC 2CHXA 4BX9C 4U6PA 3KQ4A 4NAWA 4PYUA 2NV3A 5HMMA 4EZ6A 1W1LA 3UQ2A 2ESEA 2LI5A 3N32A 4FP1A 4GMEA 7ENLA 3ZKJC 2D3DA 2PFOA 1V97A 3N1YC 1H2IA 4F4RA 1XS2A 1WJ6A 3L08A 1FIQA 2X8XX 4GGQA 2W55A 4MM3A 3L5KA 3ZXRA 2KFZA 3AE1B 9ICGA 2ZNVB 2ZZCA 5KFJA 1SE4A 4P16A 1ZQIA 3H7VA 1L5UA 3E58A 5IDZA 2NO4A 2KYWA 3ZUNA 8ICOA 3MUCA 2EANA 4R8UA 3GZFA 3MHZA 2YMMA 3MFHA 3RH5A 3T5KA 3QYPA 1DXSA 1SZPA 2BWFA 3DEQA 3IJLA 1IYFA 2QLTA 4AYBC 1DGJA 2XCPA 1J2MA 3PZDA 2ZTEA 1XSLA 1BPYA 5J8YC 3WK8A 3PZ8A 5KFLA 1GRGA 1BPXA 4XUSA 3THVA 2CRXA 1D8LA 3QUCA 3TQ1A 3NASA 3Q4DA 4EMWA 3CGBA 4ECVA 3TADA 4XA5A 2XY5A 4A90A 5JHAA 1LPFA 4PPXA 3SEBA 1SKWA 1E90A 1A5RA 2LYHA 2JZBB 4YD2A 1ZD4A 3CRXA 2N0SB 8ICXA 5KFPA 1TE6A 2FDRA 4RUCA 3P93A 4H4PA 4Z1YA 2IO0B 4QW8A 2PE6B 2F5ZA 3R11A 4ELTA 2OJRA 4O95A 1FEZA 4Y2VA 1QLTA 3ZVVA 2V3BA 1R6WA 4LNIA 1ZDLA 1ZDXA 4UW9A 2HBKA 1ZQAA 1MSWD 2C2RA 2AXRA 3KYCD 2E5SA 4PS3A 2H88B 4RQ4A 3DWGC 1PK1A 1QQ7A 4ECSA 2XICA 2R8IA 5K8EA 4F1SA 8ICRA 2D8CA 3VRBB 4JWSC 5J0QA 4YMOA 1ZQOA 1F0ZA 1XPYA 3VAWA 2FIFA 3ZO5B 1SJDA 3N3KB 3DDHA 1QT9A 1WYGA 4A9AA 1KN0A 1FXAA 3ZDCA 3FV9A 4JB3A 2WP6A 3JW7A 1I4XA 2JU6X 3NS8A 3QUTA 1GXFA 5L95C 3GE3C 3TJPA 3TJ4A 4TUSA 2YAUA 8ICHA 1JRPA 4B0MA 3MC9A 4O3PA 1WE6A 4JX1C 5AWVA 2OOBB 2HSZA 3KD3A 2PPHA 3K9OB 3R2TA 4PL1A 4IM0A 2GGEA 4ZCWA 2KQ7A 2YB1A 4QIWF 1RRBA 2HHQA 2DF4B 4RM9A 2A3VA 4PZNA 1IM4A 1WE7A 2IJ0A 2KOXA 1T94A 2KFNA 3BVGA 2KWVB 3DVNV 4EMJA 2XNAC 2L83A 2DHZA 1URJA 2ZIVB 3EPIA 2P6UA 2K8CB 2LVOA 4II3B 2PMZC 3VCCA 9ICMA 2IYDB 4UAZA 4GXIA 3B9JB 4RM8A 4ACOA 2A8XA 3DBRI 2BDPA 4I2JA 1H38A 2F3NA 4UB2A 4IWOA 3VUXA 2ATLA 2ZZBA 2DBYA 4ZRJA 3DK9A 4EX6A 3M62B 5IO9A 5U1OA 3T5JA 3N4MB 2EZZA 2OEDA 3P4QB 4RF1A 3TCAA 3PK7A 4PVJA 2BR0A 3TSSA 5G5HB 5KFEA 2HW3A 1E5WA 2C9WB 3EF6A 4AQ7A 2ZIVA 4ECTA 2K4PA 1FECA 5IIJA 4M9LA 1L3VA 3SAFA 4FN2A 2JEFA 4M0XA 5J2GA 2WXRA 1FM0D 3RJJA 3B9JA 7ICFA 4M8MA 1FD6A 2AL3A 4WJNA 2IBKA 1PGXA 4IW0A 3DGZA 3WK9A 2HOFA 2MHJA 5KFXA 5HHDG 3TTEA 3OGUA 2LVPA 4MFCA 3B08A 3I3TB 3Q8FA 4G7FA 3ISDA 4IG7B 1DRGA 4DHZE 4NJ6A 2RPVA 1CRXA 2C7NB 2WXGA 1N62C 4P1CC 3Q2AC 2Y08A 1SB3B 2L5YA 3RITA 3AUOA 1FNVA 2IY1B 5HI1A 1ZK7A 1S3SG 3RCYA 4PWBA 3G6XA 2C28A 2KDEB 1ZRMA 3HKZF 4CF3A 1WMHB 3RR7A 3NRWA 1N48A 1F1HA 4M0WB 4EM3A 1C4PA 4GFIA 3PX4A 2FBWB 1JIHA 5IIOA 3M7DA 2RDXA 3DFHA 2PVOD 2KTFA 1JDFA 5B66U 1SEBD 1SWWA 2K8BB 2XGQA 2BKEA 2EAMA 7ICVA 2PIAA 2J6TA 1C79A 2K8HA 3MKCA 3CXBA 4DNSA 3Q8KA 1WH3A 1T3NA 2P8BA 1I35A 4TURA 2LGXA 4LLGM 2FPMA 4I2GA 2WXLA 2BQQA 4M0WA 2MSED 8ICKA 3W5UB 1T0YA 4KV2A 4TMAB 3VTWA 4UB8U 1ZYQA 3WAOA 2KMCA 1X42A 2KDBA 1SL0A 2BPGA 4RQ1A 1L7OA 3U52E 4NLKA 2K8BA 2KOBA 3KLJA 2PW9A 4IM3A 3NFUA 4IUMB 9ICHA 5ALUA 2DPJA 4RQ8A 1SJED 2KWDA 1JXLA 5AE3A 3FCPA 1TS2A 1KSPA 3LDZE 4MT5A 4BKSA 2JGAA 1FHVA 2X38A 5IIMA 2UUVA 1BXTA 5KFUA 3ENLA 3BWUD 1JROA 2WXPA 4W9CA 5BO4B 3EJDB 1BGXT 1NK8A 4GYPC 1NJYA 1AROP 3KLSX 1FFUA 2NRXA 1NKCA 3OJ3A 3GIJA 1J7BA 2WGSA 4RGMA 2FAZA 3SJNA 1XANA 3UXPA 1JMLA 3SI8A 1Q1WA 1QH9A 1Z4OA 4LZGA 4EQSA 1SXEA 3PREA 2VJ5A 3AL0B 3D2DA 4KLDA 1Y8RC 3QJZA 2M9NA 2RHFA 4C4SA 4CE6A 1DZNA 2IO1B 2CJNA 4BUGA 3GS2A 2M0AA 4UASA 4IHCA 1E7UA 3U2SC 2ICIA 2PGEA 4NV0A 1UWMA 1Z5SB 2BS4B 3CIRB 2I9GA 4K1RB 3KBBA 2UU7A 3SV3A 1B0XA 3EGRA 2QVHA 2NRWA 4E0DA 2V4LA 2MRLA 3Q14C 3Q8AA 4B9KA 4K4IA 1NK0A 3RH4A 4US8A 1NJWA 4UB3A 3BJYA 1ZKHA 1W1SA 4RZRA 4M52A 1KJTA 3R10A 4ACFA 1K5OA 4YMMA 3LXDA 4DF4A 4F8CB 4J9KA 5AKKA 4MFAA 3NY5A 3DESA 4MSMB 3DQ0A 1KQQA 2WU5B 1QILA 1WX7A 2WB1F 2D10A 2P4PA 3IVFA 1AWDA 4R64A 2LM4A 4DF8A 1NNLA 3I28A 3LVVA 3C23A 4KLTA 5H8YE 2W8LA 3KVFB 2VA8A 4Y2UA 1R4NB 2GMIC 1RPLA 2EMTA 4KVGB 1MG4A 4XE0A 3Q6BA 3IBEA 2MA9B 2L76A 7ICPA 3W8WA 4GIBA 1SF0A 3MTNB 1DIQA 2Q85A 4KDIC 2ZUCA 3JPSA 5G55A 1B43A 1X1MA 2HHUA 2V4IB 2G08A 4DSLA 2WBAA 5HFYA 3GDXA 2VZKB 5KG3A 2PA6A 4R65A 4S0RA 4IOIE 5HQXA 1TK0A 3BQ7A 5FMHA 5BOFA 1QLBB 2OLAA 2NQWA 4P2HA 2LYAA 1ECQA 2ZNVC 2F1IA 3UCDA 4P7IA 1T0RC 1EM7A 3GRTA 3QPEA 2L8JA 1ZQTA 4A20A 2OPJA 3RBDA 2EAPA 3TADC 2KFJA 4F93B 5ALYA 4IRKA 5E6NA 2E1FA 4RQMA 3M3JA 4PZOA 1FHUA 1VDVA 1ZD3A 4ED1A 3RNEC 1P48A 1ZQVA 2YB4A 3FDSA 1ET6A 5AKZA 3M8SA 2FIDA 3A9KB 1S0MA 3AB5A 2AL1A 4ZOHB 1X6JA 3VC5A 1GUAB 2LUMA 1W6TA 4NQKE 3MQTA 3FW9A 3QIJA 2G4SA 1K51A 3VHTC 4C80A 1WY8A 3NZ3A 4LTUA 2LHEA 2QAEA 2HE7A 1H4RA 5KFTA 5JRTA 4BOZB 1MBBA 1X40A 1OQRA 1L3SA 3KWLA 4HCHA 3MC1A 1I4QA 1EC8A 4CQNA 1GB1A 2D3BA 2HJ1A 1BNPA 5J17A 4OJ6A 2CHWA 2QJLA 4K8GA 3L54A 2ALZA 1KM7A 1MHHE 3CGEA 2OQYA 3MP9A 2YX8A 2MUTA 4MGIE 1T8EA 5JCNA 1N6ZA 2ZCBA 3ZDTA 1QLUA 1KRHA 3Q3MC 3CW2C 3JPTA 1NZBA 4C8LA 3B1LX 5HR7A 2YQUA 4JQWC 4I2FA 3SEIA 5AKEA 4B9LA 1NYRA 4RT3A 4XRHA 2W9CB 9ICTA 1XCQL 9ICUA 3BY4B 3ZDDA 2R18A 2QJJA 3OJSA 3SFDB 2IGHA 2A19A 4DL7A 4MFFA 3DBHB 3N20C 4RH6A 2YVGA 2B0CA 3T5HA 1TFRA 5KG1A 5DDMA 3PNCA 5HP4A 4KLFA 1YX6B 3HUIA 1ZRNA 1S76D 3OTRA 2J6UA 4CNQA 4E4FA 2OVLA 1R4MB 3KH0A 5BOLA 1NI3A 4F4ZA 2QMTA 2PLIA 1IIPA 4MSQB 4Q45A 4O3RA 1ZUD2 5AI5A 2W3RA 4IM2A 2HNEA 1BPDA 2WPFA 1QKZA 4NZLB 3LWMA 1C77A 2WXKA 1FFVA 3C29A 2W9CA 4IQTA 3CSFA 2FLNA 2G0AA 4B9NA 1RWSA 4A8XC 2XH2A 3QN3A 2JMGA 3NUQA 5KFWA 5IINA 2QKQA 3H7PB 5EE1A 1JW9D 4M00A 1FO4A 4JPSA 4DL6A 2RD0A 3JW0X 4M6WB 1UXYA 1DTNA 5IOIA 5KG0A 4RQNA 4J9MA 1EBDA 2EQ9A 2G9HD 3LLBA 2G5IB 3APDA 4KEMA 1UNSA 5EBKA 3IFWB 2ZVOA 4MEMA 1WRDB 3QKEA 3OP2A 5HMLA 3T5LA 4TUQA 2BHNA 4DL5A 1AN8A 3AULA 1BNOA 4WWPA 3HW8A 2YY6A 3IV6A 5KFDA 2KHVA 4UAYA 3HX0A 4FZMA 1NK9A 3PW7A 3VDZA 2KKVA 2NVKX 3L16A 2ZTDA 3L4PA 2K9XA 1BPZA 4IL6U 4MGKE 1KFYB 4PS8A 3SD5A 3X0WA 4BVUC 5AE1A 3H7PA 4MACA 2MJ3A 5J0WA 2I1QA 4A8EA 3QWZB 4I2CA 1Z1VA 2WWZA 4YD1A 4JK1A 2KN5A 5J0OA 4M6WA 4K8DA 4IR1A 2LYBA 2ISPA 2LI6A 4CF5A 8ICTA 1S97A 2OFJA 3Q45A 3WKEA 1JALA 4TUPA 2KN7A 4DQIA 2C7HA 2C3DA 1WGGA 4BKSD 2QEJC 1EC7A 3UJ2A 4PJ0U 3JPRA 1B22A 1WGKA 4KLJA 1L4DB 5AE2A 1YJ1A 4YXMA 3DJGX 1L7MA 2ASJA 1LFDA 2JZPA 3IT4B 1XO3A 1LVLA 2WOVA 3SU8X 1KEJA 4HPPA 1VR9A 4PK1A 1L2NA 4HJKA 2ONEA 5ALLA 2GBRA 2YVFA 1YZ6A 1RZTA 8ICCA 4UB4A 1SB3C 2IA6A 5GTHU 5BYSA 1D8YA 2XH7A 1T0QC 4QIWC 5J2BA 1K53A 2KEYA 4OW0A 2N1VA 5FS9A 3F53A 4RMAA 2QDDA 1OW5A 1S9FA 2HOQA 1J7AA 4IRCA 4B95A 3UXLA 3KYDD 2EXRA 3QFBA 2CR5A 2IPIA 2LKYA 4B9UA 3C28A 2MBEA 4HK2A 5C2TB 1Q3VA 5KFFA 1YN5A 2JXXA 4HKQA 3OZYA 3PX6A 3D2HA 4CDGA 3E2EA 2CU1A 5U25A 5KFYA 2BCUA 1D9DA 1V1PB 4S17A 4ZYNA 2KK0A 1N2XA 4WIPA 4MMWA 5AKJA 4EEWA 3NRZB 1Q5WB 4E74A 1FEBA 2W9AA 5HHHA 2N9KA 5AI4A 2WDRB 1NK6A 5L1IA 4LZDA 3AU4A 1VZ8A 3DPDA 3HVDA 2R9ZA 1V49A 1FFUC 1RVKA 4RQ2A 2HXUA 4YR3A 4Q43A 2XGPA 2EAOA 1L3UA 3H4KA 2WF8A 1LVHA 1PDXA 4XQ8A 5ALTA 3D2JA 3GP7A 1KTQA 4FX9A 1BUIC 3ZJUA 1V1PA 2XK5A 4CF4A 4IR9A 5ALMA 3AEAB 2AL6A 4DWIA 1CK1A 4Y2SA 3NRZA 4FBTA 2O6VB 4FXCA 4AWJA 2AKZA 4ZH4A 5J0TA 2J6SA 4IS7A 3RJGA 9ICJA 1DK2A 8ICUA 2JK6A 2PTLA 4LJOB 3HIZA 2IOHA 1ZQRA 4KIKB 3UIOB 1NKEA 1Q1OA 3RNAC 1YQ4B 5D49A 1C1YB 3L5OA 1EBGA 9ICCA 5IKCM 3UJEA 2Y0SF 3HKZC 3FWAA 4X2PA 1IG6A 2CU3A 1XU4A 2R61A 1GRAA 3UJSA 5HKHA 1K1QA 2AQ2B 3AE3B 3MJ5A 2JH7A 4RPYA 4YR0A 4GLSC 4C8NA 4KITB 1UT8A 2O6VA 3P42A 2OZTA 2XCAA 2N7EA 3U30A 1JPMA 1UT5A 3DK4A 4JV0A 3FJ4A 4QZEA 1TAUA 3EUB2 3OSPA 3QZ7A 1S1QB 1TKGA 4OHJA 3BIID 2V3PA 2INPE 4DOCA 3FAHA 1KTKA 4M0AA 3IAM1 2GGHA 2GWSA 3OG5A 2XGZA 3KUMA 4RGTA 4J1OA 2VZKD 4BBNF 5ENLA 1QOGA 2LGYA 1DYQA 1C4CA 4JHMA 2A1JB 2WDVB 1ZQUA 1XCTL 2W9MA 2FUHB 5J2CA 2NBWB 4NJ7A 1WWVA 2GGIA 3PO5A 5KFZA 2P3HA 1X6IA 2KV2A 2BCVA 3URYA 5L9XA 2E3TA 1MBTA 1XLPA 4ANXA 4E71A 2Z8LA 2JRIB 1LB2B 4GDKB 4LCDE 1S0OA 1QSYA 3HW2A 3N6HA 3HT3A 1ZQSA 2WP9B 2QJMA 3CWIA 4I27A 1GNUA 2QJNA 3KOOA 3KUDB 3H6NA 3V6EB 2BS2B 1WGDA 4X5VA 3GE8C 2PI5A 2KZMA 3SR6B 3TEZA 4OALA 5C23A 1E8HA 2FMSA 3R8BA 4IWPA 4EZKA 2C5LC 3RBEA 4X57B 1STZA 1D5XC 1NHRA 4NL9C 4IKGA 2B21A 4HDQA 3M9NB 2XSXA 2LRWA 3PRPB 3CSTA 2NQLA 4USAA 4H4QA 1UA1A 1JQ4A 3CT2A 2C2DA 2HZGA 2WNMA 1AHUA 4RQ0A 1YX5B 1COOA 3KHGA 4NM2A 7ICHA 5CTRC 1WGYA 2MBRA 3SR6A 1ZQDA 3RFAA 3QARA 5BMIA 2ZJDA 5AUIA 1TK5A 2HVIA 3MDAA 5FJOA 1SJAA 3TI0A 1BQGA 4Y2QA 2PXIA 1YMHE 3UM9A 4IWQA 2A5UA 4UB1A 3Q6JA 5J2RA 1RQLA 5J0XA 2NRZA 2KSOB 4F3OA 5EE0A 1LO5D 3NZSA 2LFIA 4DWFA 2VAOA 3CP8A 1YJJA 2M8SA 2J3NA 2EDUA 1UF0A 2V6OA 5HHZA 4ZOHC 2R8GA 4I2IA 5AZHA 3HJEA 3AE6B 2LRUA 2WB1C 2ZUDA 1TYGB 3M95A 6ENLA 3VTVA 3N7PD 3EFUA 3I63C 3ZQ4A 5FXPA 2ZADA 3MDCA 4DQRA 4EQXA 1WM3A 1B9RA 1ZQYA 2LJ5A 5ALOA 4DOBA 2KVSA 2AGQA 2BGFA 2VANA 3L0WB 1JMSA 3ZLFA 4EELA 4YQWA 3BJSA 4RPXA 3Q8MA 1ZOLA 3PM9A 2KSOA 4QZIA 4GYPA 2WX0A 3MSYA 4KMOB 4KLUA 1WWTA 4K7ZA 1Y88A 2K4IA 2NCNA 2QHOA 2ZW0A 2DNFA 3ZVHA 4W9GA 3DCGA 1KN5A 1XD3B 4HG0A 2FKPA 1W1JA 1GRTA 2WPCA 1TT5B 1MDLA 3A7UA 3BK2A 2KMDA 2KLGA 1FPYA 3SSZA 4PGQA 3CNHA 1U45A 4KLQA 1FFVC 4DQQA 3N30A 8ICGA 4PHDA 2GDQA 2IY0B 3VXWA 3MY9A 1UWXA 2ZVNA 2WTFA 5DLGA 3B2FA 2WXHA 2VFRA 3Q8PB 2L32A 4EENA 1UBQA 5GRTA 1ENFA 4U7CA 4YMNA 2HI0A 4YP3A 5L1JA 2RQ5A 1PK3A 2DL0A 3DBLI 2RSUA 2Y5PA 3PPAA 3O13A 5EWFA 5D79A 5L6FA 4P4PA 3IRUA 1ZQWA 4QZBA 3EJBB 3PZ7A 4O3SA 4DSEA 2O2VA 3PTFC 4I6NB 3IN5A 4FS2A 2WOWA 3P1MA 1TJEA 1M4VA 5DPTA 1D5ZC 8ICPA 5FJTA 1SE2A 1HXYD 5AIAA 2KK8A 2XC9A 1H6VA 4PVEA 3TBLD 3VTEA 8ICEA 3DBSA 1SJBA 4HVBA 3C0PA 3WKDA 2QKNA 4DFPA 5AK6A 3VC6A 3LJ3A 3T8QA 1SL2A 4K81A 2ES6A 5J0PA 3TJIA 4ARCA 4PH5A 4NY8A 4F8RA 1J0GA 5FXFA 9ICEA 1HEZE 1W1KA 2LUEA 1P0RA 4EEYA 2BKFA 9ICIA 2DZMA 5KFAA 3A0HU 1Q0WB 4URKA 5G5GB 2LEKA 1DOYA 2JEIA 1EWYC 2GO7A 2C3CA 1F5SA 7ICIA 4GIRA 1SGHA 4OVVA 3S47A 4HYRA 1RYJA 1PK1B 4MH0E 5MPOA 2ZCCA 4XWWA 5CHGA 1QOAA 4ECWA 1F77A 4EEKA 2BS3B 3OLMD 1JWAD 5AKYA 2W0HA 4JN7A 5BOEA 5LLIA 4RQ6A 1KDHA 4DN1A 4P0PA 3V7KA 4ANVA 3R0KA 3DBRB 1L8LA 5AM2A 2H3FA 3BW7A 4CGZA 3WAPA 4APNA 2LWPA 3ZDEA 2O6VD 1W1QA 1SE3A 5G5GA 2X8HA 3SBFA 1N63A 4F4XA 2WFAA 4XDCA 2INCC 2VRRB 1TK8A 8ICNA 1EF5A 4G11A 5EU9A 3VTUA 3ORYA 4EBCA 4F2SA 1XO0A 1WR1A 2R2QA 1E8WA 2BW2A 2GRTA 3LB8A 2K22A 5ALXA 4NNJB 3R7RA 7ICLA 1E8FA 1Q46A 1OFFA 4BKTA 2JV3A 2EKIA 3OWEB 1QCKA 2G1EA 4DXFA 3HPFA 3F5EA 3AECB 2XVTA 1ZXHA 3C2KA 4QNLA 1WUEA 4UBBA 2A4ZA 3P0WA 4LA1A 2NRTA 3ICXA 2MRPA 4Q8EA 1AW7A 1XXGA 3QU9A 3H8WA 3M1YA 1S10A 1HQRD 1TE2A 3NVWB 4YR2A 4DO9A 5IILA 3IM1A 2OKTA 4HRSA 4EC3A 1M6IA 3FYYA 2PP0A 2NTTA 1A76A 3QXGA 3RUIB 4OJOA 2VFSA 3AEDB 2PEAA 5ALEA 2KE7A 3ZIMA 5AK3A 1IPGA 2M0XA 3L8KA 3WK6A 3PQBA 4HXDA 5JCLA 1FEAA 5KVIA 2IZVB 3AEFB 4OVUA 3CK5A 2E8PA 4DFJA 2FLPA 2EMSA 1JWBD 5BYQA 2VFTA 1U49A 9ICSA 1P7FA 1IGCA 4EKUA 1S8OA 2FCSA 2GI9A 4JAYA 4EX7A 2I1JA 3NVWA 5KFSA 2QB1A 1KCZA 1CZPA 3OPSA 3LAEA 4ZHPA 3LADA 1VZ6A 2FJ6A 1FXIA 3B0AA 3Q3OC 3AM9A 3SQIA 3N9YC 4JDRA 2OYYA 1HZ5A 4DSKA 1O03A 2F8LA 3EWAA 3AE7B 4F72A 3KTQA 1XWLA 4WWMA 1YD8U 3V4BA 2ZJ8A 3UMGA 3MR2A 3ZW3A 4ZHOA 2MCNB 1N56A 8ICMA 3SAGA 4FADA 3D2NA 1QSSA 2RRDA 3SV4A 3TSHA 2PGWA 2F76X 3DERA 2J0JA 1ZMDA 3HWTA 4KGSA 3GSYA 2DYBA 4DXAB 4CO7A 1OQYA 3U8ZA 1RXVA 9ICBA 3JPPA 1BVSA 5J2KA 4ED3A 1V5TA 2ASQA 4RFBA 1MVKA 1C3TA 3ONSA 5AKLA 2X8CA 2J7QB 1GETA 2KJ5A 3I1YA 1DOQA 3EPGA 2I5QA 3I6TA 2YVSA 4B6JA 2HDEA 3T79A 2EQ7A 2W9NA 1XSPA 1BMLC 2DZIA 4ASWC 2NO5A 3TEWA 2POZA 1HZ6A 4B0EA 2BCQA 1ELSA 1XLOA 3RN9C 3BQ2A 3O0HA 2AU0A 2BYVE 5AUKA 3RGTA 4E3CA 3K9PB 2Y4GA 3RNGC 4GXKA 3UQBA 2L00B 3URHA 2JUOA 2MX2A 2K1FA 5D4BA 1NYQA 1RFKA 3ISCA 1TTNA 1WGRA 3B2GA 2PSNA 1C76A 1KRPA 5DPWA 3W2DA 2GH1A 4OVZA 7ICKA 1QSLA 2BYFA 1IXRA 4BXOA 1MPEA 3A9JA 4D2KA 1TKKA 2Y0SC 4FHJA 3AEGB 3M8RA 3H8JA 2KLCA 1VJ5A 1YT3A 3LK9A 2PTZA 3SAHA 1V9JA 3T8MA 1JX4A 1IV8A 4YTPB 3VCBA 5ALSA 3LWLA 2HTHA 2Y3AA 2HVHA 4UD8A 3RD2A 5KFHA 4QWCA 3AE8B 4I29A 4YT0B 3RULA 3QTPA 4CCHA 5FXDA 4KPLA 2MQJA 2W9BA 4OZAA 1VJKA 3MJWA 2KIVA 1UELA 2Z0DB 4OZBA 4F5NA 4W9IA 4NLBA 2BZFA 3RNFC 3VR8B 4DHJB 4PVHA 3SZ2A 2YQEA 3BQ1A 5FR3A 3LDAA 4G0NB 4F71A 4BBNC 3L10B 4XLOA 2MSNA 1HE8A 3X23A 1YN3A 3V60A 4G50A 1WXAA 4Q44A 3A1QB 2E8OA 1RM6C 3U4FA 2WQYB 2JH1A 3C8YA 4GGHA 1F0MA 3A33B 4JIOU 2BB6A 1BKHA 2CFYA 2Q4TA 1X9MA 3UF8A 3QE9Y 1ZQKA 1K4QA 3AMZA 5D2MB 2Y1JA 2CN1A 2FCNA 4H4YA 5EWEA 2RDHA 3PHWB 1MHXA 4ECYA 5AZFA 5DKWA 2D3GA 2LD9A 3K1RB 4O3OA 4BC9A 4DCCA 2WHEA 1PGBA 4Y2YA 2H5XA 2I6XA 1E7VA 2V1YA 3TCSA 2PKEA 3AI5A 4LNKA 2ZPNA 4GMVA 4L23A 2V0GA 2WPEA 3C1ZA 2WX1A 2KQ4X 3A1QA 2NVUI 3W1YA 4DHGA 4OZCA 5TR3A 3IJIA 3MFIA 4H2HA 2BYEA 4YN4A 4KX6B 3W5VB 3U9IA 4DX3A 1N5XA 8ICJA 4I2AA 5IIKA 3WCQA 3P4PB 4YG2A 3RR8A 1RXWA 3RJHA 3N4FA 1NI2A 3NO1A 2D3AA 1T5XD 3EFCA 4B9SA 1XLQA 3T9PA 5ALKA 4NLNA 1COKA 2NTSA 3RRAA 2INNE 2QPMA 4A3RA 4EFOA 4DSJA 5JHBA 1OGWA 1E10A 2WXNA 2BQUA 2N1RA 2QB0B 4JN8A 3AQFA 4YTNB 3NVZB 2PODA 3A7AA 4DFDA 1L0VB 1GJZA 5EE9A 3DHHC 4FJZA 5DBBA 3A4RA 5IIIA 3CYMA 3MGHA 4Q8FA 2Y5BB 3NVVA 2GBNA 4PYZA 1PUZA 7ICQA 3JZUA 1I4RA 5AKIA 4ECZA 7ICSA 1VAOA 3MGVA 5KFRA 1MC8A 1NOMA 3EYZA 3H4BA 4KN7A 2KVZA 5DBCA 4H4ZA 4QWAA 2P6RA 1FNUA 2QB0A 4KMUA 2ZIUB 3NVZA 2LBOA 2DZKA 4QWBA 2EKEC 3T9LA 4KX5A 3DFYA 2ON8A 3ML9A 1O08A 3GIMA 3P63A 4TVWA 2G07A 1P7DA 1ZD2P 1MN8A 1EU3A 2RDBC 4KSKC 4MF8A 2OHFA 2BVFA 2AQ4A 4O5EA 1A0PA 4WJPA 3ZLHA 3UMBA 5C5JA 1ISNA 1YOVB 2H3VA 3TIXA 5DGBA 1RYSA 1LM8B 4KLLA 3QCAA 4JL9A 4JQ9A 2AYOB 2IHMA 5ALNA 2HBJA 5CEHA 4NL9A 1NKBA 2G3QB 5DB9A 3N4EA 4RUAA 3DV9A 5AM5A 4NM1A 3ZXVA 4J57A 2ZW1A 1ZXIA 2Y9TA 2LASA 3ALBA 2MUTB 2ZIUA 4DEZA 3JPNA 3ENEA 1FNWA 4C8MA 3DG6A 2DYOA 2J42A 3EECA 4RQ5A 1WVEA 1WJNA 1TV9A 4EZ9A 3HK0A 4L2YA 4XWTA 1E0YA 3QU4A 3EUB3 2GGGA 3OZMA 1N63C 1ZOYB 4NEWA 2D11A 3IK4A 3DWMA 3MABA 3PVLA 4LVSA 2WXIA 2HCFA 1TAQA 4ELUA 4MELA 4H19A 3V5CA 1PDYA 3UXKA 1WI0A 3LB8C 5AM3A 3WIMA 4FLHA 2Y3RA 3C0RB 3VFCA 5KT5A 8ICWA 1VD2A 2KXJA 3ZD8A 1RAXA 4LNFA 4YSXB 2GB1A 4PWCA 3S2AA 3OC4A 4I2BA 9ICXA 1TBEA 4C4TA 4KKJA 5AM4A 8ICZA 3ZGZA 3RO6A 3PSEB 4DK5A 4EWJA 5KAFU 3R2IA 4RQ7A 4FBJB 3UCCA 4EQRA 2PJHA 2WHIA 5ALIA 3TAQA 1EC9A 5AI6A 4NQLB 4DHZB 4EZLA 9ICLA 2AXTU 5ALPA 1YIWA 3WU2U 4A3PA 8ICSA 2F8KA 2NPTA 4G8TA 3A0BU 4H4UA 1XDIA 2BVHA 3NJTA 1EO6A 3DJJA 5DG7A 2LMCA 2BYTA 4DWDA 4I2DA 9ICAA 3WK4A 1U4BA 3ZDBA 5TSSA 5KHOA 2XY7A 1UCVA 5FXEA 1AQ6A 2OM6A 3D2SA 4KGRA 2Q0ZX 3SQSA 5KG7A 4ED6A 4GLXA 2UVVA 3ISBA 3RPFC 1G6JA 4EQWA 2KP7A 3Q8EA 4H4TA 3SQPA 5AKGA 5ER0A 1SV4A 2R8JA 4M47A 2VH1A 2AJQA 3S6JA 5ALRA 5T8IA 5J2JA 4GRTA 2BCPA 4M9GA 5E6OA 4M9HA 3RJIA 2AL2B 2KVRA 3GD6A 5EOZA 5D7GA 4MF2A 4NWIA 1WYWB 1SJCA 3GIIA 4J9SA 3BZKA 3FW8A 1PZNA 1BWCA 3IAS1 4LJPB 2B76B 4TUUA 1A6SA 3ZNZB 3NUHB 2GLSA 2JF5A 3A7RA 1Z4NA 3OSNA 2DFLA 1I7HA 5CHVC 3W8XA 1V2YA 2ZEQA 1TVAA 1T0SC 1J19A 5AKHA 3S1EA 3I4KA 5I1WA 4KLGA 4Y2RA 2CS4A 2K0PA 5JCKA 1OTRB 1SXDA 4I6LB 2AL2A 2KZZA 5BOMA 5BPCA 3BOXA 2JWUA 2ZXHA 2GSHA 1A77A 2KC1A 1T4GA 2I38A 3PWGA 4RT2A 1X66A 5AKXA 1HIWA 5KG4A 2F2AB 2ACZB 3ZNGC 2BPCA 2AEHA 4PVKA 2QQ6A 1F2RI 3HPOA 3Q8CA 2IOFA 5ALDA 4OD0A 3V7LA 1CEZA 2MW5A 1J8CA 1IBXB 2PMQA 1FCLA 1Z3EB 4UQGA 1K50A 4XGAB 1KOTA 3G6YA 3HHMA 2IMWP 3DHIC 5IA7A 2KICA 3OPXA 5FJPA 2I1KA 1K8RB 1WZ0A 4WJOA 1KFTA 4EZJA 2AQ1B 3JYUA 4GU2A 1D4BA 1KD0A 5DQGA 4DHJD 4DNAA 2R2ZA 4NY0A 2P66A 5CJ7A 4RNOA 3JPOA 4JGHB 4KZCA 1UGJA 4P4OA 3UJFA 3DBHI 5DPRA 1L3TA 3V6CB 2XH0A 1OJTA 4B9VA 5J0YA 1HJPA 1U9LA 3OAWA 3PO0A 3W1SC 2K6DB 3VQIA 3ZNHB 1R4MI 1DXLA 2K25A 1IBXA 4FFDA 4A55A 2O56A 2PFPA 1V5OA 2AX5A 3CYJA 3DGBA 2G45B 3LYSA 3RR1A 4DQOC 3K1GA 2FPKA 4TVYA 2XK5B 4WAFA 1J7CA 4P4MA 5KFMA 1NBFC 3U7DA 1PVQA 1KH0A 5AI0A 4W9LA 4A35A 4Y2XA 1L7NA 4XDDA 3DGHA 1C7YA 2HTME 4ICUA 2AWTA 2HDOA 2VA2A 1GAQB 1L7YA 1WGHA 4K7UA 5FS8A 1NENB 5ALHA 1TAMA 2JEGA 2W7OA 3QZ8A 2M4NA 3O0FA 3DIPA 5CHFA 2WXMA 3RRGA 3B0XA 2V3SA 4BGDA 3PSTA 4RGNA 3GC2A 1YQZA 3PR5B 3EW9A 2M19A 2PKOA 1ZGUB 2JRZA 3GV5B 2X99A 5FS7A 4FA6A 5KT3A 1ZQGA 3V3XA 5KFVA 3QFAA 1I4GA 1ZQLA 2QARB 4M9JA 4RNAA 3F2DA 4WWOA 5H92C 1LV5A 4RF0A 2RMMA 3ZD9A 4W9EA 4DXGA 4DL2A 1JCTA 3GZNB 5JH5C 2EH9A 1Y56A 5DCNA 4LK0M 4DSIA 2FMQA 1D6EC 5B5EU 1ET9A 2WF7A 4EOYA 1XF5L 2JQRB 4GR1A 2MEKA 1XT9B 1ZQXA 3VFKA 3RJEA 2L7RA 2VFVA 2IO2B 4B9TA 2WAQF 4DLEA 3H8HA 1E0ZA 2P88A 2JSVX 1WUDA 3GIKA 1MO9A 1VLBA 2QARA 3I57A 4NPNA 5BMGA 3I76A 4YTMB 4H50A 2A1AA 4K7SA 1NK5A 3FW7A 3RNCC 2LM1A 2K60A 2ZG6A 1CI4A 3ZDAA 4PYTA 4ARIA 4M9NA 2HD5B 2PP3A 3T6CA 2LGIA 2LHDA 3VUYA 3UGVA 4BC7A 2AGPA 3B0YA 5J2FA 4BZAA 1V85A 3PY8A 2GBJA 4KN4A 1E6EB 3WKBA 3D32A 4ITKA 2VFUA 3RNMA 4O9MA 3WK7A 4ICVA 1NVID 2QDEA 1TS3A 2NS5A 3C19A 3UI3A 2EZYA 3ZRCA 3H7SA 1Q1RA 2BPSA 3CXOA 2B6GA 4F91B 1T6BX 2NYVA 4PS7A 2RDJA 1SBBB 1I4HA 4OJ5A 4OO1J 4Z6FA 4QZCA 2IOFK 3RZFA 3QC8B 4F2RA 1FEHA 4WJQA 2AGOA 2DYMA 5FS6A 4G3IA 2FNJB 2GR3A 2BF8B 2AAQA 5AM0A 1S0NA 3K1ZA 4M8NA 1NPXA 5FP0A 4PGXA 3T3FA 1ZQCA 1WF9A 4FZLA 4J56A 4LJXA 3VA8A 3DDMA 4C7ZA 1ZPSA 1S0VA 3BVMA 4XYCA 1W1RA 2BB5A 2BVCA 4N9F4 3EANA 2I0KA 5FK9C 4JV1A 3F5AA 5KVHA 4WURA 1DGSA 4P0QB 4NJCA 4YVZA 2ODGA 1E8YA 2JT4B 8ICYA 1WRIA 3P3BA 2SAKA 2D2QA 2UWQA 1ZXIC 3TX1A 3PFRA 5J04A 1QTMA 3W8ZA 2WOIA 4MGGA 2KD1A 4KLSA 2K89A 2GR0A 3FG2P 2Y1IA 9ICVA 3HM3A 2DAJA 3PT2B 1QF6A 2ZC8A 3IG5A 1EU4A 2WYQA 4JUZA 9ICOA 1YQ3B 2RLTA 2KANA 5H2FU 1E7PB 1HUOA 2LHTA 2KAJA 3TEXA 2AKMA 2OJWA 2G5HB 1F9CA 1TS4A 2AQ3B 2PE9A 2JXTA 4QW9A 5IP4D 2X8GA 2K5PA 3SN0A 4P0QA 2JZZA 4O5KA 1GEUA 3KHHA 1RM6B 2HHWA 4EBEA 1IGDA 3AXCA 4GIVA 5KFCA 2ONQA 5EDSA 1D3ZA 1W1OA 4Z6DA 1ESFA 4A6GA 2KHQA 1PVPA 3P4RB 1KF6B 1NU5A 3I5JC 3ZVHB 3H9DA 4YWGG 3JVAA 3AEEB 2IHNA 1KLUD 3QA8A 1GO3F 4GC6A 3GU3A 1E8ZA 2FUG1 4ZRIA 1NK7A 3S1DA 1WJ4A 4IL2A 3CGDA 4W9JA 3F2BA 4PGYA 5DLFA 3ED5A 3MR5A 2MJEA 2DZJA 4ZDVA 4F5OA 3TFSA 9ICKA 4PHEA 1D8BA 4Q2JA 1AHZA 1K1SA 1KBUA 3BZDB 2MH7A 4UATA 5BYRA 4F7ZA 1SZHA 2KJ9A 3GQCA 1TZOA 3WALA 1Q3UA 1MRAA 2OWOA 1KLNA 1FCCC 1P98A 1TZ1A 1WX8A 3V3WA 3SYZA 3AV8A 1QQ6A 3QQ8B 3ZJVA 1WUFA 3APCA 1TYPA 2KO3A 4HPMB 4IRDA 4EYIB 3V5FA 3RJFA 5J2AA 3WAMA 4TQRA 2PCEA 2MBBB 1Z19A 1V9PA 3DG3A 3TARA 2BKRB 2JPHA 2GOWA 3KZXA 1JRUA 3H0MB 2W11A 4ZRQA 1ZJMA 1MNSA 1GG3A 2QIEB 3AE9B 3GILA 3KHRA 1NHSA 1RYRA 2KDIA 5L1LA 3WA0A 3EHVA 3PHXB 2O2VB 4HYKA 2BVGA 2ZPYA 4OJPA 1ROEA 1WXSA 3BS7A 4CYEA 4QJFB 5DQHA 1FRDA 3ZTCA 2GL5A 2OXOA 4EBDA 2GR1A 3TW9A 1LKYB 2YLMA 2YVCA 1F9JA 5D6JB 5DGAA 4MGYE 4KZ0A 3FXGA 2JR5A 4BWMA 3AEVA 4DS5A 1WFYA 3IXSA 4NAMA 1ONEA 1PDZA 3RH6A 4F92B 1DOIA 5J0RA 1RFAA 1PUTA 3APFA 2AQ0A 5G5HA 3EEZA 3Q3JA 4QWEA 2W54A 1QOFA 4IDIA 1IUEA 3UIPB 2BDUA 2JHDA 5KFOA 1LKYA 3RB6A 1KKOA 2DX5B 2VKQA 2F77X 3GV7B 1TKYA 1WCNA 4FO6A 3IDWA 3KJMA 4JB1A 3ZJTA 2MBHA 1YZ7A 3QX1A 3ZDMC 4C56C 2KJ8A 3GFKB 3RAQA 2YN4A 5KG6A 2KWUB 1WVFA 1ZQNA 3TMPB 4P0PB 1HTOA 2XN9C 2GBMA 4M2YA 3PW4A 1R0MA 1WJUA 4TQ0A 4R63A 2J53A 2J52A 1YJIA 4W9KA 2E8MA 4QZ8A 3GOEA 1MFWA 2LVQA 4HAIA 2RR9A 3N1XC 2PPGA 1TY0A 3ES7A 5KT7A 3TKAA 4UAWA 3IJQA 4CHKA 4M02A 2IO3B 5KG5A 1LGRA 4Y2JA 3JSVA 4ED0A 1KFDA 5JUMA 3U4EG 1FMAD 4N59A 4J9NA 2RPQA 5I1VA 4DLGA 5JTIA 4QZ9A 1JUDA 1IP9A 5C3JB 5DPSA 4Z17A 2YEPF 2NMQA 2KT7A 1JI7A 4DL4A 2GLEA 1GERA 3DQVA 2KHWB 1Q10A 2P13A 3H7IA 2PVGC 2WDQB 4O3NA 3VRAB 3SHQA 1SE9A 2DW7A 3D9XA 3PMNA 1B1ZA 1ZQJA 4RU9A 2WS3B 4HCPB 3MZNA 2E6XA 3KUCB 3VR9B 1ZQBA 4P1BC 4K3BA 2KTQA 1TY2A 4TV3A 3QU5A 4RQ3A 1UZXB 1L4ZB 1C9FA 1SV0A 4O3QA 4HKZE 2P8CA 4DXKA 3BZCA 2PP1A 4C8KA 2WF6A 2J0MA 1ONFA 1XHCA 3AH7A 5ALJA 4ANWA 1GC7A 1CJEA 4K4HA 3NVYB 4GGBA 1WCLA 5KFNA 1ZQFA 5KNIA 2K4EA 1SWVA 3C21A 2PFNA 5FR6A 1MDRA 5EWGA 3R0UA 3PG6A 3ZTDA 3QHTA 1SKSA 4ANUA 2D3CA 5A0LA 3JS8A 1PQSA 1KLGD 2OQHA 1XS9D 3PMLA 3V6HA 4NLGA 3SENA 3VH4B 2JZBA 2QDFA 3ZLZA 1ZY8A 3UMCA 2IGGA 1HA5A 2O3GA 1P9DU 2CXYA 4FI4A 2KMMA 4OJLA 4KTQA 3NVYA 4WJ3B 4GSWA 3NXLA 5KAIU 1XNSA 2YEPB 2BBCA 1L8PA 4IQVA 4F4WA 1QZEA 5DB8A 3HVZA 3C2MA 4MEXA 2KNJA 4BDPA 2KKCA 4I6PA 2OEHA 3SFEB 2PTYA 1JCKB 4FULA 3KFUF 3CAWA 4IP4A 5CR0A 2FCMA 3S1FA 2N7JA 3NTUA 3C5GA 1V8CA 1SGGA 2R8DA 1CUKA 4JE3B 5F9NA 3CMMB 3AE4B 2KJHB 1UPHA 4E8GA 1QQ5A 4HNLA 1YNTE 3R7QA 1S77D 4A3OA 4II2B 2N9EB 4AOFA 4FJVB 4YCXA 3QEAZ 8ICAA 2TSSA 1NK4A 2J4XA 2KC2A 1N60A 3H4DA 5F9LA 5KFBA 4HDOA 3PS6A 4F4KA 1K52A 1QOBA 2JY6A 2E1EA 2Z0EB 4LNNA 3EA6A 9ICQA 2INDC 2ZIXB 2ZUBA 3MC0B 2KTRB 4N58A 4IC7B 4K2SA 4AP4C 2HBMA 1ZETA 3Q8RB 4IT1A 4BXOB 5KFQA 2AHOB 2ISOA 2FI1A 3A9JB 4EM4A 2UYZB 2K8CA 5DDYA 5J2EA 1NJZA 2FE9A 5KT2A 4AJWA 3H0RB 1U4AA 1I42A 2DKZA 2BQ3A 5AM1A 3GD3A 4FHKA 1SIFA 1WXVA 2W9BB 2LGSA 5D94A 7ICOA 3IHPC 4MJSB 2R2OA 4HNCA 9ICWA 2ZIXA 2KTRA 3ES8A 2Z7JA 1OEYJ 5AHXA 3NGDA 4FS1A 1L6VA 1P3QU 4J9PA 5C1ZA 4ZRPA 1T3QA 1VRAB 1MQ3A 2K6QA 3OW1A 3ML8A 3V6JA 1MUCA 2KQSA 5GXGB 1F0XA 2OZ8A 2BC0A 7ICGA 5L6GA 3N7RC 5HHIA 4J9RA 2MJDA 4K7WA 5HR6A 5TISU 4KLEA 3MFGA 4E4UA 3W1SA 2WAQC 2RABA 1JWMD 3FC4A 4UDUC 4RGOS 3RMKC 1BZLA 1NELA 4C4RA 4MJSA 1MJDA 1L6UA 3AU5A 2W43A 3IHQB 2W7PA 2P35A 2QCZA 3FILB 4BV6A 4MDKE 2ZJ5A 4BWJA 4UBCA 5IN7A 3H0LB 2K39A 1ZR6A 3OTQA 4ECUA 4KPRA 3R1ZA 3STPA 3QUQA 2V9HA 1ZQ1C 2JXJA 5D3DA 4US9A 4EYHB 3N97B 4IL0A 1TKDA 2QSDA 1WMHA 2KVCA 3WKCA 2JEJA 2LZ6A 1ED1A 3T4WA 3AQEA 3ZI4A 3GB1A 1SXTA 4PHAA 2Q5WD 2QC8A 4ICAA 2W82A 2DWQA 3R3MA 5DG9A 4LDTB 1WIAA 1XO1A 5J2DA 1V6EA 4M6UA 2WDWA 3R66C 3FILA 2GR2A 1C78A 4XC2A 4KLOA 3GRSA 1WSPA 5D3IB 4DQPA 1GOZA 4IC9A 1HUZA 4F5QA 4K4GA 2AH5A 3UQAA 3Q69A 3PRZA 3M6KA 5ALWA 1E8XA 2V9WA 4M04A 3ZLGA 3OJUA 5HNKA 2ZZPB 4MHVA 4W9HA 4ZYSA 4WWNA 1AHVA 2M17A 3NVVB 4H4XA 3MHSD 3M9OB 2RGFA 3EAOA 3NZGA 2PTXA 4O1NA 3PRMB 4UB6U 3TSJA 2KG5A 5ALVA 4DSFA 8ICQA 4YSZB 5ADZA 2F1JA 4XZ4A 3RCZA 3D47A 3C5FA 1P1AA 3QU2A 1N61A 1E8GA 2UUUA 4J9LA 1B4FA 2MAXA 1Q8KA 1UD7A 4ZRKA 3PLUA 3V05A 1ZX9A 5HG2A 4KSLC 2HHTA 1AOGA 2KN4A 3PW5A 2OX4A 2DW6A 3PSPA 3E56A 2J0KA 3QUBA 4GN1A 4AUQC 1ZDVA 2N9LA 1MI0A 1R7SA 3RI7C 1HTQA 1ZQEA 4GDLB 3PSFA 2MBOA 5F3XB 9ICFA 1JEHA 3SN4A 1WX9A 2H3ZA 7ICJA 4DQSA 3ALRA 3O65B 2I2YA 4XX5A 4JMUA 2GQUA 5KHQA 5GTIU 1MA7A 1NEKB 3QLDA 2KZRA 2GH5A 2BT6A 4H4VA 3KKAA 1L0YB 2GRIA 1TZZA 3MGIA 3C2LA 2FE8A 3A4SC 2M1MA 1F3PA 3KWVA 5JXVA 1A70A 2V3AA 3HSUA 3CF6E 3PW0A 2BC1A 3SN1A 4DFMA 3C1YA 2DGZA 4J03A 5ALQA 4ECXA 3GY1A 4GDLA 3DVNU 4J6IA 3TL5A 8ICFA 5T14A 1D9FA 4H4RA 3Q8SB 3EC8A 1VCBA 2V3NA 3IC9A 4L1BA 4F4YA 4GXBA 3I6EA 3RJKA 3H8AA 1F44A 7ICMA 1NZPA 1V59A 3H12A 2ZXIA 3DVGY 2XY6A 3RB0A 2L52A 3FYHA 1H8CA 3KHLA 4MKSA 1T7PA 4K1WA 2BGWA 1N5WA 1VZ7A 3SMVA 3CGCA 3BINA 2GBKA 4WQMA 5KTQA 4W9DA 4RNNA 4TQSA 4H1ZA 2OAIA 3PGEA 1DK3A 2WU2B 1GV4A 1EF1A 1SJHD 2B3AA 4HCLA 3AEBB 3DEEA 1V86A 1UGMA 1V38A 5E6PA 4DL3A 3RT3B 1V81A 2D5GA 5K4LA 1TIFA 1SV0C 3H70A 2ZJAA 2C7MB 2PLPA 1OQQA 2GQWA 1AARA 4QWDA 2DPIA 2L0FA 2XBBC 4KGTA 2MLBA 1F52A 2N4FA 1P43A 2CDUA 3RJAA 3FKYA 2K4HA 2GGJA 2HBLA 5DBAA 9ICRA 2NPTB 2EQYA 2JWZA 3BQ0A 3D2QA 5JRBA 4IQWA 4REZA 2UVWA 1GC6A 3S5SA 4ML8A 5D46A 2MBQA 5AICA 1ZKQA 1J2NA 2W04A 7ICEA 1EWCA 2FYMA 4NEVA 4WQOB 3AN1A 3QEBZ 4GOCA 4B9MA 3QK0A 1S5LU 2PS2A 2WF9A 3AE5B 3PWIA 3L13A 3S1CA 2OO6A 2K8AA 4H4SA 4QZGA 3PO4A 4WAAA 5DB6A 4EE2A 3B97A 1R4NI 3RB4A 1I19A 5J2HA 2JVCA 3QAQA 1X2GA 3TWBA 2HJ8A 3MR3A 4KLIA 4WH4A 5CB1A 5KL8B 2HXTA 3A9KA 3DVGX 1KL9A 1P7EA 4NLZA 2HHXA 2WXFA 2BQRA 4KKIA 1DIIA 3RRHA 4JLCA 2N9XA 1ZMCA 2DQNB 3VUWA 2OCEA 5FJRA 1LXDA 3LYYA 1STEA 2UVRA 4ED2A 4BCAA 1KW4A 4UAUA 3J9CA 4UARA 4NXZA 3QNMA 5LNK1 4NLCA 3TQPA 3QU7A 2KWCA 3RJ8A 1NHPA 4E5TA 5E79U 5LXIB 4FJYA 4AYBF 2R8KA 2XO7A 2BCSA 7ICTA 3TOYA 5JCIA 2Y9UA 1U47A 2IDYA 3ZRFA 3D6JA 4ROPA 3OHBA 7ICUA 4ENLA 2HQMA 1WXMA 3J81j 4F5RA 2DKXA 2NPXA 2EQ8A 4H83A 5IAAC 2P3ZA 3Q3FA 4P6VF 3N6JA 1WM2A 1JPDX 4IZGA 5KL1B 3IT6B 5AI9A 1KKXA 3PLVA 2N1WA 3NZUA 1FRRA 2KACA 3HILA 1N60C 1ZP0B 3II4A 3UJRA 3DK8A 5DQIA 2O6KA 5CRXA 2FCQA 4QZAA 4HPNA 3BQTA 1GSNA 1NHQA 2PMVA 2G09A 2KX0A 2PU1A 4ZA0A 1TS5A 4HCNB 3ABVB 2RK5A 2I5HA 2W3SA 3RTVA 1KFSA 2OG9A 3RZWC 2PFQA 4GB9A 4G9BA 4RCOA 3RAXA 4IP5A 4AP9A 1CQVA 1ZQZA 5ALGA 4QZHA 4R3DA 1TGZB 3BSMA 5AIBA 1D5MC 2M56B 3BYTB 4PZFA 1ZJNA 4ECQA 4KX3A 1RDFA 3MBYA 2JYTA 3IG8A 2HOIA 2KZ3A 3PW2A 2QGYA 1GPXA 3UXNA 2BPFA 4DYEA 2FMPA 2VA3A 2M0NA 3H40A 4CRXA 1M6YA 4JWNA 3TWAA 3VH3B 2D07B 2REXA 2MU2A 5CP2A 2UVUA 4C4VB 1T3QC 1XC9A 1GRFA 3THUA 4Y2PA 2HHVA 1L6NA 3TAPA 3UINB 2V4RA 4TKNA 5DB7A 3DG7A 3QX7A 1HEKA 3MR6A 5L1MA 5AI8A 3LVWA 2D6FC 2MP2B 4G3XB 2KMAA 1PGAA 9ICNA 4R66A 1WZ3A 2G4DB 2WDTB 1V1OA 1KLVA 3MWCA 2YVJA 5CHWA 1GREA 1NDAA 3UPQA 3AE2B 1AYFA 2KJ6A 4I2HA 2PMZF 5KG2A 4LDTD 3WK5A 1WWUA 4DBGA 3RFZB 2Q4WA 5GMVA 3I99A 5AEKB 4C4VA 3U26A 1NDDA 5J8YA 3AU6A 3WANA 1TYTA 2OZ3A 2CJOA 1OEPA 1UH6A 4HPLB 2VIXA 5ALZA 5L83A 3GV8B 2MP2A 8ICBA 3K75D 3F2CA 3TUOA 3IG3A 4FBUA 5J0SA 3RYTA 1SL1A 1L7PA 1BPBA 1BPEA 2JYEA 1RG6A 1UUPA 2NRVA 3V72A 3OJ4B 3ZNID 1W1MA 4KWSA 3R07C 4B6WA 2LXCA 1M94A 1MG8A 4ED8A 3VC8A 2C60A 2GQTA 5AK5A 4C00A 5KFGA 2JRHA 5ALFA 2Z59B 3ZYYX 4K3CA 4HWIB 8ICIA 3AU2A 7ICNA 2H89B 3K4GA 3EZ5A 4QZFA 4C8OA 1C20A 1S7MA 1JWSD 2TPRA 1LQBA 1XLNA 3ETRB 2DAFA 4ECRA 1ZQPA 3MC8A 1ZQHA 3BS5B 4YXJA 4ED7A 1XSNA 3DDCB 3BVZA 2QILA 2ZIWB 1X9WA 3KW5B 4O3MA 3RNBC 4Z6CA 1J97A 1RLFA 1V80A 1YQBA 4QAYA 4YL8A 4C0ZA 3P4SB 3N28A 1ACCA 1PYWD 5BMHA 1YEYA 2ZZ0A 3VCNA 4F50A 1XQQA 2NBVB 4HLEA 3V7JA 1JWUD 1GRBA 2F1HA 3PZPA 4EMIA 5E6JA 1X2HA 4TSSA 1L8OA 3M9MB 3U7ZA 4N6EB 1N61C 5JCMA 2BTEA 5J29A 4M01A 4J9QA 1PVRA 4BURA 3PSIA 3NS1B 3ETRA 2DLBA 1MQ2A 5J18A 3BS5A 2KJRA 2ZIWA 4NJ8A 1E9MA 2CKHB 2L3ZA 3VDGA 4O0IA 3Q3NC 2W8KA 4DS4A 4IQUA 2YMQA 2DENB 2XH4A 5EE3A 3H8MA 4I28A 2WP5A 2MA1A 3PV8A 3Q8LA 3SDLC 2RDGA 2LGDA 2GOLA 3W9CB 4J3OD 1ZQQA 4DOAA 1GRHA 5TR5A 1DOXA 3H1UA 3HRDD 2EZXA 3PVXA 2KFKB 2L05A 4BBYA 3GO2A 3ZVIA 5C0YA 4YSYB 1MOKA 1HSKA 3KKAC 3Q8QB 2Y3SA 3NS1A 4I2EA 2RDIA 4O5CA 4GFJA 1EBHA 4KIKA 3UQ0A 3KZIU 4YXDB 1ZQMA 3E0FA 4HJGE 4ADWA 5KT6A 2LMRA 1IYXA 1WXQA 5DG8A 3RB3A 4MGZE 3L3FX 1OUQA 1FXTB 1I4PA 2IPKD 3N1ZC 1CMXB 1DNCA 4E6MA 1ZE3D 1YN4A 1RYUA 2LPEA 3PV1A 3EKGA 2BWES 1OEYA 9ICPA 2SEBD 4JV2A 4Y2TA 2KFKA 4FZNA 3ONNA 1F8WA 2MNRA 4EUTA 4KDLB 3NHEB 4MEYA 2HHSA 4J3ZA 3DOWA 4PHPA 2ASLA 2WF5A 2E8NA 2YMLA 5JZEB 1N5WC 2NBUA 2CHZA 2PTWA 2N7DA 4KLHA 4YWOA 4J9OA 4PT5A 3EJEB 2X50A 4BJQA 3NOBA 1N62A 1ECWA 4A6QA 4HN8A 2ZTCA 2A1JA 1Z2MA 4ELVA 4GISA
chains in the Genus database with same CATH topology
4KX6B 3L4PA 2K9XA 3W5VB 1N5XA 1KFYB 3HRDC 3WCQA 3P4PB 3T3OA 5AE1A 3LXFA 4MACA 2MJ3A 1T5XD 1XLQA 1L5PA 3BYYB 2NTSA 3JS8A 2INNE 2QPMA 1KLGD 4TQ1A 1TKEA 1E10A 2WXNA 1JALA 4MH8A 3NVZB 4YTNB 3TEYA 3A7AA 1L0VB 2QEJC 5EE9A 2IGGA 1WGKA 1HA5A 2WXJA 2O3GA 2KMMA 1C4AA 1L4DB 3NVYA 5AE2A 2KDMA 2YEPB 2BBCA 3NVVA 2JZPA 3HVZA 1X2GA 3IT4B 2WLBA 1I4RA 1XO3A 1VR9A 1VAOA 1QQRA 2L1AA 3SFEB 1GB4A 1JCKB 4AS1A 1SB3C 5BYSA 3S1FA 2N7JA 2K3UA 2LJIA 1K53A 1L0XB 1V8CA 4OW0A 1FNUA 3T3NA 3NVZA 2R8DA 4JE3B 1J7AA 2ON8A 3AE4B 4TVWA 3P63A 2EXRA 3Q8BA 2IPIA 1YNTE 1EU3A 1SSNA 2OHFA 4C7YA 2BVFA 4HROA 5C2TB 1YN5A 4HKQA 1PFDA 1XEEA 1SIJA 2TSSA 3I9V1 3D2HA 2E5AA 2WXQA 5G5HB 2J4XA 4MLAA 3DEDA 1N60A 1F2RC 1V1PB 4JWUC 4WIPA 1K52A 1QOBA 3NRZB 3EA6A 5HMRA 2ZW1A 1ZXIA 3MC0B 4N58A 2N9KA 2WDRB 1FNWA 2JX5A 1VZ8A 3HVDA 2DYOA 2J42A 3E9SA 1FFUC 1WVEA 4L2YA 4XWTA 1E0YA 4NAWB 1PDXA 5I4DA 4H2AA 3D2JA 3EUB3 2PLSA 3GP7A 1N63C 1ZOYB 2IGDA 3DWMA 3POPA 1BUIC 3ZJUA 2WXIA 1V1PA 4HEA1 2EELA 3AEAB 1CK1A 4FXCA 3NRZA 1FIQB 2Y5CA 3LB8C 4MM3B 2Y3RA 2PTLA 4PWCA 4YSXB 1L6VA 2GB1A 4ZRPA 1T3QA 1VRAB 1YQ4B 3BK1A 2WXOA 1VQZA 4KKJA 5FKAC 5GXGB 3ZGZA 1F0XA 3FWAA 5L6GA 2MJDA 3KQ4A 2CU3A 3R2IA 3MFGA 2R61A 1W1LA 3W1SA 2AQ2B 3AE3B 3MJ5A 1JWMD 4GLSC 1V97A 3FC4A 4UDUC 4RGOS 3P42A 1FIQA 1L6UA 2W55A 1TKGA 3EUB2 3AE1B 3FILB 4OHJA 3BIID 2V3PA 1SE4A 2INPE 4P16A 1ZR6A 3FAHA 1KTKA 3IAM1 4RGTA 2VZKD 3MHZA 2BVHA 5D3DA 2LMCA 4US9A 1QOGA 2BYTA 1DYQA 5TSSA 1C4CA 2QSDA 2WDVB 5FXEA 1XCTL 3GB1A 4KGRA 1SXTA 2Q5WD 1DGJA 2P3HA 2W82A 2DWQA 3RPFC 3URYA 2E3TA 1MBTA 1XLPA 3Q8EA 3PZ8A 2WDWA 2Z8LA 4GDKB 3FILA 1C78A 5T8IA 2WP9B 1WSPA 3CWIA 5D3IB 1GOZA 4A90A 2BS2B 5D7GA 3SEBA 3Q69A 3SR6B 2N0SB 3TEZA 3FW8A 4OALA 3IAS1 1E8HA 3R8BA 2B76B 1D5XC 4O95A 3NUHB 1QLTA 4ZYSA 1AHVA 3A7RA 3NVVB 4IKGA 1I7HA 3W8XA 3S1EA 5I1WA 1ZDXA 2K0PA 4O1NA 2AXRA 4USAA 3TSJA 5ADZA 4YSZB 1JQ4A 2H88B 3DWGC 2WNMA 1AHUA 5K8EA 1N61A 1E8GA 2JWUA 2UUUA 3VRBB 4JWSC 2I38A 3V05A 1F0ZA 2MBRA 3SR6A 2ACZB 5BMIA 4PVKA 5AUIA 5HG2A 1F2RI 1QT9A 1WYGA 2KN4A 3Q8CA 4A9AA 1YMHE 3E56A 1FXAA 1IBXB 1FCLA 1K50A 1I4XA 2JU6X 1ZDVA 2N9LA 1MI0A 1LO5D 1JRPA 1R7SA 2LFIA 5EE0A 2VAOA 4GDLB 1YJJA 4B0MA 2AQ1B 1D4BA 2R2ZA 4JX1C 5AWVA 5HHZA 4ZOHC 2I2YA 2GQUA 3R2TA 1UGJA 3AE6B 1NEKB 1TYGB 2BT6A 1L0YB 2GRIA 2IJ0A 3BVGA 3ZQ4A 2FE8A 3PO0A 5FXPA 2XNAC 2L83A 3VQIA 1B9RA 3KWVA 5JXVA 1A70A 1IBXA 4A55A 3HSUA 2AX5A 3PM9A 3B9JB 4DQOC 1WWTA 4TVYA 4WAFA 1J7CA 2ZW0A 2V3NA 4L1BA 2DBYA 4HG0A 1KH0A 1W1JA 2L52A 2OEDA 3P4QB 4RF1A 4XDDA 2HTME 3A7UA 3BK2A 4PVJA 3TSSA 1GAQB 1FFVC 1N5WA 1VZ7A 1NENB 4WQMA 4AQ7A 2OAIA 2WU2B 1UWXA 1SJHD 2WXMA 2WXRA 3B2FA 1FM0D 3AEBB 3B9JA 4RGNA 2WXHA 2M19A 2L32A 1FD6A 2PKOA 1PGXA 2D5GA 5HHDG 2PLPA 3V3XA 1OQQA 1ENFA 1I4GA 3Q8FA 4KGTA 4RNAA 5H92C 3RJAA 4RF0A 2RMMA 4DXGA 2RPVA 2WXGA 1N62C 2Y5PA 2Y08A 3O13A 1SB3B 1Y56A 1FNVA 5D79A 4LK0M 4REZA 5HI1A 1D6EC 4ML8A 1ET9A 4PWBA 1XF5L 2JQRB 3PZ7A 2MEKA 1EWCA 3AN1A 3P1MA 2VFVA 1C4PA 1TJEA 1M4VA 2FBWB 3AE5B 1D5ZC 3S1CA 3H8HA 1E0ZA 4EE2A 1SE2A 2JSVX 1HXYD 1VLBA 2PVOD 3I57A 5BMGA 4YTMB 1SEBD 1I19A 3FW7A 4PVEA 4WH4A 4PYTA 3VTEA 2PIAA 4ARIA 3C0PA 2QKNA 1P7EA 1C79A 2LGIA 2LHDA 2WXFA 4DNSA 4BC7A 4KKIA 1DIIA 4ARCA 1E6EB 2VFUA 4ITKA 4BCAA 3LYYA 1STEA 5L6FA 4LLGM 1NVID 2WXLA 1TS3A 3J9CA 4M0WA 3UI3A 3W5UB 5LNK1 5FXFA 4TMAB 3RJ8A 1HEZE 1W1KA 1T6BX 1SBBB 1I4HA 2IDYA 5G5GB 2LEKA 1DOYA 1EWYC 1FEHA 2DYMA 3U52E 1RYJA 2PW9A 5MPOA 1SJED 2KWDA 4XWWA 5AE3A 1QOAA 1F77A 1TS2A 2BS3B 4MT5A 1JWAD 2X38A 4P6VF 2UUVA 1BXTA 3BWUD 4C7ZA 1JROA 1ZPSA 2WXPA 3BVMA 3IT6B 1W1RA 2BB5A 1FRRA 2KACA 2I0KA 3KLSX 1FFUA 5FK9C 1ZP0B 1N60C 1J7BA 4RGMA 4WURA 3BW7A 1JMLA 4NJCA 1WRIA 1W1QA 1SE3A 5G5GA 2SAKA 1N63A 4XDCA 1ZXIC 2PMVA 3D2DA 3TX1A 3W8ZA 1TS5A 1DZNA 2CJNA 3ABVB 3GS2A 2M0AA 2RK5A 2W3SA 1QF6A 3U2SC 2ICIA 1EU4A 2BW2A 2K22A 1UWMA 4RCOA 1YQ3B 2BS4B 3CIRB 1CQVA 2KAJA 4R3DA 1E7PB 1E8FA 1OFFA 3TEXA 1D5MC 2EKIA 2M56B 3BYTB 2G1EA 3OWEB 4DXFA 4PZFA 3AECB 3EGRA 2JYTA 1ZXHA 1TS4A 2AQ3B 2JXTA 2K5PA 3Q8AA 1RM6B 4US8A 1GPXA 1IGDA 1W1SA 1AW7A 1XXGA 2ONQA 1W1OA 1HQRD 3NVWB 1ESFA 3P4RB 4HRSA 4EC3A 1KF6B 1T3QC 4YWGG 3AEEB 1KLUD 2NTTA 3DQ0A 2WU5B 2VFSA 1QILA 2FUG1 3S1DA 3AEDB 2P4PA 2MJEA 1AWDA 1PGAA 3PQBA 1AHZA 4Q2JA 1V1OA 3AEFB 3BZDB 5H8YE 2MH7A 5BYQA 5BYRA 1JWBD 2VFTA 3AE2B 1AYFA 1P7FA 1TZOA 1IGCA 2GI9A 4JAYA 4XE0A 1FCCC 3NVWA 1CZPA 3AV8A 3RFZB 4ZHPA 2Q4WA 1VZ6A 3ZJVA 3I99A 3LAEA 1FXIA 3W8WA 1SF0A 3AM9A 3N9YC 1DIQA 2Q85A 1HZ5A 3AE7B 2V4IB 2CJOA 4WWMA 5HFYA 2VZKB 4ZRQA 3TUOA 4ZHOA 2QIEB 3AE9B 4IOIE 5HQXA 2JYEA 1UUPA 1W1MA 3TSHA 1QLBB 2NQWA 2BVGA 3R07C 1ROEA 2GQTA 1EM7A 3ZYYX 4KGSA 3GSYA 1FRDA 2H89B 1JWSD 1XLNA 1VDVA 4RFBA 3ETRB 1MVKA 1ET6A 3AB5A 4ZOHB 3BVZA 2QILA 3IXSA 4NAMA 2LUMA 2YVSA 2HDEA 3FW9A 5BMHA 1K51A 1DOIA 1PYWD 4C80A 1ACCA 1BMLC 3NZ3A 2LHEA 3P4SB 4LTUA 3TEWA 1PUTA 1HZ6A 4B0EA 1MBBA 1OQRA 1XLOA 3KWLA 5G5HA 1JWUD 5E6JA 5AUKA 1I4QA 1X2HA 4TSSA 4CQNA 1GB1A 2Y4GA 3U7ZA 4N6EB 1N61C 2W54A 2QJLA 1QOFA 4IDIA 1IUEA 2BTEA 1MHHE 3MP9A 1NYQA 1RFKA 3B2GA 3NS1B 3ETRA 2DLBA 1TKYA 1QLUA 1C76A 3W2DA 1KRHA 3KJMA 4OVZA 3ZJTA 4JB1A 1E9MA 1MPEA 4C56C 4D2KA 3AEGB 1WVFA 4YTPB 1NYRA 2Y3AA 5EE3A 2XN9C 4UD8A 1XCQL 4TQ0A 2J53A 3AE8B 2RDGA 4YT0B 2J52A 3W9CB 5FXDA 1YJIA 4J3OD 2IGHA 3SFDB 4OZAA 4RH6A 1DOXA 1VJKA 3HRDD 1TY0A 4OZBA 3VR8B 3HUIA 2VFRA 4YSYB 4BBYA 1HSKA 4PVHA 2Y3SA 3NS1A 3U4EG 1FMAD 1NI3A 5FR3A 2QMTA 4N59A 5I1VA 2PLIA 4XLOA 4YXDB 1YN3A 4HJGE 5C3JB 2YEPF 2NMQA 1ZUD2 1RM6C 2W3RA 1WXQA 2WQYB 3C8YA 1QKZA 4NZLB 1C77A 2BB6A 2WXKA 1FFVA 2IPKD 1I4PA 1Q10A 2P13A 2PVGC 1ZE3D 3AMZA 1YN4A 1RWSA 2WDQB 3VRAB 4A8XC 2RDHA 1MHXA 5EE1A 1B1ZA 2WS3B 2SEBD 4BC9A 1JW9D 1PGBA 2E6XA 1FO4A 3VR9B 4JPSA 1UXYA 1TY2A 1C9FA 3LLBA 2G9HD 1L4ZB 1N5WC 1UNSA 4HKZE 4L23A 2V0GA 4PT5A 2KQ4X 1AN8A 4OZCA 1N62A 3AH7A 4A6QA 1CJEA 3NVYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KX6 B;  3L4P A;  2K9X A;  3W5V B;  1N5X A;  1KFY B;  3HRD C;  3WCQ A;  3P4P B;  5AE1 A;  3LXF A;  2MJ3 A;  1XLQ A;  1L5P A;  3JS8 A;  2QPM A;  1TKE A;  1E10 A;  1JAL A;  3NVZ B;  4YTN B;  3A7A A;  1L0V B;  5EE9 A;  1WGK A;  2O3G A;  2KMM A;  3NVY A;  5AE2 A;  3NVV A;  3HVZ A;  1X2G A;  2WLB A;  1XO3 A;  1VAO A;  3SFE B;  1SB3 C;  3S1F A;  1V8C A;  3NVZ A;  2R8D A;  1J7A A;  3AE4 B;  4TVW A;  3P63 A;  2EXR A;  2OHF A;  4C7Y A;  2BVF A;  4HRO A;  5C2T B;  1PFD A;  1SIJ A;  3D2H A;  2E5A A;  5G5H B;  4MLA A;  3DED A;  1N60 A;  4JWU C;  1QOB A;  3NRZ B;  5HMR A;  1ZXI A;  4N58 A;  2WDR B;  2JX5 A;  1FFU C;  1WVE A;  1E0Y A;  1PDX A;  3D2J A;  3EUB 3;  2PLS A;  1N63 C;  1ZOY B;  3DWM A;  3AEA B;  4FXC A;  3NRZ A;  1FIQ B;  2Y5C A;  3LB8 C;  4PWC A;  4YSX B;  1L6V A;  1T3Q A;  1YQ4 B;  1VQZ A;  5GXG B;  1F0X A;  3FWA A;  2MJD A;  2CU3 A;  1W1L A;  3AE3 B;  1V97 A;  3FC4 A;  1FIQ A;  1L6U A;  2W55 A;  1TKG A;  3EUB 2;  3AE1 B;  3BII D;  1ZR6 A;  3FAH A;  2BVH A;  4US9 A;  1QOG A;  2WDV B;  5FXE A;  2Q5W D;  1DGJ A;  2P3H A;  2DWQ A;  3RPF C;  1MBT A;  2E3T A;  1XLP A;  2WP9 B;  3CWI A;  2BS2 B;  3SR6 B;  2N0S B;  3FW8 A;  4OAL A;  1E8H A;  2B76 B;  4O95 A;  1QLT A;  1AHV A;  3A7R A;  3NVV B;  1I7H A;  3W8X A;  3S1E A;  2AXR A;  4USA A;  3TSJ A;  5ADZ A;  4YSZ B;  1JQ4 A;  2H88 B;  3DWG C;  1AHU A;  1N61 A;  1E8G A;  3VRB B;  4JWS C;  2MBR A;  1F0Z A;  3SR6 A;  2ACZ B;  4PVK A;  5AUI A;  1QT9 A;  4A9A A;  1WYG A;  1FXA A;  2VAO A;  1R7S A;  1JRP A;  5EE0 A;  1YJJ A;  2R2Z A;  4JX1 C;  5HHZ A;  4ZOH C;  2GQU A;  3AE6 B;  1NEK B;  1TYG B;  2BT6 A;  3PO0 A;  5FXP A;  2L83 A;  1B9R A;  1A70 A;  2AX5 A;  3PM9 A;  3B9J B;  1WWT A;  4TVY A;  1J7C A;  2DBY A;  4HG0 A;  1W1J A;  2L52 A;  3P4Q B;  2HTM E;  3A7U A;  4PVJ A;  1GAQ B;  1FFV C;  1N5W A;  1NEN B;  4WQM A;  2OAI A;  2WU2 B;  3B2F A;  1FM0 D;  3AEB B;  3B9J A;  2M19 A;  2PKO A;  1OQQ A;  5H92 C;  1N62 C;  1SB3 B;  5D79 A;  4ML8 A;  4PWB A;  2JQR B;  3AN1 A;  3P1M A;  2VFV A;  1TJE A;  2FBW B;  3AE5 B;  3S1C A;  1E0Z A;  1VLB A;  2PVO D;  4YTM B;  1I19 A;  3FW7 A;  4PVE A;  4PYT A;  3VTE A;  2PIA A;  3C0P A;  2QKN A;  4DNS A;  4BC7 A;  1DII A;  2VFU A;  1E6E B;  4ITK A;  4BCA A;  1NVI D;  3W5U B;  5FXF A;  1W1K A;  5G5G B;  2LEK A;  1DOY A;  1EWY C;  1RYJ A;  5MPO A;  5AE3 A;  1QOA A;  2BS3 B;  1JWA D;  4P6V F;  4C7Z A;  1JRO A;  1W1R A;  1FRR A;  2I0K A;  1FFU A;  1N60 C;  1ZP0 B;  1J7B A;  3BW7 A;  1WRI A;  1W1Q A;  5G5G A;  1ZXI C;  1N63 A;  3TX1 A;  3D2D A;  3W8Z A;  1DZN A;  2CJN A;  3ABV B;  2RK5 A;  2W3S A;  1QF6 A;  2K22 A;  1UWM A;  1YQ3 B;  2BS4 B;  3CIR B;  2KAJ A;  1E7P B;  1E8F A;  1OFF A;  2EKI A;  2M56 B;  4PZF A;  2G1E A;  3AEC B;  2K5P A;  1RM6 B;  4US8 A;  1GPX A;  1W1S A;  1W1O A;  3NVW B;  3P4R B;  4HRS A;  4EC3 A;  1KF6 B;  1T3Q C;  3AEE B;  3DQ0 A;  2WU5 B;  2VFS A;  3S1D A;  3AED B;  2P4P A;  2MJE A;  1AWD A;  1AHZ A;  5H8Y E;  3AEF B;  2MH7 A;  1JWB D;  2VFT A;  3AE2 B;  1AYF A;  4JAY A;  3NVW A;  1CZP A;  3AV8 A;  3LAE A;  4ZHP A;  2Q4W A;  3I99 A;  1FXI A;  3W8W A;  1SF0 A;  3AM9 A;  1DIQ A;  2Q85 A;  3AE7 B;  2CJO A;  4WWM A;  4ZHO A;  2QIE B;  3AE9 B;  5HQX A;  1W1M A;  3TSH A;  1QLB B;  2NQW A;  2BVG A;  3R07 C;  1ROE A;  2GQT A;  3ZYY X;  3GSY A;  1FRD A;  2H89 B;  1XLN A;  1VDV A;  3ETR B;  3AB5 A;  4ZOH B;  2YVS A;  3FW9 A;  3P4S B;  1DOI A;  4C80 A;  4LTU A;  1PUT A;  1MBB A;  1OQR A;  1XLO A;  3KWL A;  5G5H A;  5AUK A;  1X2H A;  4N6E B;  1N61 C;  2W54 A;  2QJL A;  1QOF A;  4IDI A;  1IUE A;  1NYQ A;  1RFK A;  3B2G A;  3NS1 B;  3ETR A;  1TKY A;  1QLU A;  1KRH A;  3KJM A;  4JB1 A;  1E9M A;  3AEG B;  1WVF A;  4YTP B;  1NYR A;  5EE3 A;  4UD8 A;  3AE8 B;  4YT0 B;  3W9C B;  5FXD A;  1YJI A;  3SFD B;  1DOX A;  1VJK A;  3HRD D;  4BBY A;  2VFR A;  3VR8 B;  3HUI A;  4YSY B;  1HSK A;  4PVH A;  3NS1 A;  1FMA D;  1NI3 A;  4N59 A;  2PLI A;  4XLO A;  4YXD B;  5C3J B;  1ZUD 2;  1RM6 C;  2W3R A;  1WXQ A;  2WQY B;  1FFV A;  2P13 A;  2PVG C;  2WDQ B;  3AMZ A;  1RWS A;  3VRA B;  5EE1 A;  2WS3 B;  4BC9 A;  1JW9 D;  1FO4 A;  3VR9 B;  1UXY A;  3LLB A;  1N5W C;  1N62 A;  3AH7 A;  1CJE A;  3NVY B; 
#chains in the Genus database with same CATH topology
 2ASD A;  3GZN I;  3UGB B;  3V62 A;  3HRD C;  3FM9 A;  3T3O A;  3HM6 X;  3LXF A;  2XID A;  5L1K A;  4W9F A;  1RQN A;  1WG8 A;  3DBL B;  1L5P A;  2KX3 A;  3BYY B;  4GDK A;  1GES A;  2CHR A;  4HCD A;  1WR6 E;  5FJU A;  2C22 A;  1JN3 A;  5J2I A;  4TQ1 A;  1TKE A;  3DHG C;  3M63 B;  3WKA A;  1U48 A;  3SD7 A;  4MH8 A;  3TEY A;  5LXH A;  3D46 A;  1KKR A;  2FPL A;  4UB5 A;  2WXJ A;  3CB3 A;  2VJ4 A;  3PR4 A;  1C4A A;  4OCZ A;  4LII A;  4FE3 A;  2EQ6 A;  2KDM A;  3ETL A;  5KT4 A;  2V4Q A;  1QLN A;  4AJY B;  1ZW7 A;  2KDF B;  2XI9 A;  1BT0 A;  2RP5 A;  5AK4 A;  5CWR A;  2WLB A;  1Z00 B;  2PI4 A;  5CX3 A;  4BAX A;  1JOA A;  5KFI A;  4Z6E A;  5CA7 A;  3G6V A;  1SKR A;  1QQR A;  2L1A A;  1GB4 A;  4GC7 A;  3H8S A;  4BOS C;  4AS1 A;  1ZD5 A;  3KUZ A;  4RPZ A;  2JZ3 B;  2KKP A;  2K3U A;  2LJI A;  1L0X B;  3R9K A;  1X9S A;  4GXJ A;  1NJX A;  3V6K A;  3T3N A;  2HMX A;  3HP6 A;  5J0U A;  3DH9 A;  2KD0 A;  5JU5 A;  3V61 A;  4DDG D;  2FLL A;  3Q8B A;  2PU0 A;  4FDC B;  4QZD A;  1SSN A;  5AZG A;  3FVD A;  3JPQ A;  2NR2 A;  4C7Y A;  4HRO A;  3N7S C;  2G06 A;  2BCR A;  4KLM A;  1Z00 A;  4JWM A;  1PFD A;  1SIJ A;  1EUV B;  1XEE A;  1UBI A;  3I9V 1;  2WXQ A;  3NG0 A;  4DDI D;  4MLA A;  2E5A A;  3RF9 A;  1F2R C;  4JWU C;  3DED A;  3ECI A;  1UHU A;  1UQV A;  4UAV A;  2CPR A;  5HMR A;  4BFR A;  5TZV A;  3OHA A;  2YMP A;  3TAN A;  2XEW A;  1UA0 A;  2JX5 A;  3L17 A;  2C2E A;  2OH2 A;  2L0T A;  2N9P C;  3E9S A;  3JVZ X;  5G2N A;  2YTU A;  3VVW B;  4YWS A;  3GD4 A;  2H3Q A;  2MWS B;  4NAW B;  2KNB A;  5I4D A;  5KFK A;  4DFK A;  4H2A A;  3IP4 B;  8ICV A;  2P0I A;  2PLS A;  2DUY A;  2IGD A;  1E9I A;  1OXJ A;  2MUC A;  3POP A;  3PX0 A;  4YFK A;  7ICR A;  3UXO A;  4HEA 1;  3TFR A;  2EEL A;  2F44 A;  1X2I A;  1X9X A;  4F5P A;  4H4W A;  1FIQ B;  4BKG A;  1EXN A;  2Y5C A;  1D7Y A;  4RNM A;  3P2B A;  4MM3 B;  3R25 A;  2LXA A;  3BDP A;  2IBI B;  3JSV B;  2R8H A;  2H3I A;  1JXE A;  2W03 A;  3TAC B;  1Z1B A;  4PL2 A;  3M6Z A;  4R8U B;  3BK1 A;  2KIW A;  2VH2 A;  2WXO A;  8ICL A;  4KT2 A;  4LNO A;  1VQZ A;  5FKA C;  2CHX A;  4BX9 C;  4U6P A;  3KQ4 A;  4NAW A;  4PYU A;  2NV3 A;  5HMM A;  4EZ6 A;  1W1L A;  3UQ2 A;  2ESE A;  2LI5 A;  3N32 A;  4FP1 A;  4GME A;  7ENL A;  3ZKJ C;  2D3D A;  2PFO A;  1V97 A;  3N1Y C;  1H2I A;  4F4R A;  1XS2 A;  1WJ6 A;  3L08 A;  1FIQ A;  2X8X X;  4GGQ A;  2W55 A;  4MM3 A;  3L5K A;  3ZXR A;  2KFZ A;  3AE1 B;  9ICG A;  2ZNV B;  2ZZC A;  5KFJ A;  1SE4 A;  4P16 A;  1ZQI A;  3H7V A;  1L5U A;  3E58 A;  5IDZ A;  2NO4 A;  2KYW A;  3ZUN A;  8ICO A;  3MUC A;  2EAN A;  4R8U A;  3GZF A;  3MHZ A;  2YMM A;  3MFH A;  3RH5 A;  3T5K A;  3QYP A;  1DXS A;  1SZP A;  2BWF A;  3DEQ A;  3IJL A;  1IYF A;  2QLT A;  4AYB C;  1DGJ A;  2XCP A;  1J2M A;  3PZD A;  2ZTE A;  1XSL A;  1BPY A;  5J8Y C;  3WK8 A;  3PZ8 A;  5KFL A;  1GRG A;  1BPX A;  4XUS A;  3THV A;  2CRX A;  1D8L A;  3QUC A;  3TQ1 A;  3NAS A;  3Q4D A;  4EMW A;  3CGB A;  4ECV A;  3TAD A;  4XA5 A;  2XY5 A;  4A90 A;  5JHA A;  1LPF A;  4PPX A;  3SEB A;  1SKW A;  1E90 A;  1A5R A;  2LYH A;  2JZB B;  4YD2 A;  1ZD4 A;  3CRX A;  2N0S B;  8ICX A;  5KFP A;  1TE6 A;  2FDR A;  4RUC A;  3P93 A;  4H4P A;  4Z1Y A;  2IO0 B;  4QW8 A;  2PE6 B;  2F5Z A;  3R11 A;  4ELT A;  2OJR A;  4O95 A;  1FEZ A;  4Y2V A;  1QLT A;  3ZVV A;  2V3B A;  1R6W A;  4LNI A;  1ZDL A;  1ZDX A;  4UW9 A;  2HBK A;  1ZQA A;  1MSW D;  2C2R A;  2AXR A;  3KYC D;  2E5S A;  4PS3 A;  2H88 B;  4RQ4 A;  3DWG C;  1PK1 A;  1QQ7 A;  4ECS A;  2XIC A;  2R8I A;  5K8E A;  4F1S A;  8ICR A;  2D8C A;  3VRB B;  4JWS C;  5J0Q A;  4YMO A;  1ZQO A;  1F0Z A;  1XPY A;  3VAW A;  2FIF A;  3ZO5 B;  1SJD A;  3N3K B;  3DDH A;  1QT9 A;  1WYG A;  4A9A A;  1KN0 A;  1FXA A;  3ZDC A;  3FV9 A;  4JB3 A;  2WP6 A;  3JW7 A;  1I4X A;  2JU6 X;  3NS8 A;  3QUT A;  1GXF A;  5L95 C;  3GE3 C;  3TJP A;  3TJ4 A;  4TUS A;  2YAU A;  8ICH A;  1JRP A;  4B0M A;  3MC9 A;  4O3P A;  1WE6 A;  4JX1 C;  5AWV A;  2OOB B;  2HSZ A;  3KD3 A;  2PPH A;  3K9O B;  3R2T A;  4PL1 A;  4IM0 A;  2GGE A;  4ZCW A;  2KQ7 A;  2YB1 A;  4QIW F;  1RRB A;  2HHQ A;  2DF4 B;  4RM9 A;  2A3V A;  4PZN A;  1IM4 A;  1WE7 A;  2IJ0 A;  2KOX A;  1T94 A;  2KFN A;  3BVG A;  2KWV B;  3DVN V;  4EMJ A;  2XNA C;  2L83 A;  2DHZ A;  1URJ A;  2ZIV B;  3EPI A;  2P6U A;  2K8C B;  2LVO A;  4II3 B;  2PMZ C;  3VCC A;  9ICM A;  2IYD B;  4UAZ A;  4GXI A;  3B9J B;  4RM8 A;  4ACO A;  2A8X A;  3DBR I;  2BDP A;  4I2J A;  1H38 A;  2F3N A;  4UB2 A;  4IWO A;  3VUX A;  2ATL A;  2ZZB A;  2DBY A;  4ZRJ A;  3DK9 A;  4EX6 A;  3M62 B;  5IO9 A;  5U1O A;  3T5J A;  3N4M B;  2EZZ A;  2OED A;  3P4Q B;  4RF1 A;  3TCA A;  3PK7 A;  4PVJ A;  2BR0 A;  3TSS A;  5G5H B;  5KFE A;  2HW3 A;  1E5W A;  2C9W B;  3EF6 A;  4AQ7 A;  2ZIV A;  4ECT A;  2K4P A;  1FEC A;  5IIJ A;  4M9L A;  1L3V A;  3SAF A;  4FN2 A;  2JEF A;  4M0X A;  5J2G A;  2WXR A;  1FM0 D;  3RJJ A;  3B9J A;  7ICF A;  4M8M A;  1FD6 A;  2AL3 A;  4WJN A;  2IBK A;  1PGX A;  4IW0 A;  3DGZ A;  3WK9 A;  2HOF A;  2MHJ A;  5KFX A;  5HHD G;  3TTE A;  3OGU A;  2LVP A;  4MFC A;  3B08 A;  3I3T B;  3Q8F A;  4G7F A;  3ISD A;  4IG7 B;  1DRG A;  4DHZ E;  4NJ6 A;  2RPV A;  1CRX A;  2C7N B;  2WXG A;  1N62 C;  4P1C C;  3Q2A C;  2Y08 A;  1SB3 B;  2L5Y A;  3RIT A;  3AUO A;  1FNV A;  2IY1 B;  5HI1 A;  1ZK7 A;  1S3S G;  3RCY A;  4PWB A;  3G6X A;  2C28 A;  2KDE B;  1ZRM A;  3HKZ F;  4CF3 A;  1WMH B;  3RR7 A;  3NRW A;  1N48 A;  1F1H A;  4M0W B;  4EM3 A;  1C4P A;  4GFI A;  3PX4 A;  2FBW B;  1JIH A;  5IIO A;  3M7D A;  2RDX A;  3DFH A;  2PVO D;  2KTF A;  1JDF A;  5B66 U;  1SEB D;  1SWW A;  2K8B B;  2XGQ A;  2BKE A;  2EAM A;  7ICV A;  2PIA A;  2J6T A;  1C79 A;  2K8H A;  3MKC A;  3CXB A;  4DNS A;  3Q8K A;  1WH3 A;  1T3N A;  2P8B A;  1I35 A;  4TUR A;  2LGX A;  4LLG M;  2FPM A;  4I2G A;  2WXL A;  2BQQ A;  4M0W A;  2MSE D;  8ICK A;  3W5U B;  1T0Y A;  4KV2 A;  4TMA B;  3VTW A;  4UB8 U;  1ZYQ A;  3WAO A;  2KMC A;  1X42 A;  2KDB A;  1SL0 A;  2BPG A;  4RQ1 A;  1L7O A;  3U52 E;  4NLK A;  2K8B A;  2KOB A;  3KLJ A;  2PW9 A;  4IM3 A;  3NFU A;  4IUM B;  9ICH A;  5ALU A;  2DPJ A;  4RQ8 A;  1SJE D;  2KWD A;  1JXL A;  5AE3 A;  3FCP A;  1TS2 A;  1KSP A;  3LDZ E;  4MT5 A;  4BKS A;  2JGA A;  1FHV A;  2X38 A;  5IIM A;  2UUV A;  1BXT A;  5KFU A;  3ENL A;  3BWU D;  1JRO A;  2WXP A;  4W9C A;  5BO4 B;  3EJD B;  1BGX T;  1NK8 A;  4GYP C;  1NJY A;  1ARO P;  3KLS X;  1FFU A;  2NRX A;  1NKC A;  3OJ3 A;  3GIJ A;  1J7B A;  2WGS A;  4RGM A;  2FAZ A;  3SJN A;  1XAN A;  3UXP A;  1JML A;  3SI8 A;  1Q1W A;  1QH9 A;  1Z4O A;  4LZG A;  4EQS A;  1SXE A;  3PRE A;  2VJ5 A;  3AL0 B;  3D2D A;  4KLD A;  1Y8R C;  3QJZ A;  2M9N A;  2RHF A;  4C4S A;  4CE6 A;  1DZN A;  2IO1 B;  2CJN A;  4BUG A;  3GS2 A;  2M0A A;  4UAS A;  4IHC A;  1E7U A;  3U2S C;  2ICI A;  2PGE A;  4NV0 A;  1UWM A;  1Z5S B;  2BS4 B;  3CIR B;  2I9G A;  4K1R B;  3KBB A;  2UU7 A;  3SV3 A;  1B0X A;  3EGR A;  2QVH A;  2NRW A;  4E0D A;  2V4L A;  2MRL A;  3Q14 C;  3Q8A A;  4B9K A;  4K4I A;  1NK0 A;  3RH4 A;  4US8 A;  1NJW A;  4UB3 A;  3BJY A;  1ZKH A;  1W1S A;  4RZR A;  4M52 A;  1KJT A;  3R10 A;  4ACF A;  1K5O A;  4YMM A;  3LXD A;  4DF4 A;  4F8C B;  4J9K A;  5AKK A;  4MFA A;  3NY5 A;  3DES A;  4MSM B;  3DQ0 A;  1KQQ A;  2WU5 B;  1QIL A;  1WX7 A;  2WB1 F;  2D10 A;  2P4P A;  3IVF A;  1AWD A;  4R64 A;  2LM4 A;  4DF8 A;  1NNL A;  3I28 A;  3LVV A;  3C23 A;  4KLT A;  5H8Y E;  2W8L A;  3KVF B;  2VA8 A;  4Y2U A;  1R4N B;  2GMI C;  1RPL A;  2EMT A;  4KVG B;  1MG4 A;  4XE0 A;  3Q6B A;  3IBE A;  2MA9 B;  2L76 A;  7ICP A;  3W8W A;  4GIB A;  1SF0 A;  3MTN B;  1DIQ A;  2Q85 A;  4KDI C;  2ZUC A;  3JPS A;  5G55 A;  1B43 A;  1X1M A;  2HHU A;  2V4I B;  2G08 A;  4DSL A;  2WBA A;  5HFY A;  3GDX A;  2VZK B;  5KG3 A;  2PA6 A;  4R65 A;  4S0R A;  4IOI E;  5HQX A;  1TK0 A;  3BQ7 A;  5FMH A;  5BOF A;  1QLB B;  2OLA A;  2NQW A;  4P2H A;  2LYA A;  1ECQ A;  2ZNV C;  2F1I A;  3UCD A;  4P7I A;  1T0R C;  1EM7 A;  3GRT A;  3QPE A;  2L8J A;  1ZQT A;  4A20 A;  2OPJ A;  3RBD A;  2EAP A;  3TAD C;  2KFJ A;  4F93 B;  5ALY A;  4IRK A;  5E6N A;  2E1F A;  4RQM A;  3M3J A;  4PZO A;  1FHU A;  1VDV A;  1ZD3 A;  4ED1 A;  3RNE C;  1P48 A;  1ZQV A;  2YB4 A;  3FDS A;  1ET6 A;  5AKZ A;  3M8S A;  2FID A;  3A9K B;  1S0M A;  3AB5 A;  2AL1 A;  4ZOH B;  1X6J A;  3VC5 A;  1GUA B;  2LUM A;  1W6T A;  4NQK E;  3MQT A;  3FW9 A;  3QIJ A;  2G4S A;  1K51 A;  3VHT C;  4C80 A;  1WY8 A;  3NZ3 A;  4LTU A;  2LHE A;  2QAE A;  2HE7 A;  1H4R A;  5KFT A;  5JRT A;  4BOZ B;  1MBB A;  1X40 A;  1OQR A;  1L3S A;  3KWL A;  4HCH A;  3MC1 A;  1I4Q A;  1EC8 A;  4CQN A;  1GB1 A;  2D3B A;  2HJ1 A;  1BNP A;  5J17 A;  4OJ6 A;  2CHW A;  2QJL A;  4K8G A;  3L54 A;  2ALZ A;  1KM7 A;  1MHH E;  3CGE A;  2OQY A;  3MP9 A;  2YX8 A;  2MUT A;  4MGI E;  1T8E A;  5JCN A;  1N6Z A;  2ZCB A;  3ZDT A;  1QLU A;  1KRH A;  3Q3M C;  3CW2 C;  3JPT A;  1NZB A;  4C8L A;  3B1L X;  5HR7 A;  2YQU A;  4JQW C;  4I2F A;  3SEI A;  5AKE A;  4B9L A;  1NYR A;  4RT3 A;  4XRH A;  2W9C B;  9ICT A;  1XCQ L;  9ICU A;  3BY4 B;  3ZDD A;  2R18 A;  2QJJ A;  3OJS A;  3SFD B;  2IGH A;  2A19 A;  4DL7 A;  4MFF A;  3DBH B;  3N20 C;  4RH6 A;  2YVG A;  2B0C A;  3T5H A;  1TFR A;  5KG1 A;  5DDM A;  3PNC A;  5HP4 A;  4KLF A;  1YX6 B;  3HUI A;  1ZRN A;  1S76 D;  3OTR A;  2J6U A;  4CNQ A;  4E4F A;  2OVL A;  1R4M B;  3KH0 A;  5BOL A;  1NI3 A;  4F4Z A;  2QMT A;  2PLI A;  1IIP A;  4MSQ B;  4Q45 A;  4O3R A;  1ZUD 2;  5AI5 A;  2W3R A;  4IM2 A;  2HNE A;  1BPD A;  2WPF A;  1QKZ A;  4NZL B;  3LWM A;  1C77 A;  2WXK A;  1FFV A;  3C29 A;  2W9C A;  4IQT A;  3CSF A;  2FLN A;  2G0A A;  4B9N A;  1RWS A;  4A8X C;  2XH2 A;  3QN3 A;  2JMG A;  3NUQ A;  5KFW A;  5IIN A;  2QKQ A;  3H7P B;  5EE1 A;  1JW9 D;  4M00 A;  1FO4 A;  4JPS A;  4DL6 A;  2RD0 A;  3JW0 X;  4M6W B;  1UXY A;  1DTN A;  5IOI A;  5KG0 A;  4RQN A;  4J9M A;  1EBD A;  2EQ9 A;  2G9H D;  3LLB A;  2G5I B;  3APD A;  4KEM A;  1UNS A;  5EBK A;  3IFW B;  2ZVO A;  4MEM A;  1WRD B;  3QKE A;  3OP2 A;  5HML A;  3T5L A;  4TUQ A;  2BHN A;  4DL5 A;  1AN8 A;  3AUL A;  1BNO A;  4WWP A;  3HW8 A;  2YY6 A;  3IV6 A;  5KFD A;  2KHV A;  4UAY A;  3HX0 A;  4FZM A;  1NK9 A;  3PW7 A;  3VDZ A;  2KKV A;  2NVK X;  3L16 A;  2ZTD A;  3L4P A;  2K9X A;  1BPZ A;  4IL6 U;  4MGK E;  1KFY B;  4PS8 A;  3SD5 A;  3X0W A;  4BVU C;  5AE1 A;  3H7P A;  4MAC A;  2MJ3 A;  5J0W A;  2I1Q A;  4A8E A;  3QWZ B;  4I2C A;  1Z1V A;  2WWZ A;  4YD1 A;  4JK1 A;  2KN5 A;  5J0O A;  4M6W A;  4K8D A;  4IR1 A;  2LYB A;  2ISP A;  2LI6 A;  4CF5 A;  8ICT A;  1S97 A;  2OFJ A;  3Q45 A;  3WKE A;  1JAL A;  4TUP A;  2KN7 A;  4DQI A;  2C7H A;  2C3D A;  1WGG A;  4BKS D;  2QEJ C;  1EC7 A;  3UJ2 A;  4PJ0 U;  3JPR A;  1B22 A;  1WGK A;  4KLJ A;  1L4D B;  5AE2 A;  1YJ1 A;  4YXM A;  3DJG X;  1L7M A;  2ASJ A;  1LFD A;  2JZP A;  3IT4 B;  1XO3 A;  1LVL A;  2WOV A;  3SU8 X;  1KEJ A;  4HPP A;  1VR9 A;  4PK1 A;  1L2N A;  4HJK A;  2ONE A;  5ALL A;  2GBR A;  2YVF A;  1YZ6 A;  1RZT A;  8ICC A;  4UB4 A;  1SB3 C;  2IA6 A;  5GTH U;  5BYS A;  1D8Y A;  2XH7 A;  1T0Q C;  4QIW C;  5J2B A;  1K53 A;  2KEY A;  4OW0 A;  2N1V A;  5FS9 A;  3F53 A;  4RMA A;  2QDD A;  1OW5 A;  1S9F A;  2HOQ A;  1J7A A;  4IRC A;  4B95 A;  3UXL A;  3KYD D;  2EXR A;  3QFB A;  2CR5 A;  2IPI A;  2LKY A;  4B9U A;  3C28 A;  2MBE A;  4HK2 A;  5C2T B;  1Q3V A;  5KFF A;  1YN5 A;  2JXX A;  4HKQ A;  3OZY A;  3PX6 A;  3D2H A;  4CDG A;  3E2E A;  2CU1 A;  5U25 A;  5KFY A;  2BCU A;  1D9D A;  1V1P B;  4S17 A;  4ZYN A;  2KK0 A;  1N2X A;  4WIP A;  4MMW A;  5AKJ A;  4EEW A;  3NRZ B;  1Q5W B;  4E74 A;  1FEB A;  2W9A A;  5HHH A;  2N9K A;  5AI4 A;  2WDR B;  1NK6 A;  5L1I A;  4LZD A;  3AU4 A;  1VZ8 A;  3DPD A;  3HVD A;  2R9Z A;  1V49 A;  1FFU C;  1RVK A;  4RQ2 A;  2HXU A;  4YR3 A;  4Q43 A;  2XGP A;  2EAO A;  1L3U A;  3H4K A;  2WF8 A;  1LVH A;  1PDX A;  4XQ8 A;  5ALT A;  3D2J A;  3GP7 A;  1KTQ A;  4FX9 A;  1BUI C;  3ZJU A;  1V1P A;  2XK5 A;  4CF4 A;  4IR9 A;  5ALM A;  3AEA B;  2AL6 A;  4DWI A;  1CK1 A;  4Y2S A;  3NRZ A;  4FBT A;  2O6V B;  4FXC A;  4AWJ A;  2AKZ A;  4ZH4 A;  5J0T A;  2J6S A;  4IS7 A;  3RJG A;  9ICJ A;  1DK2 A;  8ICU A;  2JK6 A;  2PTL A;  4LJO B;  3HIZ A;  2IOH A;  1ZQR A;  4KIK B;  3UIO B;  1NKE A;  1Q1O A;  3RNA C;  1YQ4 B;  5D49 A;  1C1Y B;  3L5O A;  1EBG A;  9ICC A;  5IKC M;  3UJE A;  2Y0S F;  3HKZ C;  3FWA A;  4X2P A;  1IG6 A;  2CU3 A;  1XU4 A;  2R61 A;  1GRA A;  3UJS A;  5HKH A;  1K1Q A;  2AQ2 B;  3AE3 B;  3MJ5 A;  2JH7 A;  4RPY A;  4YR0 A;  4GLS C;  4C8N A;  4KIT B;  1UT8 A;  2O6V A;  3P42 A;  2OZT A;  2XCA A;  2N7E A;  3U30 A;  1JPM A;  1UT5 A;  3DK4 A;  4JV0 A;  3FJ4 A;  4QZE A;  1TAU A;  3EUB 2;  3OSP A;  3QZ7 A;  1S1Q B;  1TKG A;  4OHJ A;  3BII D;  2V3P A;  2INP E;  4DOC A;  3FAH A;  1KTK A;  4M0A A;  3IAM 1;  2GGH A;  2GWS A;  3OG5 A;  2XGZ A;  3KUM A;  4RGT A;  4J1O A;  2VZK D;  4BBN F;  5ENL A;  1QOG A;  2LGY A;  1DYQ A;  1C4C A;  4JHM A;  2A1J B;  2WDV B;  1ZQU A;  1XCT L;  2W9M A;  2FUH B;  5J2C A;  2NBW B;  4NJ7 A;  1WWV A;  2GGI A;  3PO5 A;  5KFZ A;  2P3H A;  1X6I A;  2KV2 A;  2BCV A;  3URY A;  5L9X A;  2E3T A;  1MBT A;  1XLP A;  4ANX A;  4E71 A;  2Z8L A;  2JRI B;  1LB2 B;  4GDK B;  4LCD E;  1S0O A;  1QSY A;  3HW2 A;  3N6H A;  3HT3 A;  1ZQS A;  2WP9 B;  2QJM A;  3CWI A;  4I27 A;  1GNU A;  2QJN A;  3KOO A;  3KUD B;  3H6N A;  3V6E B;  2BS2 B;  1WGD A;  4X5V A;  3GE8 C;  2PI5 A;  2KZM A;  3SR6 B;  3TEZ A;  4OAL A;  5C23 A;  1E8H A;  2FMS A;  3R8B A;  4IWP A;  4EZK A;  2C5L C;  3RBE A;  4X57 B;  1STZ A;  1D5X C;  1NHR A;  4NL9 C;  4IKG A;  2B21 A;  4HDQ A;  3M9N B;  2XSX A;  2LRW A;  3PRP B;  3CST A;  2NQL A;  4USA A;  4H4Q A;  1UA1 A;  1JQ4 A;  3CT2 A;  2C2D A;  2HZG A;  2WNM A;  1AHU A;  4RQ0 A;  1YX5 B;  1COO A;  3KHG A;  4NM2 A;  7ICH A;  5CTR C;  1WGY A;  2MBR A;  3SR6 A;  1ZQD A;  3RFA A;  3QAR A;  5BMI A;  2ZJD A;  5AUI A;  1TK5 A;  2HVI A;  3MDA A;  5FJO A;  1SJA A;  3TI0 A;  1BQG A;  4Y2Q A;  2PXI A;  1YMH E;  3UM9 A;  4IWQ A;  2A5U A;  4UB1 A;  3Q6J A;  5J2R A;  1RQL A;  5J0X A;  2NRZ A;  2KSO B;  4F3O A;  5EE0 A;  1LO5 D;  3NZS A;  2LFI A;  4DWF A;  2VAO A;  3CP8 A;  1YJJ A;  2M8S A;  2J3N A;  2EDU A;  1UF0 A;  2V6O A;  5HHZ A;  4ZOH C;  2R8G A;  4I2I A;  5AZH A;  3HJE A;  3AE6 B;  2LRU A;  2WB1 C;  2ZUD A;  1TYG B;  3M95 A;  6ENL A;  3VTV A;  3N7P D;  3EFU A;  3I63 C;  3ZQ4 A;  5FXP A;  2ZAD A;  3MDC A;  4DQR A;  4EQX A;  1WM3 A;  1B9R A;  1ZQY A;  2LJ5 A;  5ALO A;  4DOB A;  2KVS A;  2AGQ A;  2BGF A;  2VAN A;  3L0W B;  1JMS A;  3ZLF A;  4EEL A;  4YQW A;  3BJS A;  4RPX A;  3Q8M A;  1ZOL A;  3PM9 A;  2KSO A;  4QZI A;  4GYP A;  2WX0 A;  3MSY A;  4KMO B;  4KLU A;  1WWT A;  4K7Z A;  1Y88 A;  2K4I A;  2NCN A;  2QHO A;  2ZW0 A;  2DNF A;  3ZVH A;  4W9G A;  3DCG A;  1KN5 A;  1XD3 B;  4HG0 A;  2FKP A;  1W1J A;  1GRT A;  2WPC A;  1TT5 B;  1MDL A;  3A7U A;  3BK2 A;  2KMD A;  2KLG A;  1FPY A;  3SSZ A;  4PGQ A;  3CNH A;  1U45 A;  4KLQ A;  1FFV C;  4DQQ A;  3N30 A;  8ICG A;  4PHD A;  2GDQ A;  2IY0 B;  3VXW A;  3MY9 A;  1UWX A;  2ZVN A;  2WTF A;  5DLG A;  3B2F A;  2WXH A;  2VFR A;  3Q8P B;  2L32 A;  4EEN A;  1UBQ A;  5GRT A;  1ENF A;  4U7C A;  4YMN A;  2HI0 A;  4YP3 A;  5L1J A;  2RQ5 A;  1PK3 A;  2DL0 A;  3DBL I;  2RSU A;  2Y5P A;  3PPA A;  3O13 A;  5EWF A;  5D79 A;  5L6F A;  4P4P A;  3IRU A;  1ZQW A;  4QZB A;  3EJB B;  3PZ7 A;  4O3S A;  4DSE A;  2O2V A;  3PTF C;  4I6N B;  3IN5 A;  4FS2 A;  2WOW A;  3P1M A;  1TJE A;  1M4V A;  5DPT A;  1D5Z C;  8ICP A;  5FJT A;  1SE2 A;  1HXY D;  5AIA A;  2KK8 A;  2XC9 A;  1H6V A;  4PVE A;  3TBL D;  3VTE A;  8ICE A;  3DBS A;  1SJB A;  4HVB A;  3C0P A;  3WKD A;  2QKN A;  4DFP A;  5AK6 A;  3VC6 A;  3LJ3 A;  3T8Q A;  1SL2 A;  4K81 A;  2ES6 A;  5J0P A;  3TJI A;  4ARC A;  4PH5 A;  4NY8 A;  4F8R A;  1J0G A;  5FXF A;  9ICE A;  1HEZ E;  1W1K A;  2LUE A;  1P0R A;  4EEY A;  2BKF A;  9ICI A;  2DZM A;  5KFA A;  3A0H U;  1Q0W B;  4URK A;  5G5G B;  2LEK A;  1DOY A;  2JEI A;  1EWY C;  2GO7 A;  2C3C A;  1F5S A;  7ICI A;  4GIR A;  1SGH A;  4OVV A;  3S47 A;  4HYR A;  1RYJ A;  1PK1 B;  4MH0 E;  5MPO A;  2ZCC A;  4XWW A;  5CHG A;  1QOA A;  4ECW A;  1F77 A;  4EEK A;  2BS3 B;  3OLM D;  1JWA D;  5AKY A;  2W0H A;  4JN7 A;  5BOE A;  5LLI A;  4RQ6 A;  1KDH A;  4DN1 A;  4P0P A;  3V7K A;  4ANV A;  3R0K A;  3DBR B;  1L8L A;  5AM2 A;  2H3F A;  3BW7 A;  4CGZ A;  3WAP A;  4APN A;  2LWP A;  3ZDE A;  2O6V D;  1W1Q A;  1SE3 A;  5G5G A;  2X8H A;  3SBF A;  1N63 A;  4F4X A;  2WFA A;  4XDC A;  2INC C;  2VRR B;  1TK8 A;  8ICN A;  1EF5 A;  4G11 A;  5EU9 A;  3VTU A;  3ORY A;  4EBC A;  4F2S A;  1XO0 A;  1WR1 A;  2R2Q A;  1E8W A;  2BW2 A;  2GRT A;  3LB8 A;  2K22 A;  5ALX A;  4NNJ B;  3R7R A;  7ICL A;  1E8F A;  1Q46 A;  1OFF A;  4BKT A;  2JV3 A;  2EKI A;  3OWE B;  1QCK A;  2G1E A;  4DXF A;  3HPF A;  3F5E A;  3AEC B;  2XVT A;  1ZXH A;  3C2K A;  4QNL A;  1WUE A;  4UBB A;  2A4Z A;  3P0W A;  4LA1 A;  2NRT A;  3ICX A;  2MRP A;  4Q8E A;  1AW7 A;  1XXG A;  3QU9 A;  3H8W A;  3M1Y A;  1S10 A;  1HQR D;  1TE2 A;  3NVW B;  4YR2 A;  4DO9 A;  5IIL A;  3IM1 A;  2OKT A;  4HRS A;  4EC3 A;  1M6I A;  3FYY A;  2PP0 A;  2NTT A;  1A76 A;  3QXG A;  3RUI B;  4OJO A;  2VFS A;  3AED B;  2PEA A;  5ALE A;  2KE7 A;  3ZIM A;  5AK3 A;  1IPG A;  2M0X A;  3L8K A;  3WK6 A;  3PQB A;  4HXD A;  5JCL A;  1FEA A;  5KVI A;  2IZV B;  3AEF B;  4OVU A;  3CK5 A;  2E8P A;  4DFJ A;  2FLP A;  2EMS A;  1JWB D;  5BYQ A;  2VFT A;  1U49 A;  9ICS A;  1P7F A;  1IGC A;  4EKU A;  1S8O A;  2FCS A;  2GI9 A;  4JAY A;  4EX7 A;  2I1J A;  3NVW A;  5KFS A;  2QB1 A;  1KCZ A;  1CZP A;  3OPS A;  3LAE A;  4ZHP A;  3LAD A;  1VZ6 A;  2FJ6 A;  1FXI A;  3B0A A;  3Q3O C;  3AM9 A;  3SQI A;  3N9Y C;  4JDR A;  2OYY A;  1HZ5 A;  4DSK A;  1O03 A;  2F8L A;  3EWA A;  3AE7 B;  4F72 A;  3KTQ A;  1XWL A;  4WWM A;  1YD8 U;  3V4B A;  2ZJ8 A;  3UMG A;  3MR2 A;  3ZW3 A;  4ZHO A;  2MCN B;  1N56 A;  8ICM A;  3SAG A;  4FAD A;  3D2N A;  1QSS A;  2RRD A;  3SV4 A;  3TSH A;  2PGW A;  2F76 X;  3DER A;  2J0J A;  1ZMD A;  3HWT A;  4KGS A;  3GSY A;  2DYB A;  4DXA B;  4CO7 A;  1OQY A;  3U8Z A;  1RXV A;  9ICB A;  3JPP A;  1BVS A;  5J2K A;  4ED3 A;  1V5T A;  2ASQ A;  4RFB A;  1MVK A;  1C3T A;  3ONS A;  5AKL A;  2X8C A;  2J7Q B;  1GET A;  2KJ5 A;  3I1Y A;  1DOQ A;  3EPG A;  2I5Q A;  3I6T A;  2YVS A;  4B6J A;  2HDE A;  3T79 A;  2EQ7 A;  2W9N A;  1XSP A;  1BML C;  2DZI A;  4ASW C;  2NO5 A;  3TEW A;  2POZ A;  1HZ6 A;  4B0E A;  2BCQ A;  1ELS A;  1XLO A;  3RN9 C;  3BQ2 A;  3O0H A;  2AU0 A;  2BYV E;  5AUK A;  3RGT A;  4E3C A;  3K9P B;  2Y4G A;  3RNG C;  4GXK A;  3UQB A;  2L00 B;  3URH A;  2JUO A;  2MX2 A;  2K1F A;  5D4B A;  1NYQ A;  1RFK A;  3ISC A;  1TTN A;  1WGR A;  3B2G A;  2PSN A;  1C76 A;  1KRP A;  5DPW A;  3W2D A;  2GH1 A;  4OVZ A;  7ICK A;  1QSL A;  2BYF A;  1IXR A;  4BXO A;  1MPE A;  3A9J A;  4D2K A;  1TKK A;  2Y0S C;  4FHJ A;  3AEG B;  3M8R A;  3H8J A;  2KLC A;  1VJ5 A;  1YT3 A;  3LK9 A;  2PTZ A;  3SAH A;  1V9J A;  3T8M A;  1JX4 A;  1IV8 A;  4YTP B;  3VCB A;  5ALS A;  3LWL A;  2HTH A;  2Y3A A;  2HVH A;  4UD8 A;  3RD2 A;  5KFH A;  4QWC A;  3AE8 B;  4I29 A;  4YT0 B;  3RUL A;  3QTP A;  4CCH A;  5FXD A;  4KPL A;  2MQJ A;  2W9B A;  4OZA A;  1VJK A;  3MJW A;  2KIV A;  1UEL A;  2Z0D B;  4OZB A;  4F5N A;  4W9I A;  4NLB A;  2BZF A;  3RNF C;  3VR8 B;  4DHJ B;  4PVH A;  3SZ2 A;  2YQE A;  3BQ1 A;  5FR3 A;  3LDA A;  4G0N B;  4F71 A;  4BBN C;  3L10 B;  4XLO A;  2MSN A;  1HE8 A;  3X23 A;  1YN3 A;  3V60 A;  4G50 A;  1WXA A;  4Q44 A;  3A1Q B;  2E8O A;  1RM6 C;  3U4F A;  2WQY B;  2JH1 A;  3C8Y A;  4GGH A;  1F0M A;  3A33 B;  4JIO U;  2BB6 A;  1BKH A;  2CFY A;  2Q4T A;  1X9M A;  3UF8 A;  3QE9 Y;  1ZQK A;  1K4Q A;  3AMZ A;  5D2M B;  2Y1J A;  2CN1 A;  2FCN A;  4H4Y A;  5EWE A;  2RDH A;  3PHW B;  1MHX A;  4ECY A;  5AZF A;  5DKW A;  2D3G A;  2LD9 A;  3K1R B;  4O3O A;  4BC9 A;  4DCC A;  2WHE A;  1PGB A;  4Y2Y A;  2H5X A;  2I6X A;  1E7V A;  2V1Y A;  3TCS A;  2PKE A;  3AI5 A;  4LNK A;  2ZPN A;  4GMV A;  4L23 A;  2V0G A;  2WPE A;  3C1Z A;  2WX1 A;  2KQ4 X;  3A1Q A;  2NVU I;  3W1Y A;  4DHG A;  4OZC A;  5TR3 A;  3IJI A;  3MFI A;  4H2H A;  2BYE A;  4YN4 A;  4KX6 B;  3W5V B;  3U9I A;  4DX3 A;  1N5X A;  8ICJ A;  4I2A A;  5IIK A;  3WCQ A;  3P4P B;  4YG2 A;  3RR8 A;  1RXW A;  3RJH A;  3N4F A;  1NI2 A;  3NO1 A;  2D3A A;  1T5X D;  3EFC A;  4B9S A;  1XLQ A;  3T9P A;  5ALK A;  4NLN A;  1COK A;  2NTS A;  3RRA A;  2INN E;  2QPM A;  4A3R A;  4EFO A;  4DSJ A;  5JHB A;  1OGW A;  1E10 A;  2WXN A;  2BQU A;  2N1R A;  2QB0 B;  4JN8 A;  3AQF A;  4YTN B;  3NVZ B;  2POD A;  3A7A A;  4DFD A;  1L0V B;  1GJZ A;  5EE9 A;  3DHH C;  4FJZ A;  5DBB A;  3A4R A;  5III A;  3CYM A;  3MGH A;  4Q8F A;  2Y5B B;  3NVV A;  2GBN A;  4PYZ A;  1PUZ A;  7ICQ A;  3JZU A;  1I4R A;  5AKI A;  4ECZ A;  7ICS A;  1VAO A;  3MGV A;  5KFR A;  1MC8 A;  1NOM A;  3EYZ A;  3H4B A;  4KN7 A;  2KVZ A;  5DBC A;  4H4Z A;  4QWA A;  2P6R A;  1FNU A;  2QB0 A;  4KMU A;  2ZIU B;  3NVZ A;  2LBO A;  2DZK A;  4QWB A;  2EKE C;  3T9L A;  4KX5 A;  3DFY A;  2ON8 A;  3ML9 A;  1O08 A;  3GIM A;  3P63 A;  4TVW A;  2G07 A;  1P7D A;  1ZD2 P;  1MN8 A;  1EU3 A;  2RDB C;  4KSK C;  4MF8 A;  2OHF A;  2BVF A;  2AQ4 A;  4O5E A;  1A0P A;  4WJP A;  3ZLH A;  3UMB A;  5C5J A;  1ISN A;  1YOV B;  2H3V A;  3TIX A;  5DGB A;  1RYS A;  1LM8 B;  4KLL A;  3QCA A;  4JL9 A;  4JQ9 A;  2AYO B;  2IHM A;  5ALN A;  2HBJ A;  5CEH A;  4NL9 A;  1NKB A;  2G3Q B;  5DB9 A;  3N4E A;  4RUA A;  3DV9 A;  5AM5 A;  4NM1 A;  3ZXV A;  4J57 A;  2ZW1 A;  1ZXI A;  2Y9T A;  2LAS A;  3ALB A;  2MUT B;  2ZIU A;  4DEZ A;  3JPN A;  3ENE A;  1FNW A;  4C8M A;  3DG6 A;  2DYO A;  2J42 A;  3EEC A;  4RQ5 A;  1WVE A;  1WJN A;  1TV9 A;  4EZ9 A;  3HK0 A;  4L2Y A;  4XWT A;  1E0Y A;  3QU4 A;  3EUB 3;  2GGG A;  3OZM A;  1N63 C;  1ZOY B;  4NEW A;  2D11 A;  3IK4 A;  3DWM A;  3MAB A;  3PVL A;  4LVS A;  2WXI A;  2HCF A;  1TAQ A;  4ELU A;  4MEL A;  4H19 A;  3V5C A;  1PDY A;  3UXK A;  1WI0 A;  3LB8 C;  5AM3 A;  3WIM A;  4FLH A;  2Y3R A;  3C0R B;  3VFC A;  5KT5 A;  8ICW A;  1VD2 A;  2KXJ A;  3ZD8 A;  1RAX A;  4LNF A;  4YSX B;  2GB1 A;  4PWC A;  3S2A A;  3OC4 A;  4I2B A;  9ICX A;  1TBE A;  4C4T A;  4KKJ A;  5AM4 A;  8ICZ A;  3ZGZ A;  3RO6 A;  3PSE B;  4DK5 A;  4EWJ A;  5KAF U;  3R2I A;  4RQ7 A;  4FBJ B;  3UCC A;  4EQR A;  2PJH A;  2WHI A;  5ALI A;  3TAQ A;  1EC9 A;  5AI6 A;  4NQL B;  4DHZ B;  4EZL A;  9ICL A;  2AXT U;  5ALP A;  1YIW A;  3WU2 U;  4A3P A;  8ICS A;  2F8K A;  2NPT A;  4G8T A;  3A0B U;  4H4U A;  1XDI A;  2BVH A;  3NJT A;  1EO6 A;  3DJJ A;  5DG7 A;  2LMC A;  2BYT A;  4DWD A;  4I2D A;  9ICA A;  3WK4 A;  1U4B A;  3ZDB A;  5TSS A;  5KHO A;  2XY7 A;  1UCV A;  5FXE A;  1AQ6 A;  2OM6 A;  3D2S A;  4KGR A;  2Q0Z X;  3SQS A;  5KG7 A;  4ED6 A;  4GLX A;  2UVV A;  3ISB A;  3RPF C;  1G6J A;  4EQW A;  2KP7 A;  3Q8E A;  4H4T A;  3SQP A;  5AKG A;  5ER0 A;  1SV4 A;  2R8J A;  4M47 A;  2VH1 A;  2AJQ A;  3S6J A;  5ALR A;  5T8I A;  5J2J A;  4GRT A;  2BCP A;  4M9G A;  5E6O A;  4M9H A;  3RJI A;  2AL2 B;  2KVR A;  3GD6 A;  5EOZ A;  5D7G A;  4MF2 A;  4NWI A;  1WYW B;  1SJC A;  3GII A;  4J9S A;  3BZK A;  3FW8 A;  1PZN A;  1BWC A;  3IAS 1;  4LJP B;  2B76 B;  4TUU A;  1A6S A;  3ZNZ B;  3NUH B;  2GLS A;  2JF5 A;  3A7R A;  1Z4N A;  3OSN A;  2DFL A;  1I7H A;  5CHV C;  3W8X A;  1V2Y A;  2ZEQ A;  1TVA A;  1T0S C;  1J19 A;  5AKH A;  3S1E A;  3I4K A;  5I1W A;  4KLG A;  4Y2R A;  2CS4 A;  2K0P A;  5JCK A;  1OTR B;  1SXD A;  4I6L B;  2AL2 A;  2KZZ A;  5BOM A;  5BPC A;  3BOX A;  2JWU A;  2ZXH A;  2GSH A;  1A77 A;  2KC1 A;  1T4G A;  2I38 A;  3PWG A;  4RT2 A;  1X66 A;  5AKX A;  1HIW A;  5KG4 A;  2F2A B;  2ACZ B;  3ZNG C;  2BPC A;  2AEH A;  4PVK A;  2QQ6 A;  1F2R I;  3HPO A;  3Q8C A;  2IOF A;  5ALD A;  4OD0 A;  3V7L A;  1CEZ A;  2MW5 A;  1J8C A;  1IBX B;  2PMQ A;  1FCL A;  1Z3E B;  4UQG A;  1K50 A;  4XGA B;  1KOT A;  3G6Y A;  3HHM A;  2IMW P;  3DHI C;  5IA7 A;  2KIC A;  3OPX A;  5FJP A;  2I1K A;  1K8R B;  1WZ0 A;  4WJO A;  1KFT A;  4EZJ A;  2AQ1 B;  3JYU A;  4GU2 A;  1D4B A;  1KD0 A;  5DQG A;  4DHJ D;  4DNA A;  2R2Z A;  4NY0 A;  2P66 A;  5CJ7 A;  4RNO A;  3JPO A;  4JGH B;  4KZC A;  1UGJ A;  4P4O A;  3UJF A;  3DBH I;  5DPR A;  1L3T A;  3V6C B;  2XH0 A;  1OJT A;  4B9V A;  5J0Y A;  1HJP A;  1U9L A;  3OAW A;  3PO0 A;  3W1S C;  2K6D B;  3VQI A;  3ZNH B;  1R4M I;  1DXL A;  2K25 A;  1IBX A;  4FFD A;  4A55 A;  2O56 A;  2PFP A;  1V5O A;  2AX5 A;  3CYJ A;  3DGB A;  2G45 B;  3LYS A;  3RR1 A;  4DQO C;  3K1G A;  2FPK A;  4TVY A;  2XK5 B;  4WAF A;  1J7C A;  4P4M A;  5KFM A;  1NBF C;  3U7D A;  1PVQ A;  1KH0 A;  5AI0 A;  4W9L A;  4A35 A;  4Y2X A;  1L7N A;  4XDD A;  3DGH A;  1C7Y A;  2HTM E;  4ICU A;  2AWT A;  2HDO A;  2VA2 A;  1GAQ B;  1L7Y A;  1WGH A;  4K7U A;  5FS8 A;  1NEN B;  5ALH A;  1TAM A;  2JEG A;  2W7O A;  3QZ8 A;  2M4N A;  3O0F A;  3DIP A;  5CHF A;  2WXM A;  3RRG A;  3B0X A;  2V3S A;  4BGD A;  3PST A;  4RGN A;  3GC2 A;  1YQZ A;  3PR5 B;  3EW9 A;  2M19 A;  2PKO A;  1ZGU B;  2JRZ A;  3GV5 B;  2X99 A;  5FS7 A;  4FA6 A;  5KT3 A;  1ZQG A;  3V3X A;  5KFV A;  3QFA A;  1I4G A;  1ZQL A;  2QAR B;  4M9J A;  4RNA A;  3F2D A;  4WWO A;  5H92 C;  1LV5 A;  4RF0 A;  2RMM A;  3ZD9 A;  4W9E A;  4DXG A;  4DL2 A;  1JCT A;  3GZN B;  5JH5 C;  2EH9 A;  1Y56 A;  5DCN A;  4LK0 M;  4DSI A;  2FMQ A;  1D6E C;  5B5E U;  1ET9 A;  2WF7 A;  4EOY A;  1XF5 L;  2JQR B;  4GR1 A;  2MEK A;  1XT9 B;  1ZQX A;  3VFK A;  3RJE A;  2L7R A;  2VFV A;  2IO2 B;  4B9T A;  2WAQ F;  4DLE A;  3H8H A;  1E0Z A;  2P88 A;  2JSV X;  1WUD A;  3GIK A;  1MO9 A;  1VLB A;  2QAR A;  3I57 A;  4NPN A;  5BMG A;  3I76 A;  4YTM B;  4H50 A;  2A1A A;  4K7S A;  1NK5 A;  3FW7 A;  3RNC C;  2LM1 A;  2K60 A;  2ZG6 A;  1CI4 A;  3ZDA A;  4PYT A;  4ARI A;  4M9N A;  2HD5 B;  2PP3 A;  3T6C A;  2LGI A;  2LHD A;  3VUY A;  3UGV A;  4BC7 A;  2AGP A;  3B0Y A;  5J2F A;  4BZA A;  1V85 A;  3PY8 A;  2GBJ A;  4KN4 A;  1E6E B;  3WKB A;  3D32 A;  4ITK A;  2VFU A;  3RNM A;  4O9M A;  3WK7 A;  4ICV A;  1NVI D;  2QDE A;  1TS3 A;  2NS5 A;  3C19 A;  3UI3 A;  2EZY A;  3ZRC A;  3H7S A;  1Q1R A;  2BPS A;  3CXO A;  2B6G A;  4F91 B;  1T6B X;  2NYV A;  4PS7 A;  2RDJ A;  1SBB B;  1I4H A;  4OJ5 A;  4OO1 J;  4Z6F A;  4QZC A;  2IOF K;  3RZF A;  3QC8 B;  4F2R A;  1FEH A;  4WJQ A;  2AGO A;  2DYM A;  5FS6 A;  4G3I A;  2FNJ B;  2GR3 A;  2BF8 B;  2AAQ A;  5AM0 A;  1S0N A;  3K1Z A;  4M8N A;  1NPX A;  5FP0 A;  4PGX A;  3T3F A;  1ZQC A;  1WF9 A;  4FZL A;  4J56 A;  4LJX A;  3VA8 A;  3DDM A;  4C7Z A;  1ZPS A;  1S0V A;  3BVM A;  4XYC A;  1W1R A;  2BB5 A;  2BVC A;  4N9F 4;  3EAN A;  2I0K A;  5FK9 C;  4JV1 A;  3F5A A;  5KVH A;  4WUR A;  1DGS A;  4P0Q B;  4NJC A;  4YVZ A;  2ODG A;  1E8Y A;  2JT4 B;  8ICY A;  1WRI A;  3P3B A;  2SAK A;  2D2Q A;  2UWQ A;  1ZXI C;  3TX1 A;  3PFR A;  5J04 A;  1QTM A;  3W8Z A;  2WOI A;  4MGG A;  2KD1 A;  4KLS A;  2K89 A;  2GR0 A;  3FG2 P;  2Y1I A;  9ICV A;  3HM3 A;  2DAJ A;  3PT2 B;  1QF6 A;  2ZC8 A;  3IG5 A;  1EU4 A;  2WYQ A;  4JUZ A;  9ICO A;  1YQ3 B;  2RLT A;  2KAN A;  5H2F U;  1E7P B;  1HUO A;  2LHT A;  2KAJ A;  3TEX A;  2AKM A;  2OJW A;  2G5H B;  1F9C A;  1TS4 A;  2AQ3 B;  2PE9 A;  2JXT A;  4QW9 A;  5IP4 D;  2X8G A;  2K5P A;  3SN0 A;  4P0Q A;  2JZZ A;  4O5K A;  1GEU A;  3KHH A;  1RM6 B;  2HHW A;  4EBE A;  1IGD A;  3AXC A;  4GIV A;  5KFC A;  2ONQ A;  5EDS A;  1D3Z A;  1W1O A;  4Z6D A;  1ESF A;  4A6G A;  2KHQ A;  1PVP A;  3P4R B;  1KF6 B;  1NU5 A;  3I5J C;  3ZVH B;  3H9D A;  4YWG G;  3JVA A;  3AEE B;  2IHN A;  1KLU D;  3QA8 A;  1GO3 F;  4GC6 A;  3GU3 A;  1E8Z A;  2FUG 1;  4ZRI A;  1NK7 A;  3S1D A;  1WJ4 A;  4IL2 A;  3CGD A;  4W9J A;  3F2B A;  4PGY A;  5DLF A;  3ED5 A;  3MR5 A;  2MJE A;  2DZJ A;  4ZDV A;  4F5O A;  3TFS A;  9ICK A;  4PHE A;  1D8B A;  4Q2J A;  1AHZ A;  1K1S A;  1KBU A;  3BZD B;  2MH7 A;  4UAT A;  5BYR A;  4F7Z A;  1SZH A;  2KJ9 A;  3GQC A;  1TZO A;  3WAL A;  1Q3U A;  1MRA A;  2OWO A;  1KLN A;  1FCC C;  1P98 A;  1TZ1 A;  1WX8 A;  3V3W A;  3SYZ A;  3AV8 A;  1QQ6 A;  3QQ8 B;  3ZJV A;  1WUF A;  3APC A;  1TYP A;  2KO3 A;  4HPM B;  4IRD A;  4EYI B;  3V5F A;  3RJF A;  5J2A A;  3WAM A;  4TQR A;  2PCE A;  2MBB B;  1Z19 A;  1V9P A;  3DG3 A;  3TAR A;  2BKR B;  2JPH A;  2GOW A;  3KZX A;  1JRU A;  3H0M B;  2W11 A;  4ZRQ A;  1ZJM A;  1MNS A;  1GG3 A;  2QIE B;  3AE9 B;  3GIL A;  3KHR A;  1NHS A;  1RYR A;  2KDI A;  5L1L A;  3WA0 A;  3EHV A;  3PHX B;  2O2V B;  4HYK A;  2BVG A;  2ZPY A;  4OJP A;  1ROE A;  1WXS A;  3BS7 A;  4CYE A;  4QJF B;  5DQH A;  1FRD A;  3ZTC A;  2GL5 A;  2OXO A;  4EBD A;  2GR1 A;  3TW9 A;  1LKY B;  2YLM A;  2YVC A;  1F9J A;  5D6J B;  5DGA A;  4MGY E;  4KZ0 A;  3FXG A;  2JR5 A;  4BWM A;  3AEV A;  4DS5 A;  1WFY A;  3IXS A;  4NAM A;  1ONE A;  1PDZ A;  3RH6 A;  4F92 B;  1DOI A;  5J0R A;  1RFA A;  1PUT A;  3APF A;  2AQ0 A;  5G5H A;  3EEZ A;  3Q3J A;  4QWE A;  2W54 A;  1QOF A;  4IDI A;  1IUE A;  3UIP B;  2BDU A;  2JHD A;  5KFO A;  1LKY A;  3RB6 A;  1KKO A;  2DX5 B;  2VKQ A;  2F77 X;  3GV7 B;  1TKY A;  1WCN A;  4FO6 A;  3IDW A;  3KJM A;  4JB1 A;  3ZJT A;  2MBH A;  1YZ7 A;  3QX1 A;  3ZDM C;  4C56 C;  2KJ8 A;  3GFK B;  3RAQ A;  2YN4 A;  5KG6 A;  2KWU B;  1WVF A;  1ZQN A;  3TMP B;  4P0P B;  1HTO A;  2XN9 C;  2GBM A;  4M2Y A;  3PW4 A;  1R0M A;  1WJU A;  4TQ0 A;  4R63 A;  2J53 A;  2J52 A;  1YJI A;  4W9K A;  2E8M A;  4QZ8 A;  3GOE A;  1MFW A;  2LVQ A;  4HAI A;  2RR9 A;  3N1X C;  2PPG A;  1TY0 A;  3ES7 A;  5KT7 A;  3TKA A;  4UAW A;  3IJQ A;  4CHK A;  4M02 A;  2IO3 B;  5KG5 A;  1LGR A;  4Y2J A;  3JSV A;  4ED0 A;  1KFD A;  5JUM A;  3U4E G;  1FMA D;  4N59 A;  4J9N A;  2RPQ A;  5I1V A;  4DLG A;  5JTI A;  4QZ9 A;  1JUD A;  1IP9 A;  5C3J B;  5DPS A;  4Z17 A;  2YEP F;  2NMQ A;  2KT7 A;  1JI7 A;  4DL4 A;  2GLE A;  1GER A;  3DQV A;  2KHW B;  1Q10 A;  2P13 A;  3H7I A;  2PVG C;  2WDQ B;  4O3N A;  3VRA B;  3SHQ A;  1SE9 A;  2DW7 A;  3D9X A;  3PMN A;  1B1Z A;  1ZQJ A;  4RU9 A;  2WS3 B;  4HCP B;  3MZN A;  2E6X A;  3KUC B;  3VR9 B;  1ZQB A;  4P1B C;  4K3B A;  2KTQ A;  1TY2 A;  4TV3 A;  3QU5 A;  4RQ3 A;  1UZX B;  1L4Z B;  1C9F A;  1SV0 A;  4O3Q A;  4HKZ E;  2P8C A;  4DXK A;  3BZC A;  2PP1 A;  4C8K A;  2WF6 A;  2J0M A;  1ONF A;  1XHC A;  3AH7 A;  5ALJ A;  4ANW A;  1GC7 A;  1CJE A;  4K4H A;  3NVY B;  4GGB A;  1WCL A;  5KFN A;  1ZQF A;  5KNI A;  2K4E A;  1SWV A;  3C21 A;  2PFN A;  5FR6 A;  1MDR A;  5EWG A;  3R0U A;  3PG6 A;  3ZTD A;  3QHT A;  1SKS A;  4ANU A;  2D3C A;  5A0L A;  3JS8 A;  1PQS A;  1KLG D;  2OQH A;  1XS9 D;  3PML A;  3V6H A;  4NLG A;  3SEN A;  3VH4 B;  2JZB A;  2QDF A;  3ZLZ A;  1ZY8 A;  3UMC A;  2IGG A;  1HA5 A;  2O3G A;  1P9D U;  2CXY A;  4FI4 A;  2KMM A;  4OJL A;  4KTQ A;  3NVY A;  4WJ3 B;  4GSW A;  3NXL A;  5KAI U;  1XNS A;  2YEP B;  2BBC A;  1L8P A;  4IQV A;  4F4W A;  1QZE A;  5DB8 A;  3HVZ A;  3C2M A;  4MEX A;  2KNJ A;  4BDP A;  2KKC A;  4I6P A;  2OEH A;  3SFE B;  2PTY A;  1JCK B;  4FUL A;  3KFU F;  3CAW A;  4IP4 A;  5CR0 A;  2FCM A;  3S1F A;  2N7J A;  3NTU A;  3C5G A;  1V8C A;  1SGG A;  2R8D A;  1CUK A;  4JE3 B;  5F9N A;  3CMM B;  3AE4 B;  2KJH B;  1UPH A;  4E8G A;  1QQ5 A;  4HNL A;  1YNT E;  3R7Q A;  1S77 D;  4A3O A;  4II2 B;  2N9E B;  4AOF A;  4FJV B;  4YCX A;  3QEA Z;  8ICA A;  2TSS A;  1NK4 A;  2J4X A;  2KC2 A;  1N60 A;  3H4D A;  5F9L A;  5KFB A;  4HDO A;  3PS6 A;  4F4K A;  1K52 A;  1QOB A;  2JY6 A;  2E1E A;  2Z0E B;  4LNN A;  3EA6 A;  9ICQ A;  2IND C;  2ZIX B;  2ZUB A;  3MC0 B;  2KTR B;  4N58 A;  4IC7 B;  4K2S A;  4AP4 C;  2HBM A;  1ZET A;  3Q8R B;  4IT1 A;  4BXO B;  5KFQ A;  2AHO B;  2ISO A;  2FI1 A;  3A9J B;  4EM4 A;  2UYZ B;  2K8C A;  5DDY A;  5J2E A;  1NJZ A;  2FE9 A;  5KT2 A;  4AJW A;  3H0R B;  1U4A A;  1I42 A;  2DKZ A;  2BQ3 A;  5AM1 A;  3GD3 A;  4FHK A;  1SIF A;  1WXV A;  2W9B B;  2LGS A;  5D94 A;  7ICO A;  3IHP C;  4MJS B;  2R2O A;  4HNC A;  9ICW A;  2ZIX A;  2KTR A;  3ES8 A;  2Z7J A;  1OEY J;  5AHX A;  3NGD A;  4FS1 A;  1L6V A;  1P3Q U;  4J9P A;  5C1Z A;  4ZRP A;  1T3Q A;  1VRA B;  1MQ3 A;  2K6Q A;  3OW1 A;  3ML8 A;  3V6J A;  1MUC A;  2KQS A;  5GXG B;  1F0X A;  2OZ8 A;  2BC0 A;  7ICG A;  5L6G A;  3N7R C;  5HHI A;  4J9R A;  2MJD A;  4K7W A;  5HR6 A;  5TIS U;  4KLE A;  3MFG A;  4E4U A;  3W1S A;  2WAQ C;  2RAB A;  1JWM D;  3FC4 A;  4UDU C;  4RGO S;  3RMK C;  1BZL A;  1NEL A;  4C4R A;  4MJS A;  1MJD A;  1L6U A;  3AU5 A;  2W43 A;  3IHQ B;  2W7P A;  2P35 A;  2QCZ A;  3FIL B;  4BV6 A;  4MDK E;  2ZJ5 A;  4BWJ A;  4UBC A;  5IN7 A;  3H0L B;  2K39 A;  1ZR6 A;  3OTQ A;  4ECU A;  4KPR A;  3R1Z A;  3STP A;  3QUQ A;  2V9H A;  1ZQ1 C;  2JXJ A;  5D3D A;  4US9 A;  4EYH B;  3N97 B;  4IL0 A;  1TKD A;  2QSD A;  1WMH A;  2KVC A;  3WKC A;  2JEJ A;  2LZ6 A;  1ED1 A;  3T4W A;  3AQE A;  3ZI4 A;  3GB1 A;  1SXT A;  4PHA A;  2Q5W D;  2QC8 A;  4ICA A;  2W82 A;  2DWQ A;  3R3M A;  5DG9 A;  4LDT B;  1WIA A;  1XO1 A;  5J2D A;  1V6E A;  4M6U A;  2WDW A;  3R66 C;  3FIL A;  2GR2 A;  1C78 A;  4XC2 A;  4KLO A;  3GRS A;  1WSP A;  5D3I B;  4DQP A;  1GOZ A;  4IC9 A;  1HUZ A;  4F5Q A;  4K4G A;  2AH5 A;  3UQA A;  3Q69 A;  3PRZ A;  3M6K A;  5ALW A;  1E8X A;  2V9W A;  4M04 A;  3ZLG A;  3OJU A;  5HNK A;  2ZZP B;  4MHV A;  4W9H A;  4ZYS A;  4WWN A;  1AHV A;  2M17 A;  3NVV B;  4H4X A;  3MHS D;  3M9O B;  2RGF A;  3EAO A;  3NZG A;  2PTX A;  4O1N A;  3PRM B;  4UB6 U;  3TSJ A;  2KG5 A;  5ALV A;  4DSF A;  8ICQ A;  4YSZ B;  5ADZ A;  2F1J A;  4XZ4 A;  3RCZ A;  3D47 A;  3C5F A;  1P1A A;  3QU2 A;  1N61 A;  1E8G A;  2UUU A;  4J9L A;  1B4F A;  2MAX A;  1Q8K A;  1UD7 A;  4ZRK A;  3PLU A;  3V05 A;  1ZX9 A;  5HG2 A;  4KSL C;  2HHT A;  1AOG A;  2KN4 A;  3PW5 A;  2OX4 A;  2DW6 A;  3PSP A;  3E56 A;  2J0K A;  3QUB A;  4GN1 A;  4AUQ C;  1ZDV A;  2N9L A;  1MI0 A;  1R7S A;  3RI7 C;  1HTQ A;  1ZQE A;  4GDL B;  3PSF A;  2MBO A;  5F3X B;  9ICF A;  1JEH A;  3SN4 A;  1WX9 A;  2H3Z A;  7ICJ A;  4DQS A;  3ALR A;  3O65 B;  2I2Y A;  4XX5 A;  4JMU A;  2GQU A;  5KHQ A;  5GTI U;  1MA7 A;  1NEK B;  3QLD A;  2KZR A;  2GH5 A;  2BT6 A;  4H4V A;  3KKA A;  1L0Y B;  2GRI A;  1TZZ A;  3MGI A;  3C2L A;  2FE8 A;  3A4S C;  2M1M A;  1F3P A;  3KWV A;  5JXV A;  1A70 A;  2V3A A;  3HSU A;  3CF6 E;  3PW0 A;  2BC1 A;  3SN1 A;  4DFM A;  3C1Y A;  2DGZ A;  4J03 A;  5ALQ A;  4ECX A;  3GY1 A;  4GDL A;  3DVN U;  4J6I A;  3TL5 A;  8ICF A;  5T14 A;  1D9F A;  4H4R A;  3Q8S B;  3EC8 A;  1VCB A;  2V3N A;  3IC9 A;  4L1B A;  4F4Y A;  4GXB A;  3I6E A;  3RJK A;  3H8A A;  1F44 A;  7ICM A;  1NZP A;  1V59 A;  3H12 A;  2ZXI A;  3DVG Y;  2XY6 A;  3RB0 A;  2L52 A;  3FYH A;  1H8C A;  3KHL A;  4MKS A;  1T7P A;  4K1W A;  2BGW A;  1N5W A;  1VZ7 A;  3SMV A;  3CGC A;  3BIN A;  2GBK A;  4WQM A;  5KTQ A;  4W9D A;  4RNN A;  4TQS A;  4H1Z A;  2OAI A;  3PGE A;  1DK3 A;  2WU2 B;  1GV4 A;  1EF1 A;  1SJH D;  2B3A A;  4HCL A;  3AEB B;  3DEE A;  1V86 A;  1UGM A;  1V38 A;  5E6P A;  4DL3 A;  3RT3 B;  1V81 A;  2D5G A;  5K4L A;  1TIF A;  1SV0 C;  3H70 A;  2ZJA A;  2C7M B;  2PLP A;  1OQQ A;  2GQW A;  1AAR A;  4QWD A;  2DPI A;  2L0F A;  2XBB C;  4KGT A;  2MLB A;  1F52 A;  2N4F A;  1P43 A;  2CDU A;  3RJA A;  3FKY A;  2K4H A;  2GGJ A;  2HBL A;  5DBA A;  9ICR A;  2NPT B;  2EQY A;  2JWZ A;  3BQ0 A;  3D2Q A;  5JRB A;  4IQW A;  4REZ A;  2UVW A;  1GC6 A;  3S5S A;  4ML8 A;  5D46 A;  2MBQ A;  5AIC A;  1ZKQ A;  1J2N A;  2W04 A;  7ICE A;  1EWC A;  2FYM A;  4NEV A;  4WQO B;  3AN1 A;  3QEB Z;  4GOC A;  4B9M A;  3QK0 A;  1S5L U;  2PS2 A;  2WF9 A;  3AE5 B;  3PWI A;  3L13 A;  3S1C A;  2OO6 A;  2K8A A;  4H4S A;  4QZG A;  3PO4 A;  4WAA A;  5DB6 A;  4EE2 A;  3B97 A;  1R4N I;  3RB4 A;  1I19 A;  5J2H A;  2JVC A;  3QAQ A;  1X2G A;  3TWB A;  2HJ8 A;  3MR3 A;  4KLI A;  4WH4 A;  5CB1 A;  5KL8 B;  2HXT A;  3A9K A;  3DVG X;  1KL9 A;  1P7E A;  4NLZ A;  2HHX A;  2WXF A;  2BQR A;  4KKI A;  1DII A;  3RRH A;  4JLC A;  2N9X A;  1ZMC A;  2DQN B;  3VUW A;  2OCE A;  5FJR A;  1LXD A;  3LYY A;  1STE A;  2UVR A;  4ED2 A;  4BCA A;  1KW4 A;  4UAU A;  3J9C A;  4UAR A;  4NXZ A;  3QNM A;  5LNK 1;  4NLC A;  3TQP A;  3QU7 A;  2KWC A;  3RJ8 A;  1NHP A;  4E5T A;  5E79 U;  5LXI B;  4FJY A;  4AYB F;  2R8K A;  2XO7 A;  2BCS A;  7ICT A;  3TOY A;  5JCI A;  2Y9U A;  1U47 A;  2IDY A;  3ZRF A;  3D6J A;  4ROP A;  3OHB A;  7ICU A;  4ENL A;  2HQM A;  1WXM A;  3J81 j;  4F5R A;  2DKX A;  2NPX A;  2EQ8 A;  4H83 A;  5IAA C;  2P3Z A;  3Q3F A;  4P6V F;  3N6J A;  1WM2 A;  1JPD X;  4IZG A;  5KL1 B;  3IT6 B;  5AI9 A;  1KKX A;  3PLV A;  2N1W A;  3NZU A;  1FRR A;  2KAC A;  3HIL A;  1N60 C;  1ZP0 B;  3II4 A;  3UJR A;  3DK8 A;  5DQI A;  2O6K A;  5CRX A;  2FCQ A;  4QZA A;  4HPN A;  3BQT A;  1GSN A;  1NHQ A;  2PMV A;  2G09 A;  2KX0 A;  2PU1 A;  4ZA0 A;  1TS5 A;  4HCN B;  3ABV B;  2RK5 A;  2I5H A;  2W3S A;  3RTV A;  1KFS A;  2OG9 A;  3RZW C;  2PFQ A;  4GB9 A;  4G9B A;  4RCO A;  3RAX A;  4IP5 A;  4AP9 A;  1CQV A;  1ZQZ A;  5ALG A;  4QZH A;  4R3D A;  1TGZ B;  3BSM A;  5AIB A;  1D5M C;  2M56 B;  3BYT B;  4PZF A;  1ZJN A;  4ECQ A;  4KX3 A;  1RDF A;  3MBY A;  2JYT A;  3IG8 A;  2HOI A;  2KZ3 A;  3PW2 A;  2QGY A;  1GPX A;  3UXN A;  2BPF A;  4DYE A;  2FMP A;  2VA3 A;  2M0N A;  3H40 A;  4CRX A;  1M6Y A;  4JWN A;  3TWA A;  3VH3 B;  2D07 B;  2REX A;  2MU2 A;  5CP2 A;  2UVU A;  4C4V B;  1T3Q C;  1XC9 A;  1GRF A;  3THU A;  4Y2P A;  2HHV A;  1L6N A;  3TAP A;  3UIN B;  2V4R A;  4TKN A;  5DB7 A;  3DG7 A;  3QX7 A;  1HEK A;  3MR6 A;  5L1M A;  5AI8 A;  3LVW A;  2D6F C;  2MP2 B;  4G3X B;  2KMA A;  1PGA A;  9ICN A;  4R66 A;  1WZ3 A;  2G4D B;  2WDT B;  1V1O A;  1KLV A;  3MWC A;  2YVJ A;  5CHW A;  1GRE A;  1NDA A;  3UPQ A;  3AE2 B;  1AYF A;  2KJ6 A;  4I2H A;  2PMZ F;  5KG2 A;  4LDT D;  3WK5 A;  1WWU A;  4DBG A;  3RFZ B;  2Q4W A;  5GMV A;  3I99 A;  5AEK B;  4C4V A;  3U26 A;  1NDD A;  5J8Y A;  3AU6 A;  3WAN A;  1TYT A;  2OZ3 A;  2CJO A;  1OEP A;  1UH6 A;  4HPL B;  2VIX A;  5ALZ A;  5L83 A;  3GV8 B;  2MP2 A;  8ICB A;  3K75 D;  3F2C A;  3TUO A;  3IG3 A;  4FBU A;  5J0S A;  3RYT A;  1SL1 A;  1L7P A;  1BPB A;  1BPE A;  2JYE A;  1RG6 A;  1UUP A;  2NRV A;  3V72 A;  3OJ4 B;  3ZNI D;  1W1M A;  4KWS A;  3R07 C;  4B6W A;  2LXC A;  1M94 A;  1MG8 A;  4ED8 A;  3VC8 A;  2C60 A;  2GQT A;  5AK5 A;  4C00 A;  5KFG A;  2JRH A;  5ALF A;  2Z59 B;  3ZYY X;  4K3C A;  4HWI B;  8ICI A;  3AU2 A;  7ICN A;  2H89 B;  3K4G A;  3EZ5 A;  4QZF A;  4C8O A;  1C20 A;  1S7M A;  1JWS D;  2TPR A;  1LQB A;  1XLN A;  3ETR B;  2DAF A;  4ECR A;  1ZQP A;  3MC8 A;  1ZQH A;  3BS5 B;  4YXJ A;  4ED7 A;  1XSN A;  3DDC B;  3BVZ A;  2QIL A;  2ZIW B;  1X9W A;  3KW5 B;  4O3M A;  3RNB C;  4Z6C A;  1J97 A;  1RLF A;  1V80 A;  1YQB A;  4QAY A;  4YL8 A;  4C0Z A;  3P4S B;  3N28 A;  1ACC A;  1PYW D;  5BMH A;  1YEY A;  2ZZ0 A;  3VCN A;  4F50 A;  1XQQ A;  2NBV B;  4HLE A;  3V7J A;  1JWU D;  1GRB A;  2F1H A;  3PZP A;  4EMI A;  5E6J A;  1X2H A;  4TSS A;  1L8O A;  3M9M B;  3U7Z A;  4N6E B;  1N61 C;  5JCM A;  2BTE A;  5J29 A;  4M01 A;  4J9Q A;  1PVR A;  4BUR A;  3PSI A;  3NS1 B;  3ETR A;  2DLB A;  1MQ2 A;  5J18 A;  3BS5 A;  2KJR A;  2ZIW A;  4NJ8 A;  1E9M A;  2CKH B;  2L3Z A;  3VDG A;  4O0I A;  3Q3N C;  2W8K A;  4DS4 A;  4IQU A;  2YMQ A;  2DEN B;  2XH4 A;  5EE3 A;  3H8M A;  4I28 A;  2WP5 A;  2MA1 A;  3PV8 A;  3Q8L A;  3SDL C;  2RDG A;  2LGD A;  2GOL A;  3W9C B;  4J3O D;  1ZQQ A;  4DOA A;  1GRH A;  5TR5 A;  1DOX A;  3H1U A;  3HRD D;  2EZX A;  3PVX A;  2KFK B;  2L05 A;  4BBY A;  3GO2 A;  3ZVI A;  5C0Y A;  4YSY B;  1MOK A;  1HSK A;  3KKA C;  3Q8Q B;  2Y3S A;  3NS1 A;  4I2E A;  2RDI A;  4O5C A;  4GFJ A;  1EBH A;  4KIK A;  3UQ0 A;  3KZI U;  4YXD B;  1ZQM A;  3E0F A;  4HJG E;  4ADW A;  5KT6 A;  2LMR A;  1IYX A;  1WXQ A;  5DG8 A;  3RB3 A;  4MGZ E;  3L3F X;  1OUQ A;  1FXT B;  1I4P A;  2IPK D;  3N1Z C;  1CMX B;  1DNC A;  4E6M A;  1ZE3 D;  1YN4 A;  1RYU A;  2LPE A;  3PV1 A;  3EKG A;  2BWE S;  1OEY A;  9ICP A;  2SEB D;  4JV2 A;  4Y2T A;  2KFK A;  4FZN A;  3ONN A;  1F8W A;  2MNR A;  4EUT A;  4KDL B;  3NHE B;  4MEY A;  2HHS A;  4J3Z A;  3DOW A;  4PHP A;  2ASL A;  2WF5 A;  2E8N A;  2YML A;  5JZE B;  1N5W C;  2NBU A;  2CHZ A;  2PTW A;  2N7D A;  4KLH A;  4YWO A;  4J9O A;  4PT5 A;  3EJE B;  2X50 A;  4BJQ A;  3NOB A;  1N62 A;  1ECW A;  4A6Q A;  4HN8 A;  2ZTC A;  2A1J A;  1Z2M A;  4ELV A;  4GIS A; 
#chains in the Genus database with same CATH homology
 4KX6 B;  3L4P A;  2K9X A;  3W5V B;  1N5X A;  1KFY B;  3HRD C;  3WCQ A;  3P4P B;  3T3O A;  5AE1 A;  3LXF A;  4MAC A;  2MJ3 A;  1T5X D;  1XLQ A;  1L5P A;  3BYY B;  2NTS A;  3JS8 A;  2INN E;  2QPM A;  1KLG D;  4TQ1 A;  1TKE A;  1E10 A;  2WXN A;  1JAL A;  4MH8 A;  3NVZ B;  4YTN B;  3TEY A;  3A7A A;  1L0V B;  2QEJ C;  5EE9 A;  2IGG A;  1WGK A;  1HA5 A;  2WXJ A;  2O3G A;  2KMM A;  1C4A A;  1L4D B;  3NVY A;  5AE2 A;  2KDM A;  2YEP B;  2BBC A;  3NVV A;  2JZP A;  3HVZ A;  1X2G A;  3IT4 B;  2WLB A;  1I4R A;  1XO3 A;  1VR9 A;  1VAO A;  1QQR A;  2L1A A;  3SFE B;  1GB4 A;  1JCK B;  4AS1 A;  1SB3 C;  5BYS A;  3S1F A;  2N7J A;  2K3U A;  2LJI A;  1K53 A;  1L0X B;  1V8C A;  4OW0 A;  1FNU A;  3T3N A;  3NVZ A;  2R8D A;  4JE3 B;  1J7A A;  2ON8 A;  3AE4 B;  4TVW A;  3P63 A;  2EXR A;  3Q8B A;  2IPI A;  1YNT E;  1EU3 A;  1SSN A;  2OHF A;  4C7Y A;  2BVF A;  4HRO A;  5C2T B;  1YN5 A;  4HKQ A;  1PFD A;  1XEE A;  1SIJ A;  2TSS A;  3I9V 1;  3D2H A;  2E5A A;  2WXQ A;  5G5H B;  2J4X A;  4MLA A;  3DED A;  1N60 A;  1F2R C;  1V1P B;  4JWU C;  4WIP A;  1K52 A;  1QOB A;  3NRZ B;  3EA6 A;  5HMR A;  2ZW1 A;  1ZXI A;  3MC0 B;  4N58 A;  2N9K A;  2WDR B;  1FNW A;  2JX5 A;  1VZ8 A;  3HVD A;  2DYO A;  2J42 A;  3E9S A;  1FFU C;  1WVE A;  4L2Y A;  4XWT A;  1E0Y A;  4NAW B;  1PDX A;  5I4D A;  4H2A A;  3D2J A;  3EUB 3;  2PLS A;  3GP7 A;  1N63 C;  1ZOY B;  2IGD A;  3DWM A;  3POP A;  1BUI C;  3ZJU A;  2WXI A;  1V1P A;  4HEA 1;  2EEL A;  3AEA B;  1CK1 A;  4FXC A;  3NRZ A;  1FIQ B;  2Y5C A;  3LB8 C;  4MM3 B;  2Y3R A;  2PTL A;  4PWC A;  4YSX B;  1L6V A;  2GB1 A;  4ZRP A;  1T3Q A;  1VRA B;  1YQ4 B;  3BK1 A;  2WXO A;  1VQZ A;  4KKJ A;  5FKA C;  5GXG B;  3ZGZ A;  1F0X A;  3FWA A;  5L6G A;  2MJD A;  3KQ4 A;  2CU3 A;  3R2I A;  3MFG A;  2R61 A;  1W1L A;  3W1S A;  2AQ2 B;  3AE3 B;  3MJ5 A;  1JWM D;  4GLS C;  1V97 A;  3FC4 A;  4UDU C;  4RGO S;  3P42 A;  1FIQ A;  1L6U A;  2W55 A;  1TKG A;  3EUB 2;  3AE1 B;  3FIL B;  4OHJ A;  3BII D;  2V3P A;  1SE4 A;  2INP E;  4P16 A;  1ZR6 A;  3FAH A;  1KTK A;  3IAM 1;  4RGT A;  2VZK D;  3MHZ A;  2BVH A;  5D3D A;  2LMC A;  4US9 A;  1QOG A;  2BYT A;  1DYQ A;  5TSS A;  1C4C A;  2QSD A;  2WDV B;  5FXE A;  1XCT L;  3GB1 A;  4KGR A;  1SXT A;  2Q5W D;  1DGJ A;  2P3H A;  2W82 A;  2DWQ A;  3RPF C;  3URY A;  2E3T A;  1MBT A;  1XLP A;  3Q8E A;  3PZ8 A;  2WDW A;  2Z8L A;  4GDK B;  3FIL A;  1C78 A;  5T8I A;  2WP9 B;  1WSP A;  3CWI A;  5D3I B;  1GOZ A;  4A90 A;  2BS2 B;  5D7G A;  3SEB A;  3Q69 A;  3SR6 B;  2N0S B;  3TEZ A;  3FW8 A;  4OAL A;  3IAS 1;  1E8H A;  3R8B A;  2B76 B;  1D5X C;  4O95 A;  3NUH B;  1QLT A;  4ZYS A;  1AHV A;  3A7R A;  3NVV B;  4IKG A;  1I7H A;  3W8X A;  3S1E A;  5I1W A;  1ZDX A;  2K0P A;  4O1N A;  2AXR A;  4USA A;  3TSJ A;  5ADZ A;  4YSZ B;  1JQ4 A;  2H88 B;  3DWG C;  2WNM A;  1AHU A;  5K8E A;  1N61 A;  1E8G A;  2JWU A;  2UUU A;  3VRB B;  4JWS C;  2I38 A;  3V05 A;  1F0Z A;  2MBR A;  3SR6 A;  2ACZ B;  5BMI A;  4PVK A;  5AUI A;  5HG2 A;  1F2R I;  1QT9 A;  1WYG A;  2KN4 A;  3Q8C A;  4A9A A;  1YMH E;  3E56 A;  1FXA A;  1IBX B;  1FCL A;  1K50 A;  1I4X A;  2JU6 X;  1ZDV A;  2N9L A;  1MI0 A;  1LO5 D;  1JRP A;  1R7S A;  2LFI A;  5EE0 A;  2VAO A;  4GDL B;  1YJJ A;  4B0M A;  2AQ1 B;  1D4B A;  2R2Z A;  4JX1 C;  5AWV A;  5HHZ A;  4ZOH C;  2I2Y A;  2GQU A;  3R2T A;  1UGJ A;  3AE6 B;  1NEK B;  1TYG B;  2BT6 A;  1L0Y B;  2GRI A;  2IJ0 A;  3BVG A;  3ZQ4 A;  2FE8 A;  3PO0 A;  5FXP A;  2XNA C;  2L83 A;  3VQI A;  1B9R A;  3KWV A;  5JXV A;  1A70 A;  1IBX A;  4A55 A;  3HSU A;  2AX5 A;  3PM9 A;  3B9J B;  4DQO C;  1WWT A;  4TVY A;  4WAF A;  1J7C A;  2ZW0 A;  2V3N A;  4L1B A;  2DBY A;  4HG0 A;  1KH0 A;  1W1J A;  2L52 A;  2OED A;  3P4Q B;  4RF1 A;  4XDD A;  2HTM E;  3A7U A;  3BK2 A;  4PVJ A;  3TSS A;  1GAQ B;  1FFV C;  1N5W A;  1VZ7 A;  1NEN B;  4WQM A;  4AQ7 A;  2OAI A;  2WU2 B;  1UWX A;  1SJH D;  2WXM A;  2WXR A;  3B2F A;  1FM0 D;  3AEB B;  3B9J A;  4RGN A;  2WXH A;  2M19 A;  2L32 A;  1FD6 A;  2PKO A;  1PGX A;  2D5G A;  5HHD G;  2PLP A;  3V3X A;  1OQQ A;  1ENF A;  1I4G A;  3Q8F A;  4KGT A;  4RNA A;  5H92 C;  3RJA A;  4RF0 A;  2RMM A;  4DXG A;  2RPV A;  2WXG A;  1N62 C;  2Y5P A;  2Y08 A;  3O13 A;  1SB3 B;  1Y56 A;  1FNV A;  5D79 A;  4LK0 M;  4REZ A;  5HI1 A;  1D6E C;  4ML8 A;  1ET9 A;  4PWB A;  1XF5 L;  2JQR B;  3PZ7 A;  2MEK A;  1EWC A;  3AN1 A;  3P1M A;  2VFV A;  1C4P A;  1TJE A;  1M4V A;  2FBW B;  3AE5 B;  1D5Z C;  3S1C A;  3H8H A;  1E0Z A;  4EE2 A;  1SE2 A;  2JSV X;  1HXY D;  1VLB A;  2PVO D;  3I57 A;  5BMG A;  4YTM B;  1SEB D;  1I19 A;  3FW7 A;  4PVE A;  4WH4 A;  4PYT A;  3VTE A;  2PIA A;  4ARI A;  3C0P A;  2QKN A;  1P7E A;  1C79 A;  2LGI A;  2LHD A;  2WXF A;  4DNS A;  4BC7 A;  4KKI A;  1DII A;  4ARC A;  1E6E B;  2VFU A;  4ITK A;  4BCA A;  3LYY A;  1STE A;  5L6F A;  4LLG M;  1NVI D;  2WXL A;  1TS3 A;  3J9C A;  4M0W A;  3UI3 A;  3W5U B;  5LNK 1;  5FXF A;  4TMA B;  3RJ8 A;  1HEZ E;  1W1K A;  1T6B X;  1SBB B;  1I4H A;  2IDY A;  5G5G B;  2LEK A;  1DOY A;  1EWY C;  1FEH A;  2DYM A;  3U52 E;  1RYJ A;  2PW9 A;  5MPO A;  1SJE D;  2KWD A;  4XWW A;  5AE3 A;  1QOA A;  1F77 A;  1TS2 A;  2BS3 B;  4MT5 A;  1JWA D;  2X38 A;  4P6V F;  2UUV A;  1BXT A;  3BWU D;  4C7Z A;  1JRO A;  1ZPS A;  2WXP A;  3BVM A;  3IT6 B;  1W1R A;  2BB5 A;  1FRR A;  2KAC A;  2I0K A;  3KLS X;  1FFU A;  5FK9 C;  1ZP0 B;  1N60 C;  1J7B A;  4RGM A;  4WUR A;  3BW7 A;  1JML A;  4NJC A;  1WRI A;  1W1Q A;  1SE3 A;  5G5G A;  2SAK A;  1N63 A;  4XDC A;  1ZXI C;  2PMV A;  3D2D A;  3TX1 A;  3W8Z A;  1TS5 A;  1DZN A;  2CJN A;  3ABV B;  3GS2 A;  2M0A A;  2RK5 A;  2W3S A;  1QF6 A;  3U2S C;  2ICI A;  1EU4 A;  2BW2 A;  2K22 A;  1UWM A;  4RCO A;  1YQ3 B;  2BS4 B;  3CIR B;  1CQV A;  2KAJ A;  4R3D A;  1E7P B;  1E8F A;  1OFF A;  3TEX A;  1D5M C;  2EKI A;  2M56 B;  3BYT B;  2G1E A;  3OWE B;  4DXF A;  4PZF A;  3AEC B;  3EGR A;  2JYT A;  1ZXH A;  1TS4 A;  2AQ3 B;  2JXT A;  2K5P A;  3Q8A A;  1RM6 B;  4US8 A;  1GPX A;  1IGD A;  1W1S A;  1AW7 A;  1XXG A;  2ONQ A;  1W1O A;  1HQR D;  3NVW B;  1ESF A;  3P4R B;  4HRS A;  4EC3 A;  1KF6 B;  1T3Q C;  4YWG G;  3AEE B;  1KLU D;  2NTT A;  3DQ0 A;  2WU5 B;  2VFS A;  1QIL A;  2FUG 1;  3S1D A;  3AED B;  2P4P A;  2MJE A;  1AWD A;  1PGA A;  3PQB A;  1AHZ A;  4Q2J A;  1V1O A;  3AEF B;  3BZD B;  5H8Y E;  2MH7 A;  5BYQ A;  5BYR A;  1JWB D;  2VFT A;  3AE2 B;  1AYF A;  1P7F A;  1TZO A;  1IGC A;  2GI9 A;  4JAY A;  4XE0 A;  1FCC C;  3NVW A;  1CZP A;  3AV8 A;  3RFZ B;  4ZHP A;  2Q4W A;  1VZ6 A;  3ZJV A;  3I99 A;  3LAE A;  1FXI A;  3W8W A;  1SF0 A;  3AM9 A;  3N9Y C;  1DIQ A;  2Q85 A;  1HZ5 A;  3AE7 B;  2V4I B;  2CJO A;  4WWM A;  5HFY A;  2VZK B;  4ZRQ A;  3TUO A;  4ZHO A;  2QIE B;  3AE9 B;  4IOI E;  5HQX A;  2JYE A;  1UUP A;  1W1M A;  3TSH A;  1QLB B;  2NQW A;  2BVG A;  3R07 C;  1ROE A;  2GQT A;  1EM7 A;  3ZYY X;  4KGS A;  3GSY A;  1FRD A;  2H89 B;  1JWS D;  1XLN A;  1VDV A;  4RFB A;  3ETR B;  1MVK A;  1ET6 A;  3AB5 A;  4ZOH B;  3BVZ A;  2QIL A;  3IXS A;  4NAM A;  2LUM A;  2YVS A;  2HDE A;  3FW9 A;  5BMH A;  1K51 A;  1DOI A;  1PYW D;  4C80 A;  1ACC A;  1BML C;  3NZ3 A;  2LHE A;  3P4S B;  4LTU A;  3TEW A;  1PUT A;  1HZ6 A;  4B0E A;  1MBB A;  1OQR A;  1XLO A;  3KWL A;  5G5H A;  1JWU D;  5E6J A;  5AUK A;  1I4Q A;  1X2H A;  4TSS A;  4CQN A;  1GB1 A;  2Y4G A;  3U7Z A;  4N6E B;  1N61 C;  2W54 A;  2QJL A;  1QOF A;  4IDI A;  1IUE A;  2BTE A;  1MHH E;  3MP9 A;  1NYQ A;  1RFK A;  3B2G A;  3NS1 B;  3ETR A;  2DLB A;  1TKY A;  1QLU A;  1C76 A;  3W2D A;  1KRH A;  3KJM A;  4OVZ A;  3ZJT A;  4JB1 A;  1E9M A;  1MPE A;  4C56 C;  4D2K A;  3AEG B;  1WVF A;  4YTP B;  1NYR A;  2Y3A A;  5EE3 A;  2XN9 C;  4UD8 A;  1XCQ L;  4TQ0 A;  2J53 A;  3AE8 B;  2RDG A;  4YT0 B;  2J52 A;  3W9C B;  5FXD A;  1YJI A;  4J3O D;  2IGH A;  3SFD B;  4OZA A;  4RH6 A;  1DOX A;  1VJK A;  3HRD D;  1TY0 A;  4OZB A;  3VR8 B;  3HUI A;  2VFR A;  4YSY B;  4BBY A;  1HSK A;  4PVH A;  2Y3S A;  3NS1 A;  3U4E G;  1FMA D;  1NI3 A;  5FR3 A;  2QMT A;  4N59 A;  5I1V A;  2PLI A;  4XLO A;  4YXD B;  1YN3 A;  4HJG E;  5C3J B;  2YEP F;  2NMQ A;  1ZUD 2;  1RM6 C;  2W3R A;  1WXQ A;  2WQY B;  3C8Y A;  1QKZ A;  4NZL B;  1C77 A;  2BB6 A;  2WXK A;  1FFV A;  2IPK D;  1I4P A;  1Q10 A;  2P13 A;  2PVG C;  1ZE3 D;  3AMZ A;  1YN4 A;  1RWS A;  2WDQ B;  3VRA B;  4A8X C;  2RDH A;  1MHX A;  5EE1 A;  1B1Z A;  2WS3 B;  2SEB D;  4BC9 A;  1JW9 D;  1PGB A;  2E6X A;  1FO4 A;  3VR9 B;  4JPS A;  1UXY A;  1TY2 A;  1C9F A;  3LLB A;  2G9H D;  1L4Z B;  1N5W C;  1UNS A;  4HKZ E;  4L23 A;  2V0G A;  4PT5 A;  2KQ4 X;  1AN8 A;  4OZC A;  1N62 A;  3AH7 A;  4A6Q A;  1CJE A;  3NVY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...