2W54A

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 123
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w54A02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w54A01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w54A03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w54A05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w54A04
3AEBB 3B2FA 3I99A 4BCAA 5FXPA 1I7HA 3C0PA 1PUTA 2KAJA 4LTUA 2BVFA 1J7BA 1X2HA 1WRIA 2HTME 2WU2B 4FXCA 1FFVC 4EC3A 2PIAA 1ZXIC 3JS8A 4USAA 3W8XA 3A7RA 1N5WA 5HMRA 1AWDA 1TKEA 2VAOA 1T3QA 1SF0A 2VFRA 3FW8A 4YXDB 3NVZA 1FFUA 1TYGB 1V8CA 4DNSA 3R07C 2E3TA 3S1EA 2N0SB 1E8HA 1WVFA 2QIEB 3FC4A 2OHFA 3A7AA 1SIJA 5EE1A 2WLBA 5AUIA 3CWIA 1HSKA 1NEKB 5G5GB 1NYRA 2P4PA 2BS4B 5EE0A 1F0XA 1R7SA 2E5AA 3KWLA 2ACZB 3W8ZA 3VRBB 5G5HB 1W1MA 2PVOD 4N6EB 3NVWA 1W1LA 1WWTA 4YT0B 2QJLA 5C3JB 2VFVA 4PVJA 3BW7A 2Q4WA 4PVKA 4BC7A 3DQ0A 4WQMA 3DEDA 1NENB 1N5WC 1NI3A 1X2GA 4PWBA 4PYTA 1E6EB 5C2TB 1T3QC 1FIQB 5GXGB 1FFUC 2H89B 5AUKA 3W5VB 3AE3B 2R2ZA 2M19A 1J7CA 1XLNA 1QOAA 3S1CA 2LEKA 3P4SB 1VLBA 1FRDA 2JQRB 2QKNA 1NVID 3TX1A 1WXQA 1JW9D 1W1JA 5AE2A 2K5PA 5EE9A 4WWMA 1JALA 1XLPA 3B2GA 3DWGC 3AECB 2JX5A 1N61A 1I19A 2WDQB 3AE6B 3AB5A 4YTPB 2O3GA 2Y5CA 3ETRB 4IDIA 3SR6A 2DWQA 3P63A 3AMZA 4ZOHC 1SB3B 2EKIA 3NRZA 4ITKA 1KFYB 3S1FA 5AE1A 1VDVA 3BIID 3HRDC 2EXRA 1QT9A 3AV8A 2B76B 3W9CB 1CZPA 5D79A 2WP9B 2WDRB 1AYFA 3EUB3 3W8WA 1TKGA 2K22A 3NVWB 1QLUA 1ROEA 3NVVB 2PLIA 1YQ3B 1AHVA 4HG0A 3WCQA 3B9JA 3NS1B 3SFDB 3ZYYX 2L83A 2MBRA 4US8A 1W1OA 2L52A 2RK5A 2PLSA 2GQUA 3LLBA 2YVSA 1DOIA 2WU5B 1UWMA 3FWAA 1QF6A 2GQTA 1N61C 3P4RB 4XLOA 2W55A 1ZUD2 4UD8A 3AE1B 2BS3B 1ZP0B 1F0ZA 1YJIA 3EUB2 2PVGC 1L5PA 1L6VA 1KRHA 2VFSA 1OQRA 3AEEB 2KMMA 1RM6C 3DWMA 4BBYA 4BC9A 1VAOA 4C7ZA 1W1RA 5H8YE 4KX6B 1WYGA 3FAHA 4JWSC 2NQWA 3VR8B 2WDVB 1L0VB 2W3RA 1E9MA 2WS3B 1TKYA 1DIQA 1V97A 1VJKA 1YJJA 2WQYB 1N60A 3TSJA 5EE3A 1E0YA 2I0KA 5G5GA 4ML8A 3AE8B 3HVZA 1DZNA 3NVYA 1FXIA 3AE2B 1QLBB 1E8FA 1PDXA 1L6UA 3AE5B 4PVEA 3SR6B 5G5HA 3ABVB 4P6VF 1MBTA 1FO4A 4US9A 5H92C 1FRRA 2H88B 3S1DA 2QPMA 1DOXA 1N62A 4PVHA 4HROA 1QOGA 1JWAD 4N59A 2P13A 1FMAD 3NVZB 3LXFA 1E0ZA 2Q5WD 4JWUC 1AHZA 5FXFA 3P1MA 1WGKA 3AEDB 5HHZA 4JX1C 2K9XA 2VFUA 1W1SA 3PO0A 3CIRB 4PZFA 3B9JB 1RWSA 2MJDA 3AH7A 1FXAA 4C7YA 2Q85A 3HUIA 1W1QA 1B9RA 2DBYA 3A7UA 1OQQA 2AX5A 2AXRA 1UXYA 3SFEB 3PM9A 1DGJA 3GSYA 5AE3A 1QOBA 2MJEA 4C80A 3LAEA 1N60C 1A70A 1EWYC 4O95A 2MJ3A 3FW7A 1WVEA 4ZHOA 1E8GA 2W3SA 1VQZA 1YQ4B 5ADZA 3AE7B 3AE4B 1E10A 5FXDA 1FM0D 1E7PB 1NYQA 1JWBD 2BS2B 1ZR6A 1DOYA 1PFDA 4ZOHB 1KF6B 1J7AA 1XLQA 3FW9A 1N62C 4MLAA 2M56B 4N58A 1N63A 3ETRA 3VR9B 1RFKA 3TSHA 2BVHA 2CJNA 2CU3A 3AN1A 4A9AA 4ZHPA 3NVYB 2BVGA 1JRPA 4YTNB 3AEFB 1CJEA 4JB1A 2BT6A 1N5XA 4JAYA 2FBWB 1IUEA 3RPFC 2G1EA 3L4PA 3AEAB 2VFTA 3NVVA 3HRDD 3P4PB 3NS1A 1DIIA 5FXEA 4HRSA 4YSZB 1FFVA 2W54A 1JQ4A 1ZOYB 3D2DA 5HQXA 2MH7A 1ZXIA 1RYJA 2OAIA 3VTEA 4TVYA 3VRAB 1QOFA 1GPXA 1MBBA 3W5UB 3KJMA 2CJOA 1JROA 1RM6B 3NRZB 1QLTA 4YTMB 3D2HA 1XO3A 3AEGB 4PWCA 1OFFA 1N63C 3AM9A 3AE9B 1SB3C 5MPOA 1AHUA 4TVWA 1TJEA 3D2JA 4OALA 2P3HA 1FIQA 4YSXB 1W1KA 2PKOA 2R8DA 1GAQB 4YSYB 1XLOA 3P4QB 3LB8C
chains in the Genus database with same CATH superfamily
1S76D 3B2FA 1NJXA 2G09A 3ZIMA 4HCHA 5FJPA 2PGEA 2BKRB 4BCAA 3R3MA 3R8BA 3VH3B 2WAQC 4F92B 2BVFA 1XQQA 4MGKE 1WRIA 2E1EA 1TT5B 1V81A 5ALPA 2YMPA 5BPCA 4FN2A 5KT3A 1VD2A 3BOXA 4A3PA 3QHTA 2KTRA 1A6SA 4ED6A 1HZ5A 3GZFA 2WU2B 3RJAA 4AYBF 2R2QA 4ECVA 4B9TA 2HBKA 4CHKA 2P0IA 2NRWA 2PIAA 1OQYA 1MDLA 4BUGA 4QWEA 2XGQA 3RI7C 7ENLA 1B0XA 3KUDB 3V6JA 4USAA 1SJDA 2JU6X 5C23A 1KBUA 3O65B 3VDZA 1I4GA 2F3NA 1T3QA 5G55A 5FJTA 1UUPA 3ZLGA 4KWSA 1L3VA 4BWMA 1KN5A 1C4CA 4GIVA 5DPSA 5ALHA 2FCMA 2KK0A 3UJRA 4ELVA 2XCPA 4OZBA 1ZK7A 3UCCA 1V8CA 4XA5A 5BYSA 2WXIA 1WMHA 4DNSA 1MC8A 2K4EA 4NAWA 2PGWA 3R07C 2WXMA 3CSFA 4MEXA 2N0SB 2AHOB 5HP4A 3OHBA 1BPYA 3PRPB 5I4DA 1E8HA 1WVFA 5JRBA 1DK3A 5DB6A 4IRKA 3WKEA 2W7OA 1ZMCA 5ALSA 4BVUC 3T6CA 5EE1A 2AGQA 3WK9A 2MUCA 5L6GA 3Q8QB 3TADC 1ZQNA 2MBOA 1CQVA 1ONFA 2XH4A 3LADA 4JLCA 3VFCA 4FZLA 2QILA 2BS4B 4RQ1A 3TEXA 1L7NA 2PMZF 2WB1F 3UIPB 4EUTA 4PHDA 2IOHA 4PPXA 4HKZE 4NJCA 1R7SA 2ONEA 4L2YA 1MN8A 4ECUA 3MFIA 5DGAA 1S0NA 2HSZA 2C7HA 3MQTA 3L5KA 4QWBA 2D3AA 5FS7A 5U1OA 2HHVA 1OJTA 2PVOD 5AK6A 4IM2A 4QZCA 3MTNB 2KFKB 1O08A 1W1LA 1EU3A 1WWTA 3BQTA 1S9FA 1GRBA 3RNMA 4O1NA 3KHRA 2HW3A 3BYYB 4Y2JA 9ICWA 5DPRA 4GC7A 3OP2A 4JL9A 1GXFA 4Z6FA 2M4NA 2FCNA 4WAAA 3ED5A 3SD5A 1MA7A 5JUMA 4PVKA 2VIXA 2FMSA 1MFWA 3N1XC 5BYQA 3BQ1A 2CN1A 4GYPC 4BKGA 2KHVA 4YG2A 2C3CA 3CSTA 1NI3A 5JCNA 3H70A 4RQ3A 4GC6A 1E6EB 3WALA 3IT6B 4RNNA 1PVPA 3JPRA 2GMIC 2M1MA 3VVWB 3CGEA 3GD4A 1AN8A 4DQIA 2OYYA 3RB6A 1FEBA 2BCQA 3RCYA 2AKZA 4IQUA 1JWSD 3QX1A 3GD6A 2E6XA 2GR3A 3CB3A 5JHAA 4Y2QA 5HG2A 5KHQA 2O6VB 8ICTA 1WR1A 1CI4A 2M19A 3GS2A 2PJHA 1J7CA 5KFQA 8ICYA 1WGYA 3WAPA 3GRSA 3QPEA 3D6JA 3KZIU 2ATLA 1QOAA 3URHA 2VZKD 1TS5A 4ECTA 4FLHA 3Q4DA 1D5ZC 4OJ6A 2G45B 2LVOA 3GZNI 1VLBA 1FRDA 1NZPA 3RMKC 3SD7A 4BAXA 2JHDA 2MSNA 8ICCA 4KIKA 4O0IA 2P6UA 2BYTA 4NJ8A 4B9VA 4CO7A 2WXRA 4C56C 3QZ7A 1NVID 2FCSA 4W9KA 3B0YA 2SEBD 5D4BA 3OJUA 2GBJA 3ZNZB 1GV4A 5EE9A 2ONQA 1FEZA 3ECIA 4WWMA 4A8XC 4RUCA 3TCAA 4PGYA 3HKZC 2QAEA 3MBYA 2WWZA 2NQLA 3M9MB 1I4XA 4LNIA 1X66A 1C4PA 5E6JA 2JRIB 1Y8RC 3ISCA 2JX5A 1ZDVA 2KLGA 4EQWA 2GBMA 1GERA 5DB8A 5AM0A 1D7YA 2WXGA 3A4SC 1T8EA 2WDQB 4RNOA 4IOIE 3NOBA 3WKDA 3AE6B 3SZ2A 3ZDMC 3TWBA 1LB2B 2RR9A 2BYEA 1GOZA 1Q46A 2DENB 2J3NA 3HSUA 4OJOA 4JPSA 4F5PA 2KG5A 1DYQA 2XNAC 2QDFA 3AMZA 4J9RA 2A4ZA 2GR1A 1TAMA 2MP2B 2B0CA 4ZYSA 1SV0A 2Y1IA 3C5FA 2DGZA 3CGCA 4U6PA 4RCOA 1KH0A 4B6JA 4DL2A 3I9V1 3W9CB 4ZRJA 4LNOA 1PYWD 2KN5A 3B97A 4H4VA 1ZRMA 2OVLA 2G5IB 4RT3A 4BZAA 4C8OA 3NO1A 4E0DA 4H50A 5AKEA 2PA6A 4K8GA 2BB6A 3QNMA 1AYFA 2Y3AA 3DQVA 1Z4OA 3EUB3 2QQ6A 5ALLA 3IJLA 2OJWA 3GE8C 2JV3A 2NVKX 2LZ6A 4DK5A 2HNEA 2Y08A 3C5GA 3EW9A 3RNCC 4WQOB 2NRZA 1FECA 1ZD4A 1WJUA 3DJGX 4I2DA 2R18A 5KFEA 3BQ2A 1TTNA 1DXLA 3NVVB 1HQRD 4H4UA 4HG0A 2QSDA 1P3QU 1RRBA 3WCQA 4HCNB 3B9JA 2PCEA 1MI0A 2W03A 2JWUA 2KVCA 1F77A 4F1SA 3MR5A 1ZQFA 1W1OA 1WI0A 4LLGM 2WGSA 1ZQJA 2MX2A 3DVNV 2K4PA 3ALBA 4H19A 5TR3A 4I2BA 1V9PA 2LUMA 2UU7A 2IO3B 2RDXA 4LNKA 4RT2A 1ZPSA 4GU2A 1MVKA 2JH1A 1UGMA 4W9CA 3IC9A 3OPXA 3B0XA 2L32A 4L1BA 2POZA 5BMGA 1TAQA 5KFDA 4PHPA 2K0PA 3P4RB 4OVVA 2FUG1 5LXIB 4BURA 3SQPA 2FLLA 2NV3A 3UQBA 2DPJA 1WJ6A 1ZQSA 4ZRIA 3KW5B 2PFNA 1UT5A 3MABA 3KHHA 4XC2A 2GSHA 3EUB2 2PVGC 4UAZA 5AM1A 5KG5A 4O3OA 2JXTA 2KDEB 5KG0A 1L6VA 3IG3A 1SGHA 1WY8A 4YR3A 3VTWA 4YWSA 4XE0A 2KMMA 4ECZA 1RYUA 3MDAA 3DWMA 1WZ0A 5KT6A 1X9SA 4PS3A 3SYZA 5C1ZA 5AKKA 4KT2A 1B22A 4BBYA 3U8ZA 2Y5PA 2DL0A 3NJTA 5FS8A 2KJ9A 1MPEA 2AH5A 3BDPA 2FCQA 2LVPA 3IM1A 1L0VB 2KN7A 1CEZA 3CRXA 1E9MA 3V05A 2H3ZA 1KFDA 2P6RA 4RQ2A 2RPVA 2FMQA 1NBFC 1VJKA 4C00A 3FYYA 2NVUI 1BNOA 2LGYA 2G5HB 3TSJA 3PS6A 2F44A 5EE3A 4JB3A 3RR8A 4UAUA 2AQ1B 1E0YA 5JZEB 4LVSA 3CK5A 2QB0A 1C1YB 4ML8A 4XRHA 1FHUA 4F8RA 3Q3JA 3VDGA 3BQ7A 4ECXA 2V9WA 1Y56A 2CHRA 4E8GA 2CU1A 5D3IB 3IAM1 3SU8X 1OEYA 4EEKA 4UAWA 5DB9A 3QUBA 4EX6A 4Y2RA 4I2JA 3JPTA 3EWAA 3ONNA 3DESA 1EU4A 3SR6B 3ZVHA 1SEBD 4BGDA 5IKCM 1S97A 3RJ8A 2EZZA 3UM9A 1BPDA 2KFKA 4US9A 4E74A 2MBEA 3ZTCA 5KFNA 4LCDE 4DF8A 2INDC 4CGZA 1UNSA 3X23A 1Z4NA 1KEJA 3K4GA 1SXTA 1D6EC 1QQ6A 4UB8U 2Y0SC 2Y3RA 3GRTA 9ICJA 4DHJB 1E0ZA 4JWUC 5FXFA 1S0VA 3P1MA 7ICEA 3HJEA 2L05A 3AEDB 5HHZA 4JX1C 4HVBA 1D5MC 4DO9A 3QU5A 1OEYJ 4QZBA 3H4BA 3SDLC 4KLIA 4FBTA 5D6JB 4IC9A 2EAOA 2D10A 2BGWA 2YEPB 2WX0A 1W1SA 2K39A 3NS8A 4K3BA 4ICUA 3V6CB 4FJZA 2HOFA 1SJAA 5KTQA 2MJDA 3RR7A 3ML8A 1FXAA 3L10B 3PMNA 4ZCWA 4CF3A 2BQ3A 4LZGA 1GRHA 3A7UA 1V49A 3DBLB 3MWCA 1EC9A 2AX5A 5KL1B 2BWES 2O6VA 5FR6A 3VH4B 2ZZCA 2K4HA 2OCEA 3SFEB 4KLTA 4O5EA 2D5GA 2X8XX 3EA6A 3GOEA 3GSYA 3N9YC 1QOBA 4WWNA 1LO5D 4HKQA 4JQ9A 1LV5A 1L0XB 3H1UA 2IOFA 4NLZA 1N60C 3ZTDA 4Z17A 3PV8A 3APDA 4UB6U 4O95A 1DXSA 3SHQA 1SJBA 1ZQDA 2KV2A 2LI6A 5KFSA 4RUAA 8ICLA 3PO4A 2GBKA 3G6XA 2HHTA 3Q8FA 3NZSA 3RJIA 1RFAA 5CWRA 1STZA 2KOBA 3WK8A 2AEHA 2OZTA 2W3SA 6ENLA 3GIJA 1X9WA 1BMLC 1V6EA 4M8MA 2JRHA 2WXOA 5BOFA 3AE7B 2EZXA 4XX5A 4P1CC 1E10A 1L8OA 7ICNA 1KM7A 1E8XA 1S7MA 1FM0D 1E7PB 1NPXA 1NYQA 3L5OA 3W1SA 2XY6A 4DYEA 4DFJA 1OUQA 1ZQVA 3U4EG 3A0HU 5KFGA 1KF6B 1CUKA 3M8SA 4ASWC 4BOSC 4RNMA 2DZJA 4EENA 2JPHA 2NBWB 2GI9A 3OJ4B 1ZETA 5AHXA 4FX9A 2HE7A 1MHHE 3Q8KA 4DSKA 9ICFA 1NKEA 3RTVA 1RXWA 3M62B 4HAIA 2BHNA 3MGVA 1HEKA 2QLTA 3RB0A 3QCAA 1WXSA 4H4SA 4ED0A 3MY9A 1N63A 4NLGA 2PP3A 3VR9B 5KFZA 4DS4A 3Q69A 4OJLA 2VJ5A 2DYMA 1L7PA 4EYIB 3PO5A 2JZ3B 1J97A 1CRXA 3VQIA 3GIIA 2MP2A 2KE7A 2EANA 3V7KA 2MWSB 3W1YA 2MSED 1KFSA 1NKBA 1RQLA 2DKXA 1P43A 2DFLA 1H8CA 3BVGA 1W6TA 4QZGA 1L7MA 4EWJA 2AJQA 4R65A 3D2SA 2ZJ8A 8ICQA 4IWOA 4ZHPA 4EEYA 3DBHB 4RMAA 4RNAA 4OJPA 1F1HA 1P98A 1OXJA 2BVGA 5IIIA 1MSWD 2JYEA 2KMCA 2N7EA 2NBUA 2ZCBA 2N4FA 3AEFB 1KLNA 3I28A 2JXJA 3T9PA 1N5XA 1WXVA 4ADWA 1IUEA 2F8LA 3LB8A 3PTFC 2KO3A 4ANUA 3H8JA 4RGOS 1YZ6A 2N9PC 3AEAB 1ZQIA 4A6GA 2WOWA 3MSYA 4F91B 2J42A 5B5EU 4K7WA 3NVVA 4AP4C 1BVSA 4FI4A 5ENLA 3G6YA 5DBBA 3F5EA 2A19A 5KG6A 4XGAB 1L8PA 3DG3A 4MEYA 4UASA 5EDSA 3CAWA 4UW9A 4R66A 3Q8EA 4MT5A 5JTIA 3WK7A 4UAYA 3ZXVA 1JQ4A 1ZOYB 3ZDAA 4BBNF 3D32A 3UXOA 3D2DA 1IXRA 2KJ5A 3H7SA 5IIMA 4QZDA 2I2YA 4UARA 4UB3A 1YX5B 2KTQA 4EKUA 3D2QA 3TSSA 2ASDA 2X38A 3TEWA 2KWDA 1C7YA 1ZQUA 3RJKA 3U26A 1V1PB 5J29A 3ENEA 1YN3A 2CDUA 4PHAA 2JEGA 3GV5B 1PDZA 1YEYA 2K6DB 3PT2B 4Z1YA 1C78A 1PK1A 4LJOB 2QJMA 1C76A 4AQ7A 4MM3B 2IJ0A 4Z6EA 5J0XA 1HEZE 1XO3A 2MRPA 3ZD9A 3IV6A 3L3FX 5DCNA 2IHMA 2HVHA 1MHXA 1C79A 5CX3A 4GMEA 4Y2SA 3LDAA 4DXKA 2YVFA 4RU9A 1ZE3D 4YD1A 1DGSA 4K4GA 4HPPA 3MUCA 3H40A 1RAXA 3PK7A 5KFOA 3I1YA 5TR5A 4MSQB 1VR9A 3TADA 2MEKA 4YQWA 3JYUA 9ICMA 4TVWA 3KLSX 3C0RB 3HM3A 2F1HA 4DL3A 4A55A 2FPKA 3VCNA 1FIQA 1W1KA 3A1QB 4DQSA 3AU6A 3N7PD 5ALVA 3PMLA 2EAPA 2WXLA 1GAQB 5DGBA 4FJYA 5J8YA 2A3VA 2MBBB 5LLIA 4DL4A 3CXBA 2GO7A 3ZNID 4I6LB 3AEBB 2GB1A 2NO4A 5IO9A 2N1WA 1U4BA 3C0PA 2RDIA 1ZQZA 2HHXA 2QDEA 1RXVA 2Q4TA 4KMUA 2E8OA 3PW5A 4IWQA 5D3DA 5JRTA 5J17A 4IKGA 5AZHA 4HNLA 5IIKA 2INPE 4KLUA 2WXFA 2E8NA 2C60A 4FXCA 3LWMA 4O3NA 2JVCA 5DG7A 4DBGA 5FR3A 1UA1A 2WXPA 2I6XA 3C1YA 4Q8FA 3PX0A 5ALUA 2LYBA 2D3BA 4DXAB 2WPFA 9ICGA 3M3JA 3DEEA 4NZLB 2JR5A 3UGBB 1AWDA 1MRAA 3MGHA 3NASA 3H8WA 4YP3A 1KTQA 4GXIA 2TPRA 2KKPA 2ISOA 3U7DA 3RH6A 3SJNA 2ZTCA 3N28A 2Y9TA 1BPXA 4OO1J 4K2SA 2EH9A 5DQIA 7ICTA 4DHZE 4K7SA 4EMJA 2JMGA 5DG8A 4F4XA 4IQWA 3URYA 4PK1A 3S1EA 2BW2A 2AQ4A 4ED8A 3LVWA 2R8HA 1IGDA 4YXMA 2WF6A 2QIEB 3FC4A 2AQ2B 3C29A 5JH5C 3GFKB 4M9HA 4Y2YA 1E5WA 2MNRA 1D8BA 1JXLA 1SIJA 3OJSA 1NK9A 1GB1A 4R8UB 2J0JA 5AUIA 5AZFA 2A8XA 1K1QA 1ZD5A 1WRDB 3CWIA 1Z1VA 2KICA 2OXOA 2ZG6A 4NJ6A 4XDCA 4IQVA 5ALWA 3H8HA 5G5GB 5L1MA 4MFFA 4RZRA 3SV4A 1NYRA 5AM4A 1IP9A 4IL2A 3Q3NC 3ES7A 5IDZA 3ZO5B 5EE0A 2JEIA 2L00B 4IL6U 4F93B 1TZZA 2PMVA 2ZCCA 4F4YA 3JW0X 1HXYD 2DW7A 4RQMA 1ZDXA 9ICHA 2RPQA 1UH6A 3KWLA 2QGYA 4F5NA 1X6JA 3W8ZA 2DUYA 2NO5A 3ORYA 4NNJB 8ICSA 2WHEA 3ZUNA 4I2IA 5HKHA 3NVWA 4C4SA 4DSLA 3W2DA 4FZMA 2QJLA 5C3JB 1I42A 4CF5A 4PVJA 3RGTA 4RGNA 3PSIA 3ZRCA 2N9XA 2LM4A 3T8MA 2J0KA 4M0WB 3LDZE 3PWGA 2DW6A 4M04A 9ICOA 2G4SA 3DG6A 3R0UA 2BDUA 1NENB 5BMIA 5JU5A 4PH5A 1XXGA 2L8JA 5ALXA 2LYAA 4ED3A 1LGRA 2WXJA 3I5JC 1D3ZA 1SIFA 3FDSA 4P1BC 1V38A 2M8SA 2MW5A 4PWBA 5AI0A 4LNFA 2ZXHA 2KACA 4ACFA 3QUCA 1BKHA 3H0MB 1SWVA 3N1YC 2Y9UA 1TY0A 3S47A 3PR4A 5L1LA 3H0LB 3TIXA 1NK4A 3H8MA 4G0NB 1FFUC 5IAAC 1IBXB 5J0RA 2CR5A 2H89B 5CTRC 3WKBA 1XC9A 4F7ZA 2HZGA 4NEVA 5DLFA 3QE9Y 1BPEA 4EZKA 1XEEA 5EU9A 3KD3A 1YX6B 3AE3B 4KZCA 1ZX9A 4J9QA 1F5SA 1RYRA 1NNLA 4H4XA 2PMZC 5AM3A 5J2GA 3KHLA 4ED1A 2BPFA 1MNSA 3IVFA 2GL5A 2LRWA 4S17A 2RQ5A 3K1RB 2MA9B 2DF4B 3Q14C 3SQIA 4PS8A 1YQZA 2DAJA 2DNFA 3CMMB 3ZLZA 4KLQA 3AEVA 2KZZA 2WBAA 2GRTA 2K6QA 3U9IA 2JT4B 2NCNA 4BKTA 3P2BA 3RNEC 2QKNA 3NHEB 5ALDA 1WXQA 3TX1A 4QIWF 3PLUA 1W1JA 4PGQA 5K4LA 2GRIA 2XCAA 4EELA 1HUZA 3DVGY 3PW4A 2L0TA 3GILA 2O6KA 1H38A 8ICFA 1XNSA 3PSFA 4FO6A 3BK2A 5AKJA 3DWGC 1KQQA 3GD3A 3QU4A 5E6OA 4J9MA 3N4EA 3CYMA 3H7PB 4ECQA 3SN4A 1I19A 5AI5A 5J2JA 5KNIA 3EPGA 2K89A 3DHIC 3RZFA 1EBHA 2KIWA 2KX0A 2LGSA 3ZNGC 1ZQEA 3HIZA 4UQGA 4BKSA 1C9FA 2ZVOA 4B0EA 1TK5A 1ACCA 5J18A 2O6VD 4EZ6A 2UUUA 5AWVA 1MO9A 1FNVA 5KFBA 2IGDA 2RLTA 1UWXA 1ZQKA 2NPTA 3CXOA 2JZPA 3RCZA 2ZJDA 3ETRB 1V1PA 2DWQA 2F1IA 3PQBA 5J2AA 4ZOHC 1NI2A 2IO0B 4O3MA 4ITKA 1KFYB 3LJ3A 1NHPA 3UGVA 4CF4A 4U7CA 2R8KA 3PY8A 2Y1JA 5AKLA 3DIPA 2FE9A 1QT9A 3HRDC 4MM3A 1ZQMA 3RT3B 1PDYA 3AL0B 3BVZA 3RNBC 4ZYNA 2IOFK 1S8OA 3M63B 1K5OA 3DH9A 3KYCD 3N6HA 2XH7A 3W8WA 2KANA 2BCUA 2XN9C 3IG5A 3T5HA 3VTVA 1OW5A 3C21A 2O2VB 2EQYA 4P0PB 1E7UA 4DFMA 2ZIVB 5AI6A 3CT2A 2P8BA 3SFDB 3GV7B 3DBLI 3V3XA 3NG0A 3PGEA 2MBRA 4US8A 2G08A 4W9JA 3TW9A 4RQ5A 1D9DA 5FMHA 1ZMDA 2D6FC 2PSNA 4HDOA 2WDTB 3PZDA 3DVGX 3OWEB 2F8KA 2PEAA 2LYHA 3RR1A 3KUZA 2YVSA 4YMMA 4BXOB 2UWQA 3IJIA 2KZ3A 4NAMA 4BFRA 4CQNA 2KEYA 3TFRA 1S3SG 3I63C 5HFYA 4GFJA 5JCKA 1PGBA 1QF6A 2FMPA 3EANA 2KC2A 1JN3A 1N61C 4JHMA 1Q8KA 2E5SA 3T8QA 2JEJA 2W55A 1WE6A 4OJ5A 3N7SC 1ZUD2 2J52A 4BJQA 3AE1B 1HZ6A 4MGYE 1L4DB 5KT5A 4QZFA 4I28A 2BS3B 4WJQA 2JEFA 4YCXA 2AGPA 4MEMA 5CHGA 1F0ZA 1XSLA 1SSNA 2SAKA 3E56A 1GUAB 1L5PA 4TUUA 1XS2A 4QZ9A 5JHBA 1Z1BA 3ZDDA 2DZIA 3ETLA 4J3ZA 4FE3A 1MOKA 1RM6C 1X6IA 4MSMB 1YMHE 2JRZA 4PJ0U 3DCGA 3QIJA 1IV8A 2W9CB 5J0YA 5HMLA 1UBQA 1L6NA 1N2XA 5ALIA 2J4XA 1VAOA 5AM5A 2CKHB 1ZY8A 2YTUA 2N9EB 2ASLA 2C2DA 5DQHA 3FAHA 3PVLA 4KX6B 3VR8B 2CPRA 4PHEA 2WDVB 5JCMA 2H3IA 2WP5A 3ZRFA 2DHZA 2PTWA 3Q8AA 2DYBA 1KJTA 2V4LA 1DIQA 4J56A 4NWIA 4M0XA 4R8UA 3LXDA 7ICRA 1KKRA 3NUQA 1F0MA 3IN5A 1N60A 4NV0A 1MUCA 1E8ZA 1YT3A 4CE6A 4I29A 1ZGUB 4HXDA 4NY0A 5G5GA 4XDDA 4H83A 3DBHI 2BCPA 1BUIC 2PP0A 3MFGA 4WJNA 3AE8B 3LYSA 2QC8A 4MELA 4IT1A 3TACB 3DGHA 1ZKHA 3A4RA 5HR6A 2HMXA 3NVYA 4EZ9A 1DZNA 2R9ZA 3AE2B 3ISDA 5HMMA 5FK9C 3PV1A 4UB4A 3FJ4A 1JEHA 1I4HA 1UF0A 2MBHA 1EF1A 4GMVA 4PVEA 5J2BA 4CNQA 2G9HD 4AP9A 4C8KA 3Q3FA 5JXVA 2ZUCA 3ABVB 4HCPB 4P6VF 2L3ZA 4EBCA 1YN4A 1FO4A 2W9MA 1F9JA 5H92C 2D3DA 2PI4A 1FRRA 2ODGA 1HTQA 4I6NB 5GRTA 1TY2A 2DPIA 2CHWA 2KWCA 2ON8A 4TV3A 4RFBA 2KP7A 4J9LA 4N59A 1WX7A 1FMAD 5D2MB 4M0WA 3D9XA 2P13A 5ALKA 3BWUD 2L0FA 1GO3F 3NGDA 2QCZA 1AHZA 3CNHA 3QUQA 2Q0ZX 1J8CA 3RJEA 3SAHA 3SENA 4RF1A 3D2NA 1ZJMA 2XK5B 2PXIA 5KFVA 3Q8LA 2IO2B 4GIRA 1BNPA 3SN0A 1SE2A 3QUTA 8ICXA 3CIRB 2F2AB 2JF5A 4RGTA 3ZLHA 1SZPA 1URJA 5EWGA 4QWDA 4ECRA 2IPKD 5JCIA 2GBNA 1RWSA 3ZKJC 3RF9A 4E71A 2AAQA 2PPHA 4KTQA 4FDCB 1V59A 4C7YA 3UQ2A 3R9KA 4DL7A 5KL8B 1YQBA 1HJPA 3C23A 3BZDB 3HUIA 1W1QA 5KFJA 3R10A 3TAPA 4JN7A 1OQQA 1TIFA 2AXRA 3U30A 2BQRA 4IW0A 1UXYA 4ICAA 4ECWA 1TK8A 2BZFA 3KBBA 2K25A 1DOQA 4Q2JA 3WIMA 2P8CA 3LAEA 1TKKA 5L1KA 3MC8A 1A70A 5KFUA 1WX9A 4B0MA 1QILA 5A0LA 2YX8A 2RMMA 3FYHA 3MC1A 4ZH4A 2FKPA 2LASA 4XWTA 2X8CA 2GWSA 4R3DA 3IK4A 1WVEA 4YVZA 2JWZA 4IM3A 3AU4A 4F4WA 3PR5B 2LGDA 5J0WA 3VTUA 1ECWA 5AKZA 7ICQA 3R1ZA 1E7VA 2JGAA 4M52A 3VUYA 2KKCA 2MQJA 1Z2MA 2M0NA 2V9HA 4FBUA 5HHIA 2KNBA 1VZ8A 5ALTA 2LHTA 5F9LA 4IRCA 3H7PA 3RN9C 4WJ3B 1T6BX 4IL0A 1AW7A 1TZOA 4ZOHB 1UGJA 1J7AA 1UPHA 4AJWA 3VA8A 3M7DA 2M0XA 2NRVA 3L16A 1C20A 4APNA 1N62C 1P1AA 4UB1A 4M6WB 3EJEB 3KZXA 1RZTA 2PU1A 2RRDA 3DBSA 1HIWA 4DQQA 3II4A 4K3CA 2P66A 4N58A 4PZNA 1N56A 3ZGZA 2PPGA 2JY6A 4DNAA 3K9OB 3ETRA 3P42A 4RPYA 4H4RA 2EQ9A 3TSHA 4KZ0A 2HI0A 4O9MA 2BVHA 3KUMA 1JCKB 2BYVE 3RZWC 3LK9A 2CJNA 2CHXA 2J0MA 3QQ8B 3LVVA 3AN1A 1WGGA 3OC4A 1ZOLA 2PKEA 3RJGA 1IG6A 7ICMA 4RPXA 4DFPA 2PFQA 4IR9A 2AL3A 4FZNA 4WIPA 3H7VA 4MF8A 4NJ7A 2BT6A 5IIOA 4ANXA 2YQUA 4J9PA 4K1WA 4JAYA 4DOBA 1D9FA 2KIVA 4TQ0A 3TL5A 4RQ4A 2V3SA 2ZPYA 3L4PA 3T5LA 4PT5A 2LGIA 1OGWA 2XICA 4KPRA 3RFAA 1R0MA 2O2VA 4I2HA 2V4RA 2YB4A 1R4MB 1XSPA 4P0PA 5ALJA 1GETA 2ZC8A 3UXKA 4W9HA 2X8HA 3K1ZA 2ZIVA 3P4PB 1P48A 1XDIA 5FXEA 5CR0A 3KFUF 4HRSA 5IA7A 1SKSA 3C1ZA 2KJRA 3F5AA 3TBLD 5ALFA 1J0GA 5GTHU 4NL9C 2EQ6A 3ZNHB 3M6KA 2MH7A 7ICKA 2LHDA 3TANA 1WYWB 4W9FA 1JPDX 4HN8A 1BGXT 4HNCA 4TVYA 4BXOA 3VRAB 1R6WA 3AU5A 2V1YA 2C28A 1K53A 1QOFA 4TMAB 1GPXA 4H4WA 3W5UB 3KKAC 9ICQA 5DPWA 2CJOA 3RUIB 1KLGD 1JROA 5FS9A 3IRUA 3T9LA 8ICAA 3U4FA 3ZJUA 1RM6B 3PSTA 4C4VB 1H4RA 1QLTA 8ICMA 3PZPA 3L13A 4YTMB 2Y5BB 4A6QA 4JQWC 1QCKA 5AK3A 4JDRA 5KFMA 4PZOA 1KDHA 2HDEA 1WWUA 1A77A 4I2EA 3AEGB 4J9NA 4GGQA 4FADA 1IM4A 1STEA 4PWCA 2HXUA 5AKHA 4LA1A 2IY1B 5CP2A 2HHQA 3UIOB 2KVSA 4ECSA 5FS6A 3V60A 1SB3C 2GGEA 5MPOA 4EQSA 3DJJA 1UHUA 3QYPA 2ASQA 5L6FA 3DGBA 5J2RA 2XY5A 3C19A 2W9CA 4HWIB 1KOTA 1ZQYA 2BC1A 4RM8A 4FP1A 4E6MA 3SMVA 1D8YA 7ICGA 4QZIA 2R61A 3MJ5A 3X0WA 2VA8A 4EM3A 2P3HA 4LJXA 1WJ4A 4TQ1A 4YSXB 9ICBA 1TS4A 2FJ6A 5AM2A 1CMXB 4DCCA 1Z19A 3TWAA 3R2TA 3P4QB 3C28A 1ZQ1C 2ZIUB 4B9NA 3R66C 2OJRA 5DKWA 4HYKA 4KITB 1WR6E 4AUQC 2FPLA 2PE9A 3I99A 4II2B 3RD2A 5D49A 1V5OA 1PUTA 2KAJA 4LTUA 3P0WA 1TAUA 2F77X 1J7BA 3BZKA 1M94A 1MG8A 1X2HA 3Q3MC 3ALRA 5AZGA 4M02A 2FI1A 1EWCA 3JPPA 3SBFA 2PI5A 1V86A 2GR0A 4NQLB 4GGBA 2HTME 1AOGA 2KKVA 4RF0A 3QTPA 3PNCA 5D94A 1FFVC 4ED2A 1QTMA 3THUA 2QJJA 4M01A 3FVDA 3GC2A 2KHWB 1Z5SB 1ZXIC 3ZW3A 3JS8A 3NTUA 4M8NA 3BS7A 3W8XA 2DX5B 3PW0A 3B08A 5HMRA 3MFHA 1L0YB 2YAUA 1FD6A 2AKMA 4Y2TA 1TKEA 2JZBB 1RG6A 2IA6A 2KJ8A 4DWIA 1SF0A 1BPBA 1VCBA 2KDIA 5BYRA 4O3PA 4KN4A 3CYJA 4ECYA 3FW8A 2AWTA 2WXQA 4XZ4A 3JSVB 4JE3B 2CFYA 1FFUA 4MFAA 9ICLA 1MG4A 2LRUA 3U7ZA 3PFRA 3DGZA 2KFZA 2V3BA 4TQRA 3PHWB 4YL8A 2E3TA 4F71A 1GJZA 1KN0A 5DPTA 1L7YA 3F2BA 2XK5A 2G06A 4EBDA 9ICNA 1EXNA 1A76A 4GDKB 4ELTA 4KKIA 2AL2B 3OLMD 5J0UA 1DRGA 4WURA 5LNK1 2N9LA 1WGHA 3BQ0A 1HSKA 3H6NA 4G3XB 1NEKB 4Y2VA 5GTIU 4F5RA 1WXMA 4E5TA 1T0YA 1LVHA 5DB7A 4KV2A 1F52A 2PTLA 3L08A 1WCLA 5KFPA 3WANA 3M9NB 4GDLB 1F0XA 4F4ZA 4W9LA 1T5XD 1ELSA 4E4UA 3HPFA 2RABA 2KD0A 1YZ7A 2OH2A 3OJ3A 3AULA 4QW9A 3N97B 3L8KA 3TJPA 1WG8A 2FLNA 5E6PA 2BTEA 5DDYA 4BWJA 2ACZB 3GP7A 1P7DA 8ICIA 1KLVA 2W43A 4P2HA 1W1MA 3P3BA 2ZZ0A 3UCDA 5KFKA 1SXEA 5E79U 3HVDA 4N6EB 1JMLA 1PQSA 1LVLA 1XCQL 1N6ZA 3PWIA 3FXGA 1GEUA 5FJUA 2LPEA 2RDJA 3H0RB 4H2HA 2V4IB 4MGZE 2XI9A 2Y0SF 4KN7A 1NELA 1Z00B 2G4DB 4BC7A 4WQMA 3E9SA 3DEDA 2AL6A 4NLKA 2WOVA 1N5WC 4EX7A 2WPEA 4BX9C 2K8CB 5KHOA 2AGOA 2EAMA 3PZ8A 5C2TB 5IP4D 4JV2A 8ICBA 1SJED 3S5SA 4M6WA 2RDBC 2H3FA 1I35A 4Y2PA 7ICSA 3BK1A 1WGDA 2WDWA 3HW8A 1BZLA 3WKCA 5J2KA 2RD0A 2D3GA 5GXGB 3TI0A 2OLAA 2ZTEA 4CCHA 2LUEA 3EKGA 3FM9A 3LWLA 4EYHB 4B9KA 1TE6A 2VA3A 4KGRA 2MU2A 5TISU 3Q8CA 4UATA 1ISNA 4GLSC 4EEWA 3EZ5A 3N3KB 4H4ZA 3QEBZ 4H4YA 3V61A 2LJ5A 2MHJA 4KGSA 1ECQA 3DV9A 2KXJA 3OHAA 4WJOA 1RQNA 3S1CA 5C0YA 2KTRB 2HBLA 2OEHA 3P4SB 2P88A 4DOAA 3OAWA 2KWUB 2LXAA 3MHSD 1X9MA 2F1JA 4F72A 1RYSA 4RGMA 2GBRA 5CHFA 4B95A 3HX0A 4H4PA 5KG1A 5J2FA 2XEWA 1JW9D 2D2QA 4YWOA 3UQAA 5AE2A 2K5PA 2ALZA 4URKA 2UVUA 3E2EA 3GIKA 4FFDA 3DDHA 2XSXA 5T8IA 1NHSA 1U49A 5J04A 2R8IA 5FJOA 4G8TA 3HM6X 3AECB 4DSIA 2JZZA 1DNCA 3EF6A 1N61A 1IIPA 3OG5A 3S2AA 4GIBA 2F76X 1U47A 1PUZA 2YY6A 2J53A 2FYMA 3RNFC 2HJ8A 1UD7A 1SKRA 2Z59B 4I2FA 2C5LC 1JWMD 3IFWB 5CHVC 3DBRB 2YVJA 2O3GA 2Y5CA 3N4FA 3PREA 3V6EB 4FS2A 3SR6A 1L2NA 2N1VA 3P63A 1H6VA 4DEZA 2EKIA 1SB3B 1QZEA 3Q6BA 4C4VA 4GYPA 3VUXA 5AE1A 1EC8A 2W04A 4DFKA 1VDVA 7ICJA 3VCBA 3UMBA 5J0TA 3AV8A 3ICXA 1Q1OA 2B76B 2QJNA 5IINA 2BB5A 9ICSA 3NZUA 2RGFA 1O03A 1UELA 1V85A 2KJ6A 2WP9B 3GE3C 2A1JB 3NZ3A 1Z3EB 3O0FA 1N48A 3T3OA 1PK3A 5L1IA 4O3QA 2WDRB 4I2AA 1XSNA 9ICTA 3N20C 4A90A 3EC8A 4B9MA 2WNMA 4L23A 1NHQA 2CHZA 4X2PA 2GOLA 1KKXA 1L3TA 1TKGA 2CS4A 1AQ6A 2WHIA 5ALGA 2K22A 4Q8EA 3F2CA 1L3SA 4HLEA 2PS2A 1UCVA 4WH4A 3TEYA 3QFBA 4K81A 1ROEA 2PLIA 4OHJA 4QIWC 2AQ0A 1AHVA 2IO1B 5HHHA 3MP9A 2JH7A 1H2IA 1NZBA 1SE4A 2NR2A 4QWAA 2HXTA 3UXLA 2BQQA 3SEIA 1J2NA 4Y2XA 1K52A 1I4PA 3DFHA 2ZIUA 4OD0A 1A0PA 3WU2U 1V1OA 2PE6B 1SBBB 2NTTA 1JX4A 4KDLB 4IR1A 3LLBA 4P4MA 2BKEA 4IQTA 3RAQA 9ICRA 2BF8B 2IMWP 2KFJA 2WU5B 1AROP 3PX4A 2LXCA 2YMLA 1ZJNA 1RDFA 3RO6A 5DBCA 1EUVB 2W82A 1KTKA 5FP0A 1UA0A 2MCNB 8ICGA 1S1QB 3FWAA 1ZDLA 4MH0E 2L1AA 4AYBC 5IN7A 4XLOA 2KC1A 4RQ8A 2UVRA 4DLEA 3TQ1A 2V4QA 3KLJA 2DZMA 3DK9A 1YJIA 3RFZB 3RNAC 4PS7A 4M00A 2QKQA 2VH2A 1KW4A 1SJHD 4DDID 1KRHA 2JZBA 3Q8RB 1JI7A 1Q3UA 2OWOA 3H4KA 3BYTB 2BDPA 2R2OA 4DDGD 4UB5A 2Z0DB 2PU0A 2NTSA 3JSVA 2QB1A 4JWMA 2ZPNA 2WP6A 3TOYA 3IDWA 4KLJA 1R4NB 2NRXA 4QZAA 5I1WA 4C7ZA 2A5UA 5H8YE 1W1RA 4G50A 1WYGA 1WUEA 3RRHA 4GDKA 3RNGC 3Q8PB 4BV6A 3QXGA 2WXHA 1COKA 2KQSA 1V80A 4DXGA 4GXBA 2AL2A 1GRFA 2WS3B 2KQ4X 9ICKA 1F2RC 5EOZA 1TKYA 2MA1A 2XGPA 4Z6DA 1V97A 5C5JA 1YJJA 2HQMA 4P16A 5EBKA 3GQCA 2RDHA 3HILA 1UBIA 3C8YA 4B9LA 3MC0B 2Y3SA 3Q8SB 3HHMA 2WB1C 3VC8A 5KAFU 1TKDA 1XO1A 3UINB 2KMAA 3FILB 4O3SA 2F5ZA 5KFHA 5U25A 5DLGA 1FXIA 4XWWA 3D46A 2AQ3B 4M2YA 5KFTA 1QLBB 3H9DA 1E8FA 4PGXA 3AE5B 3V72A 4TKNA 4TSSA 5HR7A 1R4MI 4KSLC 5KVIA 1MBTA 1X1MA 5KVHA 4F50A 4G3IA 4JK1A 2EMSA 3JW7A 3TCSA 2OPJA 4M6UA 2J6TA 3ZD8A 1LFDA 8ICHA 2IZVB 2LKYA 3S1DA 4P4PA 3GDXA 1DOXA 1N62A 4Z6CA 4JUZA 2XY7A 3UQ0A 1QOGA 1JWAD 2LGXA 2HHWA 2N1RA 4A8EA 2MUTB 3NVZB 4M9GA 2ZXIA 1Z00A 2Q5WD 4FS1A 2KSOB 4DL5A 2PFOA 1ZQLA 1FCCC 1WGKA 2LMCA 5AIBA 1EO6A 2K9XA 2VFUA 1F8WA 1MDRA 2BR0A 3KTQA 2UYZB 4IRDA 1SGGA 3MC9A 3DPDA 3PO0A 1FNWA 3M8RA 4FJVB 4HCLA 1EBGA 3JPQA 2NYVA 1GC7A 2R8GA 3QU2A 3MR3A 1S77D 8ICJA 3B9JB 3V5CA 3V3WA 4F5OA 3KYDD 4I6PA 3AQFA 4KVGB 3TAQA 9ICXA 2PFPA 3ENLA 4ZA0A 2DBYA 1NK8A 2QEJC 3GV8B 1P9DU 1WUFA 2OFJA 3FV9A 2CXYA 5AK5A 2Y4GA 2K1FA 1XS9D 4KLHA 5J0SA 1SL0A 3ZDBA 4KLDA 2N9KA 4GSWA 2E8MA 5AKYA 2YMQA 2INNE 5IIJA 3PPAA 1QQ5A 1MQ2A 1WZ3A 2ES6A 5CHWA 3H7IA 4C80A 1FCLA 4JWNA 4DHZB 3QAQA 2L5YA 1ZW7A 4HEA1 4QJFB 4KLEA 1EWYC 1X2IA 2KDBA 3FG2P 1TFRA 8ICPA 2L7RA 2LFIA 4FA6A 3UI3A 2C3DA 5EWEA 2V3NA 3QZ8A 4HPMB 4ZHOA 2REXA 4NL9A 5CA7A 2JUOA 1YQ4B 2ZADA 3A1QA 5ALQA 3B1LX 4GLXA 2WF9A 3RBEA 4IC7B 4KPLA 1NK5A 4NXZA 5KG2A 3AXCA 5B66U 3KKAA 1TVAA 5FXDA 2IDYA 3DDMA 1JWBD 4IUMB 5J2DA 1PFDA 5AI9A 2HBJA 4RPZA 9ICVA 1UT8A 5ALYA 1ZQHA 1QQ7A 3TJ4A 1XLQA 2TSSA 3FW9A 2IPIA 1EC7A 5GMVA 1NHRA 5DG9A 4MLAA 1Q1RA 9ICAA 3R11A 2EQ7A 3TTEA 4ARIA 1NU5A 3A9JB 3H12A 4AJYB 4MKSA 5EWFA 1PZNA 1RFKA 3UMGA 2MBQA 4XYCA 3NY5A 4ARCA 1JCTA 2XC9A 1NDDA 2IGHA 2FNJB 4J3OD 3Q8BA 2P3ZA 4OVZA 4KEMA 1WXAA 3EPIA 3WK6A 3KVFB 2QB0B 2WXNA 1KCZA 2W7PA 2WPCA 2W8LA 5ALMA 4A9AA 1L7OA 2XVTA 3C2MA 1Q1WA 2HDOA 1EBDA 2DYOA 2KHQA 3SAFA 1U4AA 2LI5A 2KDMA 5J8YC 3OSPA 3WK4A 3JPNA 1JRPA 2A1JA 3CP8A 4DFDA 4CRXA 2M0AA 4NY8A 1QSYA 2GH1A 4J9OA 8ICVA 2FBWB 2KTFA 1JWUD 1B4FA 3RPFC 3ZVHB 1T0RC 3DDCB 1C77A 4XQ8A 3M6ZA 1NK7A 1IGCA 4O5KA 3E58A 2FDRA 4I2GA 2N7DA 2HCFA 3EFUA 3VCCA 5AI8A 3DFYA 3EFCA 3HRDD 4M47A 4O3RA 3QEAZ 4G7FA 1WM2A 1T3NA 2PLPA 2K4IA 4C4RA 2KJHB 1SL1A 4HJKA 1FFVA 4GB9A 2GH5A 5AKGA 2WAQF 4Y2UA 4K8DA 4OW0A 5HQXA 5KG7A 4NLCA 1ZXIA 1TS3A 4PYZA 5HHDG 4AWJA 3AQEA 4H4QA 4LDTB 2OAIA 3V6KA 2BCSA 8ICKA 1FXTB 5CEHA 5KFFA 1K1SA 1MBBA 1UZXB 4H1ZA 7ICOA 2MLBA 3IAS1 3MJWA 4PL2A 2NMQA 3ZVVA 3KJMA 1JIHA 3FKYA 3I76A 4B9SA 3PRMB 2XGZA 2XIDA 3IBEA 3QKEA 3NRZB 2HD5B 1GRTA 5G2NA 3FCPA 1L3UA 1ZQTA 1HTOA 4GOCA 2IHNA 1YOVB 3D2HA 2YMMA 3C2KA 3HW2A 3N4MB 5TSSA 4B6WA 4DWDA 4EFOA 3ZDEA 1JUDA 4UBCA 2GDQA 7ICLA 5AICA 4JMUA 3WAOA 1M6IA 3N6JA 4YN4A 2BCVA 1WH3A 2D07B 3AE9B 4DWFA 2I9GA 3HT3A 2ZJAA 2X8GA 4P4OA 4Q45A 3F53A 3OSNA 4DF4A 4KLGA 4A35A 2FIDA 3ISBA 3Q8MA 3RRGA 3G6VA 3VAWA 4J1OA 3IJQA 2ZNVC 4IP4A 1FPYA 3D2JA 4EE2A 4OALA 3DG7A 4QZ8A 4OCZA 1ZKQA 1QH9A 4F4KA 2HHUA 2LJIA 2GLEA 2W9BB 2ZEQA 4KLFA 2ZIWB 3QC8B 1EM7A 2K60A 1L8LA 2I1QA 1XLOA 4DN1A 2KMDA 3TJIA 3QJZA 3PRZA 2IGGA 1TZ1A 1D8LA 5J2CA 3TARA 1XT9B 2RDGA 4FULA 3H4DA 4R63A 3PW2A 2ICIA 4AOFA 1I7HA 3ML9A 5FXPA 1VJ5A 2NPXA 4CDGA 2HOQA 3DOWA 4NLBA 1KKOA 2K3UA 2L76A 1LPFA 3T5JA 5E6NA 3FILA 1PGXA 3NZGA 2WYQA 3L0WB 4ROPA 5KFLA 1ZQWA 4DSFA 1NJWA 3JVZX 4ZRKA 5H2FU 1YIWA 3CF6E 1G6JA 3RITA 4N9F4 3OGUA 2D11A 4EC3A 3JZUA 5BO4B 4DHJD 3S6JA 4ENLA 2FLPA 5L95C 5TZVA 1KFTA 2BGFA 2C7MB 3MR2A 2JYTA 2KK8A 1N5WA 3A7RA 4HJGE 5J2IA 3RH5A 3ZJTA 4EQRA 2AYOB 1JOAA 2KD1A 3THVA 1RLFA 2VAOA 3HK0A 1WGRA 2VFRA 2V3PA 1UQVA 3GIMA 3L17A 1BPZA 3KH0A 4K7UA 1P7FA 2MUTA 3NVZA 1LXDA 4ZRQA 1GG3A 1DK2A 2HBMA 4YXDB 1WJNA 1RPLA 7ICUA 1TYGB 2KSOA 4J9SA 5F3XB 4YR2A 7ICIA 1Q5WB 3WA0A 4DSEA 2K8BB 2KX3A 3DBRI 2QHOA 2LHEA 4WAFA 2G07A 3ZLFA 5KAIU 3H8AA 1TK0A 4KDIC 3RRAA 3NXLA 2OHFA 2VRRB 1OEPA 3A7AA 5L1JA 1ZQAA 2IBIB 3F2DA 2WLBA 3UF8A 4WJPA 1XCTL 4B9UA 4K7ZA 2PTXA 7ICFA 3V6HA 1ZQRA 4EZJA 3MZNA 2BVCA 2YEPF 4NEWA 2P4PA 2HJ1A 2O56A 2GGGA 5FKAC 2UUVA 5DDMA 4MACA 4MDKE 5L9XA 2WF7A 2HHSA 2KN4A 4W9IA 2W9NA 1ZQCA 3BY4B 3R0KA 3KWVA 4II3B 5J0PA 2E5AA 4JIOU 1JDFA 4IZGA 5AEKB 5AI4A 2ZIXB 2V6OA 1E8WA 3VRBB 3V4BA 4IM0A 3PG6A 5G5HB 9ICUA 2R8JA 1P7EA 2OKTA 2AU0A 2FE8A 5D7GA 3GB1A 4YT0B 1PK1B 2VZKB 2I1KA 4DHGA 1U48A 4LJPB 3MDCA 4TUPA 2VFVA 3OZMA 3BW7A 4CYEA 3HP6A 3OTRA 5J2HA 3T79A 3A33B 2DKZA 3HKZF 3N30A 4X5VA 2Q4WA 1DTNA 3R7QA 2OG9A 3DQ0A 2V3AA 2I1JA 5IOIA 3WKAA 3PLVA 1X2GA 5IILA 4PYTA 2OM6A 2WOIA 5KG3A 3WAMA 1T3QC 3DEQA 3PZ7A 1FIQB 3B0AA 2W11A 3WK5A 2VANA 4K4HA 1GNUA 3A9JA 5BOLA 3N1ZC 2ZW0A 1SXDA 2DQNB 4GN1A 5ALNA 4M9LA 2LD9A 2GGHA 2EMTA 4QZHA 3MR6A 1X40A 5AUKA 3LYYA 3BZCA 3W5VB 5I1VA 1T94A 5KT4A 4TQSA 3Q3OC 3I6EA 4LK0M 2R2ZA 3HWTA 2HVIA 1XLNA 2WXKA 2FAZA 1HUOA 4QAYA 3STPA 4JV1A 1R4NI 2LEKA 8ICWA 2PMQA 3AI5A 4HCDA 1YN5A 1ED1A 1SL2A 4C8LA 3U2SC 2JQRB 3JVAA 4P0QB 5J2EA 2RP5A 4ACOA 2QARB 1KSPA 1YD8U 3QLDA 5BMHA 2C2RA 1ZQQA 4M9NA 2EKEC 2KYWA 4MJSB 1SV4A 3MHZA 1JPMA 2H3QA 2KVZA 1ZYQA 2ZTDA 2WF5A 4BKSD 4J57A 3IHPC 4A20A 4NQKE 3QN3A 2AL1A 4YMOA 4KX5A 5AIAA 3NRWA 1TYTA 1S5LU 2LWPA 3HPOA 1JALA 1XLPA 3B2GA 2GOWA 4GGHA 8ICEA 2A1AA 4YWGG 5D46A 3KHGA 1D4BA 1TBEA 1ZQGA 5AKXA 3EYZA 3BINA 2N7JA 2YLMA 4KLMA 3QA8A 2WTFA 4C0ZA 4BBNC 3A0BU 4YXJA 4IHCA 4F4RA 2BCRA 4IWPA 2GGIA 3P93A 1AARA 2NRTA 3AB5A 4YTPB 2W0HA 3Q6JA 1S0OA 1FEAA 1K8RB 4G11A 4I2CA 4KGTA 3ZJVA 4IDIA 9ICCA 2DLBA 3NRZA 3PX6A 1WSPA 3I57A 3S1FA 5ER0A 4HDQA 3UJFA 3KUCB 2C22A 2LM1A 2KZMA 3BIID 4GISA 2OZ3A 2YB1A 2EXRA 4LIIA 2FPMA 1LM8B 2ZNVB 2LBOA 3A9KB 2B21A 3RB4A 1CZPA 4QNLA 5D79A 4UBBA 3RJHA 3EEZA 1C3TA 3TFSA 3VXWA 4GFIA 2VA2A 2INCC 4XUSA 4YR0A 3T5KA 4ANWA 3NVWB 2H5XA 1BWCA 4J03A 4M0AA 1ONEA 8ICZA 3UPQA 4P7IA 1QLUA 4DOCA 1WWVA 5CB1A 1MQ3A 3DHGC 1YQ3B 3M9OB 4KKJA 4DL6A 4IG7B 3NS1B 2EZYA 2W9BA 1L4ZB 9ICIA 2ZIWA 4RQNA 3ZYYX 2L83A 2ZW1A 4OZAA 2L52A 1IYFA 2G0AA 3PVXA 1SE9A 1IBXA 1ZXHA 3IHQB 2RK5A 2PLSA 3BVMA 1WE7A 1PVQA 2GQUA 3BS5B 3ZVIA 1TS2A 2C7NB 4KMOB 2J6UA 1DOIA 2QDDA 3ZDCA 2M17A 1BQGA 3EAOA 3ZDTA 3T3FA 3GY1A 1UWMA 2GLSA 2P35A 1LKYB 1KLUD 2M9NA 3TMPB 2PTZA 3SQSA 1OTRB 1TE2A 1U9LA 3R7RA 2GQTA 4MF2A 4AS1A 1I4QA 4KLLA 2QVHA 1NJZA 1I4RA 3ZXRA 1SJCA 4UD8A 2XH2A 2B3AA 1P0RA 3VC6A 3I6TA 3TKAA 1ZP0B 3RULA 3VC5A 3CW2C 4RM9A 2K8HA 2OX4A 1JXEA 1E8YA 3QX7A 3UJ2A 1WM3A 4GXJA 3K9PB 5BOEA 3EGRA 2RHFA 2VFSA 1OQRA 3AEEB 1F3PA 3JPSA 1U45A 7ICPA 3MGIA 4EZLA 5KFCA 1IPGA 2EELA 1GB4A 1NDAA 2OQYA 1SV0C 7ICHA 3EHVA 5KT2A 1XU4A 3RB3A 4QWCA 4BC9A 3V7JA 4DQRA 4RH6A 4JV0A 4BOZB 1GREA 3M95A 2K8BA 5F9NA 3IG8A 3GZNB 3D47A 2NQWA 4JWSC 2Z7JA 4D2KA 2BYFA 3V5FA 2W3RA 4MGIE 3E0FA 4UB2A 4ZRPA 2NS5A 3RH4A 1T0SC 4FHJA 2OZ8A 4Q43A 2OEDA 1FNUA 2MAXA 1Q3VA 1MJDA 1ZQPA 2GQWA 4YMNA 2WQYB 4GXKA 3VUWA 4I27A 1VZ6A 4OZCA 3TEZA 1GESA 3J81j 3DK4A 3OZYA 1COOA 2I5HA 5J0OA 2K8AA 4NPNA 2I0KA 1GRAA 4MMWA 2I38A 4A3OA 1XD3B 3O0HA 4WWPA 3Q45A 1M6YA 2BBCA 3HVZA 4LZDA 3C2LA 2JSVX 2HOIA 3IXSA 5JCLA 4FHKA 5AKIA 1WFYA 2NPTB 3PW7A 1M4VA 1V9JA 1VRAB 4K4IA 1PDXA 3RYTA 2ZIXA 5CRXA 1L6UA 4GR1A 2BQUA 3DERA 1PGAA 5G5HA 3APFA 4PYUA 2VKQA 1F9CA 3UXPA 3O13A 2BC0A 2YQEA 2H88B 1HA5A 5AK4A 3IT4B 3GO2A 1JMSA 2ZUBA 2KVRA 3IP4B 4S0RA 2QPMA 2VJ4A 4ED7A 4PVHA 4HROA 2KLCA 4W9GA 3ZI4A 5KFAA 1B1ZA 1F44A 1YNTE 2ZZBA 3JPOA 2IY0B 2JXXA 2WF8A 4ICVA 4FBJB 8ICRA 1YJ1A 3TQPA 3LXFA 1ZQBA 2KWVB 5KFIA 2CRXA 4KLSA 1FEHA 1VZ7A 1XO0A 1XWLA 8ICUA 1WMHB 3R2IA 2Z8LA 3VFKA 1GSNA 4NAWB 4IP5A 5FJRA 3SN1A 3T4WA 1BXTA 1KL9A 2ESEA 1WF9A 3M1YA 2WFAA 2OO6A 4NM1A 5KG4A 2OQHA 2ASJA 2ZUDA 2MRLA 1S10A 1GC6A 1HE8A 1C4AA 4PZFA 3KQ4A 2KT7A 4TURA 1KD0A 2XH0A 2BKFA 3AH7A 2VH1A 2ZJ5A 3R25A 5KT7A 4G9BA 2Q85A 1T4GA 1E9IA 4F2RA 4HYRA 5DBAA 1QQRA 1NKCA 2V0GA 1B9RA 1NOMA 2EDUA 2RSUA 2G3QB 1X9XA 5KFXA 2C9WB 4E4FA 4JGHB 1XHCA 4EMWA 3PM9A 1F2RI 1NJYA 4C8NA 1DGJA 3L54A 2BPGA 4DXFA 2J7QB 1LQBA 5AE3A 3TUOA 2MJEA 4ANVA 3QFAA 4NLNA 3KOOA 4DQOC 3RAXA 1SZHA 3VHTC 1IYXA 3BJSA 3SSZA 1ENFA 4P0QA 4QW8A 1KRPA 2QARA 3AU2A 2YN4A 5DQGA 2MJ3A 4MJSA 4F2SA 3SEBA 3I4KA 3FW7A 3AUOA 3U52E 2I5QA 1SKWA 3SI8A 3ONSA 4Q44A 4KX3A 5BOMA 4TUQA 4R64A 1J19A 1TGZB 1E8GA 1VQZA 3OPSA 3EJDB 1E90A 4IS7A 4W9DA 2KFNA 5ADZA 3QK0A 3H8SA 3DHHC 3AE4B 2ZVNA 1WIAA 7ICVA 3K75D 5T14A 3QU9A 4EBEA 5ALEA 2BS2B 2QMTA 3V62A 1ZR6A 4C4TA 1DOYA 3UMCA 4DLGA 1ET6A 2FIFA 3UJSA 3N7RC 5KFRA 4EM4A 3UJEA 2XBBC 3DVNU 3NUHB 4YD2A 4A3RA 1FHVA 1ZQOA 2BWFA 5J0QA 4DSJA 4EOYA 2M56B 2AXTU 1QLNA 8ICOA 4WWOA 5HI1A 1TYPA 5L83A 4REZA 1Q10A 2LMRA 3T3NA 4BDPA 4MHVA 2PW9A 1ET9A 1QSLA 3RJJA 2E1FA 4O5CA 2NBVB 2X50A 4H2AA 4YFKA 4HPLB 5ALOA 4F8CB 2ISPA 3POPA 3EECA 2UVWA 3PHXB 4UDUC 4ZDVA 4JN8A 2XO7A 1B43A 3N32A 1J2MA 2CU3A 2W9AA 1QKZA 2BPCA 4F5QA 3A9KA 3QU7A 4MH8A 2ZZPB 1RVKA 2D3CA 1S0MA 4RQ6A 5KFYA 3NVYB 4M9JA 2GR2A 3RJFA 1K51A 4YTNB 1PVRA 3APCA 3BSMA 4JB1A 1CJEA 5CJ7A 2DAFA 4KIKB 3CGBA 1ZRNA 2HTHA 4E3CA 2PP1A 2G1EA 2KQ7A 2C2EA 4KLOA 1K50A 2H3VA 1XF5L 4HPNA 2B6GA 2VFTA 5LXHA 2X99A 1L5UA 3QARA 5HNKA 8ICNA 3NS1A 1DIIA 3MKCA 5K8EA 4RQ0A 5ALZA 3SAGA 1BT0A 4J9KA 4YSZB 1GRGA 3PSPA 2W54A 4QZEA 2KDFB 4W9EA 2D8CA 2UVVA 1D5XC 1XPYA 4HK2A 3ZQ4A 1RYJA 1CK1A 3BS5A 4C8MA 4GDLA 4EMIA 3K1GA 3VTEA 4J6IA 4MFCA 2KNJA 3DK8A 4F3OA 1LKYA 2E8PA 4NM2A 2IYDB 3W1SC 2DZKA 2W8KA 3CGDA 1Q0WB 3OTQA 1ZD3A 2JK6A 3PSEB 4DX3A 1K4QA 4MGGA 3ES8A 4DS5A 4TUSA 2Z0EB 2PODA 9ICEA 1XANA 3V7LA 2LVQA 2J6SA 5ALRA 2GGJA 1T0QC 4UAVA 1WCNA 3EJBB 1Y88A 3BJYA 1ZQXA 1T7PA 1OFFA 2FUHB 4K1RB 4KSKC 1N63C 3AM9A 1TV9A 1WX8A 4OVUA 4RQ7A 4H4TA 3QWZB 3GU3A 3I3TB 1X42A 1SWWA 1ESFA 5KFWA 1V5TA 2OOBB 3UXNA 2K8CA 1NK0A 9ICPA 2EQ8A 2YVGA 3NFUA 3RBDA 1AHUA 1TJEA 4GRTA 1V2YA 4ELUA 4X57B 2YVCA 4EQXA 1EF5A 3J9CA 3SV3A 1ZD2P 1WUDA 2IBKA 4PL1A 1SE3A 2KZRA 3Q2AC 4LDTD 2PKOA 1A5RA 3OW1A 4LNNA 2R8DA 1QSSA 4YSYB 2BPSA 1JRUA 2KOXA 2WX1A 2PTYA 1NK6A 4DQPA 3LB8C
chains in the Genus database with same CATH topology
3AEBB 2IGGA 3B2FA 2RDGA 1IBXB 2GB1A 3I99A 4BCAA 5FXPA 2ICIA 3R8BA 1I7HA 3C0PA 1PUTA 2KAJA 4LTUA 2BVFA 1J7BA 1X2HA 1WRIA 2K3UA 1EWCA 5D3DA 3FILA 1PGXA 4IKGA 2INPE 2HTME 2WXFA 4RF0A 1HZ5A 2WU2B 4FXCA 1FFVC 3RJAA 5FR3A 4EC3A 2PIAA 2WXPA 1ZXIC 3JS8A 4USAA 3W8XA 2JYTA 3A7RA 1N5WA 4NZLB 4HJGE 2JU6X 5HMRA 1AWDA 1L0YB 3ZJTA 1I4GA 1FD6A 1TKEA 2VAOA 1T3QA 5BYRA 1SF0A 1UUPA 2VFRA 2V3PA 1C4CA 3FW8A 4ZRQA 1P7FA 2WXQA 3NVZA 4YXDB 4JE3B 1FFUA 1TYGB 4OZBA 3U7ZA 1V8CA 5BYSA 2WXIA 4DNSA 3URYA 2E3TA 3S1EA 3R07C 2BW2A 2WXMA 2LHEA 1IGDA 2N0SB 4GDKB 4WAFA 5I4DA 1E8HA 1WVFA 2QIEB 3FC4A 2AQ2B 4KKIA 2OHFA 3A7AA 1SIJA 4WURA 5LNK1 2N9LA 1GB1A 5EE1A 2WLBA 5AUIA 1XCTL 3CWIA 1HSKA 5L6GA 1NEKB 4XDCA 1CQVA 3H8HA 5G5GB 2YEPF 1NYRA 2P4PA 2PTLA 2BS4B 2QILA 3TEXA 2UUVA 5FKAC 5EE0A 4GDLB 1F0XA 4HKZE 4NJCA 1R7SA 1T5XD 4MACA 2PMVA 2KN4A 4L2YA 1HXYD 3KWVA 1ZDXA 2BTEA 2E5AA 3KWLA 2ACZB 3W8ZA 3GP7A 3VRBB 5G5HB 1W1MA 1P7EA 2PVOD 4N6EB 3HVDA 3NVWA 2FE8A 5D7GA 1EU3A 1JMLA 1WWTA 3GB1A 4YT0B 1W1LA 1XCQL 2VZKB 3W2DA 4O1NA 2QJLA 3BYYB 5C3JB 2VFVA 4PVJA 4RGNA 3BW7A 2Q4WA 2V4IB 4PVKA 4BC7A 5BYQA 3DQ0A 4WQMA 3E9SA 3DEDA 1NENB 5BMIA 1XXGA 2WXJA 1N5WC 1NI3A 1X2GA 4PWBA 4PYTA 3PZ8A 1E6EB 3IT6B 5C2TB 2KACA 1T3QC 1SJED 3PZ7A 1FIQB 1TY0A 3BK1A 2WDWA 2ZW0A 1AN8A 5GXGB 1FFUC 2H89B 1JWSD 2E6XA 5AUKA 3W5VB 3LYYA 1XEEA 5I1VA 5HG2A 3AE3B 4LK0M 4KGRA 2M19A 3GS2A 2R2ZA 3Q8CA 4GLSC 1J7CA 1XLNA 1QOAA 2WXKA 4KGSA 2VZKD 1TS5A 3S1CA 2LEKA 1D5ZC 1YN5A 3P4SB 1VLBA 1FRDA 3U2SC 2JQRB 5BMHA 2BYTA 3MHZA 2WXRA 4RGMA 2QKNA 4C56C 1NVID 3TX1A 1WXQA 2SEBD 1JW9D 1W1JA 5AE2A 2K5PA 5EE9A 2GRIA 2ONQA 4WWMA 4A8XC 1JALA 1XLPA 3B2GA 3DWGC 3BK2A 4YWGG 5T8IA 1D4BA 1I4XA 1C4PA 3AECB 5E6JA 2JX5A 1N61A 1ZDVA 1I19A 2N7JA 2WXGA 1C9FA 2WDQB 4IOIE 4B0EA 1ACCA 2J53A 3AE6B 2UUUA 5AWVA 1FNVA 3AB5A 4YTPB 1GOZA 2IGDA 1UWXA 1JWMD 3HSUA 2JZPA 4JPSA 2O3GA 4KGTA 2Y5CA 3ZJVA 3ETRB 1DYQA 1V1PA 2XNAC 3SR6A 2DWQA 4IDIA 3PQBA 3P63A 3AMZA 4ZOHC 1SB3B 2DLBA 2EKIA 3NRZA 4ITKA 1KFYB 1WSPA 3I57A 4ZYSA 3S1FA 5AE1A 1VDVA 3BIID 3HRDC 2EXRA 1QT9A 3AV8A 4RCOA 1KH0A 2B76B 3I9V1 3W9CB 2BB5A 3BVZA 1PYWD 1CZPA 5D79A 2WP9B 3NZ3A 3T3OA 2BB6A 1AYFA 2WDRB 2Y3AA 4A90A 3EUB3 2WNMA 3W8WA 4L23A 1TKGA 2XN9C 2Y08A 2K22A 3NVWB 3TEYA 4WH4A 1QLUA 1ROEA 1HQRD 4OHJA 3NVVB 2PLIA 1YQ3B 1AHVA 4HG0A 2QSDA 3MP9A 4KKJA 1SE4A 3WCQA 3B9JA 3NS1B 1MI0A 3SFDB 1L4ZB 2JWUA 3ZYYX 3V3XA 1F77A 2L83A 1K52A 2ZW1A 4OZAA 4US8A 1I4PA 2L52A 1W1OA 2MBRA 4LLGM 2RK5A 1IBXA 1ZXHA 1V1OA 2LUMA 2PLSA 3BVMA 1SBBB 2NTTA 3OWEB 2GQUA 3LLBA 1TS2A 2YVSA 1DOIA 2WU5B 1ZPSA 1MVKA 1UWMA 4NAMA 4CQNA 1KLUD 2L32A 4L1BA 2W82A 1KTKA 5HFYA 3FWAA 1PGBA 1QF6A 2GQTA 5BMGA 2L1AA 2K0PA 4AS1A 1I4QA 3P4RB 1N61C 2FUG1 1I4RA 4XLOA 2W55A 4TSSA 1ZUD2 2J52A 4UD8A 3AE1B 1HZ6A 1L4DB 2BS3B 1ZP0B 1YJIA 3RFZB 1F0ZA 1SSNA 3EUB2 2PVGC 2SAKA 3E56A 1L5PA 2JXTA 1SJHD 1L6VA 1KRHA 3EGRA 2VFSA 1OQRA 3AEEB 4XE0A 2KMMA 3BYTB 1RM6C 2EELA 1YMHE 3DWMA 1GB4A 2NTSA 4BBYA 2Y5PA 4BC9A 4RH6A 1VAOA 5I1WA 2J4XA 4C7ZA 1W1RA 5H8YE 4KX6B 1WYGA 3FAHA 4JWSC 2NQWA 3VR8B 1MPEA 2WDVB 4D2KA 1L0VB 2W3RA 2WXHA 3Q8AA 4ZRPA 4DXGA 1E9MA 3V05A 2WS3B 2KQ4X 1F2RC 1TKYA 1DIQA 2OEDA 2RPVA 1V97A 1FNUA 1VJKA 1YJJA 4P16A 2WQYB 1N60A 2RDHA 1VZ6A 4OZCA 3TEZA 5EE3A 3TSJA 3C8YA 3MC0B 1E0YA 2AQ1B 5G5GA 4XDDA 2I0KA 2Y3SA 2I38A 1BUIC 3MFGA 4ML8A 3AE8B 2BBCA 3HVZA 1Y56A 3FILB 5D3IB 3IAM1 1DZNA 3NVYA 2JSVX 3IXSA 1FXIA 3AE2B 5FK9C 4XWWA 2AQ3B 1M4VA 1QLBB 1VRAB 1E8FA 1I4HA 1PDXA 1L6UA 3AE5B 1EU4A 4PVEA 3SR6B 1PGAA 5G5HA 2G9HD 5JXVA 1SEBD 3ABVB 4P6VF 3RJ8A 1MBTA 1YN4A 1FO4A 4US9A 3O13A 5H92C 1FRRA 1HA5A 2H88B 3IT4B 3S1DA 1UNSA 1TY2A 2QPMA 1DOXA 1N62A 2ON8A 4PVHA 4HROA 4RFBA 1B1ZA 1JWAD 1QOGA 4N59A 1FMAD 1SXTA 1D6EC 1YNTE 4M0WA 2P13A 3BWUD 2Y3RA 3NVZB 3LXFA 1E0ZA 2Q5WD 4JWUC 1AHZA 5FXFA 1FEHA 1VZ7A 1FCCC 3P1MA 1WGKA 2LMCA 3AEDB 3R2IA 5HHZA 2Z8LA 4JX1C 4NAWB 1D5MC 2K9XA 1BXTA 4RF1A 2VFUA 1SE2A 2YEPB 1W1SA 3PO0A 1FNWA 3CIRB 4RGTA 1C4AA 4PZFA 3KQ4A 3B9JB 2IPKD 1RWSA 2MJDA 3AH7A 1FXAA 4C7YA 2Q85A 3HUIA 1W1QA 3BZDB 1QQRA 2V0GA 2DBYA 1B9RA 2QEJC 3A7UA 1OQQA 2AX5A 2AXRA 1UXYA 2Y4GA 3SFEB 2D5GA 3PM9A 1F2RI 2N9KA 4DXFA 1DGJA 3EA6A 3GSYA 2INNE 3N9YC 5AE3A 1QOBA 4HKQA 1LO5D 3TUOA 2MJEA 1L0XB 4Q2JA 4DQOC 4C80A 3LAEA 1FCLA 1N60C 1A70A 4B0MA 4HEA1 1ENFA 1EWYC 1QILA 4O95A 2RMMA 2MJ3A 2LFIA 3Q8FA 3SEBA 4XWTA 2V3NA 4R3DA 3U52E 3UI3A 1WVEA 4ZHOA 3FW7A 1E8GA 2W3SA 1VQZA 1YQ4B 1BMLC 2WXOA 5ADZA 3AE7B 3AE4B 1E10A 5FXDA 2IDYA 1FM0D 1E7PB 1NYQA 1JWBD 1VZ8A 2BS2B 2QMTA 3W1SA 1DOYA 1ZR6A 1ET6A 1PFDA 1T6BX 3U4EG 1AW7A 1TZOA 4ZOHB 1KF6B 1J7AA 1UGJA 1XLQA 2TSSA 2GI9A 3NUHB 3FW9A 2IPIA 1N62C 1MHHE 4MLAA 2M56B 5HI1A 4REZA 4ARIA 1Q10A 4N58A 3T3NA 3ZGZA 1N63A 3ETRA 3VR9B 2PW9A 1ET9A 3P42A 2DYMA 3Q69A 1RFKA 4ARCA 4H2AA 3TSHA 3VQIA 3POPA 2BVHA 4UDUC 2IGHA 1JCKB 3Q8BA 4J3OD 4OVZA 2CJNA 2CU3A 3BVGA 1QKZA 2WXNA 3AN1A 4A9AA 4ZHPA 4MH8A 2DYOA 4RNAA 3NVYB 2KDMA 4WIPA 2BVGA 1JRPA 1K51A 2JYEA 4YTNB 3AEFB 1CJEA 4JB1A 2BT6A 2M0AA 1N5XA 4JAYA 2FBWB 1IUEA 3RPFC 1JWUD 4TQ0A 4RGOS 2G1EA 1C77A 3L4PA 1IGCA 4PT5A 2LGIA 3AEAB 1K50A 1XF5L 2J42A 2VFTA 3NVVA 3HRDD 3P4PB 3NS1A 1DIIA 5FXEA 5K8EA 4HRSA 2PLPA 3Q8EA 4MT5A 4YSZB 1FFVA 2W54A 1JQ4A 1ZOYB 1D5XC 4OW0A 3D2DA 5HQXA 2MH7A 2LHDA 1ZXIA 1RYJA 1CK1A 1TS3A 3ZQ4A 5HHDG 2I2YA 2OAIA 3VTEA 4TVYA 3VRAB 1QOFA 1K53A 4TMAB 3TSSA 1GPXA 3W5UB 1MBBA 2X38A 3IAS1 2NMQA 3TEWA 3KJMA 2KWDA 2CJOA 1KLGD 1JROA 1V1PB 1YN3A 3ZJUA 1RM6B 3NRZB 1QLTA 1C78A 4YTMB 3D2HA 1C76A 4A6QA 4AQ7A 4MM3B 5TSSA 2IJ0A 2HDEA 1HEZE 1XO3A 3AEGB 4PWCA 1STEA 1OFFA 1N63C 1MHXA 3AM9A 1C79A 3AE9B 1SB3C 5MPOA 1ZE3D 1ESFA 5L6FA 1VR9A 2MEKA 1AHUA 4TVWA 1TJEA 2R61A 3KLSX 4EE2A 3D2JA 3MJ5A 4OALA 4A55A 2P3HA 4TQ1A 1FIQA 4YSXB 3J9CA 1W1KA 1TS4A 1SE3A 2PKOA 2WXLA 2LJIA 2R8DA 1GAQB 4YSYB 1EM7A 1XLOA 3R2TA 3P4QB 3LB8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB B;  3B2F A;  3I99 A;  4BCA A;  5FXP A;  1I7H A;  3C0P A;  1PUT A;  2KAJ A;  4LTU A;  2BVF A;  1J7B A;  1X2H A;  1WRI A;  2HTM E;  2WU2 B;  4FXC A;  1FFV C;  4EC3 A;  2PIA A;  1ZXI C;  3JS8 A;  4USA A;  3W8X A;  3A7R A;  1N5W A;  5HMR A;  1AWD A;  1TKE A;  2VAO A;  1T3Q A;  1SF0 A;  2VFR A;  3FW8 A;  4YXD B;  3NVZ A;  1FFU A;  1TYG B;  1V8C A;  4DNS A;  3R07 C;  2E3T A;  3S1E A;  2N0S B;  1E8H A;  1WVF A;  2QIE B;  3FC4 A;  2OHF A;  3A7A A;  1SIJ A;  5EE1 A;  2WLB A;  5AUI A;  3CWI A;  1HSK A;  1NEK B;  5G5G B;  1NYR A;  2P4P A;  2BS4 B;  5EE0 A;  1F0X A;  1R7S A;  2E5A A;  3KWL A;  2ACZ B;  3W8Z A;  3VRB B;  5G5H B;  1W1M A;  2PVO D;  4N6E B;  3NVW A;  1W1L A;  1WWT A;  4YT0 B;  2QJL A;  5C3J B;  2VFV A;  4PVJ A;  3BW7 A;  2Q4W A;  4PVK A;  4BC7 A;  3DQ0 A;  4WQM A;  3DED A;  1NEN B;  1N5W C;  1NI3 A;  1X2G A;  4PWB A;  4PYT A;  1E6E B;  5C2T B;  1T3Q C;  1FIQ B;  5GXG B;  1FFU C;  2H89 B;  5AUK A;  3W5V B;  3AE3 B;  2R2Z A;  2M19 A;  1J7C A;  1XLN A;  1QOA A;  3S1C A;  2LEK A;  3P4S B;  1VLB A;  1FRD A;  2JQR B;  2QKN A;  1NVI D;  3TX1 A;  1WXQ A;  1JW9 D;  1W1J A;  5AE2 A;  2K5P A;  5EE9 A;  4WWM A;  1JAL A;  1XLP A;  3B2G A;  3DWG C;  3AEC B;  2JX5 A;  1N61 A;  1I19 A;  2WDQ B;  3AE6 B;  3AB5 A;  4YTP B;  2O3G A;  2Y5C A;  3ETR B;  4IDI A;  3SR6 A;  2DWQ A;  3P63 A;  3AMZ A;  4ZOH C;  1SB3 B;  2EKI A;  3NRZ A;  4ITK A;  1KFY B;  3S1F A;  5AE1 A;  1VDV A;  3BII D;  3HRD C;  2EXR A;  1QT9 A;  3AV8 A;  2B76 B;  3W9C B;  1CZP A;  5D79 A;  2WP9 B;  2WDR B;  1AYF A;  3EUB 3;  3W8W A;  1TKG A;  2K22 A;  3NVW B;  1QLU A;  1ROE A;  3NVV B;  2PLI A;  1YQ3 B;  1AHV A;  4HG0 A;  3WCQ A;  3B9J A;  3NS1 B;  3SFD B;  3ZYY X;  2L83 A;  2MBR A;  4US8 A;  1W1O A;  2L52 A;  2RK5 A;  2PLS A;  2GQU A;  3LLB A;  2YVS A;  1DOI A;  2WU5 B;  1UWM A;  3FWA A;  1QF6 A;  2GQT A;  1N61 C;  3P4R B;  4XLO A;  2W55 A;  1ZUD 2;  4UD8 A;  3AE1 B;  2BS3 B;  1ZP0 B;  1F0Z A;  1YJI A;  3EUB 2;  2PVG C;  1L5P A;  1L6V A;  1KRH A;  2VFS A;  1OQR A;  3AEE B;  2KMM A;  1RM6 C;  3DWM A;  4BBY A;  4BC9 A;  1VAO A;  4C7Z A;  1W1R A;  5H8Y E;  4KX6 B;  1WYG A;  3FAH A;  4JWS C;  2NQW A;  3VR8 B;  2WDV B;  1L0V B;  2W3R A;  1E9M A;  2WS3 B;  1TKY A;  1DIQ A;  1V97 A;  1VJK A;  1YJJ A;  2WQY B;  1N60 A;  3TSJ A;  5EE3 A;  1E0Y A;  2I0K A;  5G5G A;  4ML8 A;  3AE8 B;  3HVZ A;  1DZN A;  3NVY A;  1FXI A;  3AE2 B;  1QLB B;  1E8F A;  1PDX A;  1L6U A;  3AE5 B;  4PVE A;  3SR6 B;  5G5H A;  3ABV B;  4P6V F;  1MBT A;  1FO4 A;  4US9 A;  5H92 C;  1FRR A;  2H88 B;  3S1D A;  2QPM A;  1DOX A;  1N62 A;  4PVH A;  4HRO A;  1QOG A;  1JWA D;  4N59 A;  2P13 A;  1FMA D;  3NVZ B;  3LXF A;  1E0Z A;  2Q5W D;  4JWU C;  1AHZ A;  5FXF A;  3P1M A;  1WGK A;  3AED B;  5HHZ A;  4JX1 C;  2K9X A;  2VFU A;  1W1S A;  3PO0 A;  3CIR B;  4PZF A;  3B9J B;  1RWS A;  2MJD A;  3AH7 A;  1FXA A;  4C7Y A;  2Q85 A;  3HUI A;  1W1Q A;  1B9R A;  2DBY A;  3A7U A;  1OQQ A;  2AX5 A;  2AXR A;  1UXY A;  3SFE B;  3PM9 A;  1DGJ A;  3GSY A;  5AE3 A;  1QOB A;  2MJE A;  4C80 A;  3LAE A;  1N60 C;  1A70 A;  1EWY C;  4O95 A;  2MJ3 A;  3FW7 A;  1WVE A;  4ZHO A;  1E8G A;  2W3S A;  1VQZ A;  1YQ4 B;  5ADZ A;  3AE7 B;  3AE4 B;  1E10 A;  5FXD A;  1FM0 D;  1E7P B;  1NYQ A;  1JWB D;  2BS2 B;  1ZR6 A;  1DOY A;  1PFD A;  4ZOH B;  1KF6 B;  1J7A A;  1XLQ A;  3FW9 A;  1N62 C;  4MLA A;  2M56 B;  4N58 A;  1N63 A;  3ETR A;  3VR9 B;  1RFK A;  3TSH A;  2BVH A;  2CJN A;  2CU3 A;  3AN1 A;  4A9A A;  4ZHP A;  3NVY B;  2BVG A;  1JRP A;  4YTN B;  3AEF B;  1CJE A;  4JB1 A;  2BT6 A;  1N5X A;  4JAY A;  2FBW B;  1IUE A;  3RPF C;  2G1E A;  3L4P A;  3AEA B;  2VFT A;  3NVV A;  3HRD D;  3P4P B;  3NS1 A;  1DII A;  5FXE A;  4HRS A;  4YSZ B;  1FFV A;  2W54 A;  1JQ4 A;  1ZOY B;  3D2D A;  5HQX A;  2MH7 A;  1ZXI A;  1RYJ A;  2OAI A;  3VTE A;  4TVY A;  3VRA B;  1QOF A;  1GPX A;  1MBB A;  3W5U B;  3KJM A;  2CJO A;  1JRO A;  1RM6 B;  3NRZ B;  1QLT A;  4YTM B;  3D2H A;  1XO3 A;  3AEG B;  4PWC A;  1OFF A;  1N63 C;  3AM9 A;  3AE9 B;  1SB3 C;  5MPO A;  1AHU A;  4TVW A;  1TJE A;  3D2J A;  4OAL A;  2P3H A;  1FIQ A;  4YSX B;  1W1K A;  2PKO A;  2R8D A;  1GAQ B;  4YSY B;  1XLO A;  3P4Q B;  3LB8 C; 
#chains in the Genus database with same CATH topology
 1S76 D;  3B2F A;  1NJX A;  2G09 A;  3ZIM A;  4HCH A;  5FJP A;  2PGE A;  2BKR B;  4BCA A;  3R3M A;  3R8B A;  3VH3 B;  2WAQ C;  4F92 B;  2BVF A;  1XQQ A;  4MGK E;  1WRI A;  2E1E A;  1TT5 B;  1V81 A;  5ALP A;  2YMP A;  5BPC A;  4FN2 A;  5KT3 A;  1VD2 A;  3BOX A;  4A3P A;  3QHT A;  2KTR A;  1A6S A;  4ED6 A;  1HZ5 A;  3GZF A;  2WU2 B;  3RJA A;  4AYB F;  2R2Q A;  4ECV A;  4B9T A;  2HBK A;  4CHK A;  2P0I A;  2NRW A;  2PIA A;  1OQY A;  1MDL A;  4BUG A;  4QWE A;  2XGQ A;  3RI7 C;  7ENL A;  1B0X A;  3KUD B;  3V6J A;  4USA A;  1SJD A;  2JU6 X;  5C23 A;  1KBU A;  3O65 B;  3VDZ A;  1I4G A;  2F3N A;  1T3Q A;  5G55 A;  5FJT A;  1UUP A;  3ZLG A;  4KWS A;  1L3V A;  4BWM A;  1KN5 A;  1C4C A;  4GIV A;  5DPS A;  5ALH A;  2FCM A;  2KK0 A;  3UJR A;  4ELV A;  2XCP A;  4OZB A;  1ZK7 A;  3UCC A;  1V8C A;  4XA5 A;  5BYS A;  2WXI A;  1WMH A;  4DNS A;  1MC8 A;  2K4E A;  4NAW A;  2PGW A;  3R07 C;  2WXM A;  3CSF A;  4MEX A;  2N0S B;  2AHO B;  5HP4 A;  3OHB A;  1BPY A;  3PRP B;  5I4D A;  1E8H A;  1WVF A;  5JRB A;  1DK3 A;  5DB6 A;  4IRK A;  3WKE A;  2W7O A;  1ZMC A;  5ALS A;  4BVU C;  3T6C A;  5EE1 A;  2AGQ A;  3WK9 A;  2MUC A;  5L6G A;  3Q8Q B;  3TAD C;  1ZQN A;  2MBO A;  1CQV A;  1ONF A;  2XH4 A;  3LAD A;  4JLC A;  3VFC A;  4FZL A;  2QIL A;  2BS4 B;  4RQ1 A;  3TEX A;  1L7N A;  2PMZ F;  2WB1 F;  3UIP B;  4EUT A;  4PHD A;  2IOH A;  4PPX A;  4HKZ E;  4NJC A;  1R7S A;  2ONE A;  4L2Y A;  1MN8 A;  4ECU A;  3MFI A;  5DGA A;  1S0N A;  2HSZ A;  2C7H A;  3MQT A;  3L5K A;  4QWB A;  2D3A A;  5FS7 A;  5U1O A;  2HHV A;  1OJT A;  2PVO D;  5AK6 A;  4IM2 A;  4QZC A;  3MTN B;  2KFK B;  1O08 A;  1W1L A;  1EU3 A;  1WWT A;  3BQT A;  1S9F A;  1GRB A;  3RNM A;  4O1N A;  3KHR A;  2HW3 A;  3BYY B;  4Y2J A;  9ICW A;  5DPR A;  4GC7 A;  3OP2 A;  4JL9 A;  1GXF A;  4Z6F A;  2M4N A;  2FCN A;  4WAA A;  3ED5 A;  3SD5 A;  1MA7 A;  5JUM A;  4PVK A;  2VIX A;  2FMS A;  1MFW A;  3N1X C;  5BYQ A;  3BQ1 A;  2CN1 A;  4GYP C;  4BKG A;  2KHV A;  4YG2 A;  2C3C A;  3CST A;  1NI3 A;  5JCN A;  3H70 A;  4RQ3 A;  4GC6 A;  1E6E B;  3WAL A;  3IT6 B;  4RNN A;  1PVP A;  3JPR A;  2GMI C;  2M1M A;  3VVW B;  3CGE A;  3GD4 A;  1AN8 A;  4DQI A;  2OYY A;  3RB6 A;  1FEB A;  2BCQ A;  3RCY A;  2AKZ A;  4IQU A;  1JWS D;  3QX1 A;  3GD6 A;  2E6X A;  2GR3 A;  3CB3 A;  5JHA A;  4Y2Q A;  5HG2 A;  5KHQ A;  2O6V B;  8ICT A;  1WR1 A;  1CI4 A;  2M19 A;  3GS2 A;  2PJH A;  1J7C A;  5KFQ A;  8ICY A;  1WGY A;  3WAP A;  3GRS A;  3QPE A;  3D6J A;  3KZI U;  2ATL A;  1QOA A;  3URH A;  2VZK D;  1TS5 A;  4ECT A;  4FLH A;  3Q4D A;  1D5Z C;  4OJ6 A;  2G45 B;  2LVO A;  3GZN I;  1VLB A;  1FRD A;  1NZP A;  3RMK C;  3SD7 A;  4BAX A;  2JHD A;  2MSN A;  8ICC A;  4KIK A;  4O0I A;  2P6U A;  2BYT A;  4NJ8 A;  4B9V A;  4CO7 A;  2WXR A;  4C56 C;  3QZ7 A;  1NVI D;  2FCS A;  4W9K A;  3B0Y A;  2SEB D;  5D4B A;  3OJU A;  2GBJ A;  3ZNZ B;  1GV4 A;  5EE9 A;  2ONQ A;  1FEZ A;  3ECI A;  4WWM A;  4A8X C;  4RUC A;  3TCA A;  4PGY A;  3HKZ C;  2QAE A;  3MBY A;  2WWZ A;  2NQL A;  3M9M B;  1I4X A;  4LNI A;  1X66 A;  1C4P A;  5E6J A;  2JRI B;  1Y8R C;  3ISC A;  2JX5 A;  1ZDV A;  2KLG A;  4EQW A;  2GBM A;  1GER A;  5DB8 A;  5AM0 A;  1D7Y A;  2WXG A;  3A4S C;  1T8E A;  2WDQ B;  4RNO A;  4IOI E;  3NOB A;  3WKD A;  3AE6 B;  3SZ2 A;  3ZDM C;  3TWB A;  1LB2 B;  2RR9 A;  2BYE A;  1GOZ A;  1Q46 A;  2DEN B;  2J3N A;  3HSU A;  4OJO A;  4JPS A;  4F5P A;  2KG5 A;  1DYQ A;  2XNA C;  2QDF A;  3AMZ A;  4J9R A;  2A4Z A;  2GR1 A;  1TAM A;  2MP2 B;  2B0C A;  4ZYS A;  1SV0 A;  2Y1I A;  3C5F A;  2DGZ A;  3CGC A;  4U6P A;  4RCO A;  1KH0 A;  4B6J A;  4DL2 A;  3I9V 1;  3W9C B;  4ZRJ A;  4LNO A;  1PYW D;  2KN5 A;  3B97 A;  4H4V A;  1ZRM A;  2OVL A;  2G5I B;  4RT3 A;  4BZA A;  4C8O A;  3NO1 A;  4E0D A;  4H50 A;  5AKE A;  2PA6 A;  4K8G A;  2BB6 A;  3QNM A;  1AYF A;  2Y3A A;  3DQV A;  1Z4O A;  3EUB 3;  2QQ6 A;  5ALL A;  3IJL A;  2OJW A;  3GE8 C;  2JV3 A;  2NVK X;  2LZ6 A;  4DK5 A;  2HNE A;  2Y08 A;  3C5G A;  3EW9 A;  3RNC C;  4WQO B;  2NRZ A;  1FEC A;  1ZD4 A;  1WJU A;  3DJG X;  4I2D A;  2R18 A;  5KFE A;  3BQ2 A;  1TTN A;  1DXL A;  3NVV B;  1HQR D;  4H4U A;  4HG0 A;  2QSD A;  1P3Q U;  1RRB A;  3WCQ A;  4HCN B;  3B9J A;  2PCE A;  1MI0 A;  2W03 A;  2JWU A;  2KVC A;  1F77 A;  4F1S A;  3MR5 A;  1ZQF A;  1W1O A;  1WI0 A;  4LLG M;  2WGS A;  1ZQJ A;  2MX2 A;  3DVN V;  2K4P A;  3ALB A;  4H19 A;  5TR3 A;  4I2B A;  1V9P A;  2LUM A;  2UU7 A;  2IO3 B;  2RDX A;  4LNK A;  4RT2 A;  1ZPS A;  4GU2 A;  1MVK A;  2JH1 A;  1UGM A;  4W9C A;  3IC9 A;  3OPX A;  3B0X A;  2L32 A;  4L1B A;  2POZ A;  5BMG A;  1TAQ A;  5KFD A;  4PHP A;  2K0P A;  3P4R B;  4OVV A;  2FUG 1;  5LXI B;  4BUR A;  3SQP A;  2FLL A;  2NV3 A;  3UQB A;  2DPJ A;  1WJ6 A;  1ZQS A;  4ZRI A;  3KW5 B;  2PFN A;  1UT5 A;  3MAB A;  3KHH A;  4XC2 A;  2GSH A;  3EUB 2;  2PVG C;  4UAZ A;  5AM1 A;  5KG5 A;  4O3O A;  2JXT A;  2KDE B;  5KG0 A;  1L6V A;  3IG3 A;  1SGH A;  1WY8 A;  4YR3 A;  3VTW A;  4YWS A;  4XE0 A;  2KMM A;  4ECZ A;  1RYU A;  3MDA A;  3DWM A;  1WZ0 A;  5KT6 A;  1X9S A;  4PS3 A;  3SYZ A;  5C1Z A;  5AKK A;  4KT2 A;  1B22 A;  4BBY A;  3U8Z A;  2Y5P A;  2DL0 A;  3NJT A;  5FS8 A;  2KJ9 A;  1MPE A;  2AH5 A;  3BDP A;  2FCQ A;  2LVP A;  3IM1 A;  1L0V B;  2KN7 A;  1CEZ A;  3CRX A;  1E9M A;  3V05 A;  2H3Z A;  1KFD A;  2P6R A;  4RQ2 A;  2RPV A;  2FMQ A;  1NBF C;  1VJK A;  4C00 A;  3FYY A;  2NVU I;  1BNO A;  2LGY A;  2G5H B;  3TSJ A;  3PS6 A;  2F44 A;  5EE3 A;  4JB3 A;  3RR8 A;  4UAU A;  2AQ1 B;  1E0Y A;  5JZE B;  4LVS A;  3CK5 A;  2QB0 A;  1C1Y B;  4ML8 A;  4XRH A;  1FHU A;  4F8R A;  3Q3J A;  3VDG A;  3BQ7 A;  4ECX A;  2V9W A;  1Y56 A;  2CHR A;  4E8G A;  2CU1 A;  5D3I B;  3IAM 1;  3SU8 X;  1OEY A;  4EEK A;  4UAW A;  5DB9 A;  3QUB A;  4EX6 A;  4Y2R A;  4I2J A;  3JPT A;  3EWA A;  3ONN A;  3DES A;  1EU4 A;  3SR6 B;  3ZVH A;  1SEB D;  4BGD A;  5IKC M;  1S97 A;  3RJ8 A;  2EZZ A;  3UM9 A;  1BPD A;  2KFK A;  4US9 A;  4E74 A;  2MBE A;  3ZTC A;  5KFN A;  4LCD E;  4DF8 A;  2IND C;  4CGZ A;  1UNS A;  3X23 A;  1Z4N A;  1KEJ A;  3K4G A;  1SXT A;  1D6E C;  1QQ6 A;  4UB8 U;  2Y0S C;  2Y3R A;  3GRT A;  9ICJ A;  4DHJ B;  1E0Z A;  4JWU C;  5FXF A;  1S0V A;  3P1M A;  7ICE A;  3HJE A;  2L05 A;  3AED B;  5HHZ A;  4JX1 C;  4HVB A;  1D5M C;  4DO9 A;  3QU5 A;  1OEY J;  4QZB A;  3H4B A;  3SDL C;  4KLI A;  4FBT A;  5D6J B;  4IC9 A;  2EAO A;  2D10 A;  2BGW A;  2YEP B;  2WX0 A;  1W1S A;  2K39 A;  3NS8 A;  4K3B A;  4ICU A;  3V6C B;  4FJZ A;  2HOF A;  1SJA A;  5KTQ A;  2MJD A;  3RR7 A;  3ML8 A;  1FXA A;  3L10 B;  3PMN A;  4ZCW A;  4CF3 A;  2BQ3 A;  4LZG A;  1GRH A;  3A7U A;  1V49 A;  3DBL B;  3MWC A;  1EC9 A;  2AX5 A;  5KL1 B;  2BWE S;  2O6V A;  5FR6 A;  3VH4 B;  2ZZC A;  2K4H A;  2OCE A;  3SFE B;  4KLT A;  4O5E A;  2D5G A;  2X8X X;  3EA6 A;  3GOE A;  3GSY A;  3N9Y C;  1QOB A;  4WWN A;  1LO5 D;  4HKQ A;  4JQ9 A;  1LV5 A;  1L0X B;  3H1U A;  2IOF A;  4NLZ A;  1N60 C;  3ZTD A;  4Z17 A;  3PV8 A;  3APD A;  4UB6 U;  4O95 A;  1DXS A;  3SHQ A;  1SJB A;  1ZQD A;  2KV2 A;  2LI6 A;  5KFS A;  4RUA A;  8ICL A;  3PO4 A;  2GBK A;  3G6X A;  2HHT A;  3Q8F A;  3NZS A;  3RJI A;  1RFA A;  5CWR A;  1STZ A;  2KOB A;  3WK8 A;  2AEH A;  2OZT A;  2W3S A;  6ENL A;  3GIJ A;  1X9W A;  1BML C;  1V6E A;  4M8M A;  2JRH A;  2WXO A;  5BOF A;  3AE7 B;  2EZX A;  4XX5 A;  4P1C C;  1E10 A;  1L8O A;  7ICN A;  1KM7 A;  1E8X A;  1S7M A;  1FM0 D;  1E7P B;  1NPX A;  1NYQ A;  3L5O A;  3W1S A;  2XY6 A;  4DYE A;  4DFJ A;  1OUQ A;  1ZQV A;  3U4E G;  3A0H U;  5KFG A;  1KF6 B;  1CUK A;  3M8S A;  4ASW C;  4BOS C;  4RNM A;  2DZJ A;  4EEN A;  2JPH A;  2NBW B;  2GI9 A;  3OJ4 B;  1ZET A;  5AHX A;  4FX9 A;  2HE7 A;  1MHH E;  3Q8K A;  4DSK A;  9ICF A;  1NKE A;  3RTV A;  1RXW A;  3M62 B;  4HAI A;  2BHN A;  3MGV A;  1HEK A;  2QLT A;  3RB0 A;  3QCA A;  1WXS A;  4H4S A;  4ED0 A;  3MY9 A;  1N63 A;  4NLG A;  2PP3 A;  3VR9 B;  5KFZ A;  4DS4 A;  3Q69 A;  4OJL A;  2VJ5 A;  2DYM A;  1L7P A;  4EYI B;  3PO5 A;  2JZ3 B;  1J97 A;  1CRX A;  3VQI A;  3GII A;  2MP2 A;  2KE7 A;  2EAN A;  3V7K A;  2MWS B;  3W1Y A;  2MSE D;  1KFS A;  1NKB A;  1RQL A;  2DKX A;  1P43 A;  2DFL A;  1H8C A;  3BVG A;  1W6T A;  4QZG A;  1L7M A;  4EWJ A;  2AJQ A;  4R65 A;  3D2S A;  2ZJ8 A;  8ICQ A;  4IWO A;  4ZHP A;  4EEY A;  3DBH B;  4RMA A;  4RNA A;  4OJP A;  1F1H A;  1P98 A;  1OXJ A;  2BVG A;  5III A;  1MSW D;  2JYE A;  2KMC A;  2N7E A;  2NBU A;  2ZCB A;  2N4F A;  3AEF B;  1KLN A;  3I28 A;  2JXJ A;  3T9P A;  1N5X A;  1WXV A;  4ADW A;  1IUE A;  2F8L A;  3LB8 A;  3PTF C;  2KO3 A;  4ANU A;  3H8J A;  4RGO S;  1YZ6 A;  2N9P C;  3AEA B;  1ZQI A;  4A6G A;  2WOW A;  3MSY A;  4F91 B;  2J42 A;  5B5E U;  4K7W A;  3NVV A;  4AP4 C;  1BVS A;  4FI4 A;  5ENL A;  3G6Y A;  5DBB A;  3F5E A;  2A19 A;  5KG6 A;  4XGA B;  1L8P A;  3DG3 A;  4MEY A;  4UAS A;  5EDS A;  3CAW A;  4UW9 A;  4R66 A;  3Q8E A;  4MT5 A;  5JTI A;  3WK7 A;  4UAY A;  3ZXV A;  1JQ4 A;  1ZOY B;  3ZDA A;  4BBN F;  3D32 A;  3UXO A;  3D2D A;  1IXR A;  2KJ5 A;  3H7S A;  5IIM A;  4QZD A;  2I2Y A;  4UAR A;  4UB3 A;  1YX5 B;  2KTQ A;  4EKU A;  3D2Q A;  3TSS A;  2ASD A;  2X38 A;  3TEW A;  2KWD A;  1C7Y A;  1ZQU A;  3RJK A;  3U26 A;  1V1P B;  5J29 A;  3ENE A;  1YN3 A;  2CDU A;  4PHA A;  2JEG A;  3GV5 B;  1PDZ A;  1YEY A;  2K6D B;  3PT2 B;  4Z1Y A;  1C78 A;  1PK1 A;  4LJO B;  2QJM A;  1C76 A;  4AQ7 A;  4MM3 B;  2IJ0 A;  4Z6E A;  5J0X A;  1HEZ E;  1XO3 A;  2MRP A;  3ZD9 A;  3IV6 A;  3L3F X;  5DCN A;  2IHM A;  2HVH A;  1MHX A;  1C79 A;  5CX3 A;  4GME A;  4Y2S A;  3LDA A;  4DXK A;  2YVF A;  4RU9 A;  1ZE3 D;  4YD1 A;  1DGS A;  4K4G A;  4HPP A;  3MUC A;  3H40 A;  1RAX A;  3PK7 A;  5KFO A;  3I1Y A;  5TR5 A;  4MSQ B;  1VR9 A;  3TAD A;  2MEK A;  4YQW A;  3JYU A;  9ICM A;  4TVW A;  3KLS X;  3C0R B;  3HM3 A;  2F1H A;  4DL3 A;  4A55 A;  2FPK A;  3VCN A;  1FIQ A;  1W1K A;  3A1Q B;  4DQS A;  3AU6 A;  3N7P D;  5ALV A;  3PML A;  2EAP A;  2WXL A;  1GAQ B;  5DGB A;  4FJY A;  5J8Y A;  2A3V A;  2MBB B;  5LLI A;  4DL4 A;  3CXB A;  2GO7 A;  3ZNI D;  4I6L B;  3AEB B;  2GB1 A;  2NO4 A;  5IO9 A;  2N1W A;  1U4B A;  3C0P A;  2RDI A;  1ZQZ A;  2HHX A;  2QDE A;  1RXV A;  2Q4T A;  4KMU A;  2E8O A;  3PW5 A;  4IWQ A;  5D3D A;  5JRT A;  5J17 A;  4IKG A;  5AZH A;  4HNL A;  5IIK A;  2INP E;  4KLU A;  2WXF A;  2E8N A;  2C60 A;  4FXC A;  3LWM A;  4O3N A;  2JVC A;  5DG7 A;  4DBG A;  5FR3 A;  1UA1 A;  2WXP A;  2I6X A;  3C1Y A;  4Q8F A;  3PX0 A;  5ALU A;  2LYB A;  2D3B A;  4DXA B;  2WPF A;  9ICG A;  3M3J A;  3DEE A;  4NZL B;  2JR5 A;  3UGB B;  1AWD A;  1MRA A;  3MGH A;  3NAS A;  3H8W A;  4YP3 A;  1KTQ A;  4GXI A;  2TPR A;  2KKP A;  2ISO A;  3U7D A;  3RH6 A;  3SJN A;  2ZTC A;  3N28 A;  2Y9T A;  1BPX A;  4OO1 J;  4K2S A;  2EH9 A;  5DQI A;  7ICT A;  4DHZ E;  4K7S A;  4EMJ A;  2JMG A;  5DG8 A;  4F4X A;  4IQW A;  3URY A;  4PK1 A;  3S1E A;  2BW2 A;  2AQ4 A;  4ED8 A;  3LVW A;  2R8H A;  1IGD A;  4YXM A;  2WF6 A;  2QIE B;  3FC4 A;  2AQ2 B;  3C29 A;  5JH5 C;  3GFK B;  4M9H A;  4Y2Y A;  1E5W A;  2MNR A;  1D8B A;  1JXL A;  1SIJ A;  3OJS A;  1NK9 A;  1GB1 A;  4R8U B;  2J0J A;  5AUI A;  5AZF A;  2A8X A;  1K1Q A;  1ZD5 A;  1WRD B;  3CWI A;  1Z1V A;  2KIC A;  2OXO A;  2ZG6 A;  4NJ6 A;  4XDC A;  4IQV A;  5ALW A;  3H8H A;  5G5G B;  5L1M A;  4MFF A;  4RZR A;  3SV4 A;  1NYR A;  5AM4 A;  1IP9 A;  4IL2 A;  3Q3N C;  3ES7 A;  5IDZ A;  3ZO5 B;  5EE0 A;  2JEI A;  2L00 B;  4IL6 U;  4F93 B;  1TZZ A;  2PMV A;  2ZCC A;  4F4Y A;  3JW0 X;  1HXY D;  2DW7 A;  4RQM A;  1ZDX A;  9ICH A;  2RPQ A;  1UH6 A;  3KWL A;  2QGY A;  4F5N A;  1X6J A;  3W8Z A;  2DUY A;  2NO5 A;  3ORY A;  4NNJ B;  8ICS A;  2WHE A;  3ZUN A;  4I2I A;  5HKH A;  3NVW A;  4C4S A;  4DSL A;  3W2D A;  4FZM A;  2QJL A;  5C3J B;  1I42 A;  4CF5 A;  4PVJ A;  3RGT A;  4RGN A;  3PSI A;  3ZRC A;  2N9X A;  2LM4 A;  3T8M A;  2J0K A;  4M0W B;  3LDZ E;  3PWG A;  2DW6 A;  4M04 A;  9ICO A;  2G4S A;  3DG6 A;  3R0U A;  2BDU A;  1NEN B;  5BMI A;  5JU5 A;  4PH5 A;  1XXG A;  2L8J A;  5ALX A;  2LYA A;  4ED3 A;  1LGR A;  2WXJ A;  3I5J C;  1D3Z A;  1SIF A;  3FDS A;  4P1B C;  1V38 A;  2M8S A;  2MW5 A;  4PWB A;  5AI0 A;  4LNF A;  2ZXH A;  2KAC A;  4ACF A;  3QUC A;  1BKH A;  3H0M B;  1SWV A;  3N1Y C;  2Y9U A;  1TY0 A;  3S47 A;  3PR4 A;  5L1L A;  3H0L B;  3TIX A;  1NK4 A;  3H8M A;  4G0N B;  1FFU C;  5IAA C;  1IBX B;  5J0R A;  2CR5 A;  2H89 B;  5CTR C;  3WKB A;  1XC9 A;  4F7Z A;  2HZG A;  4NEV A;  5DLF A;  3QE9 Y;  1BPE A;  4EZK A;  1XEE A;  5EU9 A;  3KD3 A;  1YX6 B;  3AE3 B;  4KZC A;  1ZX9 A;  4J9Q A;  1F5S A;  1RYR A;  1NNL A;  4H4X A;  2PMZ C;  5AM3 A;  5J2G A;  3KHL A;  4ED1 A;  2BPF A;  1MNS A;  3IVF A;  2GL5 A;  2LRW A;  4S17 A;  2RQ5 A;  3K1R B;  2MA9 B;  2DF4 B;  3Q14 C;  3SQI A;  4PS8 A;  1YQZ A;  2DAJ A;  2DNF A;  3CMM B;  3ZLZ A;  4KLQ A;  3AEV A;  2KZZ A;  2WBA A;  2GRT A;  2K6Q A;  3U9I A;  2JT4 B;  2NCN A;  4BKT A;  3P2B A;  3RNE C;  2QKN A;  3NHE B;  5ALD A;  1WXQ A;  3TX1 A;  4QIW F;  3PLU A;  1W1J A;  4PGQ A;  5K4L A;  2GRI A;  2XCA A;  4EEL A;  1HUZ A;  3DVG Y;  3PW4 A;  2L0T A;  3GIL A;  2O6K A;  1H38 A;  8ICF A;  1XNS A;  3PSF A;  4FO6 A;  3BK2 A;  5AKJ A;  3DWG C;  1KQQ A;  3GD3 A;  3QU4 A;  5E6O A;  4J9M A;  3N4E A;  3CYM A;  3H7P B;  4ECQ A;  3SN4 A;  1I19 A;  5AI5 A;  5J2J A;  5KNI A;  3EPG A;  2K89 A;  3DHI C;  3RZF A;  1EBH A;  2KIW A;  2KX0 A;  2LGS A;  3ZNG C;  1ZQE A;  3HIZ A;  4UQG A;  4BKS A;  1C9F A;  2ZVO A;  4B0E A;  1TK5 A;  1ACC A;  5J18 A;  2O6V D;  4EZ6 A;  2UUU A;  5AWV A;  1MO9 A;  1FNV A;  5KFB A;  2IGD A;  2RLT A;  1UWX A;  1ZQK A;  2NPT A;  3CXO A;  2JZP A;  3RCZ A;  2ZJD A;  3ETR B;  1V1P A;  2DWQ A;  2F1I A;  3PQB A;  5J2A A;  4ZOH C;  1NI2 A;  2IO0 B;  4O3M A;  4ITK A;  1KFY B;  3LJ3 A;  1NHP A;  3UGV A;  4CF4 A;  4U7C A;  2R8K A;  3PY8 A;  2Y1J A;  5AKL A;  3DIP A;  2FE9 A;  1QT9 A;  3HRD C;  4MM3 A;  1ZQM A;  3RT3 B;  1PDY A;  3AL0 B;  3BVZ A;  3RNB C;  4ZYN A;  2IOF K;  1S8O A;  3M63 B;  1K5O A;  3DH9 A;  3KYC D;  3N6H A;  2XH7 A;  3W8W A;  2KAN A;  2BCU A;  2XN9 C;  3IG5 A;  3T5H A;  3VTV A;  1OW5 A;  3C21 A;  2O2V B;  2EQY A;  4P0P B;  1E7U A;  4DFM A;  2ZIV B;  5AI6 A;  3CT2 A;  2P8B A;  3SFD B;  3GV7 B;  3DBL I;  3V3X A;  3NG0 A;  3PGE A;  2MBR A;  4US8 A;  2G08 A;  4W9J A;  3TW9 A;  4RQ5 A;  1D9D A;  5FMH A;  1ZMD A;  2D6F C;  2PSN A;  4HDO A;  2WDT B;  3PZD A;  3DVG X;  3OWE B;  2F8K A;  2PEA A;  2LYH A;  3RR1 A;  3KUZ A;  2YVS A;  4YMM A;  4BXO B;  2UWQ A;  3IJI A;  2KZ3 A;  4NAM A;  4BFR A;  4CQN A;  2KEY A;  3TFR A;  1S3S G;  3I63 C;  5HFY A;  4GFJ A;  5JCK A;  1PGB A;  1QF6 A;  2FMP A;  3EAN A;  2KC2 A;  1JN3 A;  1N61 C;  4JHM A;  1Q8K A;  2E5S A;  3T8Q A;  2JEJ A;  2W55 A;  1WE6 A;  4OJ5 A;  3N7S C;  1ZUD 2;  2J52 A;  4BJQ A;  3AE1 B;  1HZ6 A;  4MGY E;  1L4D B;  5KT5 A;  4QZF A;  4I28 A;  2BS3 B;  4WJQ A;  2JEF A;  4YCX A;  2AGP A;  4MEM A;  5CHG A;  1F0Z A;  1XSL A;  1SSN A;  2SAK A;  3E56 A;  1GUA B;  1L5P A;  4TUU A;  1XS2 A;  4QZ9 A;  5JHB A;  1Z1B A;  3ZDD A;  2DZI A;  3ETL A;  4J3Z A;  4FE3 A;  1MOK A;  1RM6 C;  1X6I A;  4MSM B;  1YMH E;  2JRZ A;  4PJ0 U;  3DCG A;  3QIJ A;  1IV8 A;  2W9C B;  5J0Y A;  5HML A;  1UBQ A;  1L6N A;  1N2X A;  5ALI A;  2J4X A;  1VAO A;  5AM5 A;  2CKH B;  1ZY8 A;  2YTU A;  2N9E B;  2ASL A;  2C2D A;  5DQH A;  3FAH A;  3PVL A;  4KX6 B;  3VR8 B;  2CPR A;  4PHE A;  2WDV B;  5JCM A;  2H3I A;  2WP5 A;  3ZRF A;  2DHZ A;  2PTW A;  3Q8A A;  2DYB A;  1KJT A;  2V4L A;  1DIQ A;  4J56 A;  4NWI A;  4M0X A;  4R8U A;  3LXD A;  7ICR A;  1KKR A;  3NUQ A;  1F0M A;  3IN5 A;  1N60 A;  4NV0 A;  1MUC A;  1E8Z A;  1YT3 A;  4CE6 A;  4I29 A;  1ZGU B;  4HXD A;  4NY0 A;  5G5G A;  4XDD A;  4H83 A;  3DBH I;  2BCP A;  1BUI C;  2PP0 A;  3MFG A;  4WJN A;  3AE8 B;  3LYS A;  2QC8 A;  4MEL A;  4IT1 A;  3TAC B;  3DGH A;  1ZKH A;  3A4R A;  5HR6 A;  2HMX A;  3NVY A;  4EZ9 A;  1DZN A;  2R9Z A;  3AE2 B;  3ISD A;  5HMM A;  5FK9 C;  3PV1 A;  4UB4 A;  3FJ4 A;  1JEH A;  1I4H A;  1UF0 A;  2MBH A;  1EF1 A;  4GMV A;  4PVE A;  5J2B A;  4CNQ A;  2G9H D;  4AP9 A;  4C8K A;  3Q3F A;  5JXV A;  2ZUC A;  3ABV B;  4HCP B;  4P6V F;  2L3Z A;  4EBC A;  1YN4 A;  1FO4 A;  2W9M A;  1F9J A;  5H92 C;  2D3D A;  2PI4 A;  1FRR A;  2ODG A;  1HTQ A;  4I6N B;  5GRT A;  1TY2 A;  2DPI A;  2CHW A;  2KWC A;  2ON8 A;  4TV3 A;  4RFB A;  2KP7 A;  4J9L A;  4N59 A;  1WX7 A;  1FMA D;  5D2M B;  4M0W A;  3D9X A;  2P13 A;  5ALK A;  3BWU D;  2L0F A;  1GO3 F;  3NGD A;  2QCZ A;  1AHZ A;  3CNH A;  3QUQ A;  2Q0Z X;  1J8C A;  3RJE A;  3SAH A;  3SEN A;  4RF1 A;  3D2N A;  1ZJM A;  2XK5 B;  2PXI A;  5KFV A;  3Q8L A;  2IO2 B;  4GIR A;  1BNP A;  3SN0 A;  1SE2 A;  3QUT A;  8ICX A;  3CIR B;  2F2A B;  2JF5 A;  4RGT A;  3ZLH A;  1SZP A;  1URJ A;  5EWG A;  4QWD A;  4ECR A;  2IPK D;  5JCI A;  2GBN A;  1RWS A;  3ZKJ C;  3RF9 A;  4E71 A;  2AAQ A;  2PPH A;  4KTQ A;  4FDC B;  1V59 A;  4C7Y A;  3UQ2 A;  3R9K A;  4DL7 A;  5KL8 B;  1YQB A;  1HJP A;  3C23 A;  3BZD B;  3HUI A;  1W1Q A;  5KFJ A;  3R10 A;  3TAP A;  4JN7 A;  1OQQ A;  1TIF A;  2AXR A;  3U30 A;  2BQR A;  4IW0 A;  1UXY A;  4ICA A;  4ECW A;  1TK8 A;  2BZF A;  3KBB A;  2K25 A;  1DOQ A;  4Q2J A;  3WIM A;  2P8C A;  3LAE A;  1TKK A;  5L1K A;  3MC8 A;  1A70 A;  5KFU A;  1WX9 A;  4B0M A;  1QIL A;  5A0L A;  2YX8 A;  2RMM A;  3FYH A;  3MC1 A;  4ZH4 A;  2FKP A;  2LAS A;  4XWT A;  2X8C A;  2GWS A;  4R3D A;  3IK4 A;  1WVE A;  4YVZ A;  2JWZ A;  4IM3 A;  3AU4 A;  4F4W A;  3PR5 B;  2LGD A;  5J0W A;  3VTU A;  1ECW A;  5AKZ A;  7ICQ A;  3R1Z A;  1E7V A;  2JGA A;  4M52 A;  3VUY A;  2KKC A;  2MQJ A;  1Z2M A;  2M0N A;  2V9H A;  4FBU A;  5HHI A;  2KNB A;  1VZ8 A;  5ALT A;  2LHT A;  5F9L A;  4IRC A;  3H7P A;  3RN9 C;  4WJ3 B;  1T6B X;  4IL0 A;  1AW7 A;  1TZO A;  4ZOH B;  1UGJ A;  1J7A A;  1UPH A;  4AJW A;  3VA8 A;  3M7D A;  2M0X A;  2NRV A;  3L16 A;  1C20 A;  4APN A;  1N62 C;  1P1A A;  4UB1 A;  4M6W B;  3EJE B;  3KZX A;  1RZT A;  2PU1 A;  2RRD A;  3DBS A;  1HIW A;  4DQQ A;  3II4 A;  4K3C A;  2P66 A;  4N58 A;  4PZN A;  1N56 A;  3ZGZ A;  2PPG A;  2JY6 A;  4DNA A;  3K9O B;  3ETR A;  3P42 A;  4RPY A;  4H4R A;  2EQ9 A;  3TSH A;  4KZ0 A;  2HI0 A;  4O9M A;  2BVH A;  3KUM A;  1JCK B;  2BYV E;  3RZW C;  3LK9 A;  2CJN A;  2CHX A;  2J0M A;  3QQ8 B;  3LVV A;  3AN1 A;  1WGG A;  3OC4 A;  1ZOL A;  2PKE A;  3RJG A;  1IG6 A;  7ICM A;  4RPX A;  4DFP A;  2PFQ A;  4IR9 A;  2AL3 A;  4FZN A;  4WIP A;  3H7V A;  4MF8 A;  4NJ7 A;  2BT6 A;  5IIO A;  4ANX A;  2YQU A;  4J9P A;  4K1W A;  4JAY A;  4DOB A;  1D9F A;  2KIV A;  4TQ0 A;  3TL5 A;  4RQ4 A;  2V3S A;  2ZPY A;  3L4P A;  3T5L A;  4PT5 A;  2LGI A;  1OGW A;  2XIC A;  4KPR A;  3RFA A;  1R0M A;  2O2V A;  4I2H A;  2V4R A;  2YB4 A;  1R4M B;  1XSP A;  4P0P A;  5ALJ A;  1GET A;  2ZC8 A;  3UXK A;  4W9H A;  2X8H A;  3K1Z A;  2ZIV A;  3P4P B;  1P48 A;  1XDI A;  5FXE A;  5CR0 A;  3KFU F;  4HRS A;  5IA7 A;  1SKS A;  3C1Z A;  2KJR A;  3F5A A;  3TBL D;  5ALF A;  1J0G A;  5GTH U;  4NL9 C;  2EQ6 A;  3ZNH B;  3M6K A;  2MH7 A;  7ICK A;  2LHD A;  3TAN A;  1WYW B;  4W9F A;  1JPD X;  4HN8 A;  1BGX T;  4HNC A;  4TVY A;  4BXO A;  3VRA B;  1R6W A;  3AU5 A;  2V1Y A;  2C28 A;  1K53 A;  1QOF A;  4TMA B;  1GPX A;  4H4W A;  3W5U B;  3KKA C;  9ICQ A;  5DPW A;  2CJO A;  3RUI B;  1KLG D;  1JRO A;  5FS9 A;  3IRU A;  3T9L A;  8ICA A;  3U4F A;  3ZJU A;  1RM6 B;  3PST A;  4C4V B;  1H4R A;  1QLT A;  8ICM A;  3PZP A;  3L13 A;  4YTM B;  2Y5B B;  4A6Q A;  4JQW C;  1QCK A;  5AK3 A;  4JDR A;  5KFM A;  4PZO A;  1KDH A;  2HDE A;  1WWU A;  1A77 A;  4I2E A;  3AEG B;  4J9N A;  4GGQ A;  4FAD A;  1IM4 A;  1STE A;  4PWC A;  2HXU A;  5AKH A;  4LA1 A;  2IY1 B;  5CP2 A;  2HHQ A;  3UIO B;  2KVS A;  4ECS A;  5FS6 A;  3V60 A;  1SB3 C;  2GGE A;  5MPO A;  4EQS A;  3DJJ A;  1UHU A;  3QYP A;  2ASQ A;  5L6F A;  3DGB A;  5J2R A;  2XY5 A;  3C19 A;  2W9C A;  4HWI B;  1KOT A;  1ZQY A;  2BC1 A;  4RM8 A;  4FP1 A;  4E6M A;  3SMV A;  1D8Y A;  7ICG A;  4QZI A;  2R61 A;  3MJ5 A;  3X0W A;  2VA8 A;  4EM3 A;  2P3H A;  4LJX A;  1WJ4 A;  4TQ1 A;  4YSX B;  9ICB A;  1TS4 A;  2FJ6 A;  5AM2 A;  1CMX B;  4DCC A;  1Z19 A;  3TWA A;  3R2T A;  3P4Q B;  3C28 A;  1ZQ1 C;  2ZIU B;  4B9N A;  3R66 C;  2OJR A;  5DKW A;  4HYK A;  4KIT B;  1WR6 E;  4AUQ C;  2FPL A;  2PE9 A;  3I99 A;  4II2 B;  3RD2 A;  5D49 A;  1V5O A;  1PUT A;  2KAJ A;  4LTU A;  3P0W A;  1TAU A;  2F77 X;  1J7B A;  3BZK A;  1M94 A;  1MG8 A;  1X2H A;  3Q3M C;  3ALR A;  5AZG A;  4M02 A;  2FI1 A;  1EWC A;  3JPP A;  3SBF A;  2PI5 A;  1V86 A;  2GR0 A;  4NQL B;  4GGB A;  2HTM E;  1AOG A;  2KKV A;  4RF0 A;  3QTP A;  3PNC A;  5D94 A;  1FFV C;  4ED2 A;  1QTM A;  3THU A;  2QJJ A;  4M01 A;  3FVD A;  3GC2 A;  2KHW B;  1Z5S B;  1ZXI C;  3ZW3 A;  3JS8 A;  3NTU A;  4M8N A;  3BS7 A;  3W8X A;  2DX5 B;  3PW0 A;  3B08 A;  5HMR A;  3MFH A;  1L0Y B;  2YAU A;  1FD6 A;  2AKM A;  4Y2T A;  1TKE A;  2JZB B;  1RG6 A;  2IA6 A;  2KJ8 A;  4DWI A;  1SF0 A;  1BPB A;  1VCB A;  2KDI A;  5BYR A;  4O3P A;  4KN4 A;  3CYJ A;  4ECY A;  3FW8 A;  2AWT A;  2WXQ A;  4XZ4 A;  3JSV B;  4JE3 B;  2CFY A;  1FFU A;  4MFA A;  9ICL A;  1MG4 A;  2LRU A;  3U7Z A;  3PFR A;  3DGZ A;  2KFZ A;  2V3B A;  4TQR A;  3PHW B;  4YL8 A;  2E3T A;  4F71 A;  1GJZ A;  1KN0 A;  5DPT A;  1L7Y A;  3F2B A;  2XK5 A;  2G06 A;  4EBD A;  9ICN A;  1EXN A;  1A76 A;  4GDK B;  4ELT A;  4KKI A;  2AL2 B;  3OLM D;  5J0U A;  1DRG A;  4WUR A;  5LNK 1;  2N9L A;  1WGH A;  3BQ0 A;  1HSK A;  3H6N A;  4G3X B;  1NEK B;  4Y2V A;  5GTI U;  4F5R A;  1WXM A;  4E5T A;  1T0Y A;  1LVH A;  5DB7 A;  4KV2 A;  1F52 A;  2PTL A;  3L08 A;  1WCL A;  5KFP A;  3WAN A;  3M9N B;  4GDL B;  1F0X A;  4F4Z A;  4W9L A;  1T5X D;  1ELS A;  4E4U A;  3HPF A;  2RAB A;  2KD0 A;  1YZ7 A;  2OH2 A;  3OJ3 A;  3AUL A;  4QW9 A;  3N97 B;  3L8K A;  3TJP A;  1WG8 A;  2FLN A;  5E6P A;  2BTE A;  5DDY A;  4BWJ A;  2ACZ B;  3GP7 A;  1P7D A;  8ICI A;  1KLV A;  2W43 A;  4P2H A;  1W1M A;  3P3B A;  2ZZ0 A;  3UCD A;  5KFK A;  1SXE A;  5E79 U;  3HVD A;  4N6E B;  1JML A;  1PQS A;  1LVL A;  1XCQ L;  1N6Z A;  3PWI A;  3FXG A;  1GEU A;  5FJU A;  2LPE A;  2RDJ A;  3H0R B;  4H2H A;  2V4I B;  4MGZ E;  2XI9 A;  2Y0S F;  4KN7 A;  1NEL A;  1Z00 B;  2G4D B;  4BC7 A;  4WQM A;  3E9S A;  3DED A;  2AL6 A;  4NLK A;  2WOV A;  1N5W C;  4EX7 A;  2WPE A;  4BX9 C;  2K8C B;  5KHO A;  2AGO A;  2EAM A;  3PZ8 A;  5C2T B;  5IP4 D;  4JV2 A;  8ICB A;  1SJE D;  3S5S A;  4M6W A;  2RDB C;  2H3F A;  1I35 A;  4Y2P A;  7ICS A;  3BK1 A;  1WGD A;  2WDW A;  3HW8 A;  1BZL A;  3WKC A;  5J2K A;  2RD0 A;  2D3G A;  5GXG B;  3TI0 A;  2OLA A;  2ZTE A;  4CCH A;  2LUE A;  3EKG A;  3FM9 A;  3LWL A;  4EYH B;  4B9K A;  1TE6 A;  2VA3 A;  4KGR A;  2MU2 A;  5TIS U;  3Q8C A;  4UAT A;  1ISN A;  4GLS C;  4EEW A;  3EZ5 A;  3N3K B;  4H4Z A;  3QEB Z;  4H4Y A;  3V61 A;  2LJ5 A;  2MHJ A;  4KGS A;  1ECQ A;  3DV9 A;  2KXJ A;  3OHA A;  4WJO A;  1RQN A;  3S1C A;  5C0Y A;  2KTR B;  2HBL A;  2OEH A;  3P4S B;  2P88 A;  4DOA A;  3OAW A;  2KWU B;  2LXA A;  3MHS D;  1X9M A;  2F1J A;  4F72 A;  1RYS A;  4RGM A;  2GBR A;  5CHF A;  4B95 A;  3HX0 A;  4H4P A;  5KG1 A;  5J2F A;  2XEW A;  1JW9 D;  2D2Q A;  4YWO A;  3UQA A;  5AE2 A;  2K5P A;  2ALZ A;  4URK A;  2UVU A;  3E2E A;  3GIK A;  4FFD A;  3DDH A;  2XSX A;  5T8I A;  1NHS A;  1U49 A;  5J04 A;  2R8I A;  5FJO A;  4G8T A;  3HM6 X;  3AEC B;  4DSI A;  2JZZ A;  1DNC A;  3EF6 A;  1N61 A;  1IIP A;  3OG5 A;  3S2A A;  4GIB A;  2F76 X;  1U47 A;  1PUZ A;  2YY6 A;  2J53 A;  2FYM A;  3RNF C;  2HJ8 A;  1UD7 A;  1SKR A;  2Z59 B;  4I2F A;  2C5L C;  1JWM D;  3IFW B;  5CHV C;  3DBR B;  2YVJ A;  2O3G A;  2Y5C A;  3N4F A;  3PRE A;  3V6E B;  4FS2 A;  3SR6 A;  1L2N A;  2N1V A;  3P63 A;  1H6V A;  4DEZ A;  2EKI A;  1SB3 B;  1QZE A;  3Q6B A;  4C4V A;  4GYP A;  3VUX A;  5AE1 A;  1EC8 A;  2W04 A;  4DFK A;  1VDV A;  7ICJ A;  3VCB A;  3UMB A;  5J0T A;  3AV8 A;  3ICX A;  1Q1O A;  2B76 B;  2QJN A;  5IIN A;  2BB5 A;  9ICS A;  3NZU A;  2RGF A;  1O03 A;  1UEL A;  1V85 A;  2KJ6 A;  2WP9 B;  3GE3 C;  2A1J B;  3NZ3 A;  1Z3E B;  3O0F A;  1N48 A;  3T3O A;  1PK3 A;  5L1I A;  4O3Q A;  2WDR B;  4I2A A;  1XSN A;  9ICT A;  3N20 C;  4A90 A;  3EC8 A;  4B9M A;  2WNM A;  4L23 A;  1NHQ A;  2CHZ A;  4X2P A;  2GOL A;  1KKX A;  1L3T A;  1TKG A;  2CS4 A;  1AQ6 A;  2WHI A;  5ALG A;  2K22 A;  4Q8E A;  3F2C A;  1L3S A;  4HLE A;  2PS2 A;  1UCV A;  4WH4 A;  3TEY A;  3QFB A;  4K81 A;  1ROE A;  2PLI A;  4OHJ A;  4QIW C;  2AQ0 A;  1AHV A;  2IO1 B;  5HHH A;  3MP9 A;  2JH7 A;  1H2I A;  1NZB A;  1SE4 A;  2NR2 A;  4QWA A;  2HXT A;  3UXL A;  2BQQ A;  3SEI A;  1J2N A;  4Y2X A;  1K52 A;  1I4P A;  3DFH A;  2ZIU A;  4OD0 A;  1A0P A;  3WU2 U;  1V1O A;  2PE6 B;  1SBB B;  2NTT A;  1JX4 A;  4KDL B;  4IR1 A;  3LLB A;  4P4M A;  2BKE A;  4IQT A;  3RAQ A;  9ICR A;  2BF8 B;  2IMW P;  2KFJ A;  2WU5 B;  1ARO P;  3PX4 A;  2LXC A;  2YML A;  1ZJN A;  1RDF A;  3RO6 A;  5DBC A;  1EUV B;  2W82 A;  1KTK A;  5FP0 A;  1UA0 A;  2MCN B;  8ICG A;  1S1Q B;  3FWA A;  1ZDL A;  4MH0 E;  2L1A A;  4AYB C;  5IN7 A;  4XLO A;  2KC1 A;  4RQ8 A;  2UVR A;  4DLE A;  3TQ1 A;  2V4Q A;  3KLJ A;  2DZM A;  3DK9 A;  1YJI A;  3RFZ B;  3RNA C;  4PS7 A;  4M00 A;  2QKQ A;  2VH2 A;  1KW4 A;  1SJH D;  4DDI D;  1KRH A;  2JZB A;  3Q8R B;  1JI7 A;  1Q3U A;  2OWO A;  3H4K A;  3BYT B;  2BDP A;  2R2O A;  4DDG D;  4UB5 A;  2Z0D B;  2PU0 A;  2NTS A;  3JSV A;  2QB1 A;  4JWM A;  2ZPN A;  2WP6 A;  3TOY A;  3IDW A;  4KLJ A;  1R4N B;  2NRX A;  4QZA A;  5I1W A;  4C7Z A;  2A5U A;  5H8Y E;  1W1R A;  4G50 A;  1WYG A;  1WUE A;  3RRH A;  4GDK A;  3RNG C;  3Q8P B;  4BV6 A;  3QXG A;  2WXH A;  1COK A;  2KQS A;  1V80 A;  4DXG A;  4GXB A;  2AL2 A;  1GRF A;  2WS3 B;  2KQ4 X;  9ICK A;  1F2R C;  5EOZ A;  1TKY A;  2MA1 A;  2XGP A;  4Z6D A;  1V97 A;  5C5J A;  1YJJ A;  2HQM A;  4P16 A;  5EBK A;  3GQC A;  2RDH A;  3HIL A;  1UBI A;  3C8Y A;  4B9L A;  3MC0 B;  2Y3S A;  3Q8S B;  3HHM A;  2WB1 C;  3VC8 A;  5KAF U;  1TKD A;  1XO1 A;  3UIN B;  2KMA A;  3FIL B;  4O3S A;  2F5Z A;  5KFH A;  5U25 A;  5DLG A;  1FXI A;  4XWW A;  3D46 A;  2AQ3 B;  4M2Y A;  5KFT A;  1QLB B;  3H9D A;  1E8F A;  4PGX A;  3AE5 B;  3V72 A;  4TKN A;  4TSS A;  5HR7 A;  1R4M I;  4KSL C;  5KVI A;  1MBT A;  1X1M A;  5KVH A;  4F50 A;  4G3I A;  4JK1 A;  2EMS A;  3JW7 A;  3TCS A;  2OPJ A;  4M6U A;  2J6T A;  3ZD8 A;  1LFD A;  8ICH A;  2IZV B;  2LKY A;  3S1D A;  4P4P A;  3GDX A;  1DOX A;  1N62 A;  4Z6C A;  4JUZ A;  2XY7 A;  3UQ0 A;  1QOG A;  1JWA D;  2LGX A;  2HHW A;  2N1R A;  4A8E A;  2MUT B;  3NVZ B;  4M9G A;  2ZXI A;  1Z00 A;  2Q5W D;  4FS1 A;  2KSO B;  4DL5 A;  2PFO A;  1ZQL A;  1FCC C;  1WGK A;  2LMC A;  5AIB A;  1EO6 A;  2K9X A;  2VFU A;  1F8W A;  1MDR A;  2BR0 A;  3KTQ A;  2UYZ B;  4IRD A;  1SGG A;  3MC9 A;  3DPD A;  3PO0 A;  1FNW A;  3M8R A;  4FJV B;  4HCL A;  1EBG A;  3JPQ A;  2NYV A;  1GC7 A;  2R8G A;  3QU2 A;  3MR3 A;  1S77 D;  8ICJ A;  3B9J B;  3V5C A;  3V3W A;  4F5O A;  3KYD D;  4I6P A;  3AQF A;  4KVG B;  3TAQ A;  9ICX A;  2PFP A;  3ENL A;  4ZA0 A;  2DBY A;  1NK8 A;  2QEJ C;  3GV8 B;  1P9D U;  1WUF A;  2OFJ A;  3FV9 A;  2CXY A;  5AK5 A;  2Y4G A;  2K1F A;  1XS9 D;  4KLH A;  5J0S A;  1SL0 A;  3ZDB A;  4KLD A;  2N9K A;  4GSW A;  2E8M A;  5AKY A;  2YMQ A;  2INN E;  5IIJ A;  3PPA A;  1QQ5 A;  1MQ2 A;  1WZ3 A;  2ES6 A;  5CHW A;  3H7I A;  4C80 A;  1FCL A;  4JWN A;  4DHZ B;  3QAQ A;  2L5Y A;  1ZW7 A;  4HEA 1;  4QJF B;  4KLE A;  1EWY C;  1X2I A;  2KDB A;  3FG2 P;  1TFR A;  8ICP A;  2L7R A;  2LFI A;  4FA6 A;  3UI3 A;  2C3D A;  5EWE A;  2V3N A;  3QZ8 A;  4HPM B;  4ZHO A;  2REX A;  4NL9 A;  5CA7 A;  2JUO A;  1YQ4 B;  2ZAD A;  3A1Q A;  5ALQ A;  3B1L X;  4GLX A;  2WF9 A;  3RBE A;  4IC7 B;  4KPL A;  1NK5 A;  4NXZ A;  5KG2 A;  3AXC A;  5B66 U;  3KKA A;  1TVA A;  5FXD A;  2IDY A;  3DDM A;  1JWB D;  4IUM B;  5J2D A;  1PFD A;  5AI9 A;  2HBJ A;  4RPZ A;  9ICV A;  1UT8 A;  5ALY A;  1ZQH A;  1QQ7 A;  3TJ4 A;  1XLQ A;  2TSS A;  3FW9 A;  2IPI A;  1EC7 A;  5GMV A;  1NHR A;  5DG9 A;  4MLA A;  1Q1R A;  9ICA A;  3R11 A;  2EQ7 A;  3TTE A;  4ARI A;  1NU5 A;  3A9J B;  3H12 A;  4AJY B;  4MKS A;  5EWF A;  1PZN A;  1RFK A;  3UMG A;  2MBQ A;  4XYC A;  3NY5 A;  4ARC A;  1JCT A;  2XC9 A;  1NDD A;  2IGH A;  2FNJ B;  4J3O D;  3Q8B A;  2P3Z A;  4OVZ A;  4KEM A;  1WXA A;  3EPI A;  3WK6 A;  3KVF B;  2QB0 B;  2WXN A;  1KCZ A;  2W7P A;  2WPC A;  2W8L A;  5ALM A;  4A9A A;  1L7O A;  2XVT A;  3C2M A;  1Q1W A;  2HDO A;  1EBD A;  2DYO A;  2KHQ A;  3SAF A;  1U4A A;  2LI5 A;  2KDM A;  5J8Y C;  3OSP A;  3WK4 A;  3JPN A;  1JRP A;  2A1J A;  3CP8 A;  4DFD A;  4CRX A;  2M0A A;  4NY8 A;  1QSY A;  2GH1 A;  4J9O A;  8ICV A;  2FBW B;  2KTF A;  1JWU D;  1B4F A;  3RPF C;  3ZVH B;  1T0R C;  3DDC B;  1C77 A;  4XQ8 A;  3M6Z A;  1NK7 A;  1IGC A;  4O5K A;  3E58 A;  2FDR A;  4I2G A;  2N7D A;  2HCF A;  3EFU A;  3VCC A;  5AI8 A;  3DFY A;  3EFC A;  3HRD D;  4M47 A;  4O3R A;  3QEA Z;  4G7F A;  1WM2 A;  1T3N A;  2PLP A;  2K4I A;  4C4R A;  2KJH B;  1SL1 A;  4HJK A;  1FFV A;  4GB9 A;  2GH5 A;  5AKG A;  2WAQ F;  4Y2U A;  4K8D A;  4OW0 A;  5HQX A;  5KG7 A;  4NLC A;  1ZXI A;  1TS3 A;  4PYZ A;  5HHD G;  4AWJ A;  3AQE A;  4H4Q A;  4LDT B;  2OAI A;  3V6K A;  2BCS A;  8ICK A;  1FXT B;  5CEH A;  5KFF A;  1K1S A;  1MBB A;  1UZX B;  4H1Z A;  7ICO A;  2MLB A;  3IAS 1;  3MJW A;  4PL2 A;  2NMQ A;  3ZVV A;  3KJM A;  1JIH A;  3FKY A;  3I76 A;  4B9S A;  3PRM B;  2XGZ A;  2XID A;  3IBE A;  3QKE A;  3NRZ B;  2HD5 B;  1GRT A;  5G2N A;  3FCP A;  1L3U A;  1ZQT A;  1HTO A;  4GOC A;  2IHN A;  1YOV B;  3D2H A;  2YMM A;  3C2K A;  3HW2 A;  3N4M B;  5TSS A;  4B6W A;  4DWD A;  4EFO A;  3ZDE A;  1JUD A;  4UBC A;  2GDQ A;  7ICL A;  5AIC A;  4JMU A;  3WAO A;  1M6I A;  3N6J A;  4YN4 A;  2BCV A;  1WH3 A;  2D07 B;  3AE9 B;  4DWF A;  2I9G A;  3HT3 A;  2ZJA A;  2X8G A;  4P4O A;  4Q45 A;  3F53 A;  3OSN A;  4DF4 A;  4KLG A;  4A35 A;  2FID A;  3ISB A;  3Q8M A;  3RRG A;  3G6V A;  3VAW A;  4J1O A;  3IJQ A;  2ZNV C;  4IP4 A;  1FPY A;  3D2J A;  4EE2 A;  4OAL A;  3DG7 A;  4QZ8 A;  4OCZ A;  1ZKQ A;  1QH9 A;  4F4K A;  2HHU A;  2LJI A;  2GLE A;  2W9B B;  2ZEQ A;  4KLF A;  2ZIW B;  3QC8 B;  1EM7 A;  2K60 A;  1L8L A;  2I1Q A;  1XLO A;  4DN1 A;  2KMD A;  3TJI A;  3QJZ A;  3PRZ A;  2IGG A;  1TZ1 A;  1D8L A;  5J2C A;  3TAR A;  1XT9 B;  2RDG A;  4FUL A;  3H4D A;  4R63 A;  3PW2 A;  2ICI A;  4AOF A;  1I7H A;  3ML9 A;  5FXP A;  1VJ5 A;  2NPX A;  4CDG A;  2HOQ A;  3DOW A;  4NLB A;  1KKO A;  2K3U A;  2L76 A;  1LPF A;  3T5J A;  5E6N A;  3FIL A;  1PGX A;  3NZG A;  2WYQ A;  3L0W B;  4ROP A;  5KFL A;  1ZQW A;  4DSF A;  1NJW A;  3JVZ X;  4ZRK A;  5H2F U;  1YIW A;  3CF6 E;  1G6J A;  3RIT A;  4N9F 4;  3OGU A;  2D11 A;  4EC3 A;  3JZU A;  5BO4 B;  4DHJ D;  3S6J A;  4ENL A;  2FLP A;  5L95 C;  5TZV A;  1KFT A;  2BGF A;  2C7M B;  3MR2 A;  2JYT A;  2KK8 A;  1N5W A;  3A7R A;  4HJG E;  5J2I A;  3RH5 A;  3ZJT A;  4EQR A;  2AYO B;  1JOA A;  2KD1 A;  3THV A;  1RLF A;  2VAO A;  3HK0 A;  1WGR A;  2VFR A;  2V3P A;  1UQV A;  3GIM A;  3L17 A;  1BPZ A;  3KH0 A;  4K7U A;  1P7F A;  2MUT A;  3NVZ A;  1LXD A;  4ZRQ A;  1GG3 A;  1DK2 A;  2HBM A;  4YXD B;  1WJN A;  1RPL A;  7ICU A;  1TYG B;  2KSO A;  4J9S A;  5F3X B;  4YR2 A;  7ICI A;  1Q5W B;  3WA0 A;  4DSE A;  2K8B B;  2KX3 A;  3DBR I;  2QHO A;  2LHE A;  4WAF A;  2G07 A;  3ZLF A;  5KAI U;  3H8A A;  1TK0 A;  4KDI C;  3RRA A;  3NXL A;  2OHF A;  2VRR B;  1OEP A;  3A7A A;  5L1J A;  1ZQA A;  2IBI B;  3F2D A;  2WLB A;  3UF8 A;  4WJP A;  1XCT L;  4B9U A;  4K7Z A;  2PTX A;  7ICF A;  3V6H A;  1ZQR A;  4EZJ A;  3MZN A;  2BVC A;  2YEP F;  4NEW A;  2P4P A;  2HJ1 A;  2O56 A;  2GGG A;  5FKA C;  2UUV A;  5DDM A;  4MAC A;  4MDK E;  5L9X A;  2WF7 A;  2HHS A;  2KN4 A;  4W9I A;  2W9N A;  1ZQC A;  3BY4 B;  3R0K A;  3KWV A;  4II3 B;  5J0P A;  2E5A A;  4JIO U;  1JDF A;  4IZG A;  5AEK B;  5AI4 A;  2ZIX B;  2V6O A;  1E8W A;  3VRB B;  3V4B A;  4IM0 A;  3PG6 A;  5G5H B;  9ICU A;  2R8J A;  1P7E A;  2OKT A;  2AU0 A;  2FE8 A;  5D7G A;  3GB1 A;  4YT0 B;  1PK1 B;  2VZK B;  2I1K A;  4DHG A;  1U48 A;  4LJP B;  3MDC A;  4TUP A;  2VFV A;  3OZM A;  3BW7 A;  4CYE A;  3HP6 A;  3OTR A;  5J2H A;  3T79 A;  3A33 B;  2DKZ A;  3HKZ F;  3N30 A;  4X5V A;  2Q4W A;  1DTN A;  3R7Q A;  2OG9 A;  3DQ0 A;  2V3A A;  2I1J A;  5IOI A;  3WKA A;  3PLV A;  1X2G A;  5IIL A;  4PYT A;  2OM6 A;  2WOI A;  5KG3 A;  3WAM A;  1T3Q C;  3DEQ A;  3PZ7 A;  1FIQ B;  3B0A A;  2W11 A;  3WK5 A;  2VAN A;  4K4H A;  1GNU A;  3A9J A;  5BOL A;  3N1Z C;  2ZW0 A;  1SXD A;  2DQN B;  4GN1 A;  5ALN A;  4M9L A;  2LD9 A;  2GGH A;  2EMT A;  4QZH A;  3MR6 A;  1X40 A;  5AUK A;  3LYY A;  3BZC A;  3W5V B;  5I1V A;  1T94 A;  5KT4 A;  4TQS A;  3Q3O C;  3I6E A;  4LK0 M;  2R2Z A;  3HWT A;  2HVI A;  1XLN A;  2WXK A;  2FAZ A;  1HUO A;  4QAY A;  3STP A;  4JV1 A;  1R4N I;  2LEK A;  8ICW A;  2PMQ A;  3AI5 A;  4HCD A;  1YN5 A;  1ED1 A;  1SL2 A;  4C8L A;  3U2S C;  2JQR B;  3JVA A;  4P0Q B;  5J2E A;  2RP5 A;  4ACO A;  2QAR B;  1KSP A;  1YD8 U;  3QLD A;  5BMH A;  2C2R A;  1ZQQ A;  4M9N A;  2EKE C;  2KYW A;  4MJS B;  1SV4 A;  3MHZ A;  1JPM A;  2H3Q A;  2KVZ A;  1ZYQ A;  2ZTD A;  2WF5 A;  4BKS D;  4J57 A;  3IHP C;  4A20 A;  4NQK E;  3QN3 A;  2AL1 A;  4YMO A;  4KX5 A;  5AIA A;  3NRW A;  1TYT A;  1S5L U;  2LWP A;  3HPO A;  1JAL A;  1XLP A;  3B2G A;  2GOW A;  4GGH A;  8ICE A;  2A1A A;  4YWG G;  5D46 A;  3KHG A;  1D4B A;  1TBE A;  1ZQG A;  5AKX A;  3EYZ A;  3BIN A;  2N7J A;  2YLM A;  4KLM A;  3QA8 A;  2WTF A;  4C0Z A;  4BBN C;  3A0B U;  4YXJ A;  4IHC A;  4F4R A;  2BCR A;  4IWP A;  2GGI A;  3P93 A;  1AAR A;  2NRT A;  3AB5 A;  4YTP B;  2W0H A;  3Q6J A;  1S0O A;  1FEA A;  1K8R B;  4G11 A;  4I2C A;  4KGT A;  3ZJV A;  4IDI A;  9ICC A;  2DLB A;  3NRZ A;  3PX6 A;  1WSP A;  3I57 A;  3S1F A;  5ER0 A;  4HDQ A;  3UJF A;  3KUC B;  2C22 A;  2LM1 A;  2KZM A;  3BII D;  4GIS A;  2OZ3 A;  2YB1 A;  2EXR A;  4LII A;  2FPM A;  1LM8 B;  2ZNV B;  2LBO A;  3A9K B;  2B21 A;  3RB4 A;  1CZP A;  4QNL A;  5D79 A;  4UBB A;  3RJH A;  3EEZ A;  1C3T A;  3TFS A;  3VXW A;  4GFI A;  2VA2 A;  2INC C;  4XUS A;  4YR0 A;  3T5K A;  4ANW A;  3NVW B;  2H5X A;  1BWC A;  4J03 A;  4M0A A;  1ONE A;  8ICZ A;  3UPQ A;  4P7I A;  1QLU A;  4DOC A;  1WWV A;  5CB1 A;  1MQ3 A;  3DHG C;  1YQ3 B;  3M9O B;  4KKJ A;  4DL6 A;  4IG7 B;  3NS1 B;  2EZY A;  2W9B A;  1L4Z B;  9ICI A;  2ZIW A;  4RQN A;  3ZYY X;  2L83 A;  2ZW1 A;  4OZA A;  2L52 A;  1IYF A;  2G0A A;  3PVX A;  1SE9 A;  1IBX A;  1ZXH A;  3IHQ B;  2RK5 A;  2PLS A;  3BVM A;  1WE7 A;  1PVQ A;  2GQU A;  3BS5 B;  3ZVI A;  1TS2 A;  2C7N B;  4KMO B;  2J6U A;  1DOI A;  2QDD A;  3ZDC A;  2M17 A;  1BQG A;  3EAO A;  3ZDT A;  3T3F A;  3GY1 A;  1UWM A;  2GLS A;  2P35 A;  1LKY B;  1KLU D;  2M9N A;  3TMP B;  2PTZ A;  3SQS A;  1OTR B;  1TE2 A;  1U9L A;  3R7R A;  2GQT A;  4MF2 A;  4AS1 A;  1I4Q A;  4KLL A;  2QVH A;  1NJZ A;  1I4R A;  3ZXR A;  1SJC A;  4UD8 A;  2XH2 A;  2B3A A;  1P0R A;  3VC6 A;  3I6T A;  3TKA A;  1ZP0 B;  3RUL A;  3VC5 A;  3CW2 C;  4RM9 A;  2K8H A;  2OX4 A;  1JXE A;  1E8Y A;  3QX7 A;  3UJ2 A;  1WM3 A;  4GXJ A;  3K9P B;  5BOE A;  3EGR A;  2RHF A;  2VFS A;  1OQR A;  3AEE B;  1F3P A;  3JPS A;  1U45 A;  7ICP A;  3MGI A;  4EZL A;  5KFC A;  1IPG A;  2EEL A;  1GB4 A;  1NDA A;  2OQY A;  1SV0 C;  7ICH A;  3EHV A;  5KT2 A;  1XU4 A;  3RB3 A;  4QWC A;  4BC9 A;  3V7J A;  4DQR A;  4RH6 A;  4JV0 A;  4BOZ B;  1GRE A;  3M95 A;  2K8B A;  5F9N A;  3IG8 A;  3GZN B;  3D47 A;  2NQW A;  4JWS C;  2Z7J A;  4D2K A;  2BYF A;  3V5F A;  2W3R A;  4MGI E;  3E0F A;  4UB2 A;  4ZRP A;  2NS5 A;  3RH4 A;  1T0S C;  4FHJ A;  2OZ8 A;  4Q43 A;  2OED A;  1FNU A;  2MAX A;  1Q3V A;  1MJD A;  1ZQP A;  2GQW A;  4YMN A;  2WQY B;  4GXK A;  3VUW A;  4I27 A;  1VZ6 A;  4OZC A;  3TEZ A;  1GES A;  3J81 j;  3DK4 A;  3OZY A;  1COO A;  2I5H A;  5J0O A;  2K8A A;  4NPN A;  2I0K A;  1GRA A;  4MMW A;  2I38 A;  4A3O A;  1XD3 B;  3O0H A;  4WWP A;  3Q45 A;  1M6Y A;  2BBC A;  3HVZ A;  4LZD A;  3C2L A;  2JSV X;  2HOI A;  3IXS A;  5JCL A;  4FHK A;  5AKI A;  1WFY A;  2NPT B;  3PW7 A;  1M4V A;  1V9J A;  1VRA B;  4K4I A;  1PDX A;  3RYT A;  2ZIX A;  5CRX A;  1L6U A;  4GR1 A;  2BQU A;  3DER A;  1PGA A;  5G5H A;  3APF A;  4PYU A;  2VKQ A;  1F9C A;  3UXP A;  3O13 A;  2BC0 A;  2YQE A;  2H88 B;  1HA5 A;  5AK4 A;  3IT4 B;  3GO2 A;  1JMS A;  2ZUB A;  2KVR A;  3IP4 B;  4S0R A;  2QPM A;  2VJ4 A;  4ED7 A;  4PVH A;  4HRO A;  2KLC A;  4W9G A;  3ZI4 A;  5KFA A;  1B1Z A;  1F44 A;  1YNT E;  2ZZB A;  3JPO A;  2IY0 B;  2JXX A;  2WF8 A;  4ICV A;  4FBJ B;  8ICR A;  1YJ1 A;  3TQP A;  3LXF A;  1ZQB A;  2KWV B;  5KFI A;  2CRX A;  4KLS A;  1FEH A;  1VZ7 A;  1XO0 A;  1XWL A;  8ICU A;  1WMH B;  3R2I A;  2Z8L A;  3VFK A;  1GSN A;  4NAW B;  4IP5 A;  5FJR A;  3SN1 A;  3T4W A;  1BXT A;  1KL9 A;  2ESE A;  1WF9 A;  3M1Y A;  2WFA A;  2OO6 A;  4NM1 A;  5KG4 A;  2OQH A;  2ASJ A;  2ZUD A;  2MRL A;  1S10 A;  1GC6 A;  1HE8 A;  1C4A A;  4PZF A;  3KQ4 A;  2KT7 A;  4TUR A;  1KD0 A;  2XH0 A;  2BKF A;  3AH7 A;  2VH1 A;  2ZJ5 A;  3R25 A;  5KT7 A;  4G9B A;  2Q85 A;  1T4G A;  1E9I A;  4F2R A;  4HYR A;  5DBA A;  1QQR A;  1NKC A;  2V0G A;  1B9R A;  1NOM A;  2EDU A;  2RSU A;  2G3Q B;  1X9X A;  5KFX A;  2C9W B;  4E4F A;  4JGH B;  1XHC A;  4EMW A;  3PM9 A;  1F2R I;  1NJY A;  4C8N A;  1DGJ A;  3L54 A;  2BPG A;  4DXF A;  2J7Q B;  1LQB A;  5AE3 A;  3TUO A;  2MJE A;  4ANV A;  3QFA A;  4NLN A;  3KOO A;  4DQO C;  3RAX A;  1SZH A;  3VHT C;  1IYX A;  3BJS A;  3SSZ A;  1ENF A;  4P0Q A;  4QW8 A;  1KRP A;  2QAR A;  3AU2 A;  2YN4 A;  5DQG A;  2MJ3 A;  4MJS A;  4F2S A;  3SEB A;  3I4K A;  3FW7 A;  3AUO A;  3U52 E;  2I5Q A;  1SKW A;  3SI8 A;  3ONS A;  4Q44 A;  4KX3 A;  5BOM A;  4TUQ A;  4R64 A;  1J19 A;  1TGZ B;  1E8G A;  1VQZ A;  3OPS A;  3EJD B;  1E90 A;  4IS7 A;  4W9D A;  2KFN A;  5ADZ A;  3QK0 A;  3H8S A;  3DHH C;  3AE4 B;  2ZVN A;  1WIA A;  7ICV A;  3K75 D;  5T14 A;  3QU9 A;  4EBE A;  5ALE A;  2BS2 B;  2QMT A;  3V62 A;  1ZR6 A;  4C4T A;  1DOY A;  3UMC A;  4DLG A;  1ET6 A;  2FIF A;  3UJS A;  3N7R C;  5KFR A;  4EM4 A;  3UJE A;  2XBB C;  3DVN U;  3NUH B;  4YD2 A;  4A3R A;  1FHV A;  1ZQO A;  2BWF A;  5J0Q A;  4DSJ A;  4EOY A;  2M56 B;  2AXT U;  1QLN A;  8ICO A;  4WWO A;  5HI1 A;  1TYP A;  5L83 A;  4REZ A;  1Q10 A;  2LMR A;  3T3N A;  4BDP A;  4MHV A;  2PW9 A;  1ET9 A;  1QSL A;  3RJJ A;  2E1F A;  4O5C A;  2NBV B;  2X50 A;  4H2A A;  4YFK A;  4HPL B;  5ALO A;  4F8C B;  2ISP A;  3POP A;  3EEC A;  2UVW A;  3PHX B;  4UDU C;  4ZDV A;  4JN8 A;  2XO7 A;  1B43 A;  3N32 A;  1J2M A;  2CU3 A;  2W9A A;  1QKZ A;  2BPC A;  4F5Q A;  3A9K A;  3QU7 A;  4MH8 A;  2ZZP B;  1RVK A;  2D3C A;  1S0M A;  4RQ6 A;  5KFY A;  3NVY B;  4M9J A;  2GR2 A;  3RJF A;  1K51 A;  4YTN B;  1PVR A;  3APC A;  3BSM A;  4JB1 A;  1CJE A;  5CJ7 A;  2DAF A;  4KIK B;  3CGB A;  1ZRN A;  2HTH A;  4E3C A;  2PP1 A;  2G1E A;  2KQ7 A;  2C2E A;  4KLO A;  1K50 A;  2H3V A;  1XF5 L;  4HPN A;  2B6G A;  2VFT A;  5LXH A;  2X99 A;  1L5U A;  3QAR A;  5HNK A;  8ICN A;  3NS1 A;  1DII A;  3MKC A;  5K8E A;  4RQ0 A;  5ALZ A;  3SAG A;  1BT0 A;  4J9K A;  4YSZ B;  1GRG A;  3PSP A;  2W54 A;  4QZE A;  2KDF B;  4W9E A;  2D8C A;  2UVV A;  1D5X C;  1XPY A;  4HK2 A;  3ZQ4 A;  1RYJ A;  1CK1 A;  3BS5 A;  4C8M A;  4GDL A;  4EMI A;  3K1G A;  3VTE A;  4J6I A;  4MFC A;  2KNJ A;  3DK8 A;  4F3O A;  1LKY A;  2E8P A;  4NM2 A;  2IYD B;  3W1S C;  2DZK A;  2W8K A;  3CGD A;  1Q0W B;  3OTQ A;  1ZD3 A;  2JK6 A;  3PSE B;  4DX3 A;  1K4Q A;  4MGG A;  3ES8 A;  4DS5 A;  4TUS A;  2Z0E B;  2POD A;  9ICE A;  1XAN A;  3V7L A;  2LVQ A;  2J6S A;  5ALR A;  2GGJ A;  1T0Q C;  4UAV A;  1WCN A;  3EJB B;  1Y88 A;  3BJY A;  1ZQX A;  1T7P A;  1OFF A;  2FUH B;  4K1R B;  4KSK C;  1N63 C;  3AM9 A;  1TV9 A;  1WX8 A;  4OVU A;  4RQ7 A;  4H4T A;  3QWZ B;  3GU3 A;  3I3T B;  1X42 A;  1SWW A;  1ESF A;  5KFW A;  1V5T A;  2OOB B;  3UXN A;  2K8C A;  1NK0 A;  9ICP A;  2EQ8 A;  2YVG A;  3NFU A;  3RBD A;  1AHU A;  1TJE A;  4GRT A;  1V2Y A;  4ELU A;  4X57 B;  2YVC A;  4EQX A;  1EF5 A;  3J9C A;  3SV3 A;  1ZD2 P;  1WUD A;  2IBK A;  4PL1 A;  1SE3 A;  2KZR A;  3Q2A C;  4LDT D;  2PKO A;  1A5R A;  3OW1 A;  4LNN A;  2R8D A;  1QSS A;  4YSY B;  2BPS A;  1JRU A;  2KOX A;  2WX1 A;  2PTY A;  1NK6 A;  4DQP A;  3LB8 C; 
#chains in the Genus database with same CATH homology
 3AEB B;  2IGG A;  3B2F A;  2RDG A;  1IBX B;  2GB1 A;  3I99 A;  4BCA A;  5FXP A;  2ICI A;  3R8B A;  1I7H A;  3C0P A;  1PUT A;  2KAJ A;  4LTU A;  2BVF A;  1J7B A;  1X2H A;  1WRI A;  2K3U A;  1EWC A;  5D3D A;  3FIL A;  1PGX A;  4IKG A;  2INP E;  2HTM E;  2WXF A;  4RF0 A;  1HZ5 A;  2WU2 B;  4FXC A;  1FFV C;  3RJA A;  5FR3 A;  4EC3 A;  2PIA A;  2WXP A;  1ZXI C;  3JS8 A;  4USA A;  3W8X A;  2JYT A;  3A7R A;  1N5W A;  4NZL B;  4HJG E;  2JU6 X;  5HMR A;  1AWD A;  1L0Y B;  3ZJT A;  1I4G A;  1FD6 A;  1TKE A;  2VAO A;  1T3Q A;  5BYR A;  1SF0 A;  1UUP A;  2VFR A;  2V3P A;  1C4C A;  3FW8 A;  4ZRQ A;  1P7F A;  2WXQ A;  3NVZ A;  4YXD B;  4JE3 B;  1FFU A;  1TYG B;  4OZB A;  3U7Z A;  1V8C A;  5BYS A;  2WXI A;  4DNS A;  3URY A;  2E3T A;  3S1E A;  3R07 C;  2BW2 A;  2WXM A;  2LHE A;  1IGD A;  2N0S B;  4GDK B;  4WAF A;  5I4D A;  1E8H A;  1WVF A;  2QIE B;  3FC4 A;  2AQ2 B;  4KKI A;  2OHF A;  3A7A A;  1SIJ A;  4WUR A;  5LNK 1;  2N9L A;  1GB1 A;  5EE1 A;  2WLB A;  5AUI A;  1XCT L;  3CWI A;  1HSK A;  5L6G A;  1NEK B;  4XDC A;  1CQV A;  3H8H A;  5G5G B;  2YEP F;  1NYR A;  2P4P A;  2PTL A;  2BS4 B;  2QIL A;  3TEX A;  2UUV A;  5FKA C;  5EE0 A;  4GDL B;  1F0X A;  4HKZ E;  4NJC A;  1R7S A;  1T5X D;  4MAC A;  2PMV A;  2KN4 A;  4L2Y A;  1HXY D;  3KWV A;  1ZDX A;  2BTE A;  2E5A A;  3KWL A;  2ACZ B;  3W8Z A;  3GP7 A;  3VRB B;  5G5H B;  1W1M A;  1P7E A;  2PVO D;  4N6E B;  3HVD A;  3NVW A;  2FE8 A;  5D7G A;  1EU3 A;  1JML A;  1WWT A;  3GB1 A;  4YT0 B;  1W1L A;  1XCQ L;  2VZK B;  3W2D A;  4O1N A;  2QJL A;  3BYY B;  5C3J B;  2VFV A;  4PVJ A;  4RGN A;  3BW7 A;  2Q4W A;  2V4I B;  4PVK A;  4BC7 A;  5BYQ A;  3DQ0 A;  4WQM A;  3E9S A;  3DED A;  1NEN B;  5BMI A;  1XXG A;  2WXJ A;  1N5W C;  1NI3 A;  1X2G A;  4PWB A;  4PYT A;  3PZ8 A;  1E6E B;  3IT6 B;  5C2T B;  2KAC A;  1T3Q C;  1SJE D;  3PZ7 A;  1FIQ B;  1TY0 A;  3BK1 A;  2WDW A;  2ZW0 A;  1AN8 A;  5GXG B;  1FFU C;  2H89 B;  1JWS D;  2E6X A;  5AUK A;  3W5V B;  3LYY A;  1XEE A;  5I1V A;  5HG2 A;  3AE3 B;  4LK0 M;  4KGR A;  2M19 A;  3GS2 A;  2R2Z A;  3Q8C A;  4GLS C;  1J7C A;  1XLN A;  1QOA A;  2WXK A;  4KGS A;  2VZK D;  1TS5 A;  3S1C A;  2LEK A;  1D5Z C;  1YN5 A;  3P4S B;  1VLB A;  1FRD A;  3U2S C;  2JQR B;  5BMH A;  2BYT A;  3MHZ A;  2WXR A;  4RGM A;  2QKN A;  4C56 C;  1NVI D;  3TX1 A;  1WXQ A;  2SEB D;  1JW9 D;  1W1J A;  5AE2 A;  2K5P A;  5EE9 A;  2GRI A;  2ONQ A;  4WWM A;  4A8X C;  1JAL A;  1XLP A;  3B2G A;  3DWG C;  3BK2 A;  4YWG G;  5T8I A;  1D4B A;  1I4X A;  1C4P A;  3AEC B;  5E6J A;  2JX5 A;  1N61 A;  1ZDV A;  1I19 A;  2N7J A;  2WXG A;  1C9F A;  2WDQ B;  4IOI E;  4B0E A;  1ACC A;  2J53 A;  3AE6 B;  2UUU A;  5AWV A;  1FNV A;  3AB5 A;  4YTP B;  1GOZ A;  2IGD A;  1UWX A;  1JWM D;  3HSU A;  2JZP A;  4JPS A;  2O3G A;  4KGT A;  2Y5C A;  3ZJV A;  3ETR B;  1DYQ A;  1V1P A;  2XNA C;  3SR6 A;  2DWQ A;  4IDI A;  3PQB A;  3P63 A;  3AMZ A;  4ZOH C;  1SB3 B;  2DLB A;  2EKI A;  3NRZ A;  4ITK A;  1KFY B;  1WSP A;  3I57 A;  4ZYS A;  3S1F A;  5AE1 A;  1VDV A;  3BII D;  3HRD C;  2EXR A;  1QT9 A;  3AV8 A;  4RCO A;  1KH0 A;  2B76 B;  3I9V 1;  3W9C B;  2BB5 A;  3BVZ A;  1PYW D;  1CZP A;  5D79 A;  2WP9 B;  3NZ3 A;  3T3O A;  2BB6 A;  1AYF A;  2WDR B;  2Y3A A;  4A90 A;  3EUB 3;  2WNM A;  3W8W A;  4L23 A;  1TKG A;  2XN9 C;  2Y08 A;  2K22 A;  3NVW B;  3TEY A;  4WH4 A;  1QLU A;  1ROE A;  1HQR D;  4OHJ A;  3NVV B;  2PLI A;  1YQ3 B;  1AHV A;  4HG0 A;  2QSD A;  3MP9 A;  4KKJ A;  1SE4 A;  3WCQ A;  3B9J A;  3NS1 B;  1MI0 A;  3SFD B;  1L4Z B;  2JWU A;  3ZYY X;  3V3X A;  1F77 A;  2L83 A;  1K52 A;  2ZW1 A;  4OZA A;  4US8 A;  1I4P A;  2L52 A;  1W1O A;  2MBR A;  4LLG M;  2RK5 A;  1IBX A;  1ZXH A;  1V1O A;  2LUM A;  2PLS A;  3BVM A;  1SBB B;  2NTT A;  3OWE B;  2GQU A;  3LLB A;  1TS2 A;  2YVS A;  1DOI A;  2WU5 B;  1ZPS A;  1MVK A;  1UWM A;  4NAM A;  4CQN A;  1KLU D;  2L32 A;  4L1B A;  2W82 A;  1KTK A;  5HFY A;  3FWA A;  1PGB A;  1QF6 A;  2GQT A;  5BMG A;  2L1A A;  2K0P A;  4AS1 A;  1I4Q A;  3P4R B;  1N61 C;  2FUG 1;  1I4R A;  4XLO A;  2W55 A;  4TSS A;  1ZUD 2;  2J52 A;  4UD8 A;  3AE1 B;  1HZ6 A;  1L4D B;  2BS3 B;  1ZP0 B;  1YJI A;  3RFZ B;  1F0Z A;  1SSN A;  3EUB 2;  2PVG C;  2SAK A;  3E56 A;  1L5P A;  2JXT A;  1SJH D;  1L6V A;  1KRH A;  3EGR A;  2VFS A;  1OQR A;  3AEE B;  4XE0 A;  2KMM A;  3BYT B;  1RM6 C;  2EEL A;  1YMH E;  3DWM A;  1GB4 A;  2NTS A;  4BBY A;  2Y5P A;  4BC9 A;  4RH6 A;  1VAO A;  5I1W A;  2J4X A;  4C7Z A;  1W1R A;  5H8Y E;  4KX6 B;  1WYG A;  3FAH A;  4JWS C;  2NQW A;  3VR8 B;  1MPE A;  2WDV B;  4D2K A;  1L0V B;  2W3R A;  2WXH A;  3Q8A A;  4ZRP A;  4DXG A;  1E9M A;  3V05 A;  2WS3 B;  2KQ4 X;  1F2R C;  1TKY A;  1DIQ A;  2OED A;  2RPV A;  1V97 A;  1FNU A;  1VJK A;  1YJJ A;  4P16 A;  2WQY B;  1N60 A;  2RDH A;  1VZ6 A;  4OZC A;  3TEZ A;  5EE3 A;  3TSJ A;  3C8Y A;  3MC0 B;  1E0Y A;  2AQ1 B;  5G5G A;  4XDD A;  2I0K A;  2Y3S A;  2I38 A;  1BUI C;  3MFG A;  4ML8 A;  3AE8 B;  2BBC A;  3HVZ A;  1Y56 A;  3FIL B;  5D3I B;  3IAM 1;  1DZN A;  3NVY A;  2JSV X;  3IXS A;  1FXI A;  3AE2 B;  5FK9 C;  4XWW A;  2AQ3 B;  1M4V A;  1QLB B;  1VRA B;  1E8F A;  1I4H A;  1PDX A;  1L6U A;  3AE5 B;  1EU4 A;  4PVE A;  3SR6 B;  1PGA A;  5G5H A;  2G9H D;  5JXV A;  1SEB D;  3ABV B;  4P6V F;  3RJ8 A;  1MBT A;  1YN4 A;  1FO4 A;  4US9 A;  3O13 A;  5H92 C;  1FRR A;  1HA5 A;  2H88 B;  3IT4 B;  3S1D A;  1UNS A;  1TY2 A;  2QPM A;  1DOX A;  1N62 A;  2ON8 A;  4PVH A;  4HRO A;  4RFB A;  1B1Z A;  1JWA D;  1QOG A;  4N59 A;  1FMA D;  1SXT A;  1D6E C;  1YNT E;  4M0W A;  2P13 A;  3BWU D;  2Y3R A;  3NVZ B;  3LXF A;  1E0Z A;  2Q5W D;  4JWU C;  1AHZ A;  5FXF A;  1FEH A;  1VZ7 A;  1FCC C;  3P1M A;  1WGK A;  2LMC A;  3AED B;  3R2I A;  5HHZ A;  2Z8L A;  4JX1 C;  4NAW B;  1D5M C;  2K9X A;  1BXT A;  4RF1 A;  2VFU A;  1SE2 A;  2YEP B;  1W1S A;  3PO0 A;  1FNW A;  3CIR B;  4RGT A;  1C4A A;  4PZF A;  3KQ4 A;  3B9J B;  2IPK D;  1RWS A;  2MJD A;  3AH7 A;  1FXA A;  4C7Y A;  2Q85 A;  3HUI A;  1W1Q A;  3BZD B;  1QQR A;  2V0G A;  2DBY A;  1B9R A;  2QEJ C;  3A7U A;  1OQQ A;  2AX5 A;  2AXR A;  1UXY A;  2Y4G A;  3SFE B;  2D5G A;  3PM9 A;  1F2R I;  2N9K A;  4DXF A;  1DGJ A;  3EA6 A;  3GSY A;  2INN E;  3N9Y C;  5AE3 A;  1QOB A;  4HKQ A;  1LO5 D;  3TUO A;  2MJE A;  1L0X B;  4Q2J A;  4DQO C;  4C80 A;  3LAE A;  1FCL A;  1N60 C;  1A70 A;  4B0M A;  4HEA 1;  1ENF A;  1EWY C;  1QIL A;  4O95 A;  2RMM A;  2MJ3 A;  2LFI A;  3Q8F A;  3SEB A;  4XWT A;  2V3N A;  4R3D A;  3U52 E;  3UI3 A;  1WVE A;  4ZHO A;  3FW7 A;  1E8G A;  2W3S A;  1VQZ A;  1YQ4 B;  1BML C;  2WXO A;  5ADZ A;  3AE7 B;  3AE4 B;  1E10 A;  5FXD A;  2IDY A;  1FM0 D;  1E7P B;  1NYQ A;  1JWB D;  1VZ8 A;  2BS2 B;  2QMT A;  3W1S A;  1DOY A;  1ZR6 A;  1ET6 A;  1PFD A;  1T6B X;  3U4E G;  1AW7 A;  1TZO A;  4ZOH B;  1KF6 B;  1J7A A;  1UGJ A;  1XLQ A;  2TSS A;  2GI9 A;  3NUH B;  3FW9 A;  2IPI A;  1N62 C;  1MHH E;  4MLA A;  2M56 B;  5HI1 A;  4REZ A;  4ARI A;  1Q10 A;  4N58 A;  3T3N A;  3ZGZ A;  1N63 A;  3ETR A;  3VR9 B;  2PW9 A;  1ET9 A;  3P42 A;  2DYM A;  3Q69 A;  1RFK A;  4ARC A;  4H2A A;  3TSH A;  3VQI A;  3POP A;  2BVH A;  4UDU C;  2IGH A;  1JCK B;  3Q8B A;  4J3O D;  4OVZ A;  2CJN A;  2CU3 A;  3BVG A;  1QKZ A;  2WXN A;  3AN1 A;  4A9A A;  4ZHP A;  4MH8 A;  2DYO A;  4RNA A;  3NVY B;  2KDM A;  4WIP A;  2BVG A;  1JRP A;  1K51 A;  2JYE A;  4YTN B;  3AEF B;  1CJE A;  4JB1 A;  2BT6 A;  2M0A A;  1N5X A;  4JAY A;  2FBW B;  1IUE A;  3RPF C;  1JWU D;  4TQ0 A;  4RGO S;  2G1E A;  1C77 A;  3L4P A;  1IGC A;  4PT5 A;  2LGI A;  3AEA B;  1K50 A;  1XF5 L;  2J42 A;  2VFT A;  3NVV A;  3HRD D;  3P4P B;  3NS1 A;  1DII A;  5FXE A;  5K8E A;  4HRS A;  2PLP A;  3Q8E A;  4MT5 A;  4YSZ B;  1FFV A;  2W54 A;  1JQ4 A;  1ZOY B;  1D5X C;  4OW0 A;  3D2D A;  5HQX A;  2MH7 A;  2LHD A;  1ZXI A;  1RYJ A;  1CK1 A;  1TS3 A;  3ZQ4 A;  5HHD G;  2I2Y A;  2OAI A;  3VTE A;  4TVY A;  3VRA B;  1QOF A;  1K53 A;  4TMA B;  3TSS A;  1GPX A;  3W5U B;  1MBB A;  2X38 A;  3IAS 1;  2NMQ A;  3TEW A;  3KJM A;  2KWD A;  2CJO A;  1KLG D;  1JRO A;  1V1P B;  1YN3 A;  3ZJU A;  1RM6 B;  3NRZ B;  1QLT A;  1C78 A;  4YTM B;  3D2H A;  1C76 A;  4A6Q A;  4AQ7 A;  4MM3 B;  5TSS A;  2IJ0 A;  2HDE A;  1HEZ E;  1XO3 A;  3AEG B;  4PWC A;  1STE A;  1OFF A;  1N63 C;  1MHX A;  3AM9 A;  1C79 A;  3AE9 B;  1SB3 C;  5MPO A;  1ZE3 D;  1ESF A;  5L6F A;  1VR9 A;  2MEK A;  1AHU A;  4TVW A;  1TJE A;  2R61 A;  3KLS X;  4EE2 A;  3D2J A;  3MJ5 A;  4OAL A;  4A55 A;  2P3H A;  4TQ1 A;  1FIQ A;  4YSX B;  3J9C A;  1W1K A;  1TS4 A;  1SE3 A;  2PKO A;  2WXL A;  2LJI A;  2R8D A;  1GAQ B;  4YSY B;  1EM7 A;  1XLO A;  3R2T A;  3P4Q B;  3LB8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...