4PYTA

Crystal structure of a murb family ep-udp-n-acetylglucosamine reductase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
MDKVIQELKDLQVGKVLENEPLANHTTIKIGGPADCLVIPKDIQAVRDTMEVVKNHGVQWRAIGRGSNLLVLDEGIRGVVIKLGAGLDHMEIDGEQVTVGGGYSVVRLSTGISKKGLSGLEFASGIPGSVGGAVYMNAGAHGSDISRILVKALILFEDGTMEWLTNEEMEFSYRTSILQNKRPGICLEAVLQLEQKERDAIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPDHAGRLVEQAGLKGHRIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEIVGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title LucY: A Versatile New Fluorescent Reporter Protein.
pubmed doi rcsb
source organism Unidentified
molecule tags Oxidoreductase
total genus 99
structure length 302
sequence length 302
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pytA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pytA02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 4pytA03
2MBRA 1W1SA 3DQ0A 1N5XA 4PZFA 3W8ZA 1W1JA 1DZNA 1AHZA 4ZOHB 2P13A 1HSKA 3S1EA 4EC3A 3AM9A 2W3SA 2VFRA 1N62C 1FO4A 3LLBA 1AHVA 5G5HB 2OAIA 4PVJA 3W8XA 2W54A 2EXRA 1E8FA 2Q85A 3TSJA 3VTEA 3C0PA 1AHUA 1FIQB 2VFSA 1W1RA 1FFUC 4XLOA 2E3TA 3EUB3 3W8WA 2PLSA 2BVHA 1RM6B 5D79A 1WVFA 3KJMA 2R2ZA 1VAOA 1JRPA 4UD8A 1W1MA 1DIIA 4PWCA 2RK5A 4OALA 3JS8A 5AE3A 3NVWB 3S1CA 4PYTA 4BC9A 2VFUA 4PVHA 1DIQA 1SB3B 5FXEA 4PVEA 2R8DA 1UXYA 5ADZA 5FXFA 2QPMA 1VDVA 2NQWA 4BC7A 1W1OA 3AN1A 1N61C 3D2DA 3D2JA 2PLIA 2BVFA 3B9JB 2W55A 3TSHA 1MBBA 3NS1B 2I0KA 1N60C 3NVVB 1ZXIC 1T3QC 4PWBA 2YVSA 2GQUA 2GQTA 5HHZA 3DEDA 3S1DA 3FW9A 2P4PA 3I99A 4DNSA 5FXPA 2BVGA 3PM9A 1E0YA 2QKNA 2O3GA 1N5WC 2P3HA 3FWAA 1V97A 3ETRB 4BBYA 4PVKA 2W3RA 3TX1A 2AXRA 2VFVA 4JAYA 4BCAA 5FXDA 3LAEA 4O95A 3GSYA 1QLTA 3FW8A 3AMZA 5G5GB 1W1KA 1FFVC 3SR6B 1WVEA 3FW7A 1QLUA 3NRZB 1MBTA 3HRDC 4HG0A 1W1QA 3NVYB 5HMRA 1E8HA 3D2HA 3NVZB 1JROA 1I19A 2VFTA 3S1FA 4MLAA 5AE1A 1N63C 5HQXA 5AE2A 2VAOA 3BW7A 1WYGA 1ZR6A 4JB1A 1W1LA 2Q4WA 1F0XA 1E8GA 4ML8A
chains in the Genus database with same CATH superfamily
2MBRA 1W1SA 3DQ0A 1N5XA 4PZFA 3W8ZA 1W1JA 1DZNA 1AHZA 3EJBB 4ZOHB 2P13A 2WDWA 1HSKA 3S1EA 4EC3A 5I1VA 3AM9A 2W3SA 2VFRA 1N62C 1FO4A 3LLBA 1AHVA 5G5HB 2OAIA 4PVJA 3W8XA 2W54A 2EXRA 5L6FA 1E8FA 2Q85A 2Y4GA 2IPIA 3TSJA 3VTEA 3PQBA 3C0PA 1AHUA 1FIQB 2VFSA 1W1RA 1FFUC 4XLOA 2E3TA 3EUB3 3W8WA 5L6GA 2PLSA 2BVHA 1RM6B 5D79A 1WVFA 3KJMA 2R2ZA 1VAOA 1JRPA 4UD8A 1W1MA 1DIIA 4PWCA 2RK5A 4OALA 3JS8A 5AE3A 3NVWB 3S1CA 4PYTA 4BC9A 2VFUA 4PVHA 1DIQA 5AWVA 1SB3B 5FXEA 3EJDB 4PVEA 2R8DA 3HSUA 1UXYA 5ADZA 5FXFA 2QPMA 1VDVA 2NQWA 4BC7A 1W1OA 3AN1A 1N61C 3D2DA 3D2JA 2PLIA 2BVFA 3B9JB 2W55A 3TSHA 1MBBA 3NS1B 2UUUA 2I0KA 1N60C 3NVVB 1ZXIC 1T3QC 4PWBA 2Y3RA 2YVSA 2GQUA 2GQTA 5HHZA 3DEDA 3S1DA 3FW9A 2P4PA 3I99A 4DNSA 5FXPA 2BVGA 3PM9A 1E0YA 2QKNA 2O3GA 1N5WC 2P3HA 5I1WA 3POPA 3FWAA 1V97A 3ETRB 4BBYA 2Y08A 2Y3SA 3EJEB 4PVKA 2W3RA 3TX1A 3RJAA 3RJ8A 2AXRA 2VFVA 4JAYA 4BCAA 5FXDA 3LAEA 4O95A 3GSYA 1QLTA 3FW8A 3AMZA 5G5GB 1W1KA 1FFVC 3SR6B 5K8EA 1WVEA 3FW7A 1QLUA 3NRZB 1MBTA 3HRDC 4HG0A 1W1QA 3NVYB 5HMRA 1E8HA 3D2HA 3NVZB 1JROA 1I19A 2VFTA 3S1FA 4MLAA 5AE1A 1N63C 5HQXA 5AE2A 2UUVA 2VAOA 3BW7A 1WYGA 1ZR6A 4JB1A 1W1LA 2Q4WA 1F0XA 1E8GA 4ML8A
chains in the Genus database with same CATH topology
2MBRA 1W1SA 3DQ0A 1N5XA 4PZFA 3W8ZA 1W1JA 1DZNA 1AHZA 4ZOHB 2P13A 2WDWA 1HSKA 3S1EA 4EC3A 5I1VA 3AM9A 2W3SA 2VFRA 1N62C 1FO4A 3LLBA 1AHVA 5G5HB 2OAIA 4PVJA 3W8XA 2W54A 2EXRA 5L6FA 1E8FA 2Q85A 2Y4GA 2IPIA 3TSJA 3VTEA 3PQBA 3C0PA 1AHUA 1FIQB 2VFSA 1W1RA 1FFUC 4XLOA 2E3TA 3EUB3 3W8WA 5L6GA 2PLSA 2BVHA 1RM6B 5D79A 1WVFA 3KJMA 2R2ZA 1VAOA 1JRPA 4UD8A 1W1MA 1DIIA 4PWCA 2RK5A 4OALA 3JS8A 5AE3A 3NVWB 3S1CA 4PYTA 4BC9A 2VFUA 4PVHA 1DIQA 5AWVA 1SB3B 5FXEA 4PVEA 2R8DA 3HSUA 1UXYA 5ADZA 5FXFA 2QPMA 1VDVA 2NQWA 4BC7A 1W1OA 3AN1A 1N61C 3D2DA 3D2JA 2PLIA 2BVFA 3B9JB 2W55A 3TSHA 1MBBA 3NS1B 2UUUA 2I0KA 1N60C 3NVVB 1ZXIC 1T3QC 4PWBA 2Y3RA 2YVSA 2GQUA 2GQTA 5HHZA 3DEDA 3S1DA 3FW9A 2P4PA 3I99A 4DNSA 5FXPA 2BVGA 3PM9A 1E0YA 2QKNA 2O3GA 1N5WC 2P3HA 5I1WA 3POPA 3FWAA 1V97A 3ETRB 4BBYA 2Y08A 2Y3SA 4PVKA 2W3RA 3TX1A 3RJAA 3RJ8A 2AXRA 2VFVA 4JAYA 4BCAA 5FXDA 3LAEA 4O95A 3GSYA 1QLTA 3FW8A 3AMZA 5G5GB 1W1KA 1FFVC 3SR6B 5K8EA 1WVEA 3FW7A 1QLUA 3NRZB 1MBTA 3HRDC 4HG0A 1W1QA 3NVYB 5HMRA 1E8HA 3D2HA 3NVZB 1JROA 1I19A 2VFTA 3S1FA 4MLAA 5AE1A 1N63C 5HQXA 5AE2A 2UUVA 2VAOA 3BW7A 1WYGA 1ZR6A 4JB1A 1W1LA 2Q4WA 1F0XA 1E8GA 4ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBR A;  1W1S A;  3DQ0 A;  1N5X A;  4PZF A;  3W8Z A;  1W1J A;  1DZN A;  1AHZ A;  4ZOH B;  2P13 A;  1HSK A;  3S1E A;  4EC3 A;  3AM9 A;  2W3S A;  2VFR A;  1N62 C;  1FO4 A;  3LLB A;  1AHV A;  5G5H B;  2OAI A;  4PVJ A;  3W8X A;  2W54 A;  2EXR A;  1E8F A;  2Q85 A;  3TSJ A;  3VTE A;  3C0P A;  1AHU A;  1FIQ B;  2VFS A;  1W1R A;  1FFU C;  4XLO A;  2E3T A;  3EUB 3;  3W8W A;  2PLS A;  2BVH A;  1RM6 B;  5D79 A;  1WVF A;  3KJM A;  2R2Z A;  1VAO A;  1JRP A;  4UD8 A;  1W1M A;  1DII A;  4PWC A;  2RK5 A;  4OAL A;  3JS8 A;  5AE3 A;  3NVW B;  3S1C A;  4PYT A;  4BC9 A;  2VFU A;  4PVH A;  1DIQ A;  1SB3 B;  5FXE A;  4PVE A;  2R8D A;  1UXY A;  5ADZ A;  5FXF A;  2QPM A;  1VDV A;  2NQW A;  4BC7 A;  1W1O A;  3AN1 A;  1N61 C;  3D2D A;  3D2J A;  2PLI A;  2BVF A;  3B9J B;  2W55 A;  3TSH A;  1MBB A;  3NS1 B;  2I0K A;  1N60 C;  3NVV B;  1ZXI C;  1T3Q C;  4PWB A;  2YVS A;  2GQU A;  2GQT A;  5HHZ A;  3DED A;  3S1D A;  3FW9 A;  2P4P A;  3I99 A;  4DNS A;  5FXP A;  2BVG A;  3PM9 A;  1E0Y A;  2QKN A;  2O3G A;  1N5W C;  2P3H A;  3FWA A;  1V97 A;  3ETR B;  4BBY A;  4PVK A;  2W3R A;  3TX1 A;  2AXR A;  2VFV A;  4JAY A;  4BCA A;  5FXD A;  3LAE A;  4O95 A;  3GSY A;  1QLT A;  3FW8 A;  3AMZ A;  5G5G B;  1W1K A;  1FFV C;  3SR6 B;  1WVE A;  3FW7 A;  1QLU A;  3NRZ B;  1MBT A;  3HRD C;  4HG0 A;  1W1Q A;  3NVY B;  5HMR A;  1E8H A;  3D2H A;  3NVZ B;  1JRO A;  1I19 A;  2VFT A;  3S1F A;  4MLA A;  5AE1 A;  1N63 C;  5HQX A;  5AE2 A;  2VAO A;  3BW7 A;  1WYG A;  1ZR6 A;  4JB1 A;  1W1L A;  2Q4W A;  1F0X A;  1E8G A;  4ML8 A; 
#chains in the Genus database with same CATH topology
 2MBR A;  1W1S A;  3DQ0 A;  1N5X A;  4PZF A;  3W8Z A;  1W1J A;  1DZN A;  1AHZ A;  3EJB B;  4ZOH B;  2P13 A;  2WDW A;  1HSK A;  3S1E A;  4EC3 A;  5I1V A;  3AM9 A;  2W3S A;  2VFR A;  1N62 C;  1FO4 A;  3LLB A;  1AHV A;  5G5H B;  2OAI A;  4PVJ A;  3W8X A;  2W54 A;  2EXR A;  5L6F A;  1E8F A;  2Q85 A;  2Y4G A;  2IPI A;  3TSJ A;  3VTE A;  3PQB A;  3C0P A;  1AHU A;  1FIQ B;  2VFS A;  1W1R A;  1FFU C;  4XLO A;  2E3T A;  3EUB 3;  3W8W A;  5L6G A;  2PLS A;  2BVH A;  1RM6 B;  5D79 A;  1WVF A;  3KJM A;  2R2Z A;  1VAO A;  1JRP A;  4UD8 A;  1W1M A;  1DII A;  4PWC A;  2RK5 A;  4OAL A;  3JS8 A;  5AE3 A;  3NVW B;  3S1C A;  4PYT A;  4BC9 A;  2VFU A;  4PVH A;  1DIQ A;  5AWV A;  1SB3 B;  5FXE A;  3EJD B;  4PVE A;  2R8D A;  3HSU A;  1UXY A;  5ADZ A;  5FXF A;  2QPM A;  1VDV A;  2NQW A;  4BC7 A;  1W1O A;  3AN1 A;  1N61 C;  3D2D A;  3D2J A;  2PLI A;  2BVF A;  3B9J B;  2W55 A;  3TSH A;  1MBB A;  3NS1 B;  2UUU A;  2I0K A;  1N60 C;  3NVV B;  1ZXI C;  1T3Q C;  4PWB A;  2Y3R A;  2YVS A;  2GQU A;  2GQT A;  5HHZ A;  3DED A;  3S1D A;  3FW9 A;  2P4P A;  3I99 A;  4DNS A;  5FXP A;  2BVG A;  3PM9 A;  1E0Y A;  2QKN A;  2O3G A;  1N5W C;  2P3H A;  5I1W A;  3POP A;  3FWA A;  1V97 A;  3ETR B;  4BBY A;  2Y08 A;  2Y3S A;  3EJE B;  4PVK A;  2W3R A;  3TX1 A;  3RJA A;  3RJ8 A;  2AXR A;  2VFV A;  4JAY A;  4BCA A;  5FXD A;  3LAE A;  4O95 A;  3GSY A;  1QLT A;  3FW8 A;  3AMZ A;  5G5G B;  1W1K A;  1FFV C;  3SR6 B;  5K8E A;  1WVE A;  3FW7 A;  1QLU A;  3NRZ B;  1MBT A;  3HRD C;  4HG0 A;  1W1Q A;  3NVY B;  5HMR A;  1E8H A;  3D2H A;  3NVZ B;  1JRO A;  1I19 A;  2VFT A;  3S1F A;  4MLA A;  5AE1 A;  1N63 C;  5HQX A;  5AE2 A;  2UUV A;  2VAO A;  3BW7 A;  1WYG A;  1ZR6 A;  4JB1 A;  1W1L A;  2Q4W A;  1F0X A;  1E8G A;  4ML8 A; 
#chains in the Genus database with same CATH homology
 2MBR A;  1W1S A;  3DQ0 A;  1N5X A;  4PZF A;  3W8Z A;  1W1J A;  1DZN A;  1AHZ A;  4ZOH B;  2P13 A;  2WDW A;  1HSK A;  3S1E A;  4EC3 A;  5I1V A;  3AM9 A;  2W3S A;  2VFR A;  1N62 C;  1FO4 A;  3LLB A;  1AHV A;  5G5H B;  2OAI A;  4PVJ A;  3W8X A;  2W54 A;  2EXR A;  5L6F A;  1E8F A;  2Q85 A;  2Y4G A;  2IPI A;  3TSJ A;  3VTE A;  3PQB A;  3C0P A;  1AHU A;  1FIQ B;  2VFS A;  1W1R A;  1FFU C;  4XLO A;  2E3T A;  3EUB 3;  3W8W A;  5L6G A;  2PLS A;  2BVH A;  1RM6 B;  5D79 A;  1WVF A;  3KJM A;  2R2Z A;  1VAO A;  1JRP A;  4UD8 A;  1W1M A;  1DII A;  4PWC A;  2RK5 A;  4OAL A;  3JS8 A;  5AE3 A;  3NVW B;  3S1C A;  4PYT A;  4BC9 A;  2VFU A;  4PVH A;  1DIQ A;  5AWV A;  1SB3 B;  5FXE A;  4PVE A;  2R8D A;  3HSU A;  1UXY A;  5ADZ A;  5FXF A;  2QPM A;  1VDV A;  2NQW A;  4BC7 A;  1W1O A;  3AN1 A;  1N61 C;  3D2D A;  3D2J A;  2PLI A;  2BVF A;  3B9J B;  2W55 A;  3TSH A;  1MBB A;  3NS1 B;  2UUU A;  2I0K A;  1N60 C;  3NVV B;  1ZXI C;  1T3Q C;  4PWB A;  2Y3R A;  2YVS A;  2GQU A;  2GQT A;  5HHZ A;  3DED A;  3S1D A;  3FW9 A;  2P4P A;  3I99 A;  4DNS A;  5FXP A;  2BVG A;  3PM9 A;  1E0Y A;  2QKN A;  2O3G A;  1N5W C;  2P3H A;  5I1W A;  3POP A;  3FWA A;  1V97 A;  3ETR B;  4BBY A;  2Y08 A;  2Y3S A;  4PVK A;  2W3R A;  3TX1 A;  3RJA A;  3RJ8 A;  2AXR A;  2VFV A;  4JAY A;  4BCA A;  5FXD A;  3LAE A;  4O95 A;  3GSY A;  1QLT A;  3FW8 A;  3AMZ A;  5G5G B;  1W1K A;  1FFV C;  3SR6 B;  5K8E A;  1WVE A;  3FW7 A;  1QLU A;  3NRZ B;  1MBT A;  3HRD C;  4HG0 A;  1W1Q A;  3NVY B;  5HMR A;  1E8H A;  3D2H A;  3NVZ B;  1JRO A;  1I19 A;  2VFT A;  3S1F A;  4MLA A;  5AE1 A;  1N63 C;  5HQX A;  5AE2 A;  2UUV A;  2VAO A;  3BW7 A;  1WYG A;  1ZR6 A;  4JB1 A;  1W1L A;  2Q4W A;  1F0X A;  1E8G A;  4ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...