4PYTA

Crystal structure of a murb family ep-udp-n-acetylglucosamine reductase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
MDKVIQELKDLQVGKVLENEPLANHTTIKIGGPADCLVIPKDIQAVRDTMEVVKNHGVQWRAIGRGSNLLVLDEGIRGVVIKLGAGLDHMEIDGEQVTVGGGYSVVRLSTGISKKGLSGLEFASGIPGSVGGAVYMNAGAHGSDISRILVKALILFEDGTMEWLTNEEMEFSYRTSILQNKRPGICLEAVLQLEQKERDAIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPDHAGRLVEQAGLKGHRIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEIVGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title LucY: A Versatile New Fluorescent Reporter Protein.
pubmed doi rcsb
source organism Unidentified
total genus 99
structure length 302
sequence length 302
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pytA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pytA02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 4pytA03
3LLBA 4BC9A 5HMRA 2OAIA 3JS8A 4PVKA 1DIQA 4PWCA 5D79A 1SB3B 1W1SA 1W1JA 1W1MA 2Q4WA 2O3GA 4PVJA 3D2HA 2E3TA 2VAOA 3AMZA 5AE3A 2PLSA 5FXFA 3NRZB 3D2DA 3NVYB 3TSJA 1W1RA 1W1LA 3BW7A 3W8WA 1N63C 1FIQB 1HSKA 4HG0A 2W55A 2R8DA 3S1EA 1I19A 2W54A 4O95A 1AHVA 1DZNA 3W8XA 2AXRA 3NVZB 2W3RA 2PLIA 3NVWB 2R2ZA 3TSHA 3AN1A 4ZOHB 4XLOA 1RM6B 1W1OA 3VTEA 2W3SA 4JAYA 3SR6B 5G5GB 1E0YA 2P13A 2VFUA 2YVSA 3EUB3 2EXRA 3ETRB 4OALA 4MLAA 5AE1A 2GQUA 2P3HA 1E8FA 1DIIA 1N5XA 2VFVA 1E8GA 4BCAA 3I99A 1N5WC 2VFRA 1JROA 2MBRA 2BVHA 1WVFA 2RK5A 4PVHA 3S1FA 1JRPA 1VDVA 4BC7A 3FWAA 3NVVB 1N62C 4PZFA 1T3QC 3C0PA 1W1QA 1W1KA 2BVFA 1FFUC 2VFTA 2VFSA 4DNSA 1VAOA 4PVEA 3DQ0A 4PYTA 2QKNA 5ADZA 4EC3A 5HQXA 4PWBA 3S1CA 3DEDA 3FW9A 2GQTA 3FW8A 2P4PA 1E8HA 4BBYA 4ML8A 1ZXIC 5HHZA 3NS1B 5FXDA 3LAEA 2BVGA 3B9JB 2I0KA 3TX1A 5G5HB 3S1DA 1MBBA 3W8ZA 2NQWA 1QLTA 4JB1A 1WYGA 1ZR6A 1V97A 4UD8A 1FO4A 1N60C 1FFVC 5AE2A 3HRDC 5FXEA 1AHUA 3PM9A 3KJMA 3D2JA 2Q85A 3AM9A 3GSYA 1MBTA 3FW7A 1F0XA 1AHZA 5FXPA 1UXYA 1QLUA 2QPMA 1WVEA 1N61C
chains in the Genus database with same CATH superfamily
3LLBA 5K8EA 4BC9A 5HMRA 2OAIA 3HSUA 3JS8A 4PVKA 1DIQA 4PWCA 5D79A 1SB3B 1W1SA 1W1JA 1W1MA 2Q4WA 3POPA 2O3GA 4PVJA 3D2HA 2E3TA 2VAOA 3AMZA 5AE3A 2PLSA 5FXFA 3NRZB 3D2DA 3NVYB 3TSJA 3RJAA 1W1RA 1W1LA 3BW7A 3W8WA 1N63C 1FIQB 1HSKA 4HG0A 2W55A 2R8DA 3S1EA 1I19A 2W54A 4O95A 1AHVA 5I1WA 2UUVA 1DZNA 5AWVA 3W8XA 2AXRA 3NVZB 2W3RA 3NVWB 2PLIA 2R2ZA 3TSHA 2Y3SA 3EJEB 3AN1A 4ZOHB 2UUUA 4XLOA 1RM6B 1W1OA 3VTEA 2W3SA 4JAYA 3SR6B 2Y3RA 5G5GB 1E0YA 2P13A 2VFUA 2YVSA 3EUB3 2EXRA 3ETRB 4OALA 4MLAA 5AE1A 2GQUA 2P3HA 1E8FA 1DIIA 1N5XA 2VFVA 1E8GA 4BCAA 3I99A 1N5WC 2Y08A 2VFRA 1JROA 2MBRA 2BVHA 1WVFA 2RK5A 4PVHA 3S1FA 1JRPA 1VDVA 4BC7A 3FWAA 3NVVB 1N62C 4PZFA 1T3QC 3C0PA 1W1QA 1W1KA 2BVFA 1FFUC 2VFTA 2VFSA 4DNSA 3EJBB 3EJDB 1VAOA 4PVEA 3DQ0A 4PYTA 2QKNA 5ADZA 4EC3A 5HQXA 4PWBA 3S1CA 2Y4GA 3DEDA 3FW9A 2GQTA 3RJ8A 5L6GA 3FW8A 2IPIA 2P4PA 3PQBA 1E8HA 4BBYA 4ML8A 1ZXIC 5HHZA 3NS1B 5FXDA 3LAEA 2BVGA 3B9JB 2I0KA 3TX1A 5L6FA 5G5HB 3S1DA 1MBBA 3W8ZA 2NQWA 1QLTA 4JB1A 1WYGA 1ZR6A 1V97A 4UD8A 1FO4A 1N60C 1FFVC 5AE2A 3HRDC 5FXEA 1AHUA 3PM9A 3KJMA 2WDWA 5I1VA 3D2JA 2Q85A 3AM9A 3GSYA 1MBTA 3FW7A 1F0XA 1AHZA 5FXPA 1UXYA 1QLUA 2QPMA 1WVEA 1N61C
chains in the Genus database with same CATH topology
3LLBA 5K8EA 4BC9A 5HMRA 2OAIA 3HSUA 3JS8A 4PVKA 1DIQA 4PWCA 5D79A 1SB3B 1W1SA 1W1JA 1W1MA 2Q4WA 3POPA 2O3GA 4PVJA 3D2HA 2E3TA 2VAOA 3AMZA 5AE3A 2PLSA 5FXFA 3NRZB 3D2DA 3NVYB 3TSJA 3RJAA 1W1RA 1W1LA 3BW7A 3W8WA 1N63C 1FIQB 1HSKA 4HG0A 2W55A 2R8DA 3S1EA 1I19A 2W54A 4O95A 1AHVA 5I1WA 2UUVA 1DZNA 5AWVA 3W8XA 2AXRA 3NVZB 2W3RA 2PLIA 3NVWB 2R2ZA 3TSHA 2Y3SA 3AN1A 4ZOHB 2UUUA 4XLOA 1RM6B 1W1OA 3VTEA 2W3SA 4JAYA 3SR6B 2Y3RA 5G5GB 1E0YA 2P13A 2VFUA 2YVSA 3EUB3 2EXRA 3ETRB 4OALA 4MLAA 5AE1A 2GQUA 2P3HA 1E8FA 1DIIA 1N5XA 2VFVA 1E8GA 4BCAA 3I99A 1N5WC 2Y08A 2VFRA 1JROA 2MBRA 2BVHA 1WVFA 2RK5A 4PVHA 3S1FA 1JRPA 1VDVA 4BC7A 3FWAA 3NVVB 1N62C 4PZFA 1T3QC 3C0PA 1W1QA 1W1KA 2BVFA 1FFUC 2VFTA 2VFSA 4DNSA 1VAOA 4PVEA 3DQ0A 4PYTA 2QKNA 5ADZA 4EC3A 5HQXA 4PWBA 3S1CA 2Y4GA 3DEDA 3FW9A 2GQTA 3RJ8A 5L6GA 3FW8A 2IPIA 2P4PA 3PQBA 1E8HA 4BBYA 4ML8A 1ZXIC 5HHZA 3NS1B 5FXDA 3LAEA 2BVGA 3B9JB 2I0KA 3TX1A 5L6FA 5G5HB 3S1DA 1MBBA 3W8ZA 2NQWA 1QLTA 4JB1A 1WYGA 1ZR6A 1V97A 4UD8A 1FO4A 1N60C 1FFVC 5AE2A 3HRDC 5FXEA 1AHUA 3PM9A 3KJMA 2WDWA 5I1VA 3D2JA 2Q85A 3AM9A 3GSYA 1MBTA 3FW7A 1F0XA 1AHZA 5FXPA 1UXYA 1QLUA 2QPMA 1WVEA 1N61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LLB A;  4BC9 A;  5HMR A;  2OAI A;  3JS8 A;  4PVK A;  1DIQ A;  4PWC A;  5D79 A;  1SB3 B;  1W1S A;  1W1J A;  1W1M A;  2Q4W A;  2O3G A;  4PVJ A;  3D2H A;  2E3T A;  2VAO A;  3AMZ A;  5AE3 A;  2PLS A;  5FXF A;  3NRZ B;  3D2D A;  3NVY B;  3TSJ A;  1W1R A;  1W1L A;  3BW7 A;  3W8W A;  1N63 C;  1FIQ B;  1HSK A;  4HG0 A;  2W55 A;  2R8D A;  3S1E A;  1I19 A;  2W54 A;  4O95 A;  1AHV A;  1DZN A;  3W8X A;  2AXR A;  3NVZ B;  2W3R A;  2PLI A;  3NVW B;  2R2Z A;  3TSH A;  3AN1 A;  4ZOH B;  4XLO A;  1RM6 B;  1W1O A;  3VTE A;  2W3S A;  4JAY A;  3SR6 B;  5G5G B;  1E0Y A;  2P13 A;  2VFU A;  2YVS A;  3EUB 3;  2EXR A;  3ETR B;  4OAL A;  4MLA A;  5AE1 A;  2GQU A;  2P3H A;  1E8F A;  1DII A;  1N5X A;  2VFV A;  1E8G A;  4BCA A;  3I99 A;  1N5W C;  2VFR A;  1JRO A;  2MBR A;  2BVH A;  1WVF A;  2RK5 A;  4PVH A;  3S1F A;  1JRP A;  1VDV A;  4BC7 A;  3FWA A;  3NVV B;  1N62 C;  4PZF A;  1T3Q C;  3C0P A;  1W1Q A;  1W1K A;  2BVF A;  1FFU C;  2VFT A;  2VFS A;  4DNS A;  1VAO A;  4PVE A;  3DQ0 A;  4PYT A;  2QKN A;  5ADZ A;  4EC3 A;  5HQX A;  4PWB A;  3S1C A;  3DED A;  3FW9 A;  2GQT A;  3FW8 A;  2P4P A;  1E8H A;  4BBY A;  4ML8 A;  1ZXI C;  5HHZ A;  3NS1 B;  5FXD A;  3LAE A;  2BVG A;  3B9J B;  2I0K A;  3TX1 A;  5G5H B;  3S1D A;  1MBB A;  3W8Z A;  2NQW A;  1QLT A;  4JB1 A;  1WYG A;  1ZR6 A;  1V97 A;  4UD8 A;  1FO4 A;  1N60 C;  1FFV C;  5AE2 A;  3HRD C;  5FXE A;  1AHU A;  3PM9 A;  3KJM A;  3D2J A;  2Q85 A;  3AM9 A;  3GSY A;  1MBT A;  3FW7 A;  1F0X A;  1AHZ A;  5FXP A;  1UXY A;  1QLU A;  2QPM A;  1WVE A;  1N61 C; 
#chains in the Genus database with same CATH topology
 3LLB A;  5K8E A;  4BC9 A;  5HMR A;  2OAI A;  3HSU A;  3JS8 A;  4PVK A;  1DIQ A;  4PWC A;  5D79 A;  1SB3 B;  1W1S A;  1W1J A;  1W1M A;  2Q4W A;  3POP A;  2O3G A;  4PVJ A;  3D2H A;  2E3T A;  2VAO A;  3AMZ A;  5AE3 A;  2PLS A;  5FXF A;  3NRZ B;  3D2D A;  3NVY B;  3TSJ A;  3RJA A;  1W1R A;  1W1L A;  3BW7 A;  3W8W A;  1N63 C;  1FIQ B;  1HSK A;  4HG0 A;  2W55 A;  2R8D A;  3S1E A;  1I19 A;  2W54 A;  4O95 A;  1AHV A;  5I1W A;  2UUV A;  1DZN A;  5AWV A;  3W8X A;  2AXR A;  3NVZ B;  2W3R A;  3NVW B;  2PLI A;  2R2Z A;  3TSH A;  2Y3S A;  3EJE B;  3AN1 A;  4ZOH B;  2UUU A;  4XLO A;  1RM6 B;  1W1O A;  3VTE A;  2W3S A;  4JAY A;  3SR6 B;  2Y3R A;  5G5G B;  1E0Y A;  2P13 A;  2VFU A;  2YVS A;  3EUB 3;  2EXR A;  3ETR B;  4OAL A;  4MLA A;  5AE1 A;  2GQU A;  2P3H A;  1E8F A;  1DII A;  1N5X A;  2VFV A;  1E8G A;  4BCA A;  3I99 A;  1N5W C;  2Y08 A;  2VFR A;  1JRO A;  2MBR A;  2BVH A;  1WVF A;  2RK5 A;  4PVH A;  3S1F A;  1JRP A;  1VDV A;  4BC7 A;  3FWA A;  3NVV B;  1N62 C;  4PZF A;  1T3Q C;  3C0P A;  1W1Q A;  1W1K A;  2BVF A;  1FFU C;  2VFT A;  2VFS A;  4DNS A;  3EJB B;  3EJD B;  1VAO A;  4PVE A;  3DQ0 A;  4PYT A;  2QKN A;  5ADZ A;  4EC3 A;  5HQX A;  4PWB A;  3S1C A;  2Y4G A;  3DED A;  3FW9 A;  2GQT A;  3RJ8 A;  5L6G A;  3FW8 A;  2IPI A;  2P4P A;  3PQB A;  1E8H A;  4BBY A;  4ML8 A;  1ZXI C;  5HHZ A;  3NS1 B;  5FXD A;  3LAE A;  2BVG A;  3B9J B;  2I0K A;  3TX1 A;  5L6F A;  5G5H B;  3S1D A;  1MBB A;  3W8Z A;  2NQW A;  1QLT A;  4JB1 A;  1WYG A;  1ZR6 A;  1V97 A;  4UD8 A;  1FO4 A;  1N60 C;  1FFV C;  5AE2 A;  3HRD C;  5FXE A;  1AHU A;  3PM9 A;  3KJM A;  2WDW A;  5I1V A;  3D2J A;  2Q85 A;  3AM9 A;  3GSY A;  1MBT A;  3FW7 A;  1F0X A;  1AHZ A;  5FXP A;  1UXY A;  1QLU A;  2QPM A;  1WVE A;  1N61 C; 
#chains in the Genus database with same CATH homology
 3LLB A;  5K8E A;  4BC9 A;  5HMR A;  2OAI A;  3HSU A;  3JS8 A;  4PVK A;  1DIQ A;  4PWC A;  5D79 A;  1SB3 B;  1W1S A;  1W1J A;  1W1M A;  2Q4W A;  3POP A;  2O3G A;  4PVJ A;  3D2H A;  2E3T A;  2VAO A;  3AMZ A;  5AE3 A;  2PLS A;  5FXF A;  3NRZ B;  3D2D A;  3NVY B;  3TSJ A;  3RJA A;  1W1R A;  1W1L A;  3BW7 A;  3W8W A;  1N63 C;  1FIQ B;  1HSK A;  4HG0 A;  2W55 A;  2R8D A;  3S1E A;  1I19 A;  2W54 A;  4O95 A;  1AHV A;  5I1W A;  2UUV A;  1DZN A;  5AWV A;  3W8X A;  2AXR A;  3NVZ B;  2W3R A;  2PLI A;  3NVW B;  2R2Z A;  3TSH A;  2Y3S A;  3AN1 A;  4ZOH B;  2UUU A;  4XLO A;  1RM6 B;  1W1O A;  3VTE A;  2W3S A;  4JAY A;  3SR6 B;  2Y3R A;  5G5G B;  1E0Y A;  2P13 A;  2VFU A;  2YVS A;  3EUB 3;  2EXR A;  3ETR B;  4OAL A;  4MLA A;  5AE1 A;  2GQU A;  2P3H A;  1E8F A;  1DII A;  1N5X A;  2VFV A;  1E8G A;  4BCA A;  3I99 A;  1N5W C;  2Y08 A;  2VFR A;  1JRO A;  2MBR A;  2BVH A;  1WVF A;  2RK5 A;  4PVH A;  3S1F A;  1JRP A;  1VDV A;  4BC7 A;  3FWA A;  3NVV B;  1N62 C;  4PZF A;  1T3Q C;  3C0P A;  1W1Q A;  1W1K A;  2BVF A;  1FFU C;  2VFT A;  2VFS A;  4DNS A;  1VAO A;  4PVE A;  3DQ0 A;  4PYT A;  2QKN A;  5ADZ A;  4EC3 A;  5HQX A;  4PWB A;  3S1C A;  2Y4G A;  3DED A;  3FW9 A;  2GQT A;  3RJ8 A;  5L6G A;  3FW8 A;  2IPI A;  2P4P A;  3PQB A;  1E8H A;  4BBY A;  4ML8 A;  1ZXI C;  5HHZ A;  3NS1 B;  5FXD A;  3LAE A;  2BVG A;  3B9J B;  2I0K A;  3TX1 A;  5L6F A;  5G5H B;  3S1D A;  1MBB A;  3W8Z A;  2NQW A;  1QLT A;  4JB1 A;  1WYG A;  1ZR6 A;  1V97 A;  4UD8 A;  1FO4 A;  1N60 C;  1FFV C;  5AE2 A;  3HRD C;  5FXE A;  1AHU A;  3PM9 A;  3KJM A;  2WDW A;  5I1V A;  3D2J A;  2Q85 A;  3AM9 A;  3GSY A;  1MBT A;  3FW7 A;  1F0X A;  1AHZ A;  5FXP A;  1UXY A;  1QLU A;  2QPM A;  1WVE A;  1N61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...