4PYTA

Crystal structure of a murb family ep-udp-n-acetylglucosamine reductase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
b'MDKVIQELKDLQVGKVLENEPLANHTTIKIGGPADCLVIPKDIQAVRDTMEVVKNHGVQWRAIGRGSNLLVLDEGIRGVVIKLGAGLDHMEIDGEQVTVGGGYSVVRLSTGISKKGLSGLEFASGIPGSVGGAVYMNAGAHGSDISRILVKALILFEDGTMEWLTNEEMEFSYRTSILQNKRPGICLEAVLQLEQKERDAIVAQMQKNKDYRKETQPVSNPCAGSIFRNPLPDHAGRLVEQAGLKGHRIGGAKVSEMHGNFIVNAGGATAKDVLDLIAFIQKTIKEKYDIDMHTEVEIVGEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
molecule tags Oxidoreductase
source organism Unidentified
publication title LucY: A Versatile New Fluorescent Reporter Protein.
pubmed doi rcsb
total genus 99
structure length 302
sequence length 302
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pytA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pytA02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 4pytA03
3NRZB 3NVWB 4PWBA 3FW8A 1DIIA 3BW7A 2VFUA 1MBTA 2BVHA 2R8DA 5FXEA 4BC9A 4PVHA 3S1DA 4EC3A 3W8XA 2W3SA 3W8WA 4MLAA 2BVFA 5FXFA 4PYTA 2P3HA 2BVGA 2OAIA 2E3TA 4XLOA 5G5HB 1DZNA 1N60C 3ETRB 3I99A 2VAOA 5FXDA 1JRPA 1E8GA 1SB3B 1QLTA 4BC7A 2O3GA 3SR6B 3AM9A 3EUB3 3NVVB 2R2ZA 3VTEA 1FIQB 1N5WC 3S1CA 4O95A 2GQUA 1W1LA 1QLUA 5HMRA 3NVZB 3AN1A 2W3RA 1F0XA 2VFRA 1JROA 3C0PA 3B9JB 1WVFA 4ZOHB 1FFVC 1FO4A 4ML8A 1AHZA 3LAEA 3HRDC 3FW9A 1WYGA 5ADZA 4JB1A 1W1RA 2MBRA 1W1SA 4UD8A 2PLSA 1UXYA 1W1KA 3D2DA 3FW7A 1VDVA 1W1QA 1E8HA 4PWCA 3NS1B 3FWAA 3S1FA 5HHZA 3LLBA 2Q85A 1VAOA 3NVYB 3PM9A 4PVEA 5AE3A 3DEDA 3D2JA 2W55A 1AHUA 2AXRA 2QKNA 5HQXA 1N5XA 1MBBA 1W1OA 1N61C 3TX1A 1V97A 2EXRA 1AHVA 2VFVA 4PVJA 1N62C 2GQTA 5AE2A 1DIQA 2W54A 3TSJA 2PLIA 3GSYA 1T3QC 2P4PA 3KJMA 4PVKA 2Q4WA 4HG0A 2RK5A 3DQ0A 5FXPA 2I0KA 1W1MA 2YVSA 1N63C 5G5GB 3TSHA 3W8ZA 4BCAA 1ZXIC 3AMZA 1I19A 3D2HA 4DNSA 2VFTA 1E0YA 4BBYA 4OALA 2VFSA 1FFUC 1W1JA 4JAYA 1RM6B 2QPMA 1E8FA 1HSKA 2NQWA 3JS8A 2P13A 4PZFA 1WVEA 5AE1A 1ZR6A 3S1EA 5D79A
chains in the Genus database with same CATH superfamily
3NRZB 3NVWB 4PWBA 3FW8A 1DIIA 3BW7A 2VFUA 1MBTA 3HSUA 2BVHA 2R8DA 5FXEA 4BC9A 4PVHA 3S1DA 4EC3A 3W8XA 2W3SA 3W8WA 4MLAA 3POPA 2BVFA 5FXFA 4PYTA 2P3HA 2BVGA 2OAIA 2E3TA 4XLOA 5G5HB 1DZNA 1N60C 3ETRB 3I99A 2VAOA 5FXDA 1JRPA 1E8GA 1SB3B 1QLTA 4BC7A 2O3GA 3PQBA 3SR6B 3AM9A 3EUB3 3NVVB 2R2ZA 3VTEA 1FIQB 1N5WC 3S1CA 4O95A 2GQUA 1W1LA 1QLUA 5L6FA 5HMRA 3NVZB 3AN1A 2W3RA 1F0XA 2VFRA 1JROA 3C0PA 3B9JB 1WVFA 4ZOHB 1FFVC 1FO4A 4ML8A 1AHZA 2IPIA 3LAEA 3HRDC 3FW9A 1WYGA 5ADZA 4JB1A 1W1RA 2Y08A 2MBRA 1W1SA 4UD8A 2PLSA 1UXYA 5I1WA 1W1KA 3D2DA 3FW7A 1VDVA 1W1QA 2Y3RA 2UUVA 1E8HA 4PWCA 3NS1B 2Y3SA 3FWAA 3S1FA 5HHZA 3LLBA 2Q85A 1VAOA 3NVYB 3PM9A 2WDWA 4PVEA 5AE3A 5AWVA 3DEDA 3D2JA 2W55A 1AHUA 2AXRA 5I1VA 2QKNA 5HQXA 1N5XA 1MBBA 1W1OA 1N61C 3TX1A 1V97A 2EXRA 5L6GA 1AHVA 2Y4GA 2VFVA 3EJDB 4PVJA 1N62C 2GQTA 5AE2A 1DIQA 2W54A 3TSJA 2PLIA 3GSYA 1T3QC 2P4PA 3KJMA 4PVKA 2Q4WA 4HG0A 2RK5A 3DQ0A 5FXPA 2I0KA 1W1MA 2YVSA 1N63C 2UUUA 5G5GB 3TSHA 5K8EA 3W8ZA 4BCAA 1ZXIC 3AMZA 1I19A 3D2HA 4DNSA 2VFTA 1E0YA 3EJEB 4BBYA 4OALA 3RJ8A 2VFSA 1FFUC 1W1JA 4JAYA 3EJBB 1RM6B 2QPMA 3RJAA 1E8FA 1HSKA 2NQWA 3JS8A 2P13A 4PZFA 1WVEA 5AE1A 1ZR6A 3S1EA 5D79A
chains in the Genus database with same CATH topology
3NRZB 3NVWB 4PWBA 3FW8A 1DIIA 3BW7A 2VFUA 1MBTA 3HSUA 2BVHA 2R8DA 5FXEA 4BC9A 4PVHA 3S1DA 4EC3A 3W8XA 2W3SA 3W8WA 4MLAA 3POPA 2BVFA 5FXFA 4PYTA 2P3HA 2BVGA 2OAIA 2E3TA 4XLOA 5G5HB 1DZNA 1N60C 3ETRB 3I99A 2VAOA 5FXDA 1JRPA 1E8GA 1SB3B 1QLTA 4BC7A 2O3GA 3PQBA 3SR6B 3AM9A 3EUB3 3NVVB 2R2ZA 3VTEA 1FIQB 1N5WC 3S1CA 4O95A 2GQUA 1W1LA 1QLUA 5L6FA 5HMRA 3NVZB 3AN1A 2W3RA 1F0XA 2VFRA 1JROA 3C0PA 3B9JB 1WVFA 4ZOHB 1FFVC 1FO4A 4ML8A 1AHZA 2IPIA 3LAEA 3HRDC 3FW9A 1WYGA 5ADZA 4JB1A 1W1RA 2Y08A 2MBRA 1W1SA 4UD8A 2PLSA 1UXYA 5I1WA 1W1KA 3D2DA 3FW7A 1VDVA 1W1QA 2Y3RA 2UUVA 1E8HA 4PWCA 3NS1B 2Y3SA 3FWAA 3S1FA 5HHZA 3LLBA 2Q85A 1VAOA 3NVYB 3PM9A 2WDWA 4PVEA 5AE3A 5AWVA 3DEDA 3D2JA 2W55A 1AHUA 2AXRA 5I1VA 2QKNA 5HQXA 1N5XA 1MBBA 1W1OA 1N61C 3TX1A 1V97A 2EXRA 5L6GA 1AHVA 2Y4GA 2VFVA 4PVJA 1N62C 2GQTA 5AE2A 1DIQA 2W54A 3TSJA 2PLIA 3GSYA 1T3QC 2P4PA 3KJMA 4PVKA 2Q4WA 4HG0A 2RK5A 3DQ0A 5FXPA 2I0KA 1W1MA 2YVSA 1N63C 2UUUA 5G5GB 3TSHA 5K8EA 3W8ZA 4BCAA 1ZXIC 3AMZA 1I19A 3D2HA 4DNSA 2VFTA 1E0YA 4BBYA 4OALA 3RJ8A 2VFSA 1FFUC 1W1JA 4JAYA 1RM6B 2QPMA 3RJAA 1E8FA 1HSKA 2NQWA 3JS8A 2P13A 4PZFA 1WVEA 5AE1A 1ZR6A 3S1EA 5D79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRZ B;  3NVW B;  4PWB A;  3FW8 A;  1DII A;  3BW7 A;  2VFU A;  1MBT A;  2BVH A;  2R8D A;  5FXE A;  4BC9 A;  4PVH A;  3S1D A;  4EC3 A;  3W8X A;  2W3S A;  3W8W A;  4MLA A;  2BVF A;  5FXF A;  4PYT A;  2P3H A;  2BVG A;  2OAI A;  2E3T A;  4XLO A;  5G5H B;  1DZN A;  1N60 C;  3ETR B;  3I99 A;  2VAO A;  5FXD A;  1JRP A;  1E8G A;  1SB3 B;  1QLT A;  4BC7 A;  2O3G A;  3SR6 B;  3AM9 A;  3EUB 3;  3NVV B;  2R2Z A;  3VTE A;  1FIQ B;  1N5W C;  3S1C A;  4O95 A;  2GQU A;  1W1L A;  1QLU A;  5HMR A;  3NVZ B;  3AN1 A;  2W3R A;  1F0X A;  2VFR A;  1JRO A;  3C0P A;  3B9J B;  1WVF A;  4ZOH B;  1FFV C;  1FO4 A;  4ML8 A;  1AHZ A;  3LAE A;  3HRD C;  3FW9 A;  1WYG A;  5ADZ A;  4JB1 A;  1W1R A;  2MBR A;  1W1S A;  4UD8 A;  2PLS A;  1UXY A;  1W1K A;  3D2D A;  3FW7 A;  1VDV A;  1W1Q A;  1E8H A;  4PWC A;  3NS1 B;  3FWA A;  3S1F A;  5HHZ A;  3LLB A;  2Q85 A;  1VAO A;  3NVY B;  3PM9 A;  4PVE A;  5AE3 A;  3DED A;  3D2J A;  2W55 A;  1AHU A;  2AXR A;  2QKN A;  5HQX A;  1N5X A;  1MBB A;  1W1O A;  1N61 C;  3TX1 A;  1V97 A;  2EXR A;  1AHV A;  2VFV A;  4PVJ A;  1N62 C;  2GQT A;  5AE2 A;  1DIQ A;  2W54 A;  3TSJ A;  2PLI A;  3GSY A;  1T3Q C;  2P4P A;  3KJM A;  4PVK A;  2Q4W A;  4HG0 A;  2RK5 A;  3DQ0 A;  5FXP A;  2I0K A;  1W1M A;  2YVS A;  1N63 C;  5G5G B;  3TSH A;  3W8Z A;  4BCA A;  1ZXI C;  3AMZ A;  1I19 A;  3D2H A;  4DNS A;  2VFT A;  1E0Y A;  4BBY A;  4OAL A;  2VFS A;  1FFU C;  1W1J A;  4JAY A;  1RM6 B;  2QPM A;  1E8F A;  1HSK A;  2NQW A;  3JS8 A;  2P13 A;  4PZF A;  1WVE A;  5AE1 A;  1ZR6 A;  3S1E A;  5D79 A; 
#chains in the Genus database with same CATH topology
 3NRZ B;  3NVW B;  4PWB A;  3FW8 A;  1DII A;  3BW7 A;  2VFU A;  1MBT A;  3HSU A;  2BVH A;  2R8D A;  5FXE A;  4BC9 A;  4PVH A;  3S1D A;  4EC3 A;  3W8X A;  2W3S A;  3W8W A;  4MLA A;  3POP A;  2BVF A;  5FXF A;  4PYT A;  2P3H A;  2BVG A;  2OAI A;  2E3T A;  4XLO A;  5G5H B;  1DZN A;  1N60 C;  3ETR B;  3I99 A;  2VAO A;  5FXD A;  1JRP A;  1E8G A;  1SB3 B;  1QLT A;  4BC7 A;  2O3G A;  3PQB A;  3SR6 B;  3AM9 A;  3EUB 3;  3NVV B;  2R2Z A;  3VTE A;  1FIQ B;  1N5W C;  3S1C A;  4O95 A;  2GQU A;  1W1L A;  1QLU A;  5L6F A;  5HMR A;  3NVZ B;  3AN1 A;  2W3R A;  1F0X A;  2VFR A;  1JRO A;  3C0P A;  3B9J B;  1WVF A;  4ZOH B;  1FFV C;  1FO4 A;  4ML8 A;  1AHZ A;  2IPI A;  3LAE A;  3HRD C;  3FW9 A;  1WYG A;  5ADZ A;  4JB1 A;  1W1R A;  2Y08 A;  2MBR A;  1W1S A;  4UD8 A;  2PLS A;  1UXY A;  5I1W A;  1W1K A;  3D2D A;  3FW7 A;  1VDV A;  1W1Q A;  2Y3R A;  2UUV A;  1E8H A;  4PWC A;  3NS1 B;  2Y3S A;  3FWA A;  3S1F A;  5HHZ A;  3LLB A;  2Q85 A;  1VAO A;  3NVY B;  3PM9 A;  2WDW A;  4PVE A;  5AE3 A;  5AWV A;  3DED A;  3D2J A;  2W55 A;  1AHU A;  2AXR A;  5I1V A;  2QKN A;  5HQX A;  1N5X A;  1MBB A;  1W1O A;  1N61 C;  3TX1 A;  1V97 A;  2EXR A;  5L6G A;  1AHV A;  2Y4G A;  2VFV A;  3EJD B;  4PVJ A;  1N62 C;  2GQT A;  5AE2 A;  1DIQ A;  2W54 A;  3TSJ A;  2PLI A;  3GSY A;  1T3Q C;  2P4P A;  3KJM A;  4PVK A;  2Q4W A;  4HG0 A;  2RK5 A;  3DQ0 A;  5FXP A;  2I0K A;  1W1M A;  2YVS A;  1N63 C;  2UUU A;  5G5G B;  3TSH A;  5K8E A;  3W8Z A;  4BCA A;  1ZXI C;  3AMZ A;  1I19 A;  3D2H A;  4DNS A;  2VFT A;  1E0Y A;  3EJE B;  4BBY A;  4OAL A;  3RJ8 A;  2VFS A;  1FFU C;  1W1J A;  4JAY A;  3EJB B;  1RM6 B;  2QPM A;  3RJA A;  1E8F A;  1HSK A;  2NQW A;  3JS8 A;  2P13 A;  4PZF A;  1WVE A;  5AE1 A;  1ZR6 A;  3S1E A;  5D79 A; 
#chains in the Genus database with same CATH homology
 3NRZ B;  3NVW B;  4PWB A;  3FW8 A;  1DII A;  3BW7 A;  2VFU A;  1MBT A;  3HSU A;  2BVH A;  2R8D A;  5FXE A;  4BC9 A;  4PVH A;  3S1D A;  4EC3 A;  3W8X A;  2W3S A;  3W8W A;  4MLA A;  3POP A;  2BVF A;  5FXF A;  4PYT A;  2P3H A;  2BVG A;  2OAI A;  2E3T A;  4XLO A;  5G5H B;  1DZN A;  1N60 C;  3ETR B;  3I99 A;  2VAO A;  5FXD A;  1JRP A;  1E8G A;  1SB3 B;  1QLT A;  4BC7 A;  2O3G A;  3PQB A;  3SR6 B;  3AM9 A;  3EUB 3;  3NVV B;  2R2Z A;  3VTE A;  1FIQ B;  1N5W C;  3S1C A;  4O95 A;  2GQU A;  1W1L A;  1QLU A;  5L6F A;  5HMR A;  3NVZ B;  3AN1 A;  2W3R A;  1F0X A;  2VFR A;  1JRO A;  3C0P A;  3B9J B;  1WVF A;  4ZOH B;  1FFV C;  1FO4 A;  4ML8 A;  1AHZ A;  2IPI A;  3LAE A;  3HRD C;  3FW9 A;  1WYG A;  5ADZ A;  4JB1 A;  1W1R A;  2Y08 A;  2MBR A;  1W1S A;  4UD8 A;  2PLS A;  1UXY A;  5I1W A;  1W1K A;  3D2D A;  3FW7 A;  1VDV A;  1W1Q A;  2Y3R A;  2UUV A;  1E8H A;  4PWC A;  3NS1 B;  2Y3S A;  3FWA A;  3S1F A;  5HHZ A;  3LLB A;  2Q85 A;  1VAO A;  3NVY B;  3PM9 A;  2WDW A;  4PVE A;  5AE3 A;  5AWV A;  3DED A;  3D2J A;  2W55 A;  1AHU A;  2AXR A;  5I1V A;  2QKN A;  5HQX A;  1N5X A;  1MBB A;  1W1O A;  1N61 C;  3TX1 A;  1V97 A;  2EXR A;  5L6G A;  1AHV A;  2Y4G A;  2VFV A;  4PVJ A;  1N62 C;  2GQT A;  5AE2 A;  1DIQ A;  2W54 A;  3TSJ A;  2PLI A;  3GSY A;  1T3Q C;  2P4P A;  3KJM A;  4PVK A;  2Q4W A;  4HG0 A;  2RK5 A;  3DQ0 A;  5FXP A;  2I0K A;  1W1M A;  2YVS A;  1N63 C;  2UUU A;  5G5G B;  3TSH A;  5K8E A;  3W8Z A;  4BCA A;  1ZXI C;  3AMZ A;  1I19 A;  3D2H A;  4DNS A;  2VFT A;  1E0Y A;  4BBY A;  4OAL A;  3RJ8 A;  2VFS A;  1FFU C;  1W1J A;  4JAY A;  1RM6 B;  2QPM A;  3RJA A;  1E8F A;  1HSK A;  2NQW A;  3JS8 A;  2P13 A;  4PZF A;  1WVE A;  5AE1 A;  1ZR6 A;  3S1E A;  5D79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...