2OAIA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
79
Chain Sequence
EDALMVTREDGSFLIDGTLPIEELREVLGANNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
total genus 15
structure length 79
sequence length 87
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2oaiA00
4OALA 1F0XA 1JRPA 2VAOA 3NVYB 5G5HB 2E3TA 3ETRB 1W1LA 2VFRA 4PYTA 1N5XA 2OAIA 4BBYA 1W1SA 1WYGA 3AMZA 2VFVA 5FXDA 1FFVC 2P4PA 2BVHA 2W54A 1W1OA 2VFUA 3AM9A 1WVEA 3LLBA 2W55A 1W1QA 1FO4A 1N61C 3NVZB 2VFTA 1N60C 2RK5A 5G5GB 5AE1A 1WVFA 4HG0A 5FXEA 2AXRA 3LAEA 3S1CA 1DIIA 2Q85A 1W1KA 3NS1B 1V97A 1E0YA 1MBTA 1JROA 5FXFA 1N63C 4ZOHB 1E8HA 3NVWB 5HMRA 1DZNA 5FXPA 3NRZB 2W3SA 3I99A 1MBBA 3W8XA 2W3RA 1UXYA 3TX1A 1VAOA 2PLIA 2GQUA 3NVVB 2P3HA 2PLSA 2MBRA 1AHUA 2GQTA 2QPMA 1E8GA 3EUB3 2QKNA 3BW7A 4JAYA 5AE2A 1I19A 1QLTA 4XLOA 2VFSA 5HQXA 4BCAA 1FFUC 2BVGA 3W8WA 2Q4WA 3HRDC 3S1EA 3AN1A 1N62C 1VDVA 5AE3A 2P13A 4MLAA 4BC7A 1N5WC 3DQ0A 2R8DA 3SR6B 3KJMA 2NQWA 2I0KA 4ML8A 3JS8A 1QLUA 1SB3B 2R2ZA 5ADZA 1W1JA 1AHVA 3S1DA 4JB1A 2O3GA 3C0PA 1ZXIC 5HHZA 1T3QC 3DEDA 2EXRA 1DIQA 3S1FA 3PM9A 4O95A 1RM6B 1W1RA 2BVFA 1W1MA 4BC9A 1ZR6A 1E8FA 3B9JB 1HSKA 1AHZA 1FIQB 3W8ZA 2YVSA
chains in the Genus database with same CATH superfamily
4OALA 1F0XA 1JRPA 2VAOA 3GSYA 3NVYB 5G5HB 2E3TA 3ETRB 1W1LA 2VFRA 4PYTA 1N5XA 2OAIA 5K8EA 4BBYA 1W1SA 1WYGA 3AMZA 5L6FA 2VFVA 3D2JA 1FFVC 2P4PA 5FXDA 2BVHA 2W54A 1W1OA 2VFUA 3AM9A 1WVEA 3LLBA 2W55A 1W1QA 1FO4A 1N61C 3NVZB 2VFTA 1N60C 2RK5A 5G5GB 5AE1A 1WVFA 4HG0A 3D2HA 5FXEA 2AXRA 3LAEA 3S1CA 1DIIA 2Q85A 1W1KA 3NS1B 1V97A 1E0YA 1MBTA 1JROA 5FXFA 1N63C 4DNSA 4ZOHB 1E8HA 3NVWB 3RJ8A 5HMRA 1DZNA 5FXPA 3NRZB 2W3SA 3I99A 1MBBA 3W8XA 2WDWA 2Y3RA 2IPIA 2W3RA 1UXYA 3TX1A 2Y3SA 1VAOA 2PLIA 2GQUA 4UD8A 3NVVB 4PVKA 2P3HA 2PLSA 2MBRA 1AHUA 2GQTA 2QPMA 4PVJA 1E8GA 3EUB3 2QKNA 3FW8A 3BW7A 4JAYA 5AE2A 5I1WA 1I19A 1QLTA 3FW9A 3HSUA 4PWCA 4XLOA 5D79A 3TSJA 2VFSA 5HQXA 3TSHA 4BCAA 1FFUC 2BVGA 3W8WA 2Q4WA 3HRDC 3S1EA 3AN1A 1N62C 1VDVA 2Y4GA 5AE3A 5L6GA 3FWAA 2Y08A 2P13A 4MLAA 4BC7A 1N5WC 3DQ0A 2R8DA 4PWBA 3SR6B 3KJMA 4PZFA 2NQWA 2I0KA 4ML8A 3JS8A 1QLUA 1SB3B 3VTEA 2UUUA 3POPA 2R2ZA 5ADZA 1W1JA 1AHVA 3S1DA 4JB1A 3RJAA 2O3GA 3C0PA 1ZXIC 5HHZA 5I1VA 1T3QC 2UUVA 3DEDA 2EXRA 4PVEA 1DIQA 3S1FA 3D2DA 3PQBA 3PM9A 4O95A 1RM6B 1W1RA 2BVFA 1W1MA 5AWVA 3FW7A 4EC3A 4BC9A 1ZR6A 1E8FA 3B9JB 4PVHA 1HSKA 1AHZA 1FIQB 3W8ZA 2YVSA
chains in the Genus database with same CATH topology
4OALA 1F0XA 1JRPA 2VAOA 3GSYA 3NVYB 5G5HB 2E3TA 3ETRB 1W1LA 2VFRA 4PYTA 1N5XA 2OAIA 5K8EA 4BBYA 1W1SA 1WYGA 3AMZA 5L6FA 2VFVA 3D2JA 1FFVC 2P4PA 5FXDA 2BVHA 2W54A 1W1OA 2VFUA 3AM9A 1WVEA 3LLBA 2W55A 1W1QA 1FO4A 1N61C 3NVZB 2VFTA 1N60C 2RK5A 5G5GB 5AE1A 1WVFA 4HG0A 3D2HA 5FXEA 2AXRA 3LAEA 3S1CA 1DIIA 2Q85A 1W1KA 3NS1B 1V97A 1E0YA 1MBTA 1JROA 5FXFA 1N63C 4DNSA 4ZOHB 1E8HA 3NVWB 3RJ8A 5HMRA 1DZNA 5FXPA 3NRZB 2W3SA 3I99A 1MBBA 3W8XA 2WDWA 2Y3RA 2IPIA 2W3RA 1UXYA 3TX1A 2Y3SA 1VAOA 2PLIA 2GQUA 4UD8A 3NVVB 4PVKA 2P3HA 2PLSA 2MBRA 1AHUA 2GQTA 2QPMA 4PVJA 1E8GA 3EUB3 2QKNA 3FW8A 3BW7A 4JAYA 5AE2A 5I1WA 1I19A 1QLTA 3FW9A 3HSUA 4PWCA 4XLOA 5D79A 3TSJA 2VFSA 5HQXA 3TSHA 4BCAA 1FFUC 2BVGA 3W8WA 2Q4WA 3HRDC 3S1EA 3AN1A 1N62C 1VDVA 2Y4GA 5AE3A 5L6GA 3FWAA 2Y08A 2P13A 4MLAA 4BC7A 1N5WC 3DQ0A 2R8DA 4PWBA 3SR6B 3KJMA 4PZFA 2NQWA 2I0KA 4ML8A 3JS8A 1QLUA 1SB3B 3VTEA 2UUUA 3POPA 2R2ZA 5ADZA 1W1JA 1AHVA 3S1DA 4JB1A 3RJAA 2O3GA 3C0PA 1ZXIC 5HHZA 5I1VA 1T3QC 2UUVA 3DEDA 2EXRA 4PVEA 1DIQA 3S1FA 3D2DA 3PQBA 3PM9A 4O95A 1RM6B 1W1RA 2BVFA 1W1MA 5AWVA 3FW7A 4EC3A 4BC9A 1ZR6A 1E8FA 3B9JB 4PVHA 1HSKA 1AHZA 1FIQB 3W8ZA 2YVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAL A;  1F0X A;  1JRP A;  2VAO A;  3NVY B;  5G5H B;  2E3T A;  3ETR B;  1W1L A;  2VFR A;  4PYT A;  1N5X A;  2OAI A;  4BBY A;  1W1S A;  1WYG A;  3AMZ A;  2VFV A;  5FXD A;  1FFV C;  2P4P A;  2BVH A;  2W54 A;  1W1O A;  2VFU A;  3AM9 A;  1WVE A;  3LLB A;  2W55 A;  1W1Q A;  1FO4 A;  1N61 C;  3NVZ B;  2VFT A;  1N60 C;  2RK5 A;  5G5G B;  5AE1 A;  1WVF A;  4HG0 A;  5FXE A;  2AXR A;  3LAE A;  3S1C A;  1DII A;  2Q85 A;  1W1K A;  3NS1 B;  1V97 A;  1E0Y A;  1MBT A;  1JRO A;  5FXF A;  1N63 C;  4ZOH B;  1E8H A;  3NVW B;  5HMR A;  1DZN A;  5FXP A;  3NRZ B;  2W3S A;  3I99 A;  1MBB A;  3W8X A;  2W3R A;  1UXY A;  3TX1 A;  1VAO A;  2PLI A;  2GQU A;  3NVV B;  2P3H A;  2PLS A;  2MBR A;  1AHU A;  2GQT A;  2QPM A;  1E8G A;  3EUB 3;  2QKN A;  3BW7 A;  4JAY A;  5AE2 A;  1I19 A;  1QLT A;  4XLO A;  2VFS A;  5HQX A;  4BCA A;  1FFU C;  2BVG A;  3W8W A;  2Q4W A;  3HRD C;  3S1E A;  3AN1 A;  1N62 C;  1VDV A;  5AE3 A;  2P13 A;  4MLA A;  4BC7 A;  1N5W C;  3DQ0 A;  2R8D A;  3SR6 B;  3KJM A;  2NQW A;  2I0K A;  4ML8 A;  3JS8 A;  1QLU A;  1SB3 B;  2R2Z A;  5ADZ A;  1W1J A;  1AHV A;  3S1D A;  4JB1 A;  2O3G A;  3C0P A;  1ZXI C;  5HHZ A;  1T3Q C;  3DED A;  2EXR A;  1DIQ A;  3S1F A;  3PM9 A;  4O95 A;  1RM6 B;  1W1R A;  2BVF A;  1W1M A;  4BC9 A;  1ZR6 A;  1E8F A;  3B9J B;  1HSK A;  1AHZ A;  1FIQ B;  3W8Z A;  2YVS A; 
#chains in the Genus database with same CATH topology
 4OAL A;  1F0X A;  1JRP A;  2VAO A;  3GSY A;  3NVY B;  5G5H B;  2E3T A;  3ETR B;  1W1L A;  2VFR A;  4PYT A;  1N5X A;  2OAI A;  5K8E A;  4BBY A;  1W1S A;  1WYG A;  3AMZ A;  5L6F A;  2VFV A;  3D2J A;  1FFV C;  2P4P A;  5FXD A;  2BVH A;  2W54 A;  1W1O A;  2VFU A;  3AM9 A;  1WVE A;  3LLB A;  2W55 A;  1W1Q A;  1FO4 A;  1N61 C;  3NVZ B;  2VFT A;  1N60 C;  2RK5 A;  5G5G B;  5AE1 A;  1WVF A;  4HG0 A;  3D2H A;  5FXE A;  2AXR A;  3LAE A;  3S1C A;  1DII A;  2Q85 A;  1W1K A;  3NS1 B;  1V97 A;  1E0Y A;  1MBT A;  1JRO A;  5FXF A;  1N63 C;  4DNS A;  4ZOH B;  1E8H A;  3NVW B;  3RJ8 A;  5HMR A;  1DZN A;  5FXP A;  3NRZ B;  2W3S A;  3I99 A;  1MBB A;  3W8X A;  2WDW A;  2Y3R A;  2IPI A;  2W3R A;  1UXY A;  3TX1 A;  2Y3S A;  1VAO A;  2PLI A;  2GQU A;  4UD8 A;  3NVV B;  4PVK A;  2P3H A;  2PLS A;  2MBR A;  1AHU A;  2GQT A;  2QPM A;  4PVJ A;  1E8G A;  3EUB 3;  2QKN A;  3FW8 A;  3BW7 A;  4JAY A;  5AE2 A;  5I1W A;  1I19 A;  1QLT A;  3FW9 A;  3HSU A;  4PWC A;  4XLO A;  5D79 A;  3TSJ A;  2VFS A;  5HQX A;  3TSH A;  4BCA A;  1FFU C;  2BVG A;  3W8W A;  2Q4W A;  3HRD C;  3S1E A;  3AN1 A;  1N62 C;  1VDV A;  2Y4G A;  5AE3 A;  5L6G A;  3FWA A;  2Y08 A;  2P13 A;  4MLA A;  4BC7 A;  1N5W C;  3DQ0 A;  2R8D A;  4PWB A;  3SR6 B;  3KJM A;  4PZF A;  2NQW A;  2I0K A;  4ML8 A;  3JS8 A;  1QLU A;  1SB3 B;  3VTE A;  2UUU A;  3POP A;  2R2Z A;  5ADZ A;  1W1J A;  1AHV A;  3S1D A;  4JB1 A;  3RJA A;  2O3G A;  3C0P A;  1ZXI C;  5HHZ A;  5I1V A;  1T3Q C;  2UUV A;  3DED A;  2EXR A;  4PVE A;  1DIQ A;  3S1F A;  3D2D A;  3PQB A;  3PM9 A;  4O95 A;  1RM6 B;  1W1R A;  2BVF A;  1W1M A;  5AWV A;  3FW7 A;  4EC3 A;  4BC9 A;  1ZR6 A;  1E8F A;  3B9J B;  4PVH A;  1HSK A;  1AHZ A;  1FIQ B;  3W8Z A;  2YVS A; 
#chains in the Genus database with same CATH homology
 4OAL A;  1F0X A;  1JRP A;  2VAO A;  3GSY A;  3NVY B;  5G5H B;  2E3T A;  3ETR B;  1W1L A;  2VFR A;  4PYT A;  1N5X A;  2OAI A;  5K8E A;  4BBY A;  1W1S A;  1WYG A;  3AMZ A;  5L6F A;  2VFV A;  3D2J A;  1FFV C;  2P4P A;  5FXD A;  2BVH A;  2W54 A;  1W1O A;  2VFU A;  3AM9 A;  1WVE A;  3LLB A;  2W55 A;  1W1Q A;  1FO4 A;  1N61 C;  3NVZ B;  2VFT A;  1N60 C;  2RK5 A;  5G5G B;  5AE1 A;  1WVF A;  4HG0 A;  3D2H A;  5FXE A;  2AXR A;  3LAE A;  3S1C A;  1DII A;  2Q85 A;  1W1K A;  3NS1 B;  1V97 A;  1E0Y A;  1MBT A;  1JRO A;  5FXF A;  1N63 C;  4DNS A;  4ZOH B;  1E8H A;  3NVW B;  3RJ8 A;  5HMR A;  1DZN A;  5FXP A;  3NRZ B;  2W3S A;  3I99 A;  1MBB A;  3W8X A;  2WDW A;  2Y3R A;  2IPI A;  2W3R A;  1UXY A;  3TX1 A;  2Y3S A;  1VAO A;  2PLI A;  2GQU A;  4UD8 A;  3NVV B;  4PVK A;  2P3H A;  2PLS A;  2MBR A;  1AHU A;  2GQT A;  2QPM A;  4PVJ A;  1E8G A;  3EUB 3;  2QKN A;  3FW8 A;  3BW7 A;  4JAY A;  5AE2 A;  5I1W A;  1I19 A;  1QLT A;  3FW9 A;  3HSU A;  4PWC A;  4XLO A;  5D79 A;  3TSJ A;  2VFS A;  5HQX A;  3TSH A;  4BCA A;  1FFU C;  2BVG A;  3W8W A;  2Q4W A;  3HRD C;  3S1E A;  3AN1 A;  1N62 C;  1VDV A;  2Y4G A;  5AE3 A;  5L6G A;  3FWA A;  2Y08 A;  2P13 A;  4MLA A;  4BC7 A;  1N5W C;  3DQ0 A;  2R8D A;  4PWB A;  3SR6 B;  3KJM A;  4PZF A;  2NQW A;  2I0K A;  4ML8 A;  3JS8 A;  1QLU A;  1SB3 B;  3VTE A;  2UUU A;  3POP A;  2R2Z A;  5ADZ A;  1W1J A;  1AHV A;  3S1D A;  4JB1 A;  3RJA A;  2O3G A;  3C0P A;  1ZXI C;  5HHZ A;  5I1V A;  1T3Q C;  2UUV A;  3DED A;  2EXR A;  4PVE A;  1DIQ A;  3S1F A;  3D2D A;  3PQB A;  3PM9 A;  4O95 A;  1RM6 B;  1W1R A;  2BVF A;  1W1M A;  5AWV A;  3FW7 A;  4EC3 A;  4BC9 A;  1ZR6 A;  1E8F A;  3B9J B;  4PVH A;  1HSK A;  1AHZ A;  1FIQ B;  3W8Z A;  2YVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...