2OAIA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
79
Chain Sequence
EDALMVTREDGSFLIDGTLPIEELREVLGANNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Hemolysin
publication title The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
rcsb
source organism Xylella fastidiosa
total genus 15
structure length 79
sequence length 87
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2oaiA00
1HSKA 4MLAA 3W8WA 1FFUC 2O3GA 3JS8A 2OAIA 1UXYA 1AHZA 1WYGA 5ADZA 1W1OA 2I0KA 2VFUA 2W54A 1T3QC 5HHZA 1E8FA 1N62C 1JROA 3BW7A 2Q4WA 1I19A 1QLUA 2GQTA 1DIIA 2VFSA 5G5GB 2MBRA 3S1FA 2P3HA 2PLIA 4PYTA 4BC7A 1FO4A 2BVHA 4OALA 1N5XA 1QLTA 1DIQA 5FXPA 2QKNA 1W1MA 3LLBA 1W1LA 2VFVA 5G5HB 1SB3B 1VDVA 3NVZB 5FXFA 3PM9A 2NQWA 3NVVB 1FFVC 2RK5A 5FXDA 2P13A 3NVWB 3C0PA 3NRZB 2VFRA 1V97A 1AHVA 4XLOA 2VFTA 1JRPA 4JAYA 1MBBA 1W1JA 1W1KA 1N63C 2EXRA 2BVGA 2YVSA 1WVEA 3NS1B 3KJMA 2QPMA 3S1DA 4ML8A 3W8XA 2W55A 3W8ZA 3AM9A 1MBTA 2E3TA 3TX1A 2P4PA 5AE3A 4HG0A 5HMRA 2W3RA 1FIQB 2W3SA 1W1SA 4BC9A 1W1QA 3AMZA 1DZNA 3I99A 1N60C 1E8HA 1ZR6A 3DEDA 1F0XA 3S1EA 1RM6B 1ZXIC 2GQUA 4BBYA 3B9JB 1AHUA 3LAEA 2R8DA 1E0YA 1WVFA 3AN1A 4BCAA 3DQ0A 5HQXA 3S1CA 1N5WC 2R2ZA 3HRDC 3SR6B 4ZOHB 3ETRB 1E8GA 3NVYB 4JB1A 1W1RA 2AXRA 2VAOA 2PLSA 2BVFA 2Q85A 4O95A 5AE1A 5FXEA 3EUB3 1N61C 1VAOA 5AE2A
chains in the Genus database with same CATH superfamily
1HSKA 4MLAA 3W8WA 1FFUC 2O3GA 3JS8A 2OAIA 1UXYA 1AHZA 1WYGA 4PVEA 5ADZA 3GSYA 1W1OA 2I0KA 2VFUA 2W54A 1T3QC 5HHZA 1E8FA 1N62C 1JROA 3BW7A 4PWBA 2Q4WA 1I19A 1QLUA 3RJ8A 2GQTA 1DIIA 3TSJA 2VFSA 5G5GB 2MBRA 3S1FA 2P3HA 2PLIA 2Y3RA 3D2DA 3FWAA 4PYTA 4BC7A 1FO4A 2BVHA 4OALA 1N5XA 5AWVA 1QLTA 1DIQA 5FXPA 2QKNA 1W1MA 3LLBA 2UUVA 1W1LA 2IPIA 2VFVA 4PVHA 1SB3B 5G5HB 5K8EA 1VDVA 3NVZB 5FXFA 3PM9A 2NQWA 3NVVB 1FFVC 2RK5A 5FXDA 2P13A 3NVWB 3C0PA 3NRZB 2VFRA 1V97A 1AHVA 4PWCA 4PZFA 4XLOA 2VFTA 1JRPA 4JAYA 1MBBA 1W1JA 4EC3A 1W1KA 1N63C 2EXRA 2BVGA 3TSHA 2YVSA 1WVEA 3NS1B 3KJMA 2QPMA 3FW8A 3S1DA 5L6GA 4ML8A 3W8XA 2W55A 3HSUA 3W8ZA 3AM9A 1MBTA 2E3TA 3TX1A 5I1WA 2P4PA 5AE3A 4HG0A 5HMRA 2W3RA 1FIQB 2W3SA 1W1SA 4BC9A 1W1QA 3RJAA 3AMZA 1DZNA 3I99A 2UUUA 4PVKA 1N60C 1E8HA 1ZR6A 3DEDA 1F0XA 3POPA 3S1EA 1RM6B 4DNSA 1ZXIC 5D79A 2GQUA 5I1VA 2Y08A 4BBYA 3B9JB 1AHUA 3LAEA 2R8DA 1E0YA 5L6FA 1WVFA 3AN1A 4PVJA 4BCAA 3VTEA 3DQ0A 2WDWA 3FW7A 5HQXA 4UD8A 3S1CA 1N5WC 2Y3SA 2R2ZA 3HRDC 3FW9A 3SR6B 4ZOHB 3ETRB 1E8GA 3NVYB 3PQBA 4JB1A 1W1RA 2AXRA 2VAOA 3D2HA 2PLSA 2Y4GA 2BVFA 2Q85A 4O95A 5AE1A 5FXEA 3D2JA 3EUB3 1N61C 1VAOA 5AE2A
chains in the Genus database with same CATH topology
1HSKA 4MLAA 3W8WA 1FFUC 2O3GA 3JS8A 2OAIA 1UXYA 1AHZA 1WYGA 4PVEA 5ADZA 3GSYA 1W1OA 2I0KA 2VFUA 2W54A 1T3QC 5HHZA 1E8FA 1N62C 1JROA 3BW7A 4PWBA 2Q4WA 1I19A 1QLUA 3RJ8A 2GQTA 1DIIA 3TSJA 2VFSA 5G5GB 2MBRA 3S1FA 2P3HA 2PLIA 2Y3RA 3D2DA 3FWAA 4PYTA 4BC7A 1FO4A 2BVHA 4OALA 1N5XA 5AWVA 1QLTA 1DIQA 5FXPA 2QKNA 1W1MA 3LLBA 2UUVA 1W1LA 2IPIA 2VFVA 4PVHA 1SB3B 5G5HB 5K8EA 1VDVA 3NVZB 5FXFA 3PM9A 2NQWA 3NVVB 1FFVC 2RK5A 5FXDA 2P13A 3NVWB 3C0PA 3NRZB 2VFRA 1V97A 1AHVA 4PWCA 4PZFA 4XLOA 2VFTA 1JRPA 4JAYA 1MBBA 1W1JA 4EC3A 1W1KA 1N63C 2EXRA 2BVGA 3TSHA 2YVSA 1WVEA 3NS1B 3KJMA 2QPMA 3FW8A 3S1DA 5L6GA 4ML8A 3W8XA 2W55A 3HSUA 3W8ZA 3AM9A 1MBTA 2E3TA 3TX1A 5I1WA 2P4PA 5AE3A 4HG0A 5HMRA 2W3RA 1FIQB 2W3SA 1W1SA 4BC9A 1W1QA 3RJAA 3AMZA 1DZNA 3I99A 2UUUA 4PVKA 1N60C 1E8HA 1ZR6A 3DEDA 1F0XA 3POPA 3S1EA 1RM6B 4DNSA 1ZXIC 5D79A 2GQUA 5I1VA 2Y08A 4BBYA 3B9JB 1AHUA 3LAEA 2R8DA 1E0YA 5L6FA 1WVFA 3AN1A 4PVJA 4BCAA 3VTEA 3DQ0A 2WDWA 3FW7A 5HQXA 4UD8A 3S1CA 1N5WC 2Y3SA 2R2ZA 3HRDC 3FW9A 3SR6B 4ZOHB 3ETRB 1E8GA 3NVYB 3PQBA 4JB1A 1W1RA 2AXRA 2VAOA 3D2HA 2PLSA 2Y4GA 2BVFA 2Q85A 4O95A 5AE1A 5FXEA 3D2JA 3EUB3 1N61C 1VAOA 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HSK A;  4MLA A;  3W8W A;  1FFU C;  2O3G A;  3JS8 A;  2OAI A;  1UXY A;  1AHZ A;  1WYG A;  5ADZ A;  1W1O A;  2I0K A;  2VFU A;  2W54 A;  1T3Q C;  5HHZ A;  1E8F A;  1N62 C;  1JRO A;  3BW7 A;  2Q4W A;  1I19 A;  1QLU A;  2GQT A;  1DII A;  2VFS A;  5G5G B;  2MBR A;  3S1F A;  2P3H A;  2PLI A;  4PYT A;  4BC7 A;  1FO4 A;  2BVH A;  4OAL A;  1N5X A;  1QLT A;  1DIQ A;  5FXP A;  2QKN A;  1W1M A;  3LLB A;  1W1L A;  2VFV A;  5G5H B;  1SB3 B;  1VDV A;  3NVZ B;  5FXF A;  3PM9 A;  2NQW A;  3NVV B;  1FFV C;  2RK5 A;  5FXD A;  2P13 A;  3NVW B;  3C0P A;  3NRZ B;  2VFR A;  1V97 A;  1AHV A;  4XLO A;  2VFT A;  1JRP A;  4JAY A;  1MBB A;  1W1J A;  1W1K A;  1N63 C;  2EXR A;  2BVG A;  2YVS A;  1WVE A;  3NS1 B;  3KJM A;  2QPM A;  3S1D A;  4ML8 A;  3W8X A;  2W55 A;  3W8Z A;  3AM9 A;  1MBT A;  2E3T A;  3TX1 A;  2P4P A;  5AE3 A;  4HG0 A;  5HMR A;  2W3R A;  1FIQ B;  2W3S A;  1W1S A;  4BC9 A;  1W1Q A;  3AMZ A;  1DZN A;  3I99 A;  1N60 C;  1E8H A;  1ZR6 A;  3DED A;  1F0X A;  3S1E A;  1RM6 B;  1ZXI C;  2GQU A;  4BBY A;  3B9J B;  1AHU A;  3LAE A;  2R8D A;  1E0Y A;  1WVF A;  3AN1 A;  4BCA A;  3DQ0 A;  5HQX A;  3S1C A;  1N5W C;  2R2Z A;  3HRD C;  3SR6 B;  4ZOH B;  3ETR B;  1E8G A;  3NVY B;  4JB1 A;  1W1R A;  2AXR A;  2VAO A;  2PLS A;  2BVF A;  2Q85 A;  4O95 A;  5AE1 A;  5FXE A;  3EUB 3;  1N61 C;  1VAO A;  5AE2 A; 
#chains in the Genus database with same CATH topology
 1HSK A;  4MLA A;  3W8W A;  1FFU C;  2O3G A;  3JS8 A;  2OAI A;  1UXY A;  1AHZ A;  1WYG A;  4PVE A;  5ADZ A;  3GSY A;  1W1O A;  2I0K A;  2VFU A;  2W54 A;  1T3Q C;  5HHZ A;  1E8F A;  1N62 C;  1JRO A;  3BW7 A;  4PWB A;  2Q4W A;  1I19 A;  1QLU A;  3RJ8 A;  2GQT A;  1DII A;  3TSJ A;  2VFS A;  5G5G B;  2MBR A;  3S1F A;  2P3H A;  2PLI A;  2Y3R A;  3D2D A;  3FWA A;  4PYT A;  4BC7 A;  1FO4 A;  2BVH A;  4OAL A;  1N5X A;  5AWV A;  1QLT A;  1DIQ A;  5FXP A;  2QKN A;  1W1M A;  3LLB A;  2UUV A;  1W1L A;  2IPI A;  2VFV A;  4PVH A;  1SB3 B;  5G5H B;  5K8E A;  1VDV A;  3NVZ B;  5FXF A;  3PM9 A;  2NQW A;  3NVV B;  1FFV C;  2RK5 A;  5FXD A;  2P13 A;  3NVW B;  3C0P A;  3NRZ B;  2VFR A;  1V97 A;  1AHV A;  4PWC A;  4PZF A;  4XLO A;  2VFT A;  1JRP A;  4JAY A;  1MBB A;  1W1J A;  4EC3 A;  1W1K A;  1N63 C;  2EXR A;  2BVG A;  3TSH A;  2YVS A;  1WVE A;  3NS1 B;  3KJM A;  2QPM A;  3FW8 A;  3S1D A;  5L6G A;  4ML8 A;  3W8X A;  2W55 A;  3HSU A;  3W8Z A;  3AM9 A;  1MBT A;  2E3T A;  3TX1 A;  5I1W A;  2P4P A;  5AE3 A;  4HG0 A;  5HMR A;  2W3R A;  1FIQ B;  2W3S A;  1W1S A;  4BC9 A;  1W1Q A;  3RJA A;  3AMZ A;  1DZN A;  3I99 A;  2UUU A;  4PVK A;  1N60 C;  1E8H A;  1ZR6 A;  3DED A;  1F0X A;  3POP A;  3S1E A;  1RM6 B;  4DNS A;  1ZXI C;  5D79 A;  2GQU A;  5I1V A;  2Y08 A;  4BBY A;  3B9J B;  1AHU A;  3LAE A;  2R8D A;  1E0Y A;  5L6F A;  1WVF A;  3AN1 A;  4PVJ A;  4BCA A;  3VTE A;  3DQ0 A;  2WDW A;  3FW7 A;  5HQX A;  4UD8 A;  3S1C A;  1N5W C;  2Y3S A;  2R2Z A;  3HRD C;  3FW9 A;  3SR6 B;  4ZOH B;  3ETR B;  1E8G A;  3NVY B;  3PQB A;  4JB1 A;  1W1R A;  2AXR A;  2VAO A;  3D2H A;  2PLS A;  2Y4G A;  2BVF A;  2Q85 A;  4O95 A;  5AE1 A;  5FXE A;  3D2J A;  3EUB 3;  1N61 C;  1VAO A;  5AE2 A; 
#chains in the Genus database with same CATH homology
 1HSK A;  4MLA A;  3W8W A;  1FFU C;  2O3G A;  3JS8 A;  2OAI A;  1UXY A;  1AHZ A;  1WYG A;  4PVE A;  5ADZ A;  3GSY A;  1W1O A;  2I0K A;  2VFU A;  2W54 A;  1T3Q C;  5HHZ A;  1E8F A;  1N62 C;  1JRO A;  3BW7 A;  4PWB A;  2Q4W A;  1I19 A;  1QLU A;  3RJ8 A;  2GQT A;  1DII A;  3TSJ A;  2VFS A;  5G5G B;  2MBR A;  3S1F A;  2P3H A;  2PLI A;  2Y3R A;  3D2D A;  3FWA A;  4PYT A;  4BC7 A;  1FO4 A;  2BVH A;  4OAL A;  1N5X A;  5AWV A;  1QLT A;  1DIQ A;  5FXP A;  2QKN A;  1W1M A;  3LLB A;  2UUV A;  1W1L A;  2IPI A;  2VFV A;  4PVH A;  1SB3 B;  5G5H B;  5K8E A;  1VDV A;  3NVZ B;  5FXF A;  3PM9 A;  2NQW A;  3NVV B;  1FFV C;  2RK5 A;  5FXD A;  2P13 A;  3NVW B;  3C0P A;  3NRZ B;  2VFR A;  1V97 A;  1AHV A;  4PWC A;  4PZF A;  4XLO A;  2VFT A;  1JRP A;  4JAY A;  1MBB A;  1W1J A;  4EC3 A;  1W1K A;  1N63 C;  2EXR A;  2BVG A;  3TSH A;  2YVS A;  1WVE A;  3NS1 B;  3KJM A;  2QPM A;  3FW8 A;  3S1D A;  5L6G A;  4ML8 A;  3W8X A;  2W55 A;  3HSU A;  3W8Z A;  3AM9 A;  1MBT A;  2E3T A;  3TX1 A;  5I1W A;  2P4P A;  5AE3 A;  4HG0 A;  5HMR A;  2W3R A;  1FIQ B;  2W3S A;  1W1S A;  4BC9 A;  1W1Q A;  3RJA A;  3AMZ A;  1DZN A;  3I99 A;  2UUU A;  4PVK A;  1N60 C;  1E8H A;  1ZR6 A;  3DED A;  1F0X A;  3POP A;  3S1E A;  1RM6 B;  4DNS A;  1ZXI C;  5D79 A;  2GQU A;  5I1V A;  2Y08 A;  4BBY A;  3B9J B;  1AHU A;  3LAE A;  2R8D A;  1E0Y A;  5L6F A;  1WVF A;  3AN1 A;  4PVJ A;  4BCA A;  3VTE A;  3DQ0 A;  2WDW A;  3FW7 A;  5HQX A;  4UD8 A;  3S1C A;  1N5W C;  2Y3S A;  2R2Z A;  3HRD C;  3FW9 A;  3SR6 B;  4ZOH B;  3ETR B;  1E8G A;  3NVY B;  3PQB A;  4JB1 A;  1W1R A;  2AXR A;  2VAO A;  3D2H A;  2PLS A;  2Y4G A;  2BVF A;  2Q85 A;  4O95 A;  5AE1 A;  5FXE A;  3D2J A;  3EUB 3;  1N61 C;  1VAO A;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...