2OAIA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
79
Chain Sequence
EDALMVTREDGSFLIDGTLPIEELREVLGANNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title The structure of transporter associated domain CorC_HlyC from a Xylella fastidiosa Temecula1 hemolysin.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
total genus 15
structure length 79
sequence length 87
ec nomenclature
pdb deposition date 2006-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2oaiA00
3NVYB 3HRDC 1FFVC 2W54A 4BCAA 1FO4A 1E8GA 5AE2A 2E3TA 5FXEA 4BC9A 5HQXA 2VFVA 1ZR6A 2BVGA 3AN1A 1E8HA 3EUB3 2GQTA 1FFUC 2W3SA 3BW7A 2R2ZA 1N5XA 3B9JB 2EXRA 1AHZA 1ZXIC 2W3RA 3NVWB 5HMRA 3DEDA 4ML8A 3S1DA 2RK5A 1N60C 2P3HA 2BVHA 1MBTA 1MBBA 1JROA 3JS8A 2I0KA 3NVVB 1WYGA 3I99A 1W1QA 1DIQA 5ADZA 1QLUA 3DQ0A 4ZOHB 4HG0A 1WVEA 3KJMA 2VFSA 2R8DA 2BVFA 1N61C 1W1RA 5AE3A 5HHZA 1QLTA 1W1KA 4OALA 4XLOA 3ETRB 3W8ZA 3S1EA 2NQWA 1RM6B 2VFTA 2O3GA 1SB3B 1AHUA 3C0PA 3NVZB 1T3QC 1WVFA 2PLIA 2QKNA 2AXRA 1V97A 2VFUA 5AE1A 3W8WA 2GQUA 2YVSA 4JAYA 1DIIA 2VFRA 1W1SA 2W55A 4BC7A 3SR6B 1AHVA 3S1FA 2Q85A 3NS1B 1E0YA 4BBYA 2QPMA 1HSKA 2P13A 3AM9A 3NRZB 1N62C 1VAOA 1W1JA 3LLBA 4O95A 5FXDA 3TX1A 1I19A 5G5GB 3LAEA 2Q4WA 1W1MA 4JB1A 1VDVA 3W8XA 1W1OA 1W1LA 1FIQB 3AMZA 4PYTA 5G5HB 1F0XA 2OAIA 4MLAA 2VAOA 1UXYA 3S1CA 2MBRA 2P4PA 1N5WC 5FXPA 1N63C 2PLSA 5FXFA 1E8FA 1JRPA 1DZNA 3PM9A
chains in the Genus database with same CATH superfamily
3NVYB 3HRDC 1FFVC 2W54A 4PVEA 4BCAA 1FO4A 1E8GA 5AE2A 2E3TA 5FXEA 4BC9A 5HQXA 2VFVA 1ZR6A 2BVGA 3AN1A 1E8HA 3EUB3 2GQTA 1FFUC 2W3SA 4PWCA 3BW7A 3PQBA 2R2ZA 1N5XA 2Y4GA 3B9JB 2EXRA 1AHZA 1ZXIC 2W3RA 2WDWA 3NVWB 3DEDA 4ML8A 3S1DA 2RK5A 5HMRA 2IPIA 1N60C 2P3HA 2BVHA 5L6FA 3FW8A 1MBTA 1MBBA 1JROA 3JS8A 2I0KA 3NVVB 1WYGA 3I99A 1W1QA 5D79A 1DIQA 4PVJA 4DNSA 5ADZA 1QLUA 3FWAA 3DQ0A 4ZOHB 4HG0A 4PVKA 1WVEA 3FW7A 3KJMA 2VFSA 2R8DA 2BVFA 3TSHA 1N61C 1W1RA 5AE3A 5HHZA 1QLTA 2UUUA 1W1KA 4OALA 4XLOA 3ETRB 3RJ8A 3W8ZA 3S1EA 4PWBA 2NQWA 3D2JA 1RM6B 2VFTA 4EC3A 2O3GA 1SB3B 1AHUA 3C0PA 2Y08A 3NVZB 3RJAA 1T3QC 1WVFA 2PLIA 2QKNA 2AXRA 1V97A 3D2HA 2VFUA 5AE1A 3W8WA 5I1VA 2GQUA 2YVSA 4JAYA 1DIIA 2VFRA 1W1SA 2W55A 4PZFA 4BC7A 5K8EA 3SR6B 1AHVA 2UUVA 3S1FA 2Q85A 3NS1B 5L6GA 1E0YA 3D2DA 3FW9A 4BBYA 2QPMA 5I1WA 2Y3SA 1HSKA 2P13A 3AM9A 3NRZB 1N62C 2Y3RA 1VAOA 1W1JA 3LLBA 3VTEA 4O95A 5FXDA 3TX1A 1I19A 3GSYA 3LAEA 5G5GB 2Q4WA 1W1MA 4JB1A 1VDVA 4PVHA 3TSJA 3W8XA 1W1OA 1W1LA 5AWVA 1FIQB 3HSUA 3AMZA 3POPA 4PYTA 4UD8A 5G5HB 1F0XA 2OAIA 4MLAA 2VAOA 1UXYA 3S1CA 2MBRA 2P4PA 1N5WC 5FXPA 1N63C 2PLSA 5FXFA 1E8FA 1JRPA 1DZNA 3PM9A
chains in the Genus database with same CATH topology
3NVYB 3HRDC 1FFVC 2W54A 4PVEA 4BCAA 1FO4A 1E8GA 5AE2A 2E3TA 5FXEA 4BC9A 5HQXA 2VFVA 1ZR6A 2BVGA 3AN1A 1E8HA 3EUB3 2GQTA 1FFUC 2W3SA 4PWCA 3BW7A 3PQBA 2R2ZA 1N5XA 2Y4GA 3B9JB 2EXRA 1AHZA 1ZXIC 2W3RA 2WDWA 3NVWB 3DEDA 4ML8A 3S1DA 2RK5A 5HMRA 2IPIA 1N60C 2P3HA 2BVHA 5L6FA 3FW8A 1MBTA 1MBBA 1JROA 3JS8A 2I0KA 3NVVB 1WYGA 3I99A 1W1QA 5D79A 1DIQA 4PVJA 4DNSA 5ADZA 1QLUA 3FWAA 3DQ0A 4ZOHB 4HG0A 4PVKA 1WVEA 3FW7A 3KJMA 2VFSA 2R8DA 2BVFA 3TSHA 1N61C 1W1RA 5AE3A 5HHZA 1QLTA 2UUUA 1W1KA 4OALA 4XLOA 3ETRB 3RJ8A 3W8ZA 3S1EA 4PWBA 2NQWA 3D2JA 1RM6B 2VFTA 4EC3A 2O3GA 1SB3B 1AHUA 3C0PA 2Y08A 3NVZB 3RJAA 1T3QC 1WVFA 2PLIA 2QKNA 2AXRA 1V97A 3D2HA 2VFUA 5AE1A 3W8WA 5I1VA 2GQUA 2YVSA 4JAYA 1DIIA 2VFRA 1W1SA 2W55A 4PZFA 4BC7A 5K8EA 3SR6B 1AHVA 2UUVA 3S1FA 2Q85A 3NS1B 5L6GA 1E0YA 3D2DA 3FW9A 4BBYA 2QPMA 5I1WA 2Y3SA 1HSKA 2P13A 3AM9A 3NRZB 1N62C 2Y3RA 1VAOA 1W1JA 3LLBA 3VTEA 4O95A 5FXDA 3TX1A 1I19A 3GSYA 3LAEA 5G5GB 2Q4WA 1W1MA 4JB1A 1VDVA 4PVHA 3TSJA 3W8XA 1W1OA 1W1LA 5AWVA 1FIQB 3HSUA 3AMZA 3POPA 4PYTA 4UD8A 5G5HB 1F0XA 2OAIA 4MLAA 2VAOA 1UXYA 3S1CA 2MBRA 2P4PA 1N5WC 5FXPA 1N63C 2PLSA 5FXFA 1E8FA 1JRPA 1DZNA 3PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVY B;  3HRD C;  1FFV C;  2W54 A;  4BCA A;  1FO4 A;  1E8G A;  5AE2 A;  2E3T A;  5FXE A;  4BC9 A;  5HQX A;  2VFV A;  1ZR6 A;  2BVG A;  3AN1 A;  1E8H A;  3EUB 3;  2GQT A;  1FFU C;  2W3S A;  3BW7 A;  2R2Z A;  1N5X A;  3B9J B;  2EXR A;  1AHZ A;  1ZXI C;  2W3R A;  3NVW B;  5HMR A;  3DED A;  4ML8 A;  3S1D A;  2RK5 A;  1N60 C;  2P3H A;  2BVH A;  1MBT A;  1MBB A;  1JRO A;  3JS8 A;  2I0K A;  3NVV B;  1WYG A;  3I99 A;  1W1Q A;  1DIQ A;  5ADZ A;  1QLU A;  3DQ0 A;  4ZOH B;  4HG0 A;  1WVE A;  3KJM A;  2VFS A;  2R8D A;  2BVF A;  1N61 C;  1W1R A;  5AE3 A;  5HHZ A;  1QLT A;  1W1K A;  4OAL A;  4XLO A;  3ETR B;  3W8Z A;  3S1E A;  2NQW A;  1RM6 B;  2VFT A;  2O3G A;  1SB3 B;  1AHU A;  3C0P A;  3NVZ B;  1T3Q C;  1WVF A;  2PLI A;  2QKN A;  2AXR A;  1V97 A;  2VFU A;  5AE1 A;  3W8W A;  2GQU A;  2YVS A;  4JAY A;  1DII A;  2VFR A;  1W1S A;  2W55 A;  4BC7 A;  3SR6 B;  1AHV A;  3S1F A;  2Q85 A;  3NS1 B;  1E0Y A;  4BBY A;  2QPM A;  1HSK A;  2P13 A;  3AM9 A;  3NRZ B;  1N62 C;  1VAO A;  1W1J A;  3LLB A;  4O95 A;  5FXD A;  3TX1 A;  1I19 A;  5G5G B;  3LAE A;  2Q4W A;  1W1M A;  4JB1 A;  1VDV A;  3W8X A;  1W1O A;  1W1L A;  1FIQ B;  3AMZ A;  4PYT A;  5G5H B;  1F0X A;  2OAI A;  4MLA A;  2VAO A;  1UXY A;  3S1C A;  2MBR A;  2P4P A;  1N5W C;  5FXP A;  1N63 C;  2PLS A;  5FXF A;  1E8F A;  1JRP A;  1DZN A;  3PM9 A; 
#chains in the Genus database with same CATH topology
 3NVY B;  3HRD C;  1FFV C;  2W54 A;  4PVE A;  4BCA A;  1FO4 A;  1E8G A;  5AE2 A;  2E3T A;  5FXE A;  4BC9 A;  5HQX A;  2VFV A;  1ZR6 A;  2BVG A;  3AN1 A;  1E8H A;  3EUB 3;  2GQT A;  1FFU C;  2W3S A;  4PWC A;  3BW7 A;  3PQB A;  2R2Z A;  1N5X A;  2Y4G A;  3B9J B;  2EXR A;  1AHZ A;  1ZXI C;  2W3R A;  2WDW A;  3NVW B;  3DED A;  4ML8 A;  3S1D A;  2RK5 A;  5HMR A;  2IPI A;  1N60 C;  2P3H A;  2BVH A;  5L6F A;  3FW8 A;  1MBT A;  1MBB A;  1JRO A;  3JS8 A;  2I0K A;  3NVV B;  1WYG A;  3I99 A;  1W1Q A;  5D79 A;  1DIQ A;  4PVJ A;  4DNS A;  5ADZ A;  1QLU A;  3FWA A;  3DQ0 A;  4ZOH B;  4HG0 A;  4PVK A;  1WVE A;  3FW7 A;  3KJM A;  2VFS A;  2R8D A;  2BVF A;  3TSH A;  1N61 C;  1W1R A;  5AE3 A;  5HHZ A;  1QLT A;  2UUU A;  1W1K A;  4OAL A;  4XLO A;  3ETR B;  3RJ8 A;  3W8Z A;  3S1E A;  4PWB A;  2NQW A;  3D2J A;  1RM6 B;  2VFT A;  4EC3 A;  2O3G A;  1SB3 B;  1AHU A;  3C0P A;  2Y08 A;  3NVZ B;  3RJA A;  1T3Q C;  1WVF A;  2PLI A;  2QKN A;  2AXR A;  1V97 A;  3D2H A;  2VFU A;  5AE1 A;  3W8W A;  5I1V A;  2GQU A;  2YVS A;  4JAY A;  1DII A;  2VFR A;  1W1S A;  2W55 A;  4PZF A;  4BC7 A;  5K8E A;  3SR6 B;  1AHV A;  2UUV A;  3S1F A;  2Q85 A;  3NS1 B;  5L6G A;  1E0Y A;  3D2D A;  3FW9 A;  4BBY A;  2QPM A;  5I1W A;  2Y3S A;  1HSK A;  2P13 A;  3AM9 A;  3NRZ B;  1N62 C;  2Y3R A;  1VAO A;  1W1J A;  3LLB A;  3VTE A;  4O95 A;  5FXD A;  3TX1 A;  1I19 A;  3GSY A;  3LAE A;  5G5G B;  2Q4W A;  1W1M A;  4JB1 A;  1VDV A;  4PVH A;  3TSJ A;  3W8X A;  1W1O A;  1W1L A;  5AWV A;  1FIQ B;  3HSU A;  3AMZ A;  3POP A;  4PYT A;  4UD8 A;  5G5H B;  1F0X A;  2OAI A;  4MLA A;  2VAO A;  1UXY A;  3S1C A;  2MBR A;  2P4P A;  1N5W C;  5FXP A;  1N63 C;  2PLS A;  5FXF A;  1E8F A;  1JRP A;  1DZN A;  3PM9 A; 
#chains in the Genus database with same CATH homology
 3NVY B;  3HRD C;  1FFV C;  2W54 A;  4PVE A;  4BCA A;  1FO4 A;  1E8G A;  5AE2 A;  2E3T A;  5FXE A;  4BC9 A;  5HQX A;  2VFV A;  1ZR6 A;  2BVG A;  3AN1 A;  1E8H A;  3EUB 3;  2GQT A;  1FFU C;  2W3S A;  4PWC A;  3BW7 A;  3PQB A;  2R2Z A;  1N5X A;  2Y4G A;  3B9J B;  2EXR A;  1AHZ A;  1ZXI C;  2W3R A;  2WDW A;  3NVW B;  3DED A;  4ML8 A;  3S1D A;  2RK5 A;  5HMR A;  2IPI A;  1N60 C;  2P3H A;  2BVH A;  5L6F A;  3FW8 A;  1MBT A;  1MBB A;  1JRO A;  3JS8 A;  2I0K A;  3NVV B;  1WYG A;  3I99 A;  1W1Q A;  5D79 A;  1DIQ A;  4PVJ A;  4DNS A;  5ADZ A;  1QLU A;  3FWA A;  3DQ0 A;  4ZOH B;  4HG0 A;  4PVK A;  1WVE A;  3FW7 A;  3KJM A;  2VFS A;  2R8D A;  2BVF A;  3TSH A;  1N61 C;  1W1R A;  5AE3 A;  5HHZ A;  1QLT A;  2UUU A;  1W1K A;  4OAL A;  4XLO A;  3ETR B;  3RJ8 A;  3W8Z A;  3S1E A;  4PWB A;  2NQW A;  3D2J A;  1RM6 B;  2VFT A;  4EC3 A;  2O3G A;  1SB3 B;  1AHU A;  3C0P A;  2Y08 A;  3NVZ B;  3RJA A;  1T3Q C;  1WVF A;  2PLI A;  2QKN A;  2AXR A;  1V97 A;  3D2H A;  2VFU A;  5AE1 A;  3W8W A;  5I1V A;  2GQU A;  2YVS A;  4JAY A;  1DII A;  2VFR A;  1W1S A;  2W55 A;  4PZF A;  4BC7 A;  5K8E A;  3SR6 B;  1AHV A;  2UUV A;  3S1F A;  2Q85 A;  3NS1 B;  5L6G A;  1E0Y A;  3D2D A;  3FW9 A;  4BBY A;  2QPM A;  5I1W A;  2Y3S A;  1HSK A;  2P13 A;  3AM9 A;  3NRZ B;  1N62 C;  2Y3R A;  1VAO A;  1W1J A;  3LLB A;  3VTE A;  4O95 A;  5FXD A;  3TX1 A;  1I19 A;  3GSY A;  3LAE A;  5G5G B;  2Q4W A;  1W1M A;  4JB1 A;  1VDV A;  4PVH A;  3TSJ A;  3W8X A;  1W1O A;  1W1L A;  5AWV A;  1FIQ B;  3HSU A;  3AMZ A;  3POP A;  4PYT A;  4UD8 A;  5G5H B;  1F0X A;  2OAI A;  4MLA A;  2VAO A;  1UXY A;  3S1C A;  2MBR A;  2P4P A;  1N5W C;  5FXP A;  1N63 C;  2PLS A;  5FXF A;  1E8F A;  1JRP A;  1DZN A;  3PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...