2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
b'IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
molecule tags Oxidoreductase
source organism Streptomyces sp. 307-9
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
3FW8A 2Y08A 4PVEA 5L6GA 4PVHA 3W8ZA 4DNSA 4EC3A 4UD8A 5D79A 4PVKA 3RJ8A 3HSUA 2UUVA 3FW9A 4PZFA 2AXRA 2UUUA 2IPIA 2Y4GA 5L6FA 4PWCA 3VTEA 3W8WA 2Y3RA 3D2JA 2BVFA 4XLOA 3FW7A 3W8XA 3FWAA 3POPA 2BVGA 5AWVA 2WDWA 3GSYA 5I1WA 3RJAA 4PWBA 3TSJA 3PQBA 3D2DA 3TSHA 5I1VA 2BVHA 2Y3SA 1ZR6A 5K8EA 3D2HA 4PVJA
chains in the Genus database with same CATH superfamily
2OAIA 2W55A 3FW8A 1N61C 3NS1B 1SB3B 4ML8A 5FXDA 4BC9A 1FFUC 2W3RA 3NRZB 3SR6B 4HG0A 3NVVB 4PWCA 3S1FA 2VAOA 2R2ZA 3D2JA 3S1CA 2BVFA 3W8XA 2P13A 2QPMA 1W1QA 5HHZA 5I1WA 5HMRA 1VAOA 1N62C 3TSHA 1JRPA 3NVZB 2Q85A 5FXPA 3D2HA 5K8EA 4PVJA 1FO4A 1DZNA 4PVHA 2E3TA 3KJMA 4DNSA 4EC3A 5L6GA 4UD8A 1V97A 5D79A 3TX1A 1W1RA 3RJ8A 1I19A 2NQWA 2O3GA 2W3SA 4PZFA 2W54A 4O95A 1W1JA 2AXRA 2UUUA 1E8HA 1W1OA 5G5GB 1T3QC 2VFSA 3AN1A 4BC7A 2GQUA 2Y3RA 2I0KA 3FW7A 1N63C 2BVGA 1E8GA 3GSYA 3HRDC 3B9JB 5ADZA 4PWBA 2VFRA 2PLSA 2PLIA 3D2DA 3I99A 2BVHA 4ZOHB 3LAEA 3AM9A 5AE2A 3NVWB 1QLTA 2Y08A 4PVEA 3W8ZA 5HQXA 1N5WC 5AE3A 3DEDA 2RK5A 2VFTA 3FW9A 3S1EA 4BCAA 1E0YA 1W1LA 2VFVA 5AE1A 2IPIA 1VDVA 3AMZA 2Y4GA 5L6FA 4BBYA 2EXRA 3C0PA 3LLBA 2QKNA 4OALA 3FWAA 1N60C 5AWVA 2P4PA 2WDWA 3DQ0A 3JS8A 3RJAA 1AHZA 3EUB3 3PQBA 2VFUA 2Y3SA 1FIQB 4PYTA 1UXYA 1WYGA 1ZR6A 1W1MA 3S1DA 4JB1A 5FXFA 5G5HB 1W1SA 3PM9A 1N5XA 4PVKA 3NVYB 1MBTA 3HSUA 2UUVA 4JAYA 1W1KA 2P3HA 1AHUA 1DIQA 3BW7A 1E8FA 1WVEA 3ETRB 3VTEA 1ZXIC 1AHVA 2YVSA 1QLUA 2Q4WA 1MBBA 4XLOA 1F0XA 1JROA 3POPA 4MLAA 1DIIA 2MBRA 2GQTA 5FXEA 3TSJA 2R8DA 1WVFA 5I1VA 1FFVC 1RM6B 1HSKA 3W8WA
chains in the Genus database with same CATH topology
2OAIA 2W55A 3FW8A 1N61C 3NS1B 1SB3B 4ML8A 5FXDA 4BC9A 1FFUC 2W3RA 3NRZB 3SR6B 4HG0A 3NVVB 4PWCA 3S1FA 2VAOA 2R2ZA 3D2JA 3S1CA 2BVFA 3W8XA 2P13A 2QPMA 1W1QA 5HHZA 5I1WA 5HMRA 1VAOA 1N62C 3TSHA 1JRPA 3NVZB 2Q85A 5FXPA 3D2HA 5K8EA 4PVJA 1FO4A 1DZNA 4PVHA 2E3TA 3KJMA 4DNSA 4EC3A 5L6GA 4UD8A 1V97A 5D79A 3TX1A 1W1RA 3RJ8A 1I19A 2NQWA 2O3GA 2W3SA 4PZFA 2W54A 4O95A 1W1JA 2AXRA 2UUUA 1E8HA 1W1OA 5G5GB 1T3QC 2VFSA 3AN1A 4BC7A 2GQUA 2Y3RA 2I0KA 3FW7A 1N63C 2BVGA 1E8GA 3GSYA 3HRDC 3B9JB 5ADZA 4PWBA 2VFRA 2PLSA 2PLIA 3D2DA 3I99A 2BVHA 4ZOHB 3LAEA 3AM9A 5AE2A 3NVWB 1QLTA 2Y08A 4PVEA 3W8ZA 5HQXA 1N5WC 5AE3A 3DEDA 2RK5A 2VFTA 3FW9A 3S1EA 4BCAA 1E0YA 1W1LA 2VFVA 5AE1A 2IPIA 1VDVA 3AMZA 2Y4GA 5L6FA 4BBYA 2EXRA 3C0PA 3LLBA 2QKNA 4OALA 3FWAA 1N60C 5AWVA 2P4PA 2WDWA 3DQ0A 3JS8A 3RJAA 1AHZA 3EUB3 3PQBA 2VFUA 2Y3SA 1FIQB 4PYTA 1UXYA 1WYGA 1ZR6A 1W1MA 3S1DA 4JB1A 5FXFA 5G5HB 1W1SA 3PM9A 1N5XA 4PVKA 3NVYB 1MBTA 3HSUA 2UUVA 4JAYA 1W1KA 2P3HA 1AHUA 1DIQA 3BW7A 1E8FA 1WVEA 3ETRB 3VTEA 1ZXIC 1AHVA 2YVSA 1QLUA 2Q4WA 1MBBA 4XLOA 1F0XA 1JROA 3POPA 4MLAA 1DIIA 2MBRA 2GQTA 5FXEA 3TSJA 2R8DA 1WVFA 5I1VA 1FFVC 1RM6B 1HSKA 3W8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW8 A;  2Y08 A;  4PVE A;  5L6G A;  4PVH A;  3W8Z A;  4DNS A;  4EC3 A;  4UD8 A;  5D79 A;  4PVK A;  3RJ8 A;  3HSU A;  2UUV A;  3FW9 A;  4PZF A;  2AXR A;  2UUU A;  2IPI A;  2Y4G A;  5L6F A;  4PWC A;  3VTE A;  3W8W A;  2Y3R A;  3D2J A;  2BVF A;  4XLO A;  3FW7 A;  3W8X A;  3FWA A;  3POP A;  2BVG A;  5AWV A;  2WDW A;  3GSY A;  5I1W A;  3RJA A;  4PWB A;  3TSJ A;  3PQB A;  3D2D A;  3TSH A;  5I1V A;  2BVH A;  2Y3S A;  1ZR6 A;  5K8E A;  3D2H A;  4PVJ A; 
#chains in the Genus database with same CATH topology
 2OAI A;  2W55 A;  3FW8 A;  1N61 C;  3NS1 B;  1SB3 B;  4ML8 A;  5FXD A;  4BC9 A;  1FFU C;  2W3R A;  3NRZ B;  3SR6 B;  4HG0 A;  3NVV B;  4PWC A;  3S1F A;  2VAO A;  2R2Z A;  3D2J A;  3S1C A;  2BVF A;  3W8X A;  2P13 A;  2QPM A;  1W1Q A;  5HHZ A;  5I1W A;  5HMR A;  1VAO A;  1N62 C;  3TSH A;  1JRP A;  3NVZ B;  2Q85 A;  5FXP A;  3D2H A;  5K8E A;  4PVJ A;  1FO4 A;  1DZN A;  4PVH A;  2E3T A;  3KJM A;  4DNS A;  4EC3 A;  5L6G A;  4UD8 A;  1V97 A;  5D79 A;  3TX1 A;  1W1R A;  3RJ8 A;  1I19 A;  2NQW A;  2O3G A;  2W3S A;  4PZF A;  2W54 A;  4O95 A;  1W1J A;  2AXR A;  2UUU A;  1E8H A;  1W1O A;  5G5G B;  1T3Q C;  2VFS A;  3AN1 A;  4BC7 A;  2GQU A;  2Y3R A;  2I0K A;  3FW7 A;  1N63 C;  2BVG A;  1E8G A;  3GSY A;  3HRD C;  3B9J B;  5ADZ A;  4PWB A;  2VFR A;  2PLS A;  2PLI A;  3D2D A;  3I99 A;  2BVH A;  4ZOH B;  3LAE A;  3AM9 A;  5AE2 A;  3NVW B;  1QLT A;  2Y08 A;  4PVE A;  3W8Z A;  5HQX A;  1N5W C;  5AE3 A;  3DED A;  2RK5 A;  2VFT A;  3FW9 A;  3S1E A;  4BCA A;  1E0Y A;  1W1L A;  2VFV A;  5AE1 A;  2IPI A;  1VDV A;  3AMZ A;  2Y4G A;  5L6F A;  4BBY A;  2EXR A;  3C0P A;  3LLB A;  2QKN A;  4OAL A;  3FWA A;  1N60 C;  5AWV A;  2P4P A;  2WDW A;  3DQ0 A;  3JS8 A;  3RJA A;  1AHZ A;  3EUB 3;  3PQB A;  2VFU A;  2Y3S A;  1FIQ B;  4PYT A;  1UXY A;  1WYG A;  1ZR6 A;  1W1M A;  3S1D A;  4JB1 A;  5FXF A;  5G5H B;  1W1S A;  3PM9 A;  1N5X A;  4PVK A;  3NVY B;  1MBT A;  3HSU A;  2UUV A;  4JAY A;  1W1K A;  2P3H A;  1AHU A;  1DIQ A;  3BW7 A;  1E8F A;  1WVE A;  3ETR B;  3VTE A;  1ZXI C;  1AHV A;  2YVS A;  1QLU A;  2Q4W A;  1MBB A;  4XLO A;  1F0X A;  1JRO A;  3POP A;  4MLA A;  1DII A;  2MBR A;  2GQT A;  5FXE A;  3TSJ A;  2R8D A;  1WVF A;  5I1V A;  1FFV C;  1RM6 B;  1HSK A;  3W8W A; 
#chains in the Genus database with same CATH homology
 2OAI A;  2W55 A;  3FW8 A;  1N61 C;  3NS1 B;  1SB3 B;  4ML8 A;  5FXD A;  4BC9 A;  1FFU C;  2W3R A;  3NRZ B;  3SR6 B;  4HG0 A;  3NVV B;  4PWC A;  3S1F A;  2VAO A;  2R2Z A;  3D2J A;  3S1C A;  2BVF A;  3W8X A;  2P13 A;  2QPM A;  1W1Q A;  5HHZ A;  5I1W A;  5HMR A;  1VAO A;  1N62 C;  3TSH A;  1JRP A;  3NVZ B;  2Q85 A;  5FXP A;  3D2H A;  5K8E A;  4PVJ A;  1FO4 A;  1DZN A;  4PVH A;  2E3T A;  3KJM A;  4DNS A;  4EC3 A;  5L6G A;  4UD8 A;  1V97 A;  5D79 A;  3TX1 A;  1W1R A;  3RJ8 A;  1I19 A;  2NQW A;  2O3G A;  2W3S A;  4PZF A;  2W54 A;  4O95 A;  1W1J A;  2AXR A;  2UUU A;  1E8H A;  1W1O A;  5G5G B;  1T3Q C;  2VFS A;  3AN1 A;  4BC7 A;  2GQU A;  2Y3R A;  2I0K A;  3FW7 A;  1N63 C;  2BVG A;  1E8G A;  3GSY A;  3HRD C;  3B9J B;  5ADZ A;  4PWB A;  2VFR A;  2PLS A;  2PLI A;  3D2D A;  3I99 A;  2BVH A;  4ZOH B;  3LAE A;  3AM9 A;  5AE2 A;  3NVW B;  1QLT A;  2Y08 A;  4PVE A;  3W8Z A;  5HQX A;  1N5W C;  5AE3 A;  3DED A;  2RK5 A;  2VFT A;  3FW9 A;  3S1E A;  4BCA A;  1E0Y A;  1W1L A;  2VFV A;  5AE1 A;  2IPI A;  1VDV A;  3AMZ A;  2Y4G A;  5L6F A;  4BBY A;  2EXR A;  3C0P A;  3LLB A;  2QKN A;  4OAL A;  3FWA A;  1N60 C;  5AWV A;  2P4P A;  2WDW A;  3DQ0 A;  3JS8 A;  3RJA A;  1AHZ A;  3EUB 3;  3PQB A;  2VFU A;  2Y3S A;  1FIQ B;  4PYT A;  1UXY A;  1WYG A;  1ZR6 A;  1W1M A;  3S1D A;  4JB1 A;  5FXF A;  5G5H B;  1W1S A;  3PM9 A;  1N5X A;  4PVK A;  3NVY B;  1MBT A;  3HSU A;  2UUV A;  4JAY A;  1W1K A;  2P3H A;  1AHU A;  1DIQ A;  3BW7 A;  1E8F A;  1WVE A;  3ETR B;  3VTE A;  1ZXI C;  1AHV A;  2YVS A;  1QLU A;  2Q4W A;  1MBB A;  4XLO A;  1F0X A;  1JRO A;  3POP A;  4MLA A;  1DII A;  2MBR A;  2GQT A;  5FXE A;  3TSJ A;  2R8D A;  1WVF A;  5I1V A;  1FFV C;  1RM6 B;  1HSK A;  3W8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...