2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
3FW7A 4XLOA 5L6FA 4PVJA 3GSYA 4PVKA 2Y3SA 2Y3RA 5I1WA 2UUUA 4PWCA 3D2DA 3PQBA 3D2HA 1ZR6A 2IPIA 3D2JA 3FW8A 3W8ZA 5D79A 5I1VA 2BVHA 4DNSA 4PWBA 4EC3A 3POPA 4PZFA 2AXRA 3FW9A 3HSUA 5K8EA 5AWVA 3VTEA 2WDWA 3FWAA 3TSHA 5L6GA 4PVEA 3RJ8A 4UD8A 2Y4GA 2BVFA 4PVHA 3RJAA 2BVGA 2UUVA 3W8WA 2Y08A 3W8XA 3TSJA
chains in the Genus database with same CATH superfamily
3FW7A 3DQ0A 4PVKA 2VFUA 3D2DA 1N62C 1ZR6A 2IPIA 3LAEA 5AE2A 2YVSA 3W8ZA 3KJMA 2PLIA 2E3TA 5HQXA 1N5XA 4JAYA 1JROA 1HSKA 1T3QC 4ZOHB 1WYGA 2W3SA 1VDVA 2Q85A 4PYTA 4PZFA 5FXDA 2Q4WA 1AHUA 4OALA 3SR6B 3PM9A 1MBTA 3AMZA 5AWVA 3TSHA 4UD8A 3RJ8A 1N61C 2BVFA 4PVHA 1AHZA 1DZNA 2UUVA 1DIQA 2I0KA 1W1MA 3EUB3 1I19A 3S1FA 5G5GB 3ETRB 5AE1A 2P13A 2Y3SA 4BC9A 1FIQB 5I1WA 1W1SA 3D2HA 4HG0A 3FW8A 1N63C 4BBYA 2OAIA 5D79A 1QLTA 2RK5A 2W3RA 3S1DA 5FXEA 4BC7A 3POPA 5HMRA 2R8DA 2AXRA 5FXFA 3HSUA 2W54A 3TX1A 1W1KA 1ZXIC 3I99A 3VTEA 2WDWA 3LLBA 1SB3B 3FWAA 3NVWB 1E8GA 2VFTA 3AN1A 3JS8A 2BVGA 1W1JA 2VFVA 1WVFA 5G5HB 2PLSA 3NVZB 2EXRA 5L6FA 1E8HA 5AE3A 2Y3RA 1MBBA 1RM6B 3PQBA 1QLUA 1UXYA 5I1VA 2GQUA 3S1EA 4O95A 3FW9A 5ADZA 1V97A 2QPMA 4ML8A 1FO4A 2P4PA 3HRDC 5FXPA 2O3GA 2QKNA 1FFUC 2Y4GA 1E0YA 2GQTA 1W1QA 2NQWA 2VAOA 2VFRA 3DEDA 2R2ZA 2P3HA 3W8WA 2Y08A 3W8XA 3TSJA 1DIIA 4XLOA 4PVJA 3GSYA 1JRPA 3B9JB 2UUUA 4PWCA 2MBRA 3D2JA 2W55A 3C0PA 1FFVC 3NVVB 5HHZA 2BVHA 4DNSA 1E8FA 4JB1A 4PWBA 4EC3A 1AHVA 1N5WC 3AM9A 1VAOA 5K8EA 4MLAA 1W1RA 3NS1B 1N60C 3NRZB 5L6GA 4BCAA 1F0XA 4PVEA 1W1OA 3S1CA 3NVYB 3RJAA 1W1LA 2VFSA 1WVEA 3BW7A
chains in the Genus database with same CATH topology
3FW7A 3DQ0A 4PVKA 2VFUA 3D2DA 1N62C 1ZR6A 2IPIA 3LAEA 5AE2A 2YVSA 3W8ZA 3KJMA 2PLIA 2E3TA 5HQXA 1N5XA 4JAYA 1JROA 1HSKA 1T3QC 4ZOHB 1WYGA 2W3SA 1VDVA 2Q85A 4PYTA 4PZFA 5FXDA 2Q4WA 1AHUA 4OALA 3SR6B 3PM9A 1MBTA 3AMZA 5AWVA 3TSHA 4UD8A 3RJ8A 1N61C 2BVFA 4PVHA 1AHZA 1DZNA 2UUVA 1DIQA 2I0KA 1W1MA 3EUB3 1I19A 3S1FA 5G5GB 3ETRB 5AE1A 2P13A 2Y3SA 4BC9A 1FIQB 5I1WA 1W1SA 3D2HA 4HG0A 3FW8A 1N63C 4BBYA 2OAIA 5D79A 1QLTA 2RK5A 2W3RA 3S1DA 5FXEA 4BC7A 3POPA 5HMRA 2R8DA 2AXRA 5FXFA 3HSUA 2W54A 3TX1A 1W1KA 1ZXIC 3I99A 3VTEA 2WDWA 3LLBA 1SB3B 3FWAA 3NVWB 1E8GA 2VFTA 3AN1A 3JS8A 2BVGA 1W1JA 2VFVA 1WVFA 5G5HB 2PLSA 3NVZB 2EXRA 5L6FA 1E8HA 5AE3A 2Y3RA 1MBBA 1RM6B 3PQBA 1QLUA 1UXYA 5I1VA 2GQUA 3S1EA 4O95A 3FW9A 5ADZA 1V97A 2QPMA 4ML8A 1FO4A 2P4PA 3HRDC 5FXPA 2O3GA 2QKNA 1FFUC 2Y4GA 1E0YA 2GQTA 1W1QA 2NQWA 2VAOA 2VFRA 3DEDA 2R2ZA 2P3HA 3W8WA 2Y08A 3W8XA 3TSJA 1DIIA 4XLOA 4PVJA 3GSYA 1JRPA 3B9JB 2UUUA 4PWCA 2MBRA 3D2JA 2W55A 3C0PA 1FFVC 3NVVB 5HHZA 2BVHA 4DNSA 1E8FA 4JB1A 4PWBA 4EC3A 1AHVA 1N5WC 3AM9A 1VAOA 5K8EA 4MLAA 1W1RA 3NS1B 1N60C 3NRZB 5L6GA 4BCAA 1F0XA 4PVEA 1W1OA 3S1CA 3NVYB 3RJAA 1W1LA 2VFSA 1WVEA 3BW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW7 A;  4XLO A;  5L6F A;  4PVJ A;  3GSY A;  4PVK A;  2Y3S A;  2Y3R A;  5I1W A;  2UUU A;  4PWC A;  3D2D A;  3PQB A;  3D2H A;  1ZR6 A;  2IPI A;  3D2J A;  3FW8 A;  3W8Z A;  5D79 A;  5I1V A;  2BVH A;  4DNS A;  4PWB A;  4EC3 A;  3POP A;  4PZF A;  2AXR A;  3FW9 A;  3HSU A;  5K8E A;  5AWV A;  3VTE A;  2WDW A;  3FWA A;  3TSH A;  5L6G A;  4PVE A;  3RJ8 A;  4UD8 A;  2Y4G A;  2BVF A;  4PVH A;  3RJA A;  2BVG A;  2UUV A;  3W8W A;  2Y08 A;  3W8X A;  3TSJ A; 
#chains in the Genus database with same CATH topology
 3FW7 A;  3DQ0 A;  4PVK A;  2VFU A;  3D2D A;  1N62 C;  1ZR6 A;  2IPI A;  3LAE A;  5AE2 A;  2YVS A;  3W8Z A;  3KJM A;  2PLI A;  2E3T A;  5HQX A;  1N5X A;  4JAY A;  1JRO A;  1HSK A;  1T3Q C;  4ZOH B;  1WYG A;  2W3S A;  1VDV A;  2Q85 A;  4PYT A;  4PZF A;  5FXD A;  2Q4W A;  1AHU A;  4OAL A;  3SR6 B;  3PM9 A;  1MBT A;  3AMZ A;  5AWV A;  3TSH A;  4UD8 A;  3RJ8 A;  1N61 C;  2BVF A;  4PVH A;  1AHZ A;  1DZN A;  2UUV A;  1DIQ A;  2I0K A;  1W1M A;  3EUB 3;  1I19 A;  3S1F A;  5G5G B;  3ETR B;  5AE1 A;  2P13 A;  2Y3S A;  4BC9 A;  1FIQ B;  5I1W A;  1W1S A;  3D2H A;  4HG0 A;  3FW8 A;  1N63 C;  4BBY A;  2OAI A;  5D79 A;  1QLT A;  2RK5 A;  2W3R A;  3S1D A;  5FXE A;  4BC7 A;  3POP A;  5HMR A;  2R8D A;  2AXR A;  5FXF A;  3HSU A;  2W54 A;  3TX1 A;  1W1K A;  1ZXI C;  3I99 A;  3VTE A;  2WDW A;  3LLB A;  1SB3 B;  3FWA A;  3NVW B;  1E8G A;  2VFT A;  3AN1 A;  3JS8 A;  2BVG A;  1W1J A;  2VFV A;  1WVF A;  5G5H B;  2PLS A;  3NVZ B;  2EXR A;  5L6F A;  1E8H A;  5AE3 A;  2Y3R A;  1MBB A;  1RM6 B;  3PQB A;  1QLU A;  1UXY A;  5I1V A;  2GQU A;  3S1E A;  4O95 A;  3FW9 A;  5ADZ A;  1V97 A;  2QPM A;  4ML8 A;  1FO4 A;  2P4P A;  3HRD C;  5FXP A;  2O3G A;  2QKN A;  1FFU C;  2Y4G A;  1E0Y A;  2GQT A;  1W1Q A;  2NQW A;  2VAO A;  2VFR A;  3DED A;  2R2Z A;  2P3H A;  3W8W A;  2Y08 A;  3W8X A;  3TSJ A;  1DII A;  4XLO A;  4PVJ A;  3GSY A;  1JRP A;  3B9J B;  2UUU A;  4PWC A;  2MBR A;  3D2J A;  2W55 A;  3C0P A;  1FFV C;  3NVV B;  5HHZ A;  2BVH A;  4DNS A;  1E8F A;  4JB1 A;  4PWB A;  4EC3 A;  1AHV A;  1N5W C;  3AM9 A;  1VAO A;  5K8E A;  4MLA A;  1W1R A;  3NS1 B;  1N60 C;  3NRZ B;  5L6G A;  4BCA A;  1F0X A;  4PVE A;  1W1O A;  3S1C A;  3NVY B;  3RJA A;  1W1L A;  2VFS A;  1WVE A;  3BW7 A; 
#chains in the Genus database with same CATH homology
 3FW7 A;  3DQ0 A;  4PVK A;  2VFU A;  3D2D A;  1N62 C;  1ZR6 A;  2IPI A;  3LAE A;  5AE2 A;  2YVS A;  3W8Z A;  3KJM A;  2PLI A;  2E3T A;  5HQX A;  1N5X A;  4JAY A;  1JRO A;  1HSK A;  1T3Q C;  4ZOH B;  1WYG A;  2W3S A;  1VDV A;  2Q85 A;  4PYT A;  4PZF A;  5FXD A;  2Q4W A;  1AHU A;  4OAL A;  3SR6 B;  3PM9 A;  1MBT A;  3AMZ A;  5AWV A;  3TSH A;  4UD8 A;  3RJ8 A;  1N61 C;  2BVF A;  4PVH A;  1AHZ A;  1DZN A;  2UUV A;  1DIQ A;  2I0K A;  1W1M A;  3EUB 3;  1I19 A;  3S1F A;  5G5G B;  3ETR B;  5AE1 A;  2P13 A;  2Y3S A;  4BC9 A;  1FIQ B;  5I1W A;  1W1S A;  3D2H A;  4HG0 A;  3FW8 A;  1N63 C;  4BBY A;  2OAI A;  5D79 A;  1QLT A;  2RK5 A;  2W3R A;  3S1D A;  5FXE A;  4BC7 A;  3POP A;  5HMR A;  2R8D A;  2AXR A;  5FXF A;  3HSU A;  2W54 A;  3TX1 A;  1W1K A;  1ZXI C;  3I99 A;  3VTE A;  2WDW A;  3LLB A;  1SB3 B;  3FWA A;  3NVW B;  1E8G A;  2VFT A;  3AN1 A;  3JS8 A;  2BVG A;  1W1J A;  2VFV A;  1WVF A;  5G5H B;  2PLS A;  3NVZ B;  2EXR A;  5L6F A;  1E8H A;  5AE3 A;  2Y3R A;  1MBB A;  1RM6 B;  3PQB A;  1QLU A;  1UXY A;  5I1V A;  2GQU A;  3S1E A;  4O95 A;  3FW9 A;  5ADZ A;  1V97 A;  2QPM A;  4ML8 A;  1FO4 A;  2P4P A;  3HRD C;  5FXP A;  2O3G A;  2QKN A;  1FFU C;  2Y4G A;  1E0Y A;  2GQT A;  1W1Q A;  2NQW A;  2VAO A;  2VFR A;  3DED A;  2R2Z A;  2P3H A;  3W8W A;  2Y08 A;  3W8X A;  3TSJ A;  1DII A;  4XLO A;  4PVJ A;  3GSY A;  1JRP A;  3B9J B;  2UUU A;  4PWC A;  2MBR A;  3D2J A;  2W55 A;  3C0P A;  1FFV C;  3NVV B;  5HHZ A;  2BVH A;  4DNS A;  1E8F A;  4JB1 A;  4PWB A;  4EC3 A;  1AHV A;  1N5W C;  3AM9 A;  1VAO A;  5K8E A;  4MLA A;  1W1R A;  3NS1 B;  1N60 C;  3NRZ B;  5L6G A;  4BCA A;  1F0X A;  4PVE A;  1W1O A;  3S1C A;  3NVY B;  3RJA A;  1W1L A;  2VFS A;  1WVE A;  3BW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...