2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
b'IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
2AXRA 3D2JA 4EC3A 4PWBA 3POPA 5L6FA 4PVJA 3FW7A 5I1WA 5K8EA 4XLOA 2BVFA 3FW9A 5AWVA 2UUUA 4PWCA 4PZFA 2UUVA 3FW8A 2Y08A 3W8WA 1ZR6A 2Y3SA 5I1VA 4UD8A 3W8ZA 2BVHA 3FWAA 3D2HA 3HSUA 5L6GA 3RJ8A 3PQBA 3RJAA 2BVGA 4PVKA 2WDWA 2Y3RA 2Y4GA 3GSYA 4PVHA 3TSHA 3W8XA 3D2DA 3TSJA 4DNSA 5D79A 3VTEA 2IPIA 4PVEA
chains in the Genus database with same CATH superfamily
4ML8A 1V97A 4JB1A 4EC3A 2P3HA 3DEDA 4ZOHB 3TX1A 3AN1A 2GQTA 5I1WA 4XLOA 1RM6B 1W1KA 3I99A 4PWCA 2PLIA 2UUVA 2R2ZA 2Y08A 1W1OA 3NS1B 3W8WA 1MBTA 1F0XA 1ZR6A 2R8DA 3B9JB 2P4PA 3KJMA 5FXEA 2QKNA 1ZXIC 3RJ8A 2O3GA 1DZNA 3RJAA 1JROA 1UXYA 2VAOA 3LLBA 2MBRA 2OAIA 2W54A 3AMZA 3D2DA 1WVFA 4DNSA 3EUB3 1AHUA 1E0YA 5AE2A 3NRZB 2YVSA 5HHZA 3S1EA 1QLUA 4PVJA 1E8HA 1E8FA 1VDVA 3FW7A 3NVVB 1T3QC 2BVFA 4BCAA 2UUUA 4PYTA 1DIQA 5HMRA 5FXDA 4UD8A 3W8ZA 4OALA 4HG0A 5FXPA 4BC9A 3PQBA 1FFVC 4O95A 2RK5A 1WVEA 2VFRA 5G5HB 3GSYA 4PVHA 3TSHA 2VFUA 3JS8A 5D79A 3C0PA 2IPIA 2QPMA 3VTEA 1W1JA 4BBYA 1N5XA 2W3RA 1DIIA 2AXRA 1N5WC 3POPA 5L6FA 5K8EA 3FW9A 2P13A 3ETRB 3PM9A 1JRPA 3FW8A 3BW7A 2NQWA 2Y3SA 1VAOA 3NVYB 2BVHA 4JAYA 2PLSA 2BVGA 2GQUA 2W3SA 2WDWA 2Y3RA 3NVZB 3NVWB 5AE1A 5HQXA 1SB3B 3DQ0A 3AM9A 3W8XA 1W1RA 1N62C 3SR6B 1N63C 2W55A 2VFTA 1HSKA 1FFUC 3D2JA 3S1DA 4PWBA 2Q85A 3HRDC 2EXRA 1AHVA 1WYGA 5AWVA 1W1SA 4PZFA 5G5GB 2Q4WA 2VFVA 1W1MA 1W1LA 5I1VA 1QLTA 3S1FA 3FWAA 3D2HA 4MLAA 3HSUA 1E8GA 2E3TA 5L6GA 3LAEA 5ADZA 2I0KA 4PVKA 1W1QA 5AE3A 2Y4GA 1I19A 1N61C 3S1CA 3TSJA 1FIQB 1N60C 2VFSA 1MBBA 5FXFA 4BC7A 1FO4A 1AHZA 4PVEA
chains in the Genus database with same CATH topology
4ML8A 1V97A 4JB1A 4EC3A 2P3HA 3DEDA 4ZOHB 3TX1A 3AN1A 2GQTA 5I1WA 4XLOA 1RM6B 1W1KA 3I99A 4PWCA 2PLIA 2UUVA 2R2ZA 2Y08A 1W1OA 3NS1B 3W8WA 1MBTA 1F0XA 1ZR6A 2R8DA 3B9JB 2P4PA 3KJMA 5FXEA 2QKNA 1ZXIC 3RJ8A 2O3GA 1DZNA 3RJAA 1JROA 1UXYA 2VAOA 3LLBA 2MBRA 2OAIA 2W54A 3AMZA 3D2DA 1WVFA 4DNSA 3EUB3 1AHUA 1E0YA 5AE2A 3NRZB 2YVSA 5HHZA 3S1EA 1QLUA 4PVJA 1E8HA 1E8FA 1VDVA 3FW7A 3NVVB 1T3QC 2BVFA 4BCAA 2UUUA 4PYTA 1DIQA 5HMRA 5FXDA 4UD8A 3W8ZA 4OALA 4HG0A 5FXPA 4BC9A 3PQBA 1FFVC 4O95A 2RK5A 1WVEA 2VFRA 5G5HB 3GSYA 4PVHA 3TSHA 2VFUA 3JS8A 5D79A 3C0PA 2IPIA 2QPMA 3VTEA 1W1JA 4BBYA 1N5XA 2W3RA 1DIIA 2AXRA 1N5WC 3POPA 5L6FA 5K8EA 3FW9A 2P13A 3ETRB 3PM9A 1JRPA 3FW8A 3BW7A 2NQWA 2Y3SA 1VAOA 3NVYB 2BVHA 4JAYA 2PLSA 2BVGA 2GQUA 2W3SA 2WDWA 2Y3RA 3NVZB 3NVWB 5AE1A 5HQXA 1SB3B 3DQ0A 3AM9A 3W8XA 1W1RA 1N62C 3SR6B 1N63C 2W55A 2VFTA 1HSKA 1FFUC 3D2JA 3S1DA 4PWBA 2Q85A 3HRDC 2EXRA 1AHVA 1WYGA 5AWVA 1W1SA 4PZFA 5G5GB 2Q4WA 2VFVA 1W1MA 1W1LA 5I1VA 1QLTA 3S1FA 3FWAA 3D2HA 4MLAA 3HSUA 1E8GA 2E3TA 5L6GA 3LAEA 5ADZA 2I0KA 4PVKA 1W1QA 5AE3A 2Y4GA 1I19A 1N61C 3S1CA 3TSJA 1FIQB 1N60C 2VFSA 1MBBA 5FXFA 4BC7A 1FO4A 1AHZA 4PVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXR A;  3D2J A;  4EC3 A;  4PWB A;  3POP A;  5L6F A;  4PVJ A;  3FW7 A;  5I1W A;  5K8E A;  4XLO A;  2BVF A;  3FW9 A;  5AWV A;  2UUU A;  4PWC A;  4PZF A;  2UUV A;  3FW8 A;  2Y08 A;  3W8W A;  1ZR6 A;  2Y3S A;  5I1V A;  4UD8 A;  3W8Z A;  2BVH A;  3FWA A;  3D2H A;  3HSU A;  5L6G A;  3RJ8 A;  3PQB A;  3RJA A;  2BVG A;  4PVK A;  2WDW A;  2Y3R A;  2Y4G A;  3GSY A;  4PVH A;  3TSH A;  3W8X A;  3D2D A;  3TSJ A;  4DNS A;  5D79 A;  3VTE A;  2IPI A;  4PVE A; 
#chains in the Genus database with same CATH topology
 4ML8 A;  1V97 A;  4JB1 A;  4EC3 A;  2P3H A;  3DED A;  4ZOH B;  3TX1 A;  3AN1 A;  2GQT A;  5I1W A;  4XLO A;  1RM6 B;  1W1K A;  3I99 A;  4PWC A;  2PLI A;  2UUV A;  2R2Z A;  2Y08 A;  1W1O A;  3NS1 B;  3W8W A;  1MBT A;  1F0X A;  1ZR6 A;  2R8D A;  3B9J B;  2P4P A;  3KJM A;  5FXE A;  2QKN A;  1ZXI C;  3RJ8 A;  2O3G A;  1DZN A;  3RJA A;  1JRO A;  1UXY A;  2VAO A;  3LLB A;  2MBR A;  2OAI A;  2W54 A;  3AMZ A;  3D2D A;  1WVF A;  4DNS A;  3EUB 3;  1AHU A;  1E0Y A;  5AE2 A;  3NRZ B;  2YVS A;  5HHZ A;  3S1E A;  1QLU A;  4PVJ A;  1E8H A;  1E8F A;  1VDV A;  3FW7 A;  3NVV B;  1T3Q C;  2BVF A;  4BCA A;  2UUU A;  4PYT A;  1DIQ A;  5HMR A;  5FXD A;  4UD8 A;  3W8Z A;  4OAL A;  4HG0 A;  5FXP A;  4BC9 A;  3PQB A;  1FFV C;  4O95 A;  2RK5 A;  1WVE A;  2VFR A;  5G5H B;  3GSY A;  4PVH A;  3TSH A;  2VFU A;  3JS8 A;  5D79 A;  3C0P A;  2IPI A;  2QPM A;  3VTE A;  1W1J A;  4BBY A;  1N5X A;  2W3R A;  1DII A;  2AXR A;  1N5W C;  3POP A;  5L6F A;  5K8E A;  3FW9 A;  2P13 A;  3ETR B;  3PM9 A;  1JRP A;  3FW8 A;  3BW7 A;  2NQW A;  2Y3S A;  1VAO A;  3NVY B;  2BVH A;  4JAY A;  2PLS A;  2BVG A;  2GQU A;  2W3S A;  2WDW A;  2Y3R A;  3NVZ B;  3NVW B;  5AE1 A;  5HQX A;  1SB3 B;  3DQ0 A;  3AM9 A;  3W8X A;  1W1R A;  1N62 C;  3SR6 B;  1N63 C;  2W55 A;  2VFT A;  1HSK A;  1FFU C;  3D2J A;  3S1D A;  4PWB A;  2Q85 A;  3HRD C;  2EXR A;  1AHV A;  1WYG A;  5AWV A;  1W1S A;  4PZF A;  5G5G B;  2Q4W A;  2VFV A;  1W1M A;  1W1L A;  5I1V A;  1QLT A;  3S1F A;  3FWA A;  3D2H A;  4MLA A;  3HSU A;  1E8G A;  2E3T A;  5L6G A;  3LAE A;  5ADZ A;  2I0K A;  4PVK A;  1W1Q A;  5AE3 A;  2Y4G A;  1I19 A;  1N61 C;  3S1C A;  3TSJ A;  1FIQ B;  1N60 C;  2VFS A;  1MBB A;  5FXF A;  4BC7 A;  1FO4 A;  1AHZ A;  4PVE A; 
#chains in the Genus database with same CATH homology
 4ML8 A;  1V97 A;  4JB1 A;  4EC3 A;  2P3H A;  3DED A;  4ZOH B;  3TX1 A;  3AN1 A;  2GQT A;  5I1W A;  4XLO A;  1RM6 B;  1W1K A;  3I99 A;  4PWC A;  2PLI A;  2UUV A;  2R2Z A;  2Y08 A;  1W1O A;  3NS1 B;  3W8W A;  1MBT A;  1F0X A;  1ZR6 A;  2R8D A;  3B9J B;  2P4P A;  3KJM A;  5FXE A;  2QKN A;  1ZXI C;  3RJ8 A;  2O3G A;  1DZN A;  3RJA A;  1JRO A;  1UXY A;  2VAO A;  3LLB A;  2MBR A;  2OAI A;  2W54 A;  3AMZ A;  3D2D A;  1WVF A;  4DNS A;  3EUB 3;  1AHU A;  1E0Y A;  5AE2 A;  3NRZ B;  2YVS A;  5HHZ A;  3S1E A;  1QLU A;  4PVJ A;  1E8H A;  1E8F A;  1VDV A;  3FW7 A;  3NVV B;  1T3Q C;  2BVF A;  4BCA A;  2UUU A;  4PYT A;  1DIQ A;  5HMR A;  5FXD A;  4UD8 A;  3W8Z A;  4OAL A;  4HG0 A;  5FXP A;  4BC9 A;  3PQB A;  1FFV C;  4O95 A;  2RK5 A;  1WVE A;  2VFR A;  5G5H B;  3GSY A;  4PVH A;  3TSH A;  2VFU A;  3JS8 A;  5D79 A;  3C0P A;  2IPI A;  2QPM A;  3VTE A;  1W1J A;  4BBY A;  1N5X A;  2W3R A;  1DII A;  2AXR A;  1N5W C;  3POP A;  5L6F A;  5K8E A;  3FW9 A;  2P13 A;  3ETR B;  3PM9 A;  1JRP A;  3FW8 A;  3BW7 A;  2NQW A;  2Y3S A;  1VAO A;  3NVY B;  2BVH A;  4JAY A;  2PLS A;  2BVG A;  2GQU A;  2W3S A;  2WDW A;  2Y3R A;  3NVZ B;  3NVW B;  5AE1 A;  5HQX A;  1SB3 B;  3DQ0 A;  3AM9 A;  3W8X A;  1W1R A;  1N62 C;  3SR6 B;  1N63 C;  2W55 A;  2VFT A;  1HSK A;  1FFU C;  3D2J A;  3S1D A;  4PWB A;  2Q85 A;  3HRD C;  2EXR A;  1AHV A;  1WYG A;  5AWV A;  1W1S A;  4PZF A;  5G5G B;  2Q4W A;  2VFV A;  1W1M A;  1W1L A;  5I1V A;  1QLT A;  3S1F A;  3FWA A;  3D2H A;  4MLA A;  3HSU A;  1E8G A;  2E3T A;  5L6G A;  3LAE A;  5ADZ A;  2I0K A;  4PVK A;  1W1Q A;  5AE3 A;  2Y4G A;  1I19 A;  1N61 C;  3S1C A;  3TSJ A;  1FIQ B;  1N60 C;  2VFS A;  1MBB A;  5FXF A;  4BC7 A;  1FO4 A;  1AHZ A;  4PVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...