2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
5I1VA 2Y08A 5AWVA 3GSYA 2AXRA 4DNSA 2UUUA 5I1WA 2BVFA 4PWCA 2IPIA 4PVKA 2BVGA 4PVHA 5L6GA 4PVEA 3RJAA 5K8EA 3RJ8A 3TSJA 5L6FA 4PWBA 3POPA 4EC3A 3FW7A 2Y4GA 2WDWA 2UUVA 2BVHA 2Y3SA 4UD8A 3D2DA 1ZR6A 3D2JA 4PZFA 3W8ZA 3HSUA 3FWAA 3TSHA 3FW8A 3W8XA 3PQBA 4PVJA 4XLOA 5D79A 3VTEA 2Y3RA 3D2HA 3FW9A 3W8WA
chains in the Genus database with same CATH superfamily
5AE3A 2YVSA 5AWVA 4MLAA 1FIQB 2PLIA 3JS8A 5G5GB 3KJMA 2GQUA 2O3GA 4PVHA 4BC7A 5K8EA 1QLUA 1E8HA 3DQ0A 3HRDC 1WVEA 2Q4WA 3LAEA 1F0XA 3S1DA 4BBYA 3AMZA 1N5XA 1V97A 3NVZB 2VFTA 3W8ZA 1W1KA 4ZOHB 3W8XA 2VFVA 4PVJA 3SR6B 3W8WA 1W1JA 2Y08A 2AXRA 2QPMA 3NVWB 2BVFA 3NS1B 4PYTA 5HHZA 4PVKA 3PM9A 2OAIA 1N62C 3DEDA 3TSJA 1AHVA 1N5WC 2VAOA 5AE1A 5HQXA 3NVYB 2VFRA 2Y4GA 2W3RA 2WDWA 2UUVA 5AE2A 5FXPA 1W1QA 2BVHA 1W1RA 2GQTA 1VDVA 1QLTA 2VFUA 1W1SA 2R8DA 1DIIA 4OALA 2I0KA 4PZFA 3TSHA 2RK5A 1FFUC 3FW8A 3PQBA 3VTEA 5FXDA 1AHZA 5D79A 1WYGA 3C0PA 1MBTA 2E3TA 3NRZB 4DNSA 1MBBA 3I99A 1E8FA 2UUUA 1E0YA 1FO4A 1JRPA 3S1CA 1DZNA 1SB3B 2P4PA 4PVEA 1HSKA 4BCAA 1I19A 5L6GA 1W1OA 3RJ8A 4PWBA 1WVFA 3POPA 5FXFA 4EC3A 3FW7A 1UXYA 2PLSA 2MBRA 1ZXIC 2NQWA 2Y3SA 3ETRB 4UD8A 1ZR6A 1E8GA 2Q85A 3HSUA 4JB1A 4HG0A 4ML8A 4XLOA 3S1EA 3FW9A 1W1MA 1FFVC 1N60C 5I1VA 1RM6B 2W54A 3GSYA 4PWCA 1N61C 2EXRA 2R2ZA 2IPIA 3AN1A 5I1WA 3B9JB 5G5HB 2P3HA 2BVGA 4JAYA 3TX1A 5HMRA 3LLBA 3RJAA 1JROA 5L6FA 3BW7A 1W1LA 3S1FA 1T3QC 2W3SA 1DIQA 5FXEA 1AHUA 3NVVB 3D2DA 2VFSA 4O95A 5ADZA 2P13A 3D2JA 1N63C 2W55A 4BC9A 3FWAA 3AM9A 3EUB3 2Y3RA 3D2HA 1VAOA 2QKNA
chains in the Genus database with same CATH topology
5AE3A 2YVSA 5AWVA 4MLAA 1FIQB 2PLIA 3JS8A 5G5GB 3KJMA 2GQUA 2O3GA 4PVHA 4BC7A 5K8EA 1QLUA 1E8HA 3DQ0A 3HRDC 1WVEA 2Q4WA 3LAEA 1F0XA 3S1DA 4BBYA 3AMZA 1N5XA 1V97A 3NVZB 2VFTA 3W8ZA 1W1KA 4ZOHB 3W8XA 2VFVA 4PVJA 3SR6B 3W8WA 1W1JA 2Y08A 2AXRA 2QPMA 3NVWB 2BVFA 3NS1B 4PYTA 5HHZA 4PVKA 3PM9A 2OAIA 1N62C 3DEDA 3TSJA 1AHVA 1N5WC 2VAOA 5AE1A 5HQXA 3NVYB 2VFRA 2Y4GA 2W3RA 2WDWA 2UUVA 5AE2A 5FXPA 1W1QA 2BVHA 1W1RA 2GQTA 1VDVA 1QLTA 2VFUA 1W1SA 2R8DA 1DIIA 4OALA 2I0KA 4PZFA 3TSHA 2RK5A 1FFUC 3FW8A 3PQBA 3VTEA 5FXDA 1AHZA 5D79A 1WYGA 3C0PA 1MBTA 2E3TA 3NRZB 4DNSA 1MBBA 3I99A 1E8FA 2UUUA 1E0YA 1FO4A 1JRPA 3S1CA 1DZNA 1SB3B 2P4PA 4PVEA 1HSKA 4BCAA 1I19A 5L6GA 1W1OA 3RJ8A 4PWBA 1WVFA 3POPA 5FXFA 4EC3A 3FW7A 1UXYA 2PLSA 2MBRA 1ZXIC 2NQWA 2Y3SA 3ETRB 4UD8A 1ZR6A 1E8GA 2Q85A 3HSUA 4JB1A 4HG0A 4ML8A 4XLOA 3S1EA 3FW9A 1W1MA 1FFVC 1N60C 5I1VA 1RM6B 2W54A 3GSYA 4PWCA 1N61C 2EXRA 2R2ZA 2IPIA 3AN1A 5I1WA 3B9JB 5G5HB 2P3HA 2BVGA 4JAYA 3TX1A 5HMRA 3LLBA 3RJAA 1JROA 5L6FA 3BW7A 1W1LA 3S1FA 1T3QC 2W3SA 1DIQA 5FXEA 1AHUA 3NVVB 3D2DA 2VFSA 4O95A 5ADZA 2P13A 3D2JA 1N63C 2W55A 4BC9A 3FWAA 3AM9A 3EUB3 2Y3RA 3D2HA 1VAOA 2QKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I1V A;  2Y08 A;  5AWV A;  3GSY A;  2AXR A;  4DNS A;  2UUU A;  5I1W A;  2BVF A;  4PWC A;  2IPI A;  4PVK A;  2BVG A;  4PVH A;  5L6G A;  4PVE A;  3RJA A;  5K8E A;  3RJ8 A;  3TSJ A;  5L6F A;  4PWB A;  3POP A;  4EC3 A;  3FW7 A;  2Y4G A;  2WDW A;  2UUV A;  2BVH A;  2Y3S A;  4UD8 A;  3D2D A;  1ZR6 A;  3D2J A;  4PZF A;  3W8Z A;  3HSU A;  3FWA A;  3TSH A;  3FW8 A;  3W8X A;  3PQB A;  4PVJ A;  4XLO A;  5D79 A;  3VTE A;  2Y3R A;  3D2H A;  3FW9 A;  3W8W A; 
#chains in the Genus database with same CATH topology
 5AE3 A;  2YVS A;  5AWV A;  4MLA A;  1FIQ B;  2PLI A;  3JS8 A;  5G5G B;  3KJM A;  2GQU A;  2O3G A;  4PVH A;  4BC7 A;  5K8E A;  1QLU A;  1E8H A;  3DQ0 A;  3HRD C;  1WVE A;  2Q4W A;  3LAE A;  1F0X A;  3S1D A;  4BBY A;  3AMZ A;  1N5X A;  1V97 A;  3NVZ B;  2VFT A;  3W8Z A;  1W1K A;  4ZOH B;  3W8X A;  2VFV A;  4PVJ A;  3SR6 B;  3W8W A;  1W1J A;  2Y08 A;  2AXR A;  2QPM A;  3NVW B;  2BVF A;  3NS1 B;  4PYT A;  5HHZ A;  4PVK A;  3PM9 A;  2OAI A;  1N62 C;  3DED A;  3TSJ A;  1AHV A;  1N5W C;  2VAO A;  5AE1 A;  5HQX A;  3NVY B;  2VFR A;  2Y4G A;  2W3R A;  2WDW A;  2UUV A;  5AE2 A;  5FXP A;  1W1Q A;  2BVH A;  1W1R A;  2GQT A;  1VDV A;  1QLT A;  2VFU A;  1W1S A;  2R8D A;  1DII A;  4OAL A;  2I0K A;  4PZF A;  3TSH A;  2RK5 A;  1FFU C;  3FW8 A;  3PQB A;  3VTE A;  5FXD A;  1AHZ A;  5D79 A;  1WYG A;  3C0P A;  1MBT A;  2E3T A;  3NRZ B;  4DNS A;  1MBB A;  3I99 A;  1E8F A;  2UUU A;  1E0Y A;  1FO4 A;  1JRP A;  3S1C A;  1DZN A;  1SB3 B;  2P4P A;  4PVE A;  1HSK A;  4BCA A;  1I19 A;  5L6G A;  1W1O A;  3RJ8 A;  4PWB A;  1WVF A;  3POP A;  5FXF A;  4EC3 A;  3FW7 A;  1UXY A;  2PLS A;  2MBR A;  1ZXI C;  2NQW A;  2Y3S A;  3ETR B;  4UD8 A;  1ZR6 A;  1E8G A;  2Q85 A;  3HSU A;  4JB1 A;  4HG0 A;  4ML8 A;  4XLO A;  3S1E A;  3FW9 A;  1W1M A;  1FFV C;  1N60 C;  5I1V A;  1RM6 B;  2W54 A;  3GSY A;  4PWC A;  1N61 C;  2EXR A;  2R2Z A;  2IPI A;  3AN1 A;  5I1W A;  3B9J B;  5G5H B;  2P3H A;  2BVG A;  4JAY A;  3TX1 A;  5HMR A;  3LLB A;  3RJA A;  1JRO A;  5L6F A;  3BW7 A;  1W1L A;  3S1F A;  1T3Q C;  2W3S A;  1DIQ A;  5FXE A;  1AHU A;  3NVV B;  3D2D A;  2VFS A;  4O95 A;  5ADZ A;  2P13 A;  3D2J A;  1N63 C;  2W55 A;  4BC9 A;  3FWA A;  3AM9 A;  3EUB 3;  2Y3R A;  3D2H A;  1VAO A;  2QKN A; 
#chains in the Genus database with same CATH homology
 5AE3 A;  2YVS A;  5AWV A;  4MLA A;  1FIQ B;  2PLI A;  3JS8 A;  5G5G B;  3KJM A;  2GQU A;  2O3G A;  4PVH A;  4BC7 A;  5K8E A;  1QLU A;  1E8H A;  3DQ0 A;  3HRD C;  1WVE A;  2Q4W A;  3LAE A;  1F0X A;  3S1D A;  4BBY A;  3AMZ A;  1N5X A;  1V97 A;  3NVZ B;  2VFT A;  3W8Z A;  1W1K A;  4ZOH B;  3W8X A;  2VFV A;  4PVJ A;  3SR6 B;  3W8W A;  1W1J A;  2Y08 A;  2AXR A;  2QPM A;  3NVW B;  2BVF A;  3NS1 B;  4PYT A;  5HHZ A;  4PVK A;  3PM9 A;  2OAI A;  1N62 C;  3DED A;  3TSJ A;  1AHV A;  1N5W C;  2VAO A;  5AE1 A;  5HQX A;  3NVY B;  2VFR A;  2Y4G A;  2W3R A;  2WDW A;  2UUV A;  5AE2 A;  5FXP A;  1W1Q A;  2BVH A;  1W1R A;  2GQT A;  1VDV A;  1QLT A;  2VFU A;  1W1S A;  2R8D A;  1DII A;  4OAL A;  2I0K A;  4PZF A;  3TSH A;  2RK5 A;  1FFU C;  3FW8 A;  3PQB A;  3VTE A;  5FXD A;  1AHZ A;  5D79 A;  1WYG A;  3C0P A;  1MBT A;  2E3T A;  3NRZ B;  4DNS A;  1MBB A;  3I99 A;  1E8F A;  2UUU A;  1E0Y A;  1FO4 A;  1JRP A;  3S1C A;  1DZN A;  1SB3 B;  2P4P A;  4PVE A;  1HSK A;  4BCA A;  1I19 A;  5L6G A;  1W1O A;  3RJ8 A;  4PWB A;  1WVF A;  3POP A;  5FXF A;  4EC3 A;  3FW7 A;  1UXY A;  2PLS A;  2MBR A;  1ZXI C;  2NQW A;  2Y3S A;  3ETR B;  4UD8 A;  1ZR6 A;  1E8G A;  2Q85 A;  3HSU A;  4JB1 A;  4HG0 A;  4ML8 A;  4XLO A;  3S1E A;  3FW9 A;  1W1M A;  1FFV C;  1N60 C;  5I1V A;  1RM6 B;  2W54 A;  3GSY A;  4PWC A;  1N61 C;  2EXR A;  2R2Z A;  2IPI A;  3AN1 A;  5I1W A;  3B9J B;  5G5H B;  2P3H A;  2BVG A;  4JAY A;  3TX1 A;  5HMR A;  3LLB A;  3RJA A;  1JRO A;  5L6F A;  3BW7 A;  1W1L A;  3S1F A;  1T3Q C;  2W3S A;  1DIQ A;  5FXE A;  1AHU A;  3NVV B;  3D2D A;  2VFS A;  4O95 A;  5ADZ A;  2P13 A;  3D2J A;  1N63 C;  2W55 A;  4BC9 A;  3FWA A;  3AM9 A;  3EUB 3;  2Y3R A;  3D2H A;  1VAO A;  2QKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...