2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
molecule keywords TAML
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
4PVEA 3D2HA 4PWCA 4UD8A 2Y3RA 5K8EA 1ZR6A 5I1WA 3FWAA 2WDWA 2IPIA 3FW8A 3TSJA 2UUUA 4XLOA 3W8XA 3FW7A 5AWVA 3RJ8A 4DNSA 4PVJA 2Y4GA 3D2JA 3POPA 2UUVA 2BVFA 4PZFA 5L6FA 3GSYA 3RJAA 3FW9A 2Y3SA 3TSHA 4PVKA 3W8ZA 2AXRA 3W8WA 4PVHA 5I1VA 5D79A 4PWBA 3HSUA 3D2DA 2Y08A 3PQBA 3VTEA 4EC3A 2BVGA 2BVHA 5L6GA
chains in the Genus database with same CATH superfamily
2VFSA 2I0KA 3D2HA 1W1KA 4UD8A 3KJMA 5G5HB 2IPIA 1SB3B 2UUUA 1AHVA 2GQTA 2VFVA 1WVEA 4HG0A 1VAOA 2OAIA 3ETRB 4OALA 5FXEA 3AMZA 1WYGA 3LAEA 3NS1B 1W1OA 5G5GB 3SR6B 2BVFA 2MBRA 4PZFA 4MLAA 2GQUA 3W8ZA 1MBTA 1W1QA 2AXRA 2R2ZA 4PVHA 1W1MA 5D79A 5I1VA 4ZOHB 1I19A 3NVYB 1E8HA 3VTEA 4EC3A 2QPMA 3B9JB 1AHUA 2BVHA 3HRDC 3S1CA 3JS8A 4BC7A 1E8GA 3NRZB 4PVEA 3PM9A 1DIQA 3FWAA 2P4PA 1HSKA 3NVZB 1DIIA 2P3HA 4BBYA 4PYTA 1QLUA 1N63C 1WVFA 1N61C 3NVWB 2QKNA 5AE1A 1QLTA 5AE2A 2Y4GA 5AE3A 5ADZA 2R8DA 1ZXIC 1FFUC 1MBBA 2YVSA 5FXFA 1N60C 1N62C 4PWBA 2RK5A 1FFVC 1FO4A 2BVGA 3DEDA 1W1SA 3AN1A 2W55A 1T3QC 2Y3RA 5K8EA 5I1WA 3S1EA 3AM9A 3S1DA 2VFRA 3TSJA 4BC9A 3BW7A 2Q85A 1RM6B 2W3RA 4ML8A 1DZNA 1AHZA 4PVJA 1JRPA 3D2JA 3POPA 2EXRA 2Q4WA 1W1LA 2UUVA 1VDVA 5FXDA 3GSYA 5L6FA 5HQXA 2VFUA 3RJAA 2Y3SA 3TSHA 3TX1A 5HHZA 3W8WA 3HSUA 4JB1A 2Y08A 1W1RA 3PQBA 1E8FA 2P13A 3NVVB 1UXYA 1E0YA 2PLSA 5FXPA 1N5WC 1V97A 4PWCA 2W54A 3S1FA 1ZR6A 2WDWA 2E3TA 3DQ0A 2VAOA 3FW8A 4XLOA 2PLIA 1F0XA 3W8XA 5HMRA 4BCAA 3FW7A 1FIQB 3C0PA 5AWVA 2O3GA 4O95A 3RJ8A 4DNSA 1JROA 3FW9A 3LLBA 4PVKA 2W3SA 1W1JA 2VFTA 3D2DA 4JAYA 2NQWA 3EUB3 1N5XA 3I99A 5L6GA
chains in the Genus database with same CATH topology
2VFSA 2I0KA 3D2HA 1W1KA 4UD8A 3KJMA 5G5HB 2IPIA 1SB3B 2UUUA 1AHVA 2GQTA 2VFVA 1WVEA 4HG0A 1VAOA 2OAIA 3ETRB 4OALA 5FXEA 3AMZA 1WYGA 3LAEA 3NS1B 1W1OA 5G5GB 3SR6B 2BVFA 2MBRA 4PZFA 4MLAA 2GQUA 3W8ZA 1MBTA 1W1QA 2AXRA 2R2ZA 4PVHA 1W1MA 5D79A 5I1VA 4ZOHB 1I19A 3NVYB 1E8HA 3VTEA 4EC3A 2QPMA 3B9JB 1AHUA 2BVHA 3HRDC 3S1CA 3JS8A 4BC7A 1E8GA 3NRZB 4PVEA 3PM9A 1DIQA 3FWAA 2P4PA 1HSKA 3NVZB 1DIIA 2P3HA 4BBYA 4PYTA 1QLUA 1N63C 1WVFA 1N61C 3NVWB 2QKNA 5AE1A 1QLTA 5AE2A 2Y4GA 5AE3A 5ADZA 2R8DA 1ZXIC 1FFUC 1MBBA 2YVSA 5FXFA 1N60C 1N62C 4PWBA 2RK5A 1FFVC 1FO4A 2BVGA 3DEDA 1W1SA 3AN1A 2W55A 1T3QC 2Y3RA 5K8EA 5I1WA 3S1EA 3AM9A 3S1DA 2VFRA 3TSJA 4BC9A 3BW7A 2Q85A 1RM6B 2W3RA 4ML8A 1DZNA 1AHZA 4PVJA 1JRPA 3D2JA 3POPA 2EXRA 2Q4WA 1W1LA 2UUVA 1VDVA 5FXDA 3GSYA 5L6FA 5HQXA 2VFUA 3RJAA 2Y3SA 3TSHA 3TX1A 5HHZA 3W8WA 3HSUA 4JB1A 2Y08A 1W1RA 3PQBA 1E8FA 2P13A 3NVVB 1UXYA 1E0YA 2PLSA 5FXPA 1N5WC 1V97A 4PWCA 2W54A 3S1FA 1ZR6A 2WDWA 2E3TA 3DQ0A 2VAOA 3FW8A 4XLOA 2PLIA 1F0XA 3W8XA 5HMRA 4BCAA 3FW7A 1FIQB 3C0PA 5AWVA 2O3GA 4O95A 3RJ8A 4DNSA 1JROA 3FW9A 3LLBA 4PVKA 2W3SA 1W1JA 2VFTA 3D2DA 4JAYA 2NQWA 3EUB3 1N5XA 3I99A 5L6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVE A;  3D2H A;  4PWC A;  4UD8 A;  2Y3R A;  5K8E A;  1ZR6 A;  5I1W A;  3FWA A;  2WDW A;  2IPI A;  3FW8 A;  3TSJ A;  2UUU A;  4XLO A;  3W8X A;  3FW7 A;  5AWV A;  3RJ8 A;  4DNS A;  4PVJ A;  2Y4G A;  3D2J A;  3POP A;  2UUV A;  2BVF A;  4PZF A;  5L6F A;  3GSY A;  3RJA A;  3FW9 A;  2Y3S A;  3TSH A;  4PVK A;  3W8Z A;  2AXR A;  3W8W A;  4PVH A;  5I1V A;  5D79 A;  4PWB A;  3HSU A;  3D2D A;  2Y08 A;  3PQB A;  3VTE A;  4EC3 A;  2BVG A;  2BVH A;  5L6G A; 
#chains in the Genus database with same CATH topology
 2VFS A;  2I0K A;  3D2H A;  1W1K A;  4UD8 A;  3KJM A;  5G5H B;  2IPI A;  1SB3 B;  2UUU A;  1AHV A;  2GQT A;  2VFV A;  1WVE A;  4HG0 A;  1VAO A;  2OAI A;  3ETR B;  4OAL A;  5FXE A;  3AMZ A;  1WYG A;  3LAE A;  3NS1 B;  1W1O A;  5G5G B;  3SR6 B;  2BVF A;  2MBR A;  4PZF A;  4MLA A;  2GQU A;  3W8Z A;  1MBT A;  1W1Q A;  2AXR A;  2R2Z A;  4PVH A;  1W1M A;  5D79 A;  5I1V A;  4ZOH B;  1I19 A;  3NVY B;  1E8H A;  3VTE A;  4EC3 A;  2QPM A;  3B9J B;  1AHU A;  2BVH A;  3HRD C;  3S1C A;  3JS8 A;  4BC7 A;  1E8G A;  3NRZ B;  4PVE A;  3PM9 A;  1DIQ A;  3FWA A;  2P4P A;  1HSK A;  3NVZ B;  1DII A;  2P3H A;  4BBY A;  4PYT A;  1QLU A;  1N63 C;  1WVF A;  1N61 C;  3NVW B;  2QKN A;  5AE1 A;  1QLT A;  5AE2 A;  2Y4G A;  5AE3 A;  5ADZ A;  2R8D A;  1ZXI C;  1FFU C;  1MBB A;  2YVS A;  5FXF A;  1N60 C;  1N62 C;  4PWB A;  2RK5 A;  1FFV C;  1FO4 A;  2BVG A;  3DED A;  1W1S A;  3AN1 A;  2W55 A;  1T3Q C;  2Y3R A;  5K8E A;  5I1W A;  3S1E A;  3AM9 A;  3S1D A;  2VFR A;  3TSJ A;  4BC9 A;  3BW7 A;  2Q85 A;  1RM6 B;  2W3R A;  4ML8 A;  1DZN A;  1AHZ A;  4PVJ A;  1JRP A;  3D2J A;  3POP A;  2EXR A;  2Q4W A;  1W1L A;  2UUV A;  1VDV A;  5FXD A;  3GSY A;  5L6F A;  5HQX A;  2VFU A;  3RJA A;  2Y3S A;  3TSH A;  3TX1 A;  5HHZ A;  3W8W A;  3HSU A;  4JB1 A;  2Y08 A;  1W1R A;  3PQB A;  1E8F A;  2P13 A;  3NVV B;  1UXY A;  1E0Y A;  2PLS A;  5FXP A;  1N5W C;  1V97 A;  4PWC A;  2W54 A;  3S1F A;  1ZR6 A;  2WDW A;  2E3T A;  3DQ0 A;  2VAO A;  3FW8 A;  4XLO A;  2PLI A;  1F0X A;  3W8X A;  5HMR A;  4BCA A;  3FW7 A;  1FIQ B;  3C0P A;  5AWV A;  2O3G A;  4O95 A;  3RJ8 A;  4DNS A;  1JRO A;  3FW9 A;  3LLB A;  4PVK A;  2W3S A;  1W1J A;  2VFT A;  3D2D A;  4JAY A;  2NQW A;  3EUB 3;  1N5X A;  3I99 A;  5L6G A; 
#chains in the Genus database with same CATH homology
 2VFS A;  2I0K A;  3D2H A;  1W1K A;  4UD8 A;  3KJM A;  5G5H B;  2IPI A;  1SB3 B;  2UUU A;  1AHV A;  2GQT A;  2VFV A;  1WVE A;  4HG0 A;  1VAO A;  2OAI A;  3ETR B;  4OAL A;  5FXE A;  3AMZ A;  1WYG A;  3LAE A;  3NS1 B;  1W1O A;  5G5G B;  3SR6 B;  2BVF A;  2MBR A;  4PZF A;  4MLA A;  2GQU A;  3W8Z A;  1MBT A;  1W1Q A;  2AXR A;  2R2Z A;  4PVH A;  1W1M A;  5D79 A;  5I1V A;  4ZOH B;  1I19 A;  3NVY B;  1E8H A;  3VTE A;  4EC3 A;  2QPM A;  3B9J B;  1AHU A;  2BVH A;  3HRD C;  3S1C A;  3JS8 A;  4BC7 A;  1E8G A;  3NRZ B;  4PVE A;  3PM9 A;  1DIQ A;  3FWA A;  2P4P A;  1HSK A;  3NVZ B;  1DII A;  2P3H A;  4BBY A;  4PYT A;  1QLU A;  1N63 C;  1WVF A;  1N61 C;  3NVW B;  2QKN A;  5AE1 A;  1QLT A;  5AE2 A;  2Y4G A;  5AE3 A;  5ADZ A;  2R8D A;  1ZXI C;  1FFU C;  1MBB A;  2YVS A;  5FXF A;  1N60 C;  1N62 C;  4PWB A;  2RK5 A;  1FFV C;  1FO4 A;  2BVG A;  3DED A;  1W1S A;  3AN1 A;  2W55 A;  1T3Q C;  2Y3R A;  5K8E A;  5I1W A;  3S1E A;  3AM9 A;  3S1D A;  2VFR A;  3TSJ A;  4BC9 A;  3BW7 A;  2Q85 A;  1RM6 B;  2W3R A;  4ML8 A;  1DZN A;  1AHZ A;  4PVJ A;  1JRP A;  3D2J A;  3POP A;  2EXR A;  2Q4W A;  1W1L A;  2UUV A;  1VDV A;  5FXD A;  3GSY A;  5L6F A;  5HQX A;  2VFU A;  3RJA A;  2Y3S A;  3TSH A;  3TX1 A;  5HHZ A;  3W8W A;  3HSU A;  4JB1 A;  2Y08 A;  1W1R A;  3PQB A;  1E8F A;  2P13 A;  3NVV B;  1UXY A;  1E0Y A;  2PLS A;  5FXP A;  1N5W C;  1V97 A;  4PWC A;  2W54 A;  3S1F A;  1ZR6 A;  2WDW A;  2E3T A;  3DQ0 A;  2VAO A;  3FW8 A;  4XLO A;  2PLI A;  1F0X A;  3W8X A;  5HMR A;  4BCA A;  3FW7 A;  1FIQ B;  3C0P A;  5AWV A;  2O3G A;  4O95 A;  3RJ8 A;  4DNS A;  1JRO A;  3FW9 A;  3LLB A;  4PVK A;  2W3S A;  1W1J A;  2VFT A;  3D2D A;  4JAY A;  2NQW A;  3EUB 3;  1N5X A;  3I99 A;  5L6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...