2Y3RA

Structure of the tirandamycin-bound fad-dependent tirandamycin oxidase taml in p21 space group
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
496
structure length
492
Chain Sequence
IDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
molecule keywords TAML
total genus 163
structure length 492
sequence length 496
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y3rA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y3rA02
5D79A 2Y4GA 3FWAA 5AWVA 2BVGA 2UUUA 3D2DA 3D2HA 3FW8A 5I1VA 4PVEA 3FW7A 3D2JA 4XLOA 4PVJA 3PQBA 3HSUA 5L6FA 1ZR6A 3POPA 2BVHA 3RJAA 3W8XA 3VTEA 3TSHA 2WDWA 2Y3SA 3FW9A 5L6GA 2IPIA 4PWCA 3RJ8A 3GSYA 2Y3RA 5K8EA 4PVKA 4PVHA 4PZFA 3W8ZA 4EC3A 2UUVA 4PWBA 5I1WA 4UD8A 3W8WA 3TSJA 2Y08A 4DNSA 2AXRA 2BVFA
chains in the Genus database with same CATH superfamily
1N5XA 1MBBA 3NS1B 3FWAA 3TX1A 5G5HB 4BCAA 4MLAA 2BVGA 1E0YA 4HG0A 5FXPA 3FW8A 1N5WC 2QKNA 4PVEA 2W54A 3NVWB 1E8FA 3FW7A 5HQXA 1N60C 4BC7A 1N62C 1ZXIC 1W1JA 4JB1A 3DQ0A 3NVZB 2Q4WA 4ZOHB 2QPMA 1ZR6A 2VFRA 2P3HA 2VFUA 1N63C 1JROA 2R2ZA 4PWBA 3W8WA 1N61C 3TSJA 2Q85A 3HRDC 3S1FA 2BVFA 4PYTA 5G5GB 2VAOA 3AMZA 2W3RA 5FXFA 3D2HA 1SB3B 2O3GA 2VFTA 5ADZA 4PVJA 1VAOA 5FXDA 3SR6B 1WVFA 3S1DA 3S1CA 3POPA 2P4PA 2BVHA 1E8GA 2E3TA 2YVSA 2MBRA 2WDWA 2W55A 3GSYA 1I19A 1QLUA 4PZFA 2UUVA 4UD8A 5I1WA 1HSKA 3AM9A 3AN1A 2W3SA 2AXRA 1AHVA 2I0KA 3NVVB 3DEDA 5HHZA 2P13A 1DIQA 2Y4GA 5AWVA 2VFVA 3LAEA 1W1LA 3LLBA 2UUUA 3D2DA 4ML8A 2NQWA 2PLIA 1T3QC 3JS8A 5HMRA 3PQBA 3PM9A 3HSUA 5L6FA 3ETRB 3W8XA 5AE3A 3VTEA 1FIQB 3B9JB 1QLTA 3TSHA 5AE1A 1FFVC 1V97A 2PLSA 2R8DA 3EUB3 2IPIA 1W1MA 3FW9A 3NRZB 4PWCA 3RJ8A 1W1OA 4PVHA 1UXYA 1JRPA 1WYGA 1AHUA 1DZNA 1AHZA 2GQUA 2Y08A 3BW7A 1DIIA 5D79A 3C0PA 1F0XA 1VDVA 3KJMA 3NVYB 1WVEA 4OALA 4BC9A 2EXRA 1FFUC 5I1VA 4BBYA 5AE2A 4O95A 4JAYA 3D2JA 4XLOA 2VFSA 1W1RA 1RM6B 1W1SA 2OAIA 5FXEA 2GQTA 3S1EA 1FO4A 3RJAA 3I99A 1W1KA 1MBTA 2Y3SA 1E8HA 5L6GA 2RK5A 2Y3RA 5K8EA 4PVKA 4EC3A 3W8ZA 1W1QA 4DNSA
chains in the Genus database with same CATH topology
1N5XA 1MBBA 3NS1B 3FWAA 3TX1A 5G5HB 4BCAA 4MLAA 2BVGA 1E0YA 4HG0A 5FXPA 3FW8A 1N5WC 2QKNA 4PVEA 2W54A 3NVWB 1E8FA 3FW7A 5HQXA 1N60C 4BC7A 1N62C 1ZXIC 1W1JA 4JB1A 3DQ0A 3NVZB 2Q4WA 4ZOHB 2QPMA 1ZR6A 2VFRA 2P3HA 2VFUA 1N63C 1JROA 2R2ZA 4PWBA 3W8WA 1N61C 3TSJA 2Q85A 3HRDC 3S1FA 2BVFA 4PYTA 5G5GB 2VAOA 3AMZA 2W3RA 5FXFA 3D2HA 1SB3B 2O3GA 2VFTA 5ADZA 4PVJA 1VAOA 5FXDA 3SR6B 1WVFA 3S1DA 3S1CA 3POPA 2P4PA 2BVHA 1E8GA 2E3TA 2YVSA 2MBRA 2WDWA 2W55A 3GSYA 1I19A 1QLUA 4PZFA 2UUVA 4UD8A 5I1WA 1HSKA 3AM9A 3AN1A 2W3SA 2AXRA 1AHVA 2I0KA 3NVVB 3DEDA 5HHZA 2P13A 1DIQA 2Y4GA 5AWVA 2VFVA 3LAEA 1W1LA 3LLBA 2UUUA 3D2DA 4ML8A 2NQWA 2PLIA 1T3QC 3JS8A 5HMRA 3PQBA 3PM9A 3HSUA 5L6FA 3ETRB 3W8XA 5AE3A 3VTEA 1FIQB 3B9JB 1QLTA 3TSHA 5AE1A 1FFVC 1V97A 2PLSA 2R8DA 3EUB3 2IPIA 1W1MA 3FW9A 3NRZB 4PWCA 3RJ8A 1W1OA 4PVHA 1UXYA 1JRPA 1WYGA 1AHUA 1DZNA 1AHZA 2GQUA 2Y08A 3BW7A 1DIIA 5D79A 3C0PA 1F0XA 1VDVA 3KJMA 3NVYB 1WVEA 4OALA 4BC9A 2EXRA 1FFUC 5I1VA 4BBYA 5AE2A 4O95A 4JAYA 3D2JA 4XLOA 2VFSA 1W1RA 1RM6B 1W1SA 2OAIA 5FXEA 2GQTA 3S1EA 1FO4A 3RJAA 3I99A 1W1KA 1MBTA 2Y3SA 1E8HA 5L6GA 2RK5A 2Y3RA 5K8EA 4PVKA 4EC3A 3W8ZA 1W1QA 4DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D79 A;  2Y4G A;  3FWA A;  5AWV A;  2BVG A;  2UUU A;  3D2D A;  3D2H A;  3FW8 A;  5I1V A;  4PVE A;  3FW7 A;  3D2J A;  4XLO A;  4PVJ A;  3PQB A;  3HSU A;  5L6F A;  1ZR6 A;  3POP A;  2BVH A;  3RJA A;  3W8X A;  3VTE A;  3TSH A;  2WDW A;  2Y3S A;  3FW9 A;  5L6G A;  2IPI A;  4PWC A;  3RJ8 A;  3GSY A;  2Y3R A;  5K8E A;  4PVK A;  4PVH A;  4PZF A;  3W8Z A;  4EC3 A;  2UUV A;  4PWB A;  5I1W A;  4UD8 A;  3W8W A;  3TSJ A;  2Y08 A;  4DNS A;  2AXR A;  2BVF A; 
#chains in the Genus database with same CATH topology
 1N5X A;  1MBB A;  3NS1 B;  3FWA A;  3TX1 A;  5G5H B;  4BCA A;  4MLA A;  2BVG A;  1E0Y A;  4HG0 A;  5FXP A;  3FW8 A;  1N5W C;  2QKN A;  4PVE A;  2W54 A;  3NVW B;  1E8F A;  3FW7 A;  5HQX A;  1N60 C;  4BC7 A;  1N62 C;  1ZXI C;  1W1J A;  4JB1 A;  3DQ0 A;  3NVZ B;  2Q4W A;  4ZOH B;  2QPM A;  1ZR6 A;  2VFR A;  2P3H A;  2VFU A;  1N63 C;  1JRO A;  2R2Z A;  4PWB A;  3W8W A;  1N61 C;  3TSJ A;  2Q85 A;  3HRD C;  3S1F A;  2BVF A;  4PYT A;  5G5G B;  2VAO A;  3AMZ A;  2W3R A;  5FXF A;  3D2H A;  1SB3 B;  2O3G A;  2VFT A;  5ADZ A;  4PVJ A;  1VAO A;  5FXD A;  3SR6 B;  1WVF A;  3S1D A;  3S1C A;  3POP A;  2P4P A;  2BVH A;  1E8G A;  2E3T A;  2YVS A;  2MBR A;  2WDW A;  2W55 A;  3GSY A;  1I19 A;  1QLU A;  4PZF A;  2UUV A;  4UD8 A;  5I1W A;  1HSK A;  3AM9 A;  3AN1 A;  2W3S A;  2AXR A;  1AHV A;  2I0K A;  3NVV B;  3DED A;  5HHZ A;  2P13 A;  1DIQ A;  2Y4G A;  5AWV A;  2VFV A;  3LAE A;  1W1L A;  3LLB A;  2UUU A;  3D2D A;  4ML8 A;  2NQW A;  2PLI A;  1T3Q C;  3JS8 A;  5HMR A;  3PQB A;  3PM9 A;  3HSU A;  5L6F A;  3ETR B;  3W8X A;  5AE3 A;  3VTE A;  1FIQ B;  3B9J B;  1QLT A;  3TSH A;  5AE1 A;  1FFV C;  1V97 A;  2PLS A;  2R8D A;  3EUB 3;  2IPI A;  1W1M A;  3FW9 A;  3NRZ B;  4PWC A;  3RJ8 A;  1W1O A;  4PVH A;  1UXY A;  1JRP A;  1WYG A;  1AHU A;  1DZN A;  1AHZ A;  2GQU A;  2Y08 A;  3BW7 A;  1DII A;  5D79 A;  3C0P A;  1F0X A;  1VDV A;  3KJM A;  3NVY B;  1WVE A;  4OAL A;  4BC9 A;  2EXR A;  1FFU C;  5I1V A;  4BBY A;  5AE2 A;  4O95 A;  4JAY A;  3D2J A;  4XLO A;  2VFS A;  1W1R A;  1RM6 B;  1W1S A;  2OAI A;  5FXE A;  2GQT A;  3S1E A;  1FO4 A;  3RJA A;  3I99 A;  1W1K A;  1MBT A;  2Y3S A;  1E8H A;  5L6G A;  2RK5 A;  2Y3R A;  5K8E A;  4PVK A;  4EC3 A;  3W8Z A;  1W1Q A;  4DNS A; 
#chains in the Genus database with same CATH homology
 1N5X A;  1MBB A;  3NS1 B;  3FWA A;  3TX1 A;  5G5H B;  4BCA A;  4MLA A;  2BVG A;  1E0Y A;  4HG0 A;  5FXP A;  3FW8 A;  1N5W C;  2QKN A;  4PVE A;  2W54 A;  3NVW B;  1E8F A;  3FW7 A;  5HQX A;  1N60 C;  4BC7 A;  1N62 C;  1ZXI C;  1W1J A;  4JB1 A;  3DQ0 A;  3NVZ B;  2Q4W A;  4ZOH B;  2QPM A;  1ZR6 A;  2VFR A;  2P3H A;  2VFU A;  1N63 C;  1JRO A;  2R2Z A;  4PWB A;  3W8W A;  1N61 C;  3TSJ A;  2Q85 A;  3HRD C;  3S1F A;  2BVF A;  4PYT A;  5G5G B;  2VAO A;  3AMZ A;  2W3R A;  5FXF A;  3D2H A;  1SB3 B;  2O3G A;  2VFT A;  5ADZ A;  4PVJ A;  1VAO A;  5FXD A;  3SR6 B;  1WVF A;  3S1D A;  3S1C A;  3POP A;  2P4P A;  2BVH A;  1E8G A;  2E3T A;  2YVS A;  2MBR A;  2WDW A;  2W55 A;  3GSY A;  1I19 A;  1QLU A;  4PZF A;  2UUV A;  4UD8 A;  5I1W A;  1HSK A;  3AM9 A;  3AN1 A;  2W3S A;  2AXR A;  1AHV A;  2I0K A;  3NVV B;  3DED A;  5HHZ A;  2P13 A;  1DIQ A;  2Y4G A;  5AWV A;  2VFV A;  3LAE A;  1W1L A;  3LLB A;  2UUU A;  3D2D A;  4ML8 A;  2NQW A;  2PLI A;  1T3Q C;  3JS8 A;  5HMR A;  3PQB A;  3PM9 A;  3HSU A;  5L6F A;  3ETR B;  3W8X A;  5AE3 A;  3VTE A;  1FIQ B;  3B9J B;  1QLT A;  3TSH A;  5AE1 A;  1FFV C;  1V97 A;  2PLS A;  2R8D A;  3EUB 3;  2IPI A;  1W1M A;  3FW9 A;  3NRZ B;  4PWC A;  3RJ8 A;  1W1O A;  4PVH A;  1UXY A;  1JRP A;  1WYG A;  1AHU A;  1DZN A;  1AHZ A;  2GQU A;  2Y08 A;  3BW7 A;  1DII A;  5D79 A;  3C0P A;  1F0X A;  1VDV A;  3KJM A;  3NVY B;  1WVE A;  4OAL A;  4BC9 A;  2EXR A;  1FFU C;  5I1V A;  4BBY A;  5AE2 A;  4O95 A;  4JAY A;  3D2J A;  4XLO A;  2VFS A;  1W1R A;  1RM6 B;  1W1S A;  2OAI A;  5FXE A;  2GQT A;  3S1E A;  1FO4 A;  3RJA A;  3I99 A;  1W1K A;  1MBT A;  2Y3S A;  1E8H A;  5L6G A;  2RK5 A;  2Y3R A;  5K8E A;  4PVK A;  4EC3 A;  3W8Z A;  1W1Q A;  4DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...