4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
b'EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
molecule tags Oxidoreductase
source organism Phleum pratense
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
3POPA 3NVZB 2VFRA 4UD8A 2W3RA 1MBTA 3BW7A 5FXDA 2W3SA 3HSUA 1JROA 2I0KA 2MBRA 3FW8A 1E8FA 1FO4A 2GQTA 3JS8A 3AN1A 4PWCA 1FFVC 3EUB3 2WDWA 2Q85A 3TX1A 2EXRA 3D2DA 4BBYA 3W8XA 1N5XA 1DIIA 3W8WA 1T3QC 3RJAA 4ZOHB 1WYGA 5ADZA 1ZR6A 2BVHA 1ZXIC 1W1KA 1VDVA 1W1OA 3D2JA 1VAOA 4PVEA 2GQUA 5I1WA 3TSJA 3AMZA 3RJ8A 1E0YA 3D2HA 5AE1A 1DZNA 1F0XA 4BC9A 2E3TA 2Y4GA 4BC7A 2W55A 2IPIA 2Y3RA 3SR6B 4JAYA 5AE2A 1N5WC 1DIQA 3TSHA 1FFUC 2Y3SA 4PWBA 4O95A 1FIQB 5I1VA 1I19A 1N63C 2VFSA 1QLUA 3I99A 1E8GA 4PVJA 3W8ZA 1QLTA 5HMRA 3PQBA 2VFTA 2VFVA 3B9JB 2QKNA 1W1QA 2Q4WA 5HQXA 3S1EA 2QPMA 5FXFA 4BCAA 1HSKA 2BVFA 3VTEA 1WVEA 3FW7A 4DNSA 3S1CA 1AHUA 3AM9A 1E8HA 4PZFA 3GSYA 1W1LA 1W1RA 1W1SA 4JB1A 4PVKA 5AWVA 2VAOA 1N61C 5HHZA 2VFUA 5FXEA 1V97A 3FW9A 5FXPA 1AHZA 1N60C 3C0PA 2W54A 1W1MA 1WVFA 2AXRA 1W1JA 3FWAA 4ML8A 2BVGA 5K8EA 1MBBA 5D79A 4MLAA 5L6GA 2Y08A 4PYTA 5AE3A 3S1FA 4XLOA 3S1DA 4OALA 3DQ0A 3NRZB 5L6FA 4PVHA 3ETRB 1AHVA 3NS1B 4EC3A 3PM9A 1N62C 1UXYA 3KJMA
chains in the Genus database with same CATH superfamily
3POPA 3NVZB 2VFRA 4UD8A 2W3RA 2R2ZA 1MBTA 3BW7A 5FXDA 2W3SA 3HSUA 1JROA 2I0KA 2MBRA 3FW8A 1E8FA 1FO4A 2GQTA 3JS8A 2UUUA 2RK5A 3AN1A 4PWCA 1FFVC 3EUB3 2P3HA 2Q85A 3TX1A 2EXRA 3EJBB 2WDWA 3D2DA 4BBYA 3W8XA 1N5XA 1DIIA 3W8WA 1T3QC 5G5GB 3RJAA 4ZOHB 1WYGA 5ADZA 1ZR6A 2BVHA 1ZXIC 1W1KA 1VDVA 1W1OA 3D2JA 1VAOA 3EJEB 2YVSA 4PVEA 2R8DA 2GQUA 5I1WA 3TSJA 2OAIA 3AMZA 3RJ8A 1E0YA 3D2HA 5AE1A 1DZNA 1F0XA 4BC9A 2E3TA 2Y4GA 3HRDC 4BC7A 2W55A 2IPIA 2Y3RA 3SR6B 4JAYA 5AE2A 1N5WC 1DIQA 3TSHA 1FFUC 2PLSA 2Y3SA 3LLBA 4PWBA 4O95A 1FIQB 5I1VA 1I19A 1N63C 2VFSA 1QLUA 3I99A 3NVYB 1E8GA 4PVJA 3W8ZA 3DEDA 1QLTA 5HMRA 3PQBA 2VFTA 2VFVA 3B9JB 2QKNA 4HG0A 3NVWB 1W1QA 2Q4WA 5HQXA 3S1EA 2QPMA 5FXFA 4BCAA 1HSKA 2BVFA 3NVVB 1JRPA 3VTEA 1WVEA 2P13A 3FW7A 4DNSA 3S1CA 1AHUA 2UUVA 3AM9A 1E8HA 4PZFA 3GSYA 1W1LA 1W1RA 1W1SA 4JB1A 4PVKA 5AWVA 2VAOA 1N61C 5HHZA 2VFUA 5FXEA 1V97A 3FW9A 5FXPA 2NQWA 1AHZA 1N60C 3C0PA 2W54A 1W1MA 1RM6B 1WVFA 2AXRA 2PLIA 1W1JA 5G5HB 3FWAA 4ML8A 2BVGA 5K8EA 1MBBA 5D79A 4MLAA 5L6GA 2Y08A 4PYTA 3EJDB 5AE3A 2P4PA 3LAEA 3S1FA 4XLOA 1SB3B 3S1DA 4OALA 3DQ0A 3NRZB 5L6FA 4PVHA 2O3GA 3ETRB 1AHVA 3NS1B 4EC3A 3PM9A 1N62C 1UXYA 3KJMA
chains in the Genus database with same CATH topology
3POPA 3NVZB 2VFRA 4UD8A 2W3RA 2R2ZA 1MBTA 3BW7A 5FXDA 2W3SA 3HSUA 1JROA 2I0KA 2MBRA 3FW8A 1E8FA 1FO4A 2GQTA 3JS8A 2UUUA 2RK5A 3AN1A 4PWCA 1FFVC 3EUB3 2P3HA 2Q85A 3TX1A 2EXRA 2WDWA 3D2DA 4BBYA 3W8XA 1N5XA 1DIIA 3W8WA 1T3QC 5G5GB 3RJAA 4ZOHB 1WYGA 5ADZA 1ZR6A 2BVHA 1ZXIC 1W1KA 1VDVA 1W1OA 3D2JA 1VAOA 2YVSA 4PVEA 2R8DA 2GQUA 5I1WA 3TSJA 2OAIA 3AMZA 3RJ8A 1E0YA 3D2HA 5AE1A 1DZNA 1F0XA 4BC9A 2E3TA 2Y4GA 3HRDC 4BC7A 2W55A 2IPIA 2Y3RA 3SR6B 4JAYA 5AE2A 1N5WC 1DIQA 3TSHA 1FFUC 2PLSA 2Y3SA 3LLBA 4PWBA 4O95A 1FIQB 5I1VA 1I19A 1N63C 2VFSA 1QLUA 3I99A 3NVYB 1E8GA 4PVJA 3W8ZA 3DEDA 1QLTA 5HMRA 3PQBA 2VFTA 2VFVA 3B9JB 2QKNA 4HG0A 3NVWB 1W1QA 2Q4WA 5HQXA 3S1EA 2QPMA 5FXFA 4BCAA 1HSKA 2BVFA 1JRPA 3NVVB 3VTEA 1WVEA 2P13A 3FW7A 4DNSA 3S1CA 1AHUA 2UUVA 3AM9A 1E8HA 4PZFA 3GSYA 1W1LA 1W1RA 1W1SA 4JB1A 4PVKA 5AWVA 2VAOA 1N61C 5HHZA 2VFUA 5FXEA 1V97A 3FW9A 5FXPA 2NQWA 1AHZA 1N60C 3C0PA 2W54A 1W1MA 1RM6B 1WVFA 2AXRA 2PLIA 1W1JA 5G5HB 3FWAA 4ML8A 2BVGA 5K8EA 1MBBA 5D79A 4MLAA 5L6GA 2Y08A 4PYTA 5AE3A 2P4PA 3LAEA 3S1FA 4XLOA 1SB3B 3S1DA 4OALA 3DQ0A 3NRZB 5L6FA 4PVHA 2O3GA 3ETRB 1AHVA 3NS1B 4EC3A 3PM9A 1N62C 1UXYA 3KJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POP A;  3NVZ B;  2VFR A;  4UD8 A;  2W3R A;  1MBT A;  3BW7 A;  5FXD A;  2W3S A;  3HSU A;  1JRO A;  2I0K A;  2MBR A;  3FW8 A;  1E8F A;  1FO4 A;  2GQT A;  3JS8 A;  3AN1 A;  4PWC A;  1FFV C;  3EUB 3;  2WDW A;  2Q85 A;  3TX1 A;  2EXR A;  3D2D A;  4BBY A;  3W8X A;  1N5X A;  1DII A;  3W8W A;  1T3Q C;  3RJA A;  4ZOH B;  1WYG A;  5ADZ A;  1ZR6 A;  2BVH A;  1ZXI C;  1W1K A;  1VDV A;  1W1O A;  3D2J A;  1VAO A;  4PVE A;  2GQU A;  5I1W A;  3TSJ A;  3AMZ A;  3RJ8 A;  1E0Y A;  3D2H A;  5AE1 A;  1DZN A;  1F0X A;  4BC9 A;  2E3T A;  2Y4G A;  4BC7 A;  2W55 A;  2IPI A;  2Y3R A;  3SR6 B;  4JAY A;  5AE2 A;  1N5W C;  1DIQ A;  3TSH A;  1FFU C;  2Y3S A;  4PWB A;  4O95 A;  1FIQ B;  5I1V A;  1I19 A;  1N63 C;  2VFS A;  1QLU A;  3I99 A;  1E8G A;  4PVJ A;  3W8Z A;  1QLT A;  5HMR A;  3PQB A;  2VFT A;  2VFV A;  3B9J B;  2QKN A;  1W1Q A;  2Q4W A;  5HQX A;  3S1E A;  2QPM A;  5FXF A;  4BCA A;  1HSK A;  2BVF A;  3VTE A;  1WVE A;  3FW7 A;  4DNS A;  3S1C A;  1AHU A;  3AM9 A;  1E8H A;  4PZF A;  3GSY A;  1W1L A;  1W1R A;  1W1S A;  4JB1 A;  4PVK A;  5AWV A;  2VAO A;  1N61 C;  5HHZ A;  2VFU A;  5FXE A;  1V97 A;  3FW9 A;  5FXP A;  1AHZ A;  1N60 C;  3C0P A;  2W54 A;  1W1M A;  1WVF A;  2AXR A;  1W1J A;  3FWA A;  4ML8 A;  2BVG A;  5K8E A;  1MBB A;  5D79 A;  4MLA A;  5L6G A;  2Y08 A;  4PYT A;  5AE3 A;  3S1F A;  4XLO A;  3S1D A;  4OAL A;  3DQ0 A;  3NRZ B;  5L6F A;  4PVH A;  3ETR B;  1AHV A;  3NS1 B;  4EC3 A;  3PM9 A;  1N62 C;  1UXY A;  3KJM A; 
#chains in the Genus database with same CATH topology
 3POP A;  3NVZ B;  2VFR A;  4UD8 A;  2W3R A;  2R2Z A;  1MBT A;  3BW7 A;  5FXD A;  2W3S A;  3HSU A;  1JRO A;  2I0K A;  2MBR A;  3FW8 A;  1E8F A;  1FO4 A;  2GQT A;  3JS8 A;  2UUU A;  2RK5 A;  3AN1 A;  4PWC A;  1FFV C;  3EUB 3;  2P3H A;  2Q85 A;  3TX1 A;  2EXR A;  3EJB B;  2WDW A;  3D2D A;  4BBY A;  3W8X A;  1N5X A;  1DII A;  3W8W A;  1T3Q C;  5G5G B;  3RJA A;  4ZOH B;  1WYG A;  5ADZ A;  1ZR6 A;  2BVH A;  1ZXI C;  1W1K A;  1VDV A;  1W1O A;  3D2J A;  1VAO A;  3EJE B;  2YVS A;  4PVE A;  2R8D A;  2GQU A;  5I1W A;  3TSJ A;  2OAI A;  3AMZ A;  3RJ8 A;  1E0Y A;  3D2H A;  5AE1 A;  1DZN A;  1F0X A;  4BC9 A;  2E3T A;  2Y4G A;  3HRD C;  4BC7 A;  2W55 A;  2IPI A;  2Y3R A;  3SR6 B;  4JAY A;  5AE2 A;  1N5W C;  1DIQ A;  3TSH A;  1FFU C;  2PLS A;  2Y3S A;  3LLB A;  4PWB A;  4O95 A;  1FIQ B;  5I1V A;  1I19 A;  1N63 C;  2VFS A;  1QLU A;  3I99 A;  3NVY B;  1E8G A;  4PVJ A;  3W8Z A;  3DED A;  1QLT A;  5HMR A;  3PQB A;  2VFT A;  2VFV A;  3B9J B;  2QKN A;  4HG0 A;  3NVW B;  1W1Q A;  2Q4W A;  5HQX A;  3S1E A;  2QPM A;  5FXF A;  4BCA A;  1HSK A;  2BVF A;  3NVV B;  1JRP A;  3VTE A;  1WVE A;  2P13 A;  3FW7 A;  4DNS A;  3S1C A;  1AHU A;  2UUV A;  3AM9 A;  1E8H A;  4PZF A;  3GSY A;  1W1L A;  1W1R A;  1W1S A;  4JB1 A;  4PVK A;  5AWV A;  2VAO A;  1N61 C;  5HHZ A;  2VFU A;  5FXE A;  1V97 A;  3FW9 A;  5FXP A;  2NQW A;  1AHZ A;  1N60 C;  3C0P A;  2W54 A;  1W1M A;  1RM6 B;  1WVF A;  2AXR A;  2PLI A;  1W1J A;  5G5H B;  3FWA A;  4ML8 A;  2BVG A;  5K8E A;  1MBB A;  5D79 A;  4MLA A;  5L6G A;  2Y08 A;  4PYT A;  3EJD B;  5AE3 A;  2P4P A;  3LAE A;  3S1F A;  4XLO A;  1SB3 B;  3S1D A;  4OAL A;  3DQ0 A;  3NRZ B;  5L6F A;  4PVH A;  2O3G A;  3ETR B;  1AHV A;  3NS1 B;  4EC3 A;  3PM9 A;  1N62 C;  1UXY A;  3KJM A; 
#chains in the Genus database with same CATH homology
 3POP A;  3NVZ B;  2VFR A;  4UD8 A;  2W3R A;  2R2Z A;  1MBT A;  3BW7 A;  5FXD A;  2W3S A;  3HSU A;  1JRO A;  2I0K A;  2MBR A;  3FW8 A;  1E8F A;  1FO4 A;  2GQT A;  3JS8 A;  2UUU A;  2RK5 A;  3AN1 A;  4PWC A;  1FFV C;  3EUB 3;  2P3H A;  2Q85 A;  3TX1 A;  2EXR A;  2WDW A;  3D2D A;  4BBY A;  3W8X A;  1N5X A;  1DII A;  3W8W A;  1T3Q C;  5G5G B;  3RJA A;  4ZOH B;  1WYG A;  5ADZ A;  1ZR6 A;  2BVH A;  1ZXI C;  1W1K A;  1VDV A;  1W1O A;  3D2J A;  1VAO A;  2YVS A;  4PVE A;  2R8D A;  2GQU A;  5I1W A;  3TSJ A;  2OAI A;  3AMZ A;  3RJ8 A;  1E0Y A;  3D2H A;  5AE1 A;  1DZN A;  1F0X A;  4BC9 A;  2E3T A;  2Y4G A;  3HRD C;  4BC7 A;  2W55 A;  2IPI A;  2Y3R A;  3SR6 B;  4JAY A;  5AE2 A;  1N5W C;  1DIQ A;  3TSH A;  1FFU C;  2PLS A;  2Y3S A;  3LLB A;  4PWB A;  4O95 A;  1FIQ B;  5I1V A;  1I19 A;  1N63 C;  2VFS A;  1QLU A;  3I99 A;  3NVY B;  1E8G A;  4PVJ A;  3W8Z A;  3DED A;  1QLT A;  5HMR A;  3PQB A;  2VFT A;  2VFV A;  3B9J B;  2QKN A;  4HG0 A;  3NVW B;  1W1Q A;  2Q4W A;  5HQX A;  3S1E A;  2QPM A;  5FXF A;  4BCA A;  1HSK A;  2BVF A;  1JRP A;  3NVV B;  3VTE A;  1WVE A;  2P13 A;  3FW7 A;  4DNS A;  3S1C A;  1AHU A;  2UUV A;  3AM9 A;  1E8H A;  4PZF A;  3GSY A;  1W1L A;  1W1R A;  1W1S A;  4JB1 A;  4PVK A;  5AWV A;  2VAO A;  1N61 C;  5HHZ A;  2VFU A;  5FXE A;  1V97 A;  3FW9 A;  5FXP A;  2NQW A;  1AHZ A;  1N60 C;  3C0P A;  2W54 A;  1W1M A;  1RM6 B;  1WVF A;  2AXR A;  2PLI A;  1W1J A;  5G5H B;  3FWA A;  4ML8 A;  2BVG A;  5K8E A;  1MBB A;  5D79 A;  4MLA A;  5L6G A;  2Y08 A;  4PYT A;  5AE3 A;  2P4P A;  3LAE A;  3S1F A;  4XLO A;  1SB3 B;  3S1D A;  4OAL A;  3DQ0 A;  3NRZ B;  5L6F A;  4PVH A;  2O3G A;  3ETR B;  1AHV A;  3NS1 B;  4EC3 A;  3PM9 A;  1N62 C;  1UXY A;  3KJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...