4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
4ZOHB 1W1OA 1AHUA 1AHVA 1E8FA 3D2JA 2GQTA 5L6FA 1W1MA 2E3TA 5FXFA 1N5XA 1QLTA 3PM9A 3RJAA 1VDVA 3D2DA 4PYTA 4UD8A 5AE1A 5HMRA 2Q4WA 1E0YA 1E8GA 5FXDA 1N62C 1W1JA 1F0XA 3BW7A 5FXEA 1FO4A 2WDWA 5FXPA 5K8EA 4MLAA 2Q85A 3KJMA 3DQ0A 2AXRA 2VFVA 4EC3A 5L6GA 3B9JB 2VFTA 5HQXA 3PQBA 4OALA 2QKNA 4PVEA 1WYGA 3AN1A 4XLOA 4PZFA 3TX1A 1JROA 3D2HA 4PVHA 2VFSA 1MBTA 5D79A 3S1EA 1W1SA 3TSJA 3S1DA 1FFUC 3FWAA 2W55A 2Y3SA 4PWCA 1W1KA 2BVFA 2BVGA 3RJ8A 1E8HA 1WVFA 3POPA 1VAOA 1AHZA 1ZR6A 3NVZB 1I19A 3EUB3 3I99A 5AE3A 3C0PA 3GSYA 1W1RA 3FW9A 2GQUA 4BC9A 1HSKA 4O95A 3NRZB 4BBYA 3ETRB 2W3SA 1DZNA 2W3RA 4DNSA 2VFUA 4PWBA 3W8ZA 4JB1A 2QPMA 4BCAA 4PVKA 1N60C 1UXYA 1WVEA 4BC7A 1V97A 3S1FA 2W54A 3JS8A 2EXRA 2Y4GA 1FFVC 3VTEA 1W1LA 1N63C 3W8WA 1DIIA 4JAYA 5ADZA 3HSUA 2Y08A 3W8XA 1QLUA 5AE2A 5HHZA 4ML8A 2VFRA 2MBRA 2VAOA 1FIQB 3AM9A 1N5WC 1ZXIC 1DIQA 3SR6B 3AMZA 3TSHA 3S1CA 2BVHA 3FW7A 2IPIA 1T3QC 5I1VA 2Y3RA 5I1WA 2I0KA 1MBBA 1W1QA 4PVJA 1N61C 3FW8A 5AWVA 3NS1B
chains in the Genus database with same CATH superfamily
4ZOHB 1W1OA 1AHUA 1AHVA 1E8FA 3D2JA 2GQTA 5L6FA 1W1MA 2E3TA 3LLBA 5FXFA 2P13A 1N5XA 1QLTA 3NVVB 3PM9A 3RJAA 1VDVA 3D2DA 4PYTA 2PLIA 4UD8A 5AE1A 5HMRA 2Q4WA 1E0YA 1E8GA 5FXDA 1N62C 1W1JA 1F0XA 3BW7A 5FXEA 1FO4A 2WDWA 5FXPA 5K8EA 4MLAA 2Q85A 1SB3B 2P3HA 2R2ZA 3KJMA 3DEDA 3DQ0A 2AXRA 2VFVA 4EC3A 5L6GA 3B9JB 2VFTA 5HQXA 3PQBA 4OALA 2R8DA 2QKNA 4PVEA 1WYGA 3AN1A 4XLOA 4PZFA 3TX1A 1JROA 3D2HA 4PVHA 2NQWA 2VFSA 1MBTA 5D79A 3S1EA 1W1SA 3TSJA 3S1DA 1FFUC 3FWAA 2W55A 2Y3SA 4PWCA 5G5HB 1W1KA 2BVFA 2BVGA 3RJ8A 1E8HA 1WVFA 3NVYB 3POPA 5G5GB 3NVWB 1VAOA 2YVSA 1AHZA 1ZR6A 3NVZB 1I19A 3EUB3 3I99A 5AE3A 2UUUA 3C0PA 3GSYA 1W1RA 3FW9A 2GQUA 4BC9A 1HSKA 4O95A 3EJEB 3NRZB 4BBYA 3ETRB 2W3SA 3EJBB 1DZNA 4HG0A 2W3RA 4DNSA 2VFUA 4PWBA 3W8ZA 2OAIA 4JB1A 2QPMA 4BCAA 4PVKA 1N60C 1UXYA 1WVEA 4BC7A 1V97A 3S1FA 2W54A 3JS8A 3HRDC 2EXRA 1RM6B 2Y4GA 1FFVC 3VTEA 1W1LA 1N63C 3W8WA 1DIIA 4JAYA 5ADZA 3HSUA 2Y08A 3W8XA 1QLUA 5AE2A 5HHZA 4ML8A 2UUVA 2VFRA 2MBRA 1JRPA 2VAOA 1FIQB 3AM9A 3LAEA 1N5WC 1ZXIC 1DIQA 2P4PA 3SR6B 3AMZA 2O3GA 3TSHA 3S1CA 3EJDB 2BVHA 3FW7A 2IPIA 1T3QC 5I1VA 2Y3RA 5I1WA 2I0KA 1MBBA 1W1QA 2PLSA 4PVJA 2RK5A 1N61C 3FW8A 5AWVA 3NS1B
chains in the Genus database with same CATH topology
4ZOHB 1W1OA 1AHUA 1AHVA 1E8FA 3D2JA 2GQTA 5L6FA 1W1MA 2E3TA 3LLBA 5FXFA 2P13A 1N5XA 1QLTA 3PM9A 3NVVB 3RJAA 1VDVA 3D2DA 4PYTA 2PLIA 4UD8A 5AE1A 5HMRA 2Q4WA 1E0YA 1E8GA 5FXDA 1N62C 1W1JA 1F0XA 3BW7A 5FXEA 1FO4A 2WDWA 5FXPA 5K8EA 4MLAA 2Q85A 1SB3B 2P3HA 2R2ZA 3KJMA 3DEDA 3DQ0A 2AXRA 2VFVA 4EC3A 5L6GA 3B9JB 2VFTA 5HQXA 3PQBA 4OALA 2R8DA 2QKNA 4PVEA 1WYGA 3AN1A 4XLOA 4PZFA 3TX1A 1JROA 3D2HA 4PVHA 2NQWA 2VFSA 1MBTA 5D79A 3S1EA 1W1SA 3TSJA 3S1DA 1FFUC 3FWAA 2W55A 2Y3SA 4PWCA 5G5HB 1W1KA 2BVFA 2BVGA 3RJ8A 1E8HA 1WVFA 3NVYB 3POPA 5G5GB 3NVWB 1VAOA 2YVSA 1AHZA 1ZR6A 3NVZB 1I19A 3EUB3 3I99A 5AE3A 2UUUA 3C0PA 3GSYA 1W1RA 3FW9A 2GQUA 4BC9A 1HSKA 4O95A 3NRZB 4BBYA 3ETRB 2W3SA 1DZNA 4HG0A 2W3RA 4DNSA 2VFUA 4PWBA 3W8ZA 2OAIA 4JB1A 2QPMA 4BCAA 4PVKA 1N60C 1UXYA 1WVEA 4BC7A 1V97A 3S1FA 2W54A 3JS8A 3HRDC 2EXRA 1RM6B 2Y4GA 1FFVC 3VTEA 1W1LA 1N63C 3W8WA 1DIIA 4JAYA 5ADZA 3HSUA 2Y08A 3W8XA 1QLUA 5AE2A 5HHZA 4ML8A 2UUVA 2VFRA 2MBRA 1JRPA 2VAOA 1FIQB 3AM9A 3LAEA 1N5WC 1ZXIC 1DIQA 2P4PA 3SR6B 3AMZA 2O3GA 3TSHA 3S1CA 2BVHA 3FW7A 2IPIA 1T3QC 5I1VA 2Y3RA 5I1WA 2I0KA 1MBBA 1W1QA 2PLSA 4PVJA 2RK5A 1N61C 3FW8A 5AWVA 3NS1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZOH B;  1W1O A;  1AHU A;  1AHV A;  1E8F A;  3D2J A;  2GQT A;  5L6F A;  1W1M A;  2E3T A;  5FXF A;  1N5X A;  1QLT A;  3PM9 A;  3RJA A;  1VDV A;  3D2D A;  4PYT A;  4UD8 A;  5AE1 A;  5HMR A;  2Q4W A;  1E0Y A;  1E8G A;  5FXD A;  1N62 C;  1W1J A;  1F0X A;  3BW7 A;  5FXE A;  1FO4 A;  2WDW A;  5FXP A;  5K8E A;  4MLA A;  2Q85 A;  3KJM A;  3DQ0 A;  2AXR A;  2VFV A;  4EC3 A;  5L6G A;  3B9J B;  2VFT A;  5HQX A;  3PQB A;  4OAL A;  2QKN A;  4PVE A;  1WYG A;  3AN1 A;  4XLO A;  4PZF A;  3TX1 A;  1JRO A;  3D2H A;  4PVH A;  2VFS A;  1MBT A;  5D79 A;  3S1E A;  1W1S A;  3TSJ A;  3S1D A;  1FFU C;  3FWA A;  2W55 A;  2Y3S A;  4PWC A;  1W1K A;  2BVF A;  2BVG A;  3RJ8 A;  1E8H A;  1WVF A;  3POP A;  1VAO A;  1AHZ A;  1ZR6 A;  3NVZ B;  1I19 A;  3EUB 3;  3I99 A;  5AE3 A;  3C0P A;  3GSY A;  1W1R A;  3FW9 A;  2GQU A;  4BC9 A;  1HSK A;  4O95 A;  3NRZ B;  4BBY A;  3ETR B;  2W3S A;  1DZN A;  2W3R A;  4DNS A;  2VFU A;  4PWB A;  3W8Z A;  4JB1 A;  2QPM A;  4BCA A;  4PVK A;  1N60 C;  1UXY A;  1WVE A;  4BC7 A;  1V97 A;  3S1F A;  2W54 A;  3JS8 A;  2EXR A;  2Y4G A;  1FFV C;  3VTE A;  1W1L A;  1N63 C;  3W8W A;  1DII A;  4JAY A;  5ADZ A;  3HSU A;  2Y08 A;  3W8X A;  1QLU A;  5AE2 A;  5HHZ A;  4ML8 A;  2VFR A;  2MBR A;  2VAO A;  1FIQ B;  3AM9 A;  1N5W C;  1ZXI C;  1DIQ A;  3SR6 B;  3AMZ A;  3TSH A;  3S1C A;  2BVH A;  3FW7 A;  2IPI A;  1T3Q C;  5I1V A;  2Y3R A;  5I1W A;  2I0K A;  1MBB A;  1W1Q A;  4PVJ A;  1N61 C;  3FW8 A;  5AWV A;  3NS1 B; 
#chains in the Genus database with same CATH topology
 4ZOH B;  1W1O A;  1AHU A;  1AHV A;  1E8F A;  3D2J A;  2GQT A;  5L6F A;  1W1M A;  2E3T A;  3LLB A;  5FXF A;  2P13 A;  1N5X A;  1QLT A;  3NVV B;  3PM9 A;  3RJA A;  1VDV A;  3D2D A;  4PYT A;  2PLI A;  4UD8 A;  5AE1 A;  5HMR A;  2Q4W A;  1E0Y A;  1E8G A;  5FXD A;  1N62 C;  1W1J A;  1F0X A;  3BW7 A;  5FXE A;  1FO4 A;  2WDW A;  5FXP A;  5K8E A;  4MLA A;  2Q85 A;  1SB3 B;  2P3H A;  2R2Z A;  3KJM A;  3DED A;  3DQ0 A;  2AXR A;  2VFV A;  4EC3 A;  5L6G A;  3B9J B;  2VFT A;  5HQX A;  3PQB A;  4OAL A;  2R8D A;  2QKN A;  4PVE A;  1WYG A;  3AN1 A;  4XLO A;  4PZF A;  3TX1 A;  1JRO A;  3D2H A;  4PVH A;  2NQW A;  2VFS A;  1MBT A;  5D79 A;  3S1E A;  1W1S A;  3TSJ A;  3S1D A;  1FFU C;  3FWA A;  2W55 A;  2Y3S A;  4PWC A;  5G5H B;  1W1K A;  2BVF A;  2BVG A;  3RJ8 A;  1E8H A;  1WVF A;  3NVY B;  3POP A;  5G5G B;  3NVW B;  1VAO A;  2YVS A;  1AHZ A;  1ZR6 A;  3NVZ B;  1I19 A;  3EUB 3;  3I99 A;  5AE3 A;  2UUU A;  3C0P A;  3GSY A;  1W1R A;  3FW9 A;  2GQU A;  4BC9 A;  1HSK A;  4O95 A;  3EJE B;  3NRZ B;  4BBY A;  3ETR B;  2W3S A;  3EJB B;  1DZN A;  4HG0 A;  2W3R A;  4DNS A;  2VFU A;  4PWB A;  3W8Z A;  2OAI A;  4JB1 A;  2QPM A;  4BCA A;  4PVK A;  1N60 C;  1UXY A;  1WVE A;  4BC7 A;  1V97 A;  3S1F A;  2W54 A;  3JS8 A;  3HRD C;  2EXR A;  1RM6 B;  2Y4G A;  1FFV C;  3VTE A;  1W1L A;  1N63 C;  3W8W A;  1DII A;  4JAY A;  5ADZ A;  3HSU A;  2Y08 A;  3W8X A;  1QLU A;  5AE2 A;  5HHZ A;  4ML8 A;  2UUV A;  2VFR A;  2MBR A;  1JRP A;  2VAO A;  1FIQ B;  3AM9 A;  3LAE A;  1N5W C;  1ZXI C;  1DIQ A;  2P4P A;  3SR6 B;  3AMZ A;  2O3G A;  3TSH A;  3S1C A;  3EJD B;  2BVH A;  3FW7 A;  2IPI A;  1T3Q C;  5I1V A;  2Y3R A;  5I1W A;  2I0K A;  1MBB A;  1W1Q A;  2PLS A;  4PVJ A;  2RK5 A;  1N61 C;  3FW8 A;  5AWV A;  3NS1 B; 
#chains in the Genus database with same CATH homology
 4ZOH B;  1W1O A;  1AHU A;  1AHV A;  1E8F A;  3D2J A;  2GQT A;  5L6F A;  1W1M A;  2E3T A;  3LLB A;  5FXF A;  2P13 A;  1N5X A;  1QLT A;  3PM9 A;  3NVV B;  3RJA A;  1VDV A;  3D2D A;  4PYT A;  2PLI A;  4UD8 A;  5AE1 A;  5HMR A;  2Q4W A;  1E0Y A;  1E8G A;  5FXD A;  1N62 C;  1W1J A;  1F0X A;  3BW7 A;  5FXE A;  1FO4 A;  2WDW A;  5FXP A;  5K8E A;  4MLA A;  2Q85 A;  1SB3 B;  2P3H A;  2R2Z A;  3KJM A;  3DED A;  3DQ0 A;  2AXR A;  2VFV A;  4EC3 A;  5L6G A;  3B9J B;  2VFT A;  5HQX A;  3PQB A;  4OAL A;  2R8D A;  2QKN A;  4PVE A;  1WYG A;  3AN1 A;  4XLO A;  4PZF A;  3TX1 A;  1JRO A;  3D2H A;  4PVH A;  2NQW A;  2VFS A;  1MBT A;  5D79 A;  3S1E A;  1W1S A;  3TSJ A;  3S1D A;  1FFU C;  3FWA A;  2W55 A;  2Y3S A;  4PWC A;  5G5H B;  1W1K A;  2BVF A;  2BVG A;  3RJ8 A;  1E8H A;  1WVF A;  3NVY B;  3POP A;  5G5G B;  3NVW B;  1VAO A;  2YVS A;  1AHZ A;  1ZR6 A;  3NVZ B;  1I19 A;  3EUB 3;  3I99 A;  5AE3 A;  2UUU A;  3C0P A;  3GSY A;  1W1R A;  3FW9 A;  2GQU A;  4BC9 A;  1HSK A;  4O95 A;  3NRZ B;  4BBY A;  3ETR B;  2W3S A;  1DZN A;  4HG0 A;  2W3R A;  4DNS A;  2VFU A;  4PWB A;  3W8Z A;  2OAI A;  4JB1 A;  2QPM A;  4BCA A;  4PVK A;  1N60 C;  1UXY A;  1WVE A;  4BC7 A;  1V97 A;  3S1F A;  2W54 A;  3JS8 A;  3HRD C;  2EXR A;  1RM6 B;  2Y4G A;  1FFV C;  3VTE A;  1W1L A;  1N63 C;  3W8W A;  1DII A;  4JAY A;  5ADZ A;  3HSU A;  2Y08 A;  3W8X A;  1QLU A;  5AE2 A;  5HHZ A;  4ML8 A;  2UUV A;  2VFR A;  2MBR A;  1JRP A;  2VAO A;  1FIQ B;  3AM9 A;  3LAE A;  1N5W C;  1ZXI C;  1DIQ A;  2P4P A;  3SR6 B;  3AMZ A;  2O3G A;  3TSH A;  3S1C A;  2BVH A;  3FW7 A;  2IPI A;  1T3Q C;  5I1V A;  2Y3R A;  5I1W A;  2I0K A;  1MBB A;  1W1Q A;  2PLS A;  4PVJ A;  2RK5 A;  1N61 C;  3FW8 A;  5AWV A;  3NS1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...