4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
1AHZA 2BVGA 1FO4A 4BC7A 3AM9A 5I1VA 1WYGA 2EXRA 5HHZA 2I0KA 2VFSA 3SR6B 4BBYA 4DNSA 1ZR6A 2QKNA 3GSYA 5AE1A 5HQXA 2W3SA 1MBTA 2GQUA 3FW7A 4JB1A 3PM9A 4PWCA 2VFVA 1DZNA 1MBBA 3AN1A 1FFUC 4MLAA 3B9JB 3TSJA 1QLUA 3FW8A 2Y3SA 5FXEA 3NVZB 4PVKA 1VAOA 2Y4GA 5FXFA 2MBRA 2VAOA 4JAYA 4EC3A 2Q85A 5L6FA 2W3RA 2Y3RA 1N61C 1N5WC 1N5XA 3S1EA 1E0YA 2W54A 5AE2A 4PVJA 2BVFA 2GQTA 2BVHA 3RJ8A 1VDVA 2Q4WA 5FXDA 1F0XA 1FFVC 1W1OA 3AMZA 1T3QC 1W1SA 4PWBA 2VFTA 3DQ0A 3W8XA 3KJMA 1FIQB 3PQBA 3W8WA 4OALA 3S1DA 1W1RA 4PZFA 5K8EA 5L6GA 3POPA 1E8FA 1N63C 1QLTA 3EUB3 2WDWA 3NS1B 1AHVA 5I1WA 4PYTA 1W1JA 4PVHA 3VTEA 5AWVA 1E8HA 2W55A 1WVEA 1W1KA 1JROA 2AXRA 3D2JA 1E8GA 4O95A 3NRZB 3BW7A 3S1CA 1HSKA 3FWAA 1N62C 5AE3A 2Y08A 5D79A 3TSHA 1W1MA 4ZOHB 3RJAA 3D2DA 3TX1A 1UXYA 3S1FA 1DIIA 1DIQA 4UD8A 5HMRA 5ADZA 3I99A 1WVFA 4ML8A 4XLOA 3FW9A 2E3TA 3HSUA 3C0PA 5FXPA 1W1LA 2QPMA 3JS8A 2VFRA 1AHUA 4BC9A 1V97A 1ZXIC 3ETRB 4BCAA 1N60C 3D2HA 2IPIA 2VFUA 1I19A 1W1QA 4PVEA 3W8ZA
chains in the Genus database with same CATH superfamily
1AHZA 2P4PA 2BVGA 1FO4A 5G5GB 4BC7A 3AM9A 3HRDC 1WYGA 2EXRA 5I1VA 2R2ZA 5HHZA 2I0KA 2VFSA 3SR6B 4BBYA 4DNSA 1ZR6A 2QKNA 3GSYA 1JRPA 5AE1A 5HQXA 2W3SA 1MBTA 2GQUA 3FW7A 4JB1A 3PM9A 4PWCA 2VFVA 1DZNA 1MBBA 3AN1A 1FFUC 4MLAA 2R8DA 3B9JB 3TSJA 1QLUA 3FW8A 2Y3SA 5FXEA 3NVZB 4PVKA 1VAOA 2Y4GA 1SB3B 5FXFA 1RM6B 2MBRA 5G5HB 2VAOA 4JAYA 4EC3A 2Q85A 4HG0A 5L6FA 2W3RA 2Y3RA 1N61C 1N5WC 1N5XA 3S1EA 1E0YA 2W54A 2O3GA 5AE2A 2UUUA 4PVJA 2BVFA 2GQTA 2BVHA 2PLSA 3RJ8A 1VDVA 2Q4WA 5FXDA 1F0XA 1FFVC 3EJBB 1W1OA 3AMZA 2UUVA 2P3HA 1T3QC 1W1SA 4PWBA 2VFTA 3DQ0A 3W8XA 3KJMA 1FIQB 3DEDA 3LLBA 3PQBA 3W8WA 4OALA 3S1DA 1W1RA 4PZFA 2YVSA 5K8EA 5L6GA 3POPA 1E8FA 1N63C 1QLTA 3EUB3 2WDWA 2NQWA 3NS1B 1AHVA 5I1WA 4PYTA 1W1JA 4PVHA 3VTEA 5AWVA 1E8HA 3EJEB 2W55A 1WVEA 3NVVB 1W1KA 3LAEA 1JROA 2AXRA 3D2JA 1E8GA 4O95A 3NRZB 3NVWB 3BW7A 3NVYB 3S1CA 1HSKA 2RK5A 3FWAA 1N62C 5AE3A 2Y08A 5D79A 3TSHA 1W1MA 4ZOHB 3RJAA 3D2DA 3TX1A 1UXYA 3S1FA 1DIIA 1DIQA 4UD8A 5HMRA 5ADZA 3I99A 1WVFA 4ML8A 4XLOA 3FW9A 2E3TA 3HSUA 3C0PA 5FXPA 1W1LA 2QPMA 3JS8A 2VFRA 1AHUA 4BC9A 1V97A 2PLIA 2OAIA 1ZXIC 3ETRB 4BCAA 1N60C 3D2HA 2IPIA 2VFUA 1I19A 3EJDB 1W1QA 4PVEA 3W8ZA 2P13A
chains in the Genus database with same CATH topology
1AHZA 2P4PA 2BVGA 1FO4A 5G5GB 4BC7A 3AM9A 3HRDC 1WYGA 2EXRA 5I1VA 2R2ZA 5HHZA 2I0KA 2VFSA 3SR6B 4BBYA 4DNSA 1ZR6A 2QKNA 3GSYA 1JRPA 5AE1A 5HQXA 2W3SA 1MBTA 2GQUA 3FW7A 4JB1A 3PM9A 4PWCA 2VFVA 1DZNA 1MBBA 3AN1A 1FFUC 4MLAA 2R8DA 3B9JB 3TSJA 1QLUA 3FW8A 2Y3SA 5FXEA 3NVZB 4PVKA 1VAOA 2Y4GA 1SB3B 5FXFA 1RM6B 2MBRA 5G5HB 2VAOA 4JAYA 4EC3A 2Q85A 4HG0A 5L6FA 2W3RA 2Y3RA 1N61C 1N5WC 1N5XA 3S1EA 1E0YA 2W54A 2O3GA 5AE2A 2UUUA 4PVJA 2BVFA 2GQTA 2BVHA 2PLSA 3RJ8A 1VDVA 2Q4WA 5FXDA 1F0XA 1FFVC 1W1OA 3AMZA 2UUVA 2P3HA 1T3QC 1W1SA 4PWBA 2VFTA 3DQ0A 3W8XA 3KJMA 1FIQB 3DEDA 3LLBA 3PQBA 3W8WA 4OALA 3S1DA 1W1RA 4PZFA 2YVSA 5K8EA 5L6GA 3POPA 1E8FA 1N63C 1QLTA 3EUB3 2WDWA 2NQWA 3NS1B 1AHVA 5I1WA 4PYTA 1W1JA 4PVHA 3VTEA 5AWVA 1E8HA 2W55A 1WVEA 3NVVB 1W1KA 3LAEA 1JROA 2AXRA 3D2JA 1E8GA 4O95A 3NRZB 3NVWB 3BW7A 3NVYB 3S1CA 1HSKA 2RK5A 3FWAA 1N62C 5AE3A 2Y08A 5D79A 3TSHA 1W1MA 4ZOHB 3RJAA 3D2DA 3TX1A 1UXYA 3S1FA 1DIIA 1DIQA 4UD8A 5HMRA 5ADZA 3I99A 1WVFA 4ML8A 4XLOA 3FW9A 2E3TA 3HSUA 3C0PA 5FXPA 1W1LA 2QPMA 3JS8A 2VFRA 1AHUA 4BC9A 1V97A 2PLIA 2OAIA 1ZXIC 3ETRB 4BCAA 1N60C 3D2HA 2IPIA 2VFUA 1I19A 1W1QA 4PVEA 3W8ZA 2P13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHZ A;  2BVG A;  1FO4 A;  4BC7 A;  3AM9 A;  5I1V A;  1WYG A;  2EXR A;  5HHZ A;  2I0K A;  2VFS A;  3SR6 B;  4BBY A;  4DNS A;  1ZR6 A;  2QKN A;  3GSY A;  5AE1 A;  5HQX A;  2W3S A;  1MBT A;  2GQU A;  3FW7 A;  4JB1 A;  3PM9 A;  4PWC A;  2VFV A;  1DZN A;  1MBB A;  3AN1 A;  1FFU C;  4MLA A;  3B9J B;  3TSJ A;  1QLU A;  3FW8 A;  2Y3S A;  5FXE A;  3NVZ B;  4PVK A;  1VAO A;  2Y4G A;  5FXF A;  2MBR A;  2VAO A;  4JAY A;  4EC3 A;  2Q85 A;  5L6F A;  2W3R A;  2Y3R A;  1N61 C;  1N5W C;  1N5X A;  3S1E A;  1E0Y A;  2W54 A;  5AE2 A;  4PVJ A;  2BVF A;  2GQT A;  2BVH A;  3RJ8 A;  1VDV A;  2Q4W A;  5FXD A;  1F0X A;  1FFV C;  1W1O A;  3AMZ A;  1T3Q C;  1W1S A;  4PWB A;  2VFT A;  3DQ0 A;  3W8X A;  3KJM A;  1FIQ B;  3PQB A;  3W8W A;  4OAL A;  3S1D A;  1W1R A;  4PZF A;  5K8E A;  5L6G A;  3POP A;  1E8F A;  1N63 C;  1QLT A;  3EUB 3;  2WDW A;  3NS1 B;  1AHV A;  5I1W A;  4PYT A;  1W1J A;  4PVH A;  3VTE A;  5AWV A;  1E8H A;  2W55 A;  1WVE A;  1W1K A;  1JRO A;  2AXR A;  3D2J A;  1E8G A;  4O95 A;  3NRZ B;  3BW7 A;  3S1C A;  1HSK A;  3FWA A;  1N62 C;  5AE3 A;  2Y08 A;  5D79 A;  3TSH A;  1W1M A;  4ZOH B;  3RJA A;  3D2D A;  3TX1 A;  1UXY A;  3S1F A;  1DII A;  1DIQ A;  4UD8 A;  5HMR A;  5ADZ A;  3I99 A;  1WVF A;  4ML8 A;  4XLO A;  3FW9 A;  2E3T A;  3HSU A;  3C0P A;  5FXP A;  1W1L A;  2QPM A;  3JS8 A;  2VFR A;  1AHU A;  4BC9 A;  1V97 A;  1ZXI C;  3ETR B;  4BCA A;  1N60 C;  3D2H A;  2IPI A;  2VFU A;  1I19 A;  1W1Q A;  4PVE A;  3W8Z A; 
#chains in the Genus database with same CATH topology
 1AHZ A;  2P4P A;  2BVG A;  1FO4 A;  5G5G B;  4BC7 A;  3AM9 A;  3HRD C;  1WYG A;  2EXR A;  5I1V A;  2R2Z A;  5HHZ A;  2I0K A;  2VFS A;  3SR6 B;  4BBY A;  4DNS A;  1ZR6 A;  2QKN A;  3GSY A;  1JRP A;  5AE1 A;  5HQX A;  2W3S A;  1MBT A;  2GQU A;  3FW7 A;  4JB1 A;  3PM9 A;  4PWC A;  2VFV A;  1DZN A;  1MBB A;  3AN1 A;  1FFU C;  4MLA A;  2R8D A;  3B9J B;  3TSJ A;  1QLU A;  3FW8 A;  2Y3S A;  5FXE A;  3NVZ B;  4PVK A;  1VAO A;  2Y4G A;  1SB3 B;  5FXF A;  1RM6 B;  2MBR A;  5G5H B;  2VAO A;  4JAY A;  4EC3 A;  2Q85 A;  4HG0 A;  5L6F A;  2W3R A;  2Y3R A;  1N61 C;  1N5W C;  1N5X A;  3S1E A;  1E0Y A;  2W54 A;  2O3G A;  5AE2 A;  2UUU A;  4PVJ A;  2BVF A;  2GQT A;  2BVH A;  2PLS A;  3RJ8 A;  1VDV A;  2Q4W A;  5FXD A;  1F0X A;  1FFV C;  3EJB B;  1W1O A;  3AMZ A;  2UUV A;  2P3H A;  1T3Q C;  1W1S A;  4PWB A;  2VFT A;  3DQ0 A;  3W8X A;  3KJM A;  1FIQ B;  3DED A;  3LLB A;  3PQB A;  3W8W A;  4OAL A;  3S1D A;  1W1R A;  4PZF A;  2YVS A;  5K8E A;  5L6G A;  3POP A;  1E8F A;  1N63 C;  1QLT A;  3EUB 3;  2WDW A;  2NQW A;  3NS1 B;  1AHV A;  5I1W A;  4PYT A;  1W1J A;  4PVH A;  3VTE A;  5AWV A;  1E8H A;  3EJE B;  2W55 A;  1WVE A;  3NVV B;  1W1K A;  3LAE A;  1JRO A;  2AXR A;  3D2J A;  1E8G A;  4O95 A;  3NRZ B;  3NVW B;  3BW7 A;  3NVY B;  3S1C A;  1HSK A;  2RK5 A;  3FWA A;  1N62 C;  5AE3 A;  2Y08 A;  5D79 A;  3TSH A;  1W1M A;  4ZOH B;  3RJA A;  3D2D A;  3TX1 A;  1UXY A;  3S1F A;  1DII A;  1DIQ A;  4UD8 A;  5HMR A;  5ADZ A;  3I99 A;  1WVF A;  4ML8 A;  4XLO A;  3FW9 A;  2E3T A;  3HSU A;  3C0P A;  5FXP A;  1W1L A;  2QPM A;  3JS8 A;  2VFR A;  1AHU A;  4BC9 A;  1V97 A;  2PLI A;  2OAI A;  1ZXI C;  3ETR B;  4BCA A;  1N60 C;  3D2H A;  2IPI A;  2VFU A;  1I19 A;  3EJD B;  1W1Q A;  4PVE A;  3W8Z A;  2P13 A; 
#chains in the Genus database with same CATH homology
 1AHZ A;  2P4P A;  2BVG A;  1FO4 A;  5G5G B;  4BC7 A;  3AM9 A;  3HRD C;  1WYG A;  2EXR A;  5I1V A;  2R2Z A;  5HHZ A;  2I0K A;  2VFS A;  3SR6 B;  4BBY A;  4DNS A;  1ZR6 A;  2QKN A;  3GSY A;  1JRP A;  5AE1 A;  5HQX A;  2W3S A;  1MBT A;  2GQU A;  3FW7 A;  4JB1 A;  3PM9 A;  4PWC A;  2VFV A;  1DZN A;  1MBB A;  3AN1 A;  1FFU C;  4MLA A;  2R8D A;  3B9J B;  3TSJ A;  1QLU A;  3FW8 A;  2Y3S A;  5FXE A;  3NVZ B;  4PVK A;  1VAO A;  2Y4G A;  1SB3 B;  5FXF A;  1RM6 B;  2MBR A;  5G5H B;  2VAO A;  4JAY A;  4EC3 A;  2Q85 A;  4HG0 A;  5L6F A;  2W3R A;  2Y3R A;  1N61 C;  1N5W C;  1N5X A;  3S1E A;  1E0Y A;  2W54 A;  2O3G A;  5AE2 A;  2UUU A;  4PVJ A;  2BVF A;  2GQT A;  2BVH A;  2PLS A;  3RJ8 A;  1VDV A;  2Q4W A;  5FXD A;  1F0X A;  1FFV C;  1W1O A;  3AMZ A;  2UUV A;  2P3H A;  1T3Q C;  1W1S A;  4PWB A;  2VFT A;  3DQ0 A;  3W8X A;  3KJM A;  1FIQ B;  3DED A;  3LLB A;  3PQB A;  3W8W A;  4OAL A;  3S1D A;  1W1R A;  4PZF A;  2YVS A;  5K8E A;  5L6G A;  3POP A;  1E8F A;  1N63 C;  1QLT A;  3EUB 3;  2WDW A;  2NQW A;  3NS1 B;  1AHV A;  5I1W A;  4PYT A;  1W1J A;  4PVH A;  3VTE A;  5AWV A;  1E8H A;  2W55 A;  1WVE A;  3NVV B;  1W1K A;  3LAE A;  1JRO A;  2AXR A;  3D2J A;  1E8G A;  4O95 A;  3NRZ B;  3NVW B;  3BW7 A;  3NVY B;  3S1C A;  1HSK A;  2RK5 A;  3FWA A;  1N62 C;  5AE3 A;  2Y08 A;  5D79 A;  3TSH A;  1W1M A;  4ZOH B;  3RJA A;  3D2D A;  3TX1 A;  1UXY A;  3S1F A;  1DII A;  1DIQ A;  4UD8 A;  5HMR A;  5ADZ A;  3I99 A;  1WVF A;  4ML8 A;  4XLO A;  3FW9 A;  2E3T A;  3HSU A;  3C0P A;  5FXP A;  1W1L A;  2QPM A;  3JS8 A;  2VFR A;  1AHU A;  4BC9 A;  1V97 A;  2PLI A;  2OAI A;  1ZXI C;  3ETR B;  4BCA A;  1N60 C;  3D2H A;  2IPI A;  2VFU A;  1I19 A;  1W1Q A;  4PVE A;  3W8Z A;  2P13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...