4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
3S1EA 3DQ0A 4PVKA 2BVHA 5HHZA 4BC7A 3FW9A 2VFUA 2VFVA 3EUB3 2GQTA 1MBBA 1W1QA 3KJMA 1DIIA 3FW8A 5FXPA 3ETRB 1W1MA 1E0YA 1MBTA 3S1CA 4ZOHB 1AHVA 3POPA 3RJ8A 1ZR6A 3NRZB 2VFSA 4PWBA 2BVFA 4PZFA 5AE1A 1QLTA 1W1KA 1AHUA 3FWAA 1AHZA 3S1FA 3W8ZA 1W1JA 1DZNA 3D2JA 3NVZB 5I1VA 2VFTA 2EXRA 1F0XA 4PVHA 1QLUA 1WYGA 5FXEA 4DNSA 3NS1B 5AE3A 2QKNA 1E8HA 1I19A 1VAOA 5AE2A 3S1DA 1FFUC 1W1RA 5L6FA 3BW7A 4BC9A 4UD8A 2VAOA 3AMZA 2Q4WA 3AN1A 2MBRA 4EC3A 3PQBA 4OALA 3PM9A 2BVGA 3TSHA 4MLAA 3C0PA 3I99A 3D2DA 1JROA 3D2HA 2I0KA 4BBYA 3HSUA 3AM9A 1N5WC 1UXYA 3VTEA 1HSKA 3TSJA 4PVJA 5ADZA 1FIQB 1V97A 5HQXA 5HMRA 1N60C 2AXRA 1VDVA 2IPIA 4XLOA 4O95A 1W1OA 1E8FA 2Q85A 3W8XA 2GQUA 2WDWA 1T3QC 4PWCA 1DIQA 1W1SA 1E8GA 3JS8A 3GSYA 3RJAA 2QPMA 1N5XA 3FW7A 4PYTA 1N62C 4JAYA 2W3SA 2Y4GA 2Y08A 2VFRA 5D79A 1WVEA 2E3TA 5K8EA 5L6GA 1ZXIC 2W3RA 2W55A 1W1LA 2Y3RA 4JB1A 3B9JB 2W54A 4ML8A 4BCAA 5FXDA 5FXFA 1FO4A 1N63C 5AWVA 2Y3SA 3W8WA 1N61C 1WVFA 3SR6B 5I1WA 4PVEA 3TX1A 1FFVC
chains in the Genus database with same CATH superfamily
3S1EA 3DQ0A 4PVKA 2BVHA 5HHZA 4BC7A 5G5HB 3FW9A 2VFUA 2VFVA 3EUB3 2GQTA 1MBBA 1W1QA 2UUVA 3KJMA 1DIIA 3FW8A 5FXPA 3ETRB 2UUUA 1W1MA 1E0YA 1MBTA 3S1CA 4ZOHB 1AHVA 3POPA 3RJ8A 1ZR6A 3NRZB 2P13A 2VFSA 3EJDB 4PWBA 2BVFA 4PZFA 5AE1A 1QLTA 1W1KA 1AHUA 3FWAA 1AHZA 3S1FA 4HG0A 3W8ZA 1W1JA 3EJBB 1DZNA 3D2JA 3NVZB 5I1VA 2VFTA 2EXRA 1F0XA 4PVHA 1QLUA 5G5GB 3LAEA 1WYGA 3NVYB 5FXEA 2R8DA 4DNSA 3NS1B 2PLIA 5AE3A 2QKNA 1E8HA 1I19A 1VAOA 5AE2A 3S1DA 1FFUC 1W1RA 5L6FA 3BW7A 2OAIA 4BC9A 4UD8A 2VAOA 3AMZA 2Q4WA 3AN1A 2MBRA 4EC3A 1RM6B 3PQBA 4OALA 3PM9A 2P4PA 2BVGA 3TSHA 4MLAA 3C0PA 3I99A 3D2DA 1JROA 3HRDC 3D2HA 2I0KA 4BBYA 3HSUA 3AM9A 2O3GA 1N5WC 2YVSA 1UXYA 3VTEA 1HSKA 3TSJA 4PVJA 5ADZA 1FIQB 1V97A 1SB3B 5HQXA 2P3HA 5HMRA 1N60C 2AXRA 1VDVA 1JRPA 2IPIA 4XLOA 4O95A 1W1OA 1E8FA 2Q85A 3W8XA 2GQUA 2WDWA 1T3QC 3NVVB 1DIQA 4PWCA 1W1SA 1E8GA 3JS8A 3GSYA 3RJAA 2R2ZA 2QPMA 3EJEB 1N5XA 3FW7A 4PYTA 1N62C 3NVWB 4JAYA 2W3SA 2Y4GA 2Y08A 3LLBA 2VFRA 5D79A 1WVEA 3DEDA 2E3TA 5K8EA 5L6GA 1ZXIC 2W3RA 2W55A 1W1LA 2Y3RA 4JB1A 3B9JB 2W54A 4ML8A 4BCAA 5FXDA 5FXFA 1FO4A 2RK5A 1N63C 2PLSA 5AWVA 2Y3SA 3W8WA 1N61C 1WVFA 3SR6B 5I1WA 4PVEA 2NQWA 3TX1A 1FFVC
chains in the Genus database with same CATH topology
3S1EA 3DQ0A 4PVKA 2BVHA 5HHZA 4BC7A 5G5HB 3FW9A 2VFUA 2VFVA 3EUB3 2GQTA 1MBBA 1W1QA 2UUVA 3KJMA 1DIIA 3FW8A 5FXPA 3ETRB 2UUUA 1W1MA 1E0YA 1MBTA 3S1CA 4ZOHB 1AHVA 3POPA 3RJ8A 1ZR6A 3NRZB 2P13A 2VFSA 4PWBA 2BVFA 4PZFA 5AE1A 1QLTA 1W1KA 1AHUA 3FWAA 1AHZA 3S1FA 4HG0A 3W8ZA 1W1JA 1DZNA 3D2JA 3NVZB 5I1VA 2VFTA 2EXRA 1F0XA 4PVHA 1QLUA 5G5GB 3LAEA 1WYGA 3NVYB 5FXEA 2R8DA 4DNSA 3NS1B 2PLIA 5AE3A 2QKNA 1E8HA 1I19A 1VAOA 5AE2A 3S1DA 1FFUC 1W1RA 5L6FA 3BW7A 2OAIA 4BC9A 4UD8A 2VAOA 3AMZA 2Q4WA 3AN1A 2MBRA 4EC3A 1RM6B 3PQBA 4OALA 3PM9A 2P4PA 2BVGA 3TSHA 4MLAA 3C0PA 3I99A 3D2DA 1JROA 3HRDC 3D2HA 2I0KA 4BBYA 3HSUA 3AM9A 2O3GA 1N5WC 2YVSA 1UXYA 3VTEA 1HSKA 3TSJA 4PVJA 5ADZA 1FIQB 1V97A 1SB3B 5HQXA 2P3HA 5HMRA 1N60C 2AXRA 1VDVA 1JRPA 2IPIA 4XLOA 4O95A 1W1OA 1E8FA 2Q85A 3W8XA 2GQUA 2WDWA 1T3QC 4PWCA 1DIQA 3NVVB 1W1SA 1E8GA 3JS8A 3GSYA 3RJAA 2R2ZA 2QPMA 1N5XA 3FW7A 4PYTA 1N62C 3NVWB 4JAYA 2W3SA 2Y4GA 2Y08A 3LLBA 2VFRA 5D79A 1WVEA 3DEDA 2E3TA 5K8EA 5L6GA 1ZXIC 2W3RA 2W55A 1W1LA 2Y3RA 4JB1A 3B9JB 2W54A 4ML8A 4BCAA 5FXDA 5FXFA 1FO4A 2RK5A 1N63C 2PLSA 5AWVA 2Y3SA 3W8WA 1N61C 1WVFA 3SR6B 5I1WA 4PVEA 2NQWA 3TX1A 1FFVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1E A;  3DQ0 A;  4PVK A;  2BVH A;  5HHZ A;  4BC7 A;  3FW9 A;  2VFU A;  2VFV A;  3EUB 3;  2GQT A;  1MBB A;  1W1Q A;  3KJM A;  1DII A;  3FW8 A;  5FXP A;  3ETR B;  1W1M A;  1E0Y A;  1MBT A;  3S1C A;  4ZOH B;  1AHV A;  3POP A;  3RJ8 A;  1ZR6 A;  3NRZ B;  2VFS A;  4PWB A;  2BVF A;  4PZF A;  5AE1 A;  1QLT A;  1W1K A;  1AHU A;  3FWA A;  1AHZ A;  3S1F A;  3W8Z A;  1W1J A;  1DZN A;  3D2J A;  3NVZ B;  5I1V A;  2VFT A;  2EXR A;  1F0X A;  4PVH A;  1QLU A;  1WYG A;  5FXE A;  4DNS A;  3NS1 B;  5AE3 A;  2QKN A;  1E8H A;  1I19 A;  1VAO A;  5AE2 A;  3S1D A;  1FFU C;  1W1R A;  5L6F A;  3BW7 A;  4BC9 A;  4UD8 A;  2VAO A;  3AMZ A;  2Q4W A;  3AN1 A;  2MBR A;  4EC3 A;  3PQB A;  4OAL A;  3PM9 A;  2BVG A;  3TSH A;  4MLA A;  3C0P A;  3I99 A;  3D2D A;  1JRO A;  3D2H A;  2I0K A;  4BBY A;  3HSU A;  3AM9 A;  1N5W C;  1UXY A;  3VTE A;  1HSK A;  3TSJ A;  4PVJ A;  5ADZ A;  1FIQ B;  1V97 A;  5HQX A;  5HMR A;  1N60 C;  2AXR A;  1VDV A;  2IPI A;  4XLO A;  4O95 A;  1W1O A;  1E8F A;  2Q85 A;  3W8X A;  2GQU A;  2WDW A;  1T3Q C;  4PWC A;  1DIQ A;  1W1S A;  1E8G A;  3JS8 A;  3GSY A;  3RJA A;  2QPM A;  1N5X A;  3FW7 A;  4PYT A;  1N62 C;  4JAY A;  2W3S A;  2Y4G A;  2Y08 A;  2VFR A;  5D79 A;  1WVE A;  2E3T A;  5K8E A;  5L6G A;  1ZXI C;  2W3R A;  2W55 A;  1W1L A;  2Y3R A;  4JB1 A;  3B9J B;  2W54 A;  4ML8 A;  4BCA A;  5FXD A;  5FXF A;  1FO4 A;  1N63 C;  5AWV A;  2Y3S A;  3W8W A;  1N61 C;  1WVF A;  3SR6 B;  5I1W A;  4PVE A;  3TX1 A;  1FFV C; 
#chains in the Genus database with same CATH topology
 3S1E A;  3DQ0 A;  4PVK A;  2BVH A;  5HHZ A;  4BC7 A;  5G5H B;  3FW9 A;  2VFU A;  2VFV A;  3EUB 3;  2GQT A;  1MBB A;  1W1Q A;  2UUV A;  3KJM A;  1DII A;  3FW8 A;  5FXP A;  3ETR B;  2UUU A;  1W1M A;  1E0Y A;  1MBT A;  3S1C A;  4ZOH B;  1AHV A;  3POP A;  3RJ8 A;  1ZR6 A;  3NRZ B;  2P13 A;  2VFS A;  3EJD B;  4PWB A;  2BVF A;  4PZF A;  5AE1 A;  1QLT A;  1W1K A;  1AHU A;  3FWA A;  1AHZ A;  3S1F A;  4HG0 A;  3W8Z A;  1W1J A;  3EJB B;  1DZN A;  3D2J A;  3NVZ B;  5I1V A;  2VFT A;  2EXR A;  1F0X A;  4PVH A;  1QLU A;  5G5G B;  3LAE A;  1WYG A;  3NVY B;  5FXE A;  2R8D A;  4DNS A;  3NS1 B;  2PLI A;  5AE3 A;  2QKN A;  1E8H A;  1I19 A;  1VAO A;  5AE2 A;  3S1D A;  1FFU C;  1W1R A;  5L6F A;  3BW7 A;  2OAI A;  4BC9 A;  4UD8 A;  2VAO A;  3AMZ A;  2Q4W A;  3AN1 A;  2MBR A;  4EC3 A;  1RM6 B;  3PQB A;  4OAL A;  3PM9 A;  2P4P A;  2BVG A;  3TSH A;  4MLA A;  3C0P A;  3I99 A;  3D2D A;  1JRO A;  3HRD C;  3D2H A;  2I0K A;  4BBY A;  3HSU A;  3AM9 A;  2O3G A;  1N5W C;  2YVS A;  1UXY A;  3VTE A;  1HSK A;  3TSJ A;  4PVJ A;  5ADZ A;  1FIQ B;  1V97 A;  1SB3 B;  5HQX A;  2P3H A;  5HMR A;  1N60 C;  2AXR A;  1VDV A;  1JRP A;  2IPI A;  4XLO A;  4O95 A;  1W1O A;  1E8F A;  2Q85 A;  3W8X A;  2GQU A;  2WDW A;  1T3Q C;  3NVV B;  1DIQ A;  4PWC A;  1W1S A;  1E8G A;  3JS8 A;  3GSY A;  3RJA A;  2R2Z A;  2QPM A;  3EJE B;  1N5X A;  3FW7 A;  4PYT A;  1N62 C;  3NVW B;  4JAY A;  2W3S A;  2Y4G A;  2Y08 A;  3LLB A;  2VFR A;  5D79 A;  1WVE A;  3DED A;  2E3T A;  5K8E A;  5L6G A;  1ZXI C;  2W3R A;  2W55 A;  1W1L A;  2Y3R A;  4JB1 A;  3B9J B;  2W54 A;  4ML8 A;  4BCA A;  5FXD A;  5FXF A;  1FO4 A;  2RK5 A;  1N63 C;  2PLS A;  5AWV A;  2Y3S A;  3W8W A;  1N61 C;  1WVF A;  3SR6 B;  5I1W A;  4PVE A;  2NQW A;  3TX1 A;  1FFV C; 
#chains in the Genus database with same CATH homology
 3S1E A;  3DQ0 A;  4PVK A;  2BVH A;  5HHZ A;  4BC7 A;  5G5H B;  3FW9 A;  2VFU A;  2VFV A;  3EUB 3;  2GQT A;  1MBB A;  1W1Q A;  2UUV A;  3KJM A;  1DII A;  3FW8 A;  5FXP A;  3ETR B;  2UUU A;  1W1M A;  1E0Y A;  1MBT A;  3S1C A;  4ZOH B;  1AHV A;  3POP A;  3RJ8 A;  1ZR6 A;  3NRZ B;  2P13 A;  2VFS A;  4PWB A;  2BVF A;  4PZF A;  5AE1 A;  1QLT A;  1W1K A;  1AHU A;  3FWA A;  1AHZ A;  3S1F A;  4HG0 A;  3W8Z A;  1W1J A;  1DZN A;  3D2J A;  3NVZ B;  5I1V A;  2VFT A;  2EXR A;  1F0X A;  4PVH A;  1QLU A;  5G5G B;  3LAE A;  1WYG A;  3NVY B;  5FXE A;  2R8D A;  4DNS A;  3NS1 B;  2PLI A;  5AE3 A;  2QKN A;  1E8H A;  1I19 A;  1VAO A;  5AE2 A;  3S1D A;  1FFU C;  1W1R A;  5L6F A;  3BW7 A;  2OAI A;  4BC9 A;  4UD8 A;  2VAO A;  3AMZ A;  2Q4W A;  3AN1 A;  2MBR A;  4EC3 A;  1RM6 B;  3PQB A;  4OAL A;  3PM9 A;  2P4P A;  2BVG A;  3TSH A;  4MLA A;  3C0P A;  3I99 A;  3D2D A;  1JRO A;  3HRD C;  3D2H A;  2I0K A;  4BBY A;  3HSU A;  3AM9 A;  2O3G A;  1N5W C;  2YVS A;  1UXY A;  3VTE A;  1HSK A;  3TSJ A;  4PVJ A;  5ADZ A;  1FIQ B;  1V97 A;  1SB3 B;  5HQX A;  2P3H A;  5HMR A;  1N60 C;  2AXR A;  1VDV A;  1JRP A;  2IPI A;  4XLO A;  4O95 A;  1W1O A;  1E8F A;  2Q85 A;  3W8X A;  2GQU A;  2WDW A;  1T3Q C;  4PWC A;  1DIQ A;  3NVV B;  1W1S A;  1E8G A;  3JS8 A;  3GSY A;  3RJA A;  2R2Z A;  2QPM A;  1N5X A;  3FW7 A;  4PYT A;  1N62 C;  3NVW B;  4JAY A;  2W3S A;  2Y4G A;  2Y08 A;  3LLB A;  2VFR A;  5D79 A;  1WVE A;  3DED A;  2E3T A;  5K8E A;  5L6G A;  1ZXI C;  2W3R A;  2W55 A;  1W1L A;  2Y3R A;  4JB1 A;  3B9J B;  2W54 A;  4ML8 A;  4BCA A;  5FXD A;  5FXF A;  1FO4 A;  2RK5 A;  1N63 C;  2PLS A;  5AWV A;  2Y3S A;  3W8W A;  1N61 C;  1WVF A;  3SR6 B;  5I1W A;  4PVE A;  2NQW A;  3TX1 A;  1FFV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...