4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
3TSHA 1E8FA 3C0PA 1N60C 3FW9A 2W55A 5HQXA 2QKNA 1N5XA 1ZXIC 3W8XA 3FW8A 3D2DA 1W1SA 4UD8A 1F0XA 1W1MA 2Q4WA 5HHZA 1FO4A 4BCAA 5L6FA 1QLUA 1VAOA 4PVHA 3VTEA 1WVFA 2Y4GA 3AMZA 4PZFA 4ZOHB 2IPIA 4BC9A 3BW7A 2GQTA 3RJAA 2WDWA 2VAOA 3GSYA 5AWVA 1FFVC 1ZR6A 1MBBA 1DZNA 5AE1A 5FXFA 1W1KA 3SR6B 2Y08A 1JROA 1N62C 2E3TA 4BC7A 3HSUA 5ADZA 1DIIA 1E0YA 3DQ0A 1T3QC 2MBRA 3W8WA 1E8HA 1E8GA 3S1EA 3TSJA 1N61C 3POPA 2AXRA 3I99A 2BVGA 5D79A 1AHUA 1HSKA 1FFUC 1I19A 1UXYA 3S1DA 4JB1A 3TX1A 1W1OA 2VFTA 2W3RA 4BBYA 3RJ8A 4PWCA 3D2JA 5L6GA 2QPMA 1N63C 2BVHA 1W1JA 1VDVA 3EUB3 3NRZB 4PVJA 1WYGA 5FXDA 3AM9A 4DNSA 3KJMA 5I1WA 3S1CA 4PVKA 2Y3RA 3D2HA 3FWAA 3FW7A 3NVZB 2VFVA 4O95A 1FIQB 2VFUA 3B9JB 3JS8A 1WVEA 1AHVA 3AN1A 3NS1B 1W1LA 2W54A 1AHZA 2Q85A 2Y3SA 1V97A 2VFSA 4OALA 4PVEA 5AE2A 4JAYA 5FXEA 5FXPA 2I0KA 1N5WC 4MLAA 3PQBA 3S1FA 5K8EA 1W1RA 3PM9A 2GQUA 5AE3A 5HMRA 4ML8A 4PYTA 1DIQA 2VFRA 4EC3A 2W3SA 4PWBA 3W8ZA 1MBTA 2BVFA 5I1VA 4XLOA 1QLTA 1W1QA 2EXRA 3ETRB
chains in the Genus database with same CATH superfamily
3TSHA 2UUUA 1E8FA 1SB3B 3C0PA 1N60C 3FW9A 2NQWA 2W55A 5HQXA 2QKNA 1N5XA 1ZXIC 3W8XA 3FW8A 3D2DA 1W1SA 4UD8A 1F0XA 1W1MA 2Q4WA 5HHZA 1FO4A 4BCAA 5G5HB 5L6FA 1QLUA 1VAOA 4PVHA 3VTEA 1WVFA 2Y4GA 3AMZA 4PZFA 4ZOHB 2IPIA 4BC9A 3BW7A 2GQTA 3RJAA 2WDWA 2VAOA 2P13A 3GSYA 5AWVA 1FFVC 1ZR6A 2P4PA 3HRDC 3DEDA 1MBBA 1DZNA 2RK5A 3NVWB 5AE1A 5FXFA 1W1KA 3NVVB 3SR6B 2Y08A 1JROA 1N62C 2E3TA 4BC7A 3HSUA 5ADZA 1DIIA 1E0YA 2PLSA 3DQ0A 1T3QC 2OAIA 3EJDB 2MBRA 3W8WA 1E8HA 1E8GA 3S1EA 3TSJA 1N61C 3POPA 2AXRA 3I99A 2BVGA 5D79A 1AHUA 1HSKA 1FFUC 1I19A 1UXYA 3S1DA 1JRPA 4JB1A 3TX1A 1W1OA 2VFTA 2W3RA 4BBYA 3RJ8A 4PWCA 3EJEB 3D2JA 5L6GA 2QPMA 1N63C 2O3GA 2BVHA 1W1JA 2R8DA 1VDVA 3EUB3 3NRZB 4PVJA 1WYGA 5FXDA 3AM9A 4DNSA 3KJMA 5I1WA 3S1CA 4PVKA 2UUVA 2Y3RA 2PLIA 3D2HA 3FWAA 3FW7A 3NVZB 2VFVA 4O95A 1FIQB 2VFUA 3B9JB 3JS8A 1WVEA 1AHVA 3AN1A 2YVSA 3NS1B 1W1LA 2P3HA 3EJBB 2W54A 1AHZA 2Q85A 5G5GB 2Y3SA 1V97A 2VFSA 4OALA 4PVEA 5AE2A 4JAYA 5FXEA 5FXPA 3LLBA 2I0KA 1N5WC 4MLAA 3LAEA 3PQBA 3S1FA 5K8EA 1W1RA 3PM9A 2GQUA 5AE3A 5HMRA 4ML8A 4PYTA 3NVYB 1DIQA 4HG0A 2VFRA 4EC3A 2W3SA 4PWBA 2R2ZA 3W8ZA 1MBTA 2BVFA 1RM6B 4XLOA 5I1VA 1QLTA 1W1QA 2EXRA 3ETRB
chains in the Genus database with same CATH topology
3TSHA 2UUUA 1E8FA 1SB3B 3C0PA 1N60C 3FW9A 2NQWA 2W55A 5HQXA 2QKNA 1N5XA 1ZXIC 3W8XA 3FW8A 3D2DA 1W1SA 4UD8A 1F0XA 1W1MA 2Q4WA 5HHZA 1FO4A 4BCAA 5G5HB 5L6FA 1QLUA 1VAOA 4PVHA 3VTEA 1WVFA 2Y4GA 3AMZA 4PZFA 4ZOHB 2IPIA 4BC9A 3BW7A 2GQTA 3RJAA 2WDWA 2VAOA 2P13A 3GSYA 5AWVA 1FFVC 1ZR6A 2P4PA 3HRDC 3DEDA 1MBBA 1DZNA 2RK5A 3NVWB 5AE1A 5FXFA 1W1KA 3SR6B 3NVVB 2Y08A 1JROA 1N62C 2E3TA 4BC7A 3HSUA 5ADZA 1DIIA 1E0YA 2PLSA 3DQ0A 1T3QC 2OAIA 2MBRA 3W8WA 1E8HA 1E8GA 3S1EA 3TSJA 1N61C 3POPA 2AXRA 3I99A 2BVGA 5D79A 1AHUA 1HSKA 1FFUC 1I19A 1UXYA 3S1DA 1JRPA 4JB1A 3TX1A 1W1OA 2VFTA 2W3RA 4BBYA 3RJ8A 4PWCA 3D2JA 5L6GA 2QPMA 1N63C 2O3GA 2BVHA 1W1JA 2R8DA 1VDVA 3EUB3 3NRZB 4PVJA 1WYGA 5FXDA 3AM9A 4DNSA 3KJMA 5I1WA 3S1CA 4PVKA 2UUVA 2Y3RA 2PLIA 3D2HA 3FWAA 3FW7A 3NVZB 2VFVA 4O95A 1FIQB 2VFUA 3B9JB 3JS8A 1WVEA 1AHVA 3AN1A 2YVSA 3NS1B 1W1LA 2P3HA 2W54A 1AHZA 2Q85A 5G5GB 2Y3SA 1V97A 2VFSA 4OALA 4PVEA 5AE2A 4JAYA 5FXEA 5FXPA 3LLBA 2I0KA 1N5WC 4MLAA 3LAEA 3PQBA 3S1FA 5K8EA 1W1RA 3PM9A 2GQUA 5AE3A 5HMRA 4ML8A 4PYTA 3NVYB 1DIQA 4HG0A 2VFRA 4EC3A 2W3SA 4PWBA 2R2ZA 3W8ZA 1MBTA 2BVFA 1RM6B 4XLOA 5I1VA 1QLTA 1W1QA 2EXRA 3ETRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSH A;  1E8F A;  3C0P A;  1N60 C;  3FW9 A;  2W55 A;  5HQX A;  2QKN A;  1N5X A;  1ZXI C;  3W8X A;  3FW8 A;  3D2D A;  1W1S A;  4UD8 A;  1F0X A;  1W1M A;  2Q4W A;  5HHZ A;  1FO4 A;  4BCA A;  5L6F A;  1QLU A;  1VAO A;  4PVH A;  3VTE A;  1WVF A;  2Y4G A;  3AMZ A;  4PZF A;  4ZOH B;  2IPI A;  4BC9 A;  3BW7 A;  2GQT A;  3RJA A;  2WDW A;  2VAO A;  3GSY A;  5AWV A;  1FFV C;  1ZR6 A;  1MBB A;  1DZN A;  5AE1 A;  5FXF A;  1W1K A;  3SR6 B;  2Y08 A;  1JRO A;  1N62 C;  2E3T A;  4BC7 A;  3HSU A;  5ADZ A;  1DII A;  1E0Y A;  3DQ0 A;  1T3Q C;  2MBR A;  3W8W A;  1E8H A;  1E8G A;  3S1E A;  3TSJ A;  1N61 C;  3POP A;  2AXR A;  3I99 A;  2BVG A;  5D79 A;  1AHU A;  1HSK A;  1FFU C;  1I19 A;  1UXY A;  3S1D A;  4JB1 A;  3TX1 A;  1W1O A;  2VFT A;  2W3R A;  4BBY A;  3RJ8 A;  4PWC A;  3D2J A;  5L6G A;  2QPM A;  1N63 C;  2BVH A;  1W1J A;  1VDV A;  3EUB 3;  3NRZ B;  4PVJ A;  1WYG A;  5FXD A;  3AM9 A;  4DNS A;  3KJM A;  5I1W A;  3S1C A;  4PVK A;  2Y3R A;  3D2H A;  3FWA A;  3FW7 A;  3NVZ B;  2VFV A;  4O95 A;  1FIQ B;  2VFU A;  3B9J B;  3JS8 A;  1WVE A;  1AHV A;  3AN1 A;  3NS1 B;  1W1L A;  2W54 A;  1AHZ A;  2Q85 A;  2Y3S A;  1V97 A;  2VFS A;  4OAL A;  4PVE A;  5AE2 A;  4JAY A;  5FXE A;  5FXP A;  2I0K A;  1N5W C;  4MLA A;  3PQB A;  3S1F A;  5K8E A;  1W1R A;  3PM9 A;  2GQU A;  5AE3 A;  5HMR A;  4ML8 A;  4PYT A;  1DIQ A;  2VFR A;  4EC3 A;  2W3S A;  4PWB A;  3W8Z A;  1MBT A;  2BVF A;  5I1V A;  4XLO A;  1QLT A;  1W1Q A;  2EXR A;  3ETR B; 
#chains in the Genus database with same CATH topology
 3TSH A;  2UUU A;  1E8F A;  1SB3 B;  3C0P A;  1N60 C;  3FW9 A;  2NQW A;  2W55 A;  5HQX A;  2QKN A;  1N5X A;  1ZXI C;  3W8X A;  3FW8 A;  3D2D A;  1W1S A;  4UD8 A;  1F0X A;  1W1M A;  2Q4W A;  5HHZ A;  1FO4 A;  4BCA A;  5G5H B;  5L6F A;  1QLU A;  1VAO A;  4PVH A;  3VTE A;  1WVF A;  2Y4G A;  3AMZ A;  4PZF A;  4ZOH B;  2IPI A;  4BC9 A;  3BW7 A;  2GQT A;  3RJA A;  2WDW A;  2VAO A;  2P13 A;  3GSY A;  5AWV A;  1FFV C;  1ZR6 A;  2P4P A;  3HRD C;  3DED A;  1MBB A;  1DZN A;  2RK5 A;  3NVW B;  5AE1 A;  5FXF A;  1W1K A;  3NVV B;  3SR6 B;  2Y08 A;  1JRO A;  1N62 C;  2E3T A;  4BC7 A;  3HSU A;  5ADZ A;  1DII A;  1E0Y A;  2PLS A;  3DQ0 A;  1T3Q C;  2OAI A;  3EJD B;  2MBR A;  3W8W A;  1E8H A;  1E8G A;  3S1E A;  3TSJ A;  1N61 C;  3POP A;  2AXR A;  3I99 A;  2BVG A;  5D79 A;  1AHU A;  1HSK A;  1FFU C;  1I19 A;  1UXY A;  3S1D A;  1JRP A;  4JB1 A;  3TX1 A;  1W1O A;  2VFT A;  2W3R A;  4BBY A;  3RJ8 A;  4PWC A;  3EJE B;  3D2J A;  5L6G A;  2QPM A;  1N63 C;  2O3G A;  2BVH A;  1W1J A;  2R8D A;  1VDV A;  3EUB 3;  3NRZ B;  4PVJ A;  1WYG A;  5FXD A;  3AM9 A;  4DNS A;  3KJM A;  5I1W A;  3S1C A;  4PVK A;  2UUV A;  2Y3R A;  2PLI A;  3D2H A;  3FWA A;  3FW7 A;  3NVZ B;  2VFV A;  4O95 A;  1FIQ B;  2VFU A;  3B9J B;  3JS8 A;  1WVE A;  1AHV A;  3AN1 A;  2YVS A;  3NS1 B;  1W1L A;  2P3H A;  3EJB B;  2W54 A;  1AHZ A;  2Q85 A;  5G5G B;  2Y3S A;  1V97 A;  2VFS A;  4OAL A;  4PVE A;  5AE2 A;  4JAY A;  5FXE A;  5FXP A;  3LLB A;  2I0K A;  1N5W C;  4MLA A;  3LAE A;  3PQB A;  3S1F A;  5K8E A;  1W1R A;  3PM9 A;  2GQU A;  5AE3 A;  5HMR A;  4ML8 A;  4PYT A;  3NVY B;  1DIQ A;  4HG0 A;  2VFR A;  4EC3 A;  2W3S A;  4PWB A;  2R2Z A;  3W8Z A;  1MBT A;  2BVF A;  1RM6 B;  4XLO A;  5I1V A;  1QLT A;  1W1Q A;  2EXR A;  3ETR B; 
#chains in the Genus database with same CATH homology
 3TSH A;  2UUU A;  1E8F A;  1SB3 B;  3C0P A;  1N60 C;  3FW9 A;  2NQW A;  2W55 A;  5HQX A;  2QKN A;  1N5X A;  1ZXI C;  3W8X A;  3FW8 A;  3D2D A;  1W1S A;  4UD8 A;  1F0X A;  1W1M A;  2Q4W A;  5HHZ A;  1FO4 A;  4BCA A;  5G5H B;  5L6F A;  1QLU A;  1VAO A;  4PVH A;  3VTE A;  1WVF A;  2Y4G A;  3AMZ A;  4PZF A;  4ZOH B;  2IPI A;  4BC9 A;  3BW7 A;  2GQT A;  3RJA A;  2WDW A;  2VAO A;  2P13 A;  3GSY A;  5AWV A;  1FFV C;  1ZR6 A;  2P4P A;  3HRD C;  3DED A;  1MBB A;  1DZN A;  2RK5 A;  3NVW B;  5AE1 A;  5FXF A;  1W1K A;  3SR6 B;  3NVV B;  2Y08 A;  1JRO A;  1N62 C;  2E3T A;  4BC7 A;  3HSU A;  5ADZ A;  1DII A;  1E0Y A;  2PLS A;  3DQ0 A;  1T3Q C;  2OAI A;  2MBR A;  3W8W A;  1E8H A;  1E8G A;  3S1E A;  3TSJ A;  1N61 C;  3POP A;  2AXR A;  3I99 A;  2BVG A;  5D79 A;  1AHU A;  1HSK A;  1FFU C;  1I19 A;  1UXY A;  3S1D A;  1JRP A;  4JB1 A;  3TX1 A;  1W1O A;  2VFT A;  2W3R A;  4BBY A;  3RJ8 A;  4PWC A;  3D2J A;  5L6G A;  2QPM A;  1N63 C;  2O3G A;  2BVH A;  1W1J A;  2R8D A;  1VDV A;  3EUB 3;  3NRZ B;  4PVJ A;  1WYG A;  5FXD A;  3AM9 A;  4DNS A;  3KJM A;  5I1W A;  3S1C A;  4PVK A;  2UUV A;  2Y3R A;  2PLI A;  3D2H A;  3FWA A;  3FW7 A;  3NVZ B;  2VFV A;  4O95 A;  1FIQ B;  2VFU A;  3B9J B;  3JS8 A;  1WVE A;  1AHV A;  3AN1 A;  2YVS A;  3NS1 B;  1W1L A;  2P3H A;  2W54 A;  1AHZ A;  2Q85 A;  5G5G B;  2Y3S A;  1V97 A;  2VFS A;  4OAL A;  4PVE A;  5AE2 A;  4JAY A;  5FXE A;  5FXP A;  3LLB A;  2I0K A;  1N5W C;  4MLA A;  3LAE A;  3PQB A;  3S1F A;  5K8E A;  1W1R A;  3PM9 A;  2GQU A;  5AE3 A;  5HMR A;  4ML8 A;  4PYT A;  3NVY B;  1DIQ A;  4HG0 A;  2VFR A;  4EC3 A;  2W3S A;  4PWB A;  2R2Z A;  3W8Z A;  1MBT A;  2BVF A;  1RM6 B;  4XLO A;  5I1V A;  1QLT A;  1W1Q A;  2EXR A;  3ETR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...