4PWCA

Phl p 4 i153v n158h variant, a glucose oxidase, 3.5 m nabr soak
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
490
structure length
490
Chain Sequence
b'EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGHFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 165
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwcA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwcA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwcA03
1E8HA 2EXRA 4BC7A 5I1VA 2MBRA 1DZNA 3BW7A 3ETRB 1ZR6A 2BVGA 3NS1B 1E8GA 3RJAA 3TSHA 1DIIA 4PVEA 2VFRA 3S1EA 3NVZB 4PZFA 4BBYA 1FFUC 3S1CA 4PWBA 1WVFA 3AMZA 2QPMA 3S1FA 4EC3A 5AE3A 1DIQA 4OALA 5FXDA 3VTEA 3KJMA 3W8XA 3PM9A 1JROA 1UXYA 3NRZB 4PWCA 1W1RA 4O95A 2Y3SA 3D2DA 5AE1A 3B9JB 3FWAA 1AHZA 2E3TA 5I1WA 2W3RA 3D2HA 1VDVA 4UD8A 1N5XA 5K8EA 1MBTA 4PVHA 3FW7A 5HHZA 5L6FA 1N60C 1W1MA 5L6GA 2WDWA 1F0XA 2Y08A 3AN1A 4BC9A 4XLOA 4JAYA 5FXFA 5D79A 4DNSA 3W8WA 1WYGA 1ZXIC 1AHUA 2GQTA 1HSKA 1W1LA 3D2JA 1W1JA 3EUB3 1N62C 2QKNA 1V97A 2VFVA 1MBBA 1AHVA 1QLUA 1W1QA 3SR6B 2Y4GA 3FW8A 4ML8A 2Y3RA 1QLTA 3C0PA 4PVJA 1W1KA 4PVKA 1N61C 3GSYA 3W8ZA 5AWVA 2VFTA 2W3SA 4PYTA 2IPIA 5HMRA 1WVEA 1W1OA 3PQBA 1N5WC 3HSUA 2Q85A 2BVHA 4ZOHB 3I99A 2BVFA 2Q4WA 2I0KA 3AM9A 1FO4A 4BCAA 2W55A 1N63C 2AXRA 5ADZA 2VFUA 3DQ0A 3POPA 1E0YA 4MLAA 5FXEA 2VFSA 1T3QC 4JB1A 3FW9A 3JS8A 2GQUA 1I19A 1W1SA 5FXPA 2VAOA 5AE2A 3TX1A 1VAOA 3S1DA 2W54A 3TSJA 1E8FA 5HQXA 3RJ8A 1FFVC 1FIQB
chains in the Genus database with same CATH superfamily
1E8HA 2EXRA 4BC7A 5I1VA 2MBRA 1DZNA 3BW7A 2UUVA 3ETRB 1ZR6A 2BVGA 3NS1B 1E8GA 2P4PA 3RJAA 3TSHA 1DIIA 4PVEA 2VFRA 3S1EA 3NVZB 4PZFA 4BBYA 1FFUC 3EJBB 3S1CA 4PWBA 3NVYB 1WVFA 3AMZA 3LAEA 2QPMA 3S1FA 5G5GB 4EC3A 3EJDB 5AE3A 1DIQA 4OALA 5FXDA 3VTEA 3KJMA 3W8XA 3PM9A 1JROA 1UXYA 3NRZB 4PWCA 1W1RA 5G5HB 4O95A 2Y3SA 3D2DA 5AE1A 3B9JB 3FWAA 1AHZA 2E3TA 5I1WA 2W3RA 3D2HA 1VDVA 4UD8A 1N5XA 5K8EA 1MBTA 4PVHA 3FW7A 5HHZA 5L6FA 2P3HA 1N60C 1W1MA 5L6GA 3EJEB 2WDWA 1F0XA 2Y08A 2UUUA 2PLSA 3AN1A 4BC9A 4XLOA 4JAYA 5FXFA 5D79A 4DNSA 3W8WA 1WYGA 1ZXIC 1AHUA 2GQTA 3HRDC 1HSKA 1W1LA 3D2JA 1W1JA 3EUB3 2NQWA 2PLIA 1N62C 3LLBA 3NVVB 2QKNA 1V97A 2VFVA 1MBBA 2YVSA 1AHVA 1QLUA 1W1QA 3SR6B 2R8DA 3FW8A 2Y4GA 3DEDA 4ML8A 2Y3RA 1QLTA 3C0PA 4PVJA 1W1KA 2RK5A 4PVKA 3NVWB 2R2ZA 1SB3B 1N61C 2P13A 3GSYA 3W8ZA 5AWVA 2VFTA 2W3SA 4PYTA 2IPIA 5HMRA 1WVEA 1W1OA 3PQBA 1N5WC 3HSUA 4HG0A 2Q85A 2BVHA 4ZOHB 3I99A 2BVFA 2Q4WA 2I0KA 3AM9A 1FO4A 4BCAA 2W55A 1RM6B 1N63C 2AXRA 5ADZA 2VFUA 3DQ0A 3POPA 1E0YA 4MLAA 5FXEA 2VFSA 1T3QC 4JB1A 3FW9A 3JS8A 2GQUA 1I19A 1W1SA 5FXPA 2VAOA 1JRPA 5AE2A 3TX1A 1VAOA 2OAIA 3S1DA 2W54A 3TSJA 2O3GA 1E8FA 5HQXA 3RJ8A 1FFVC 1FIQB
chains in the Genus database with same CATH topology
1E8HA 2EXRA 4BC7A 5I1VA 2MBRA 1DZNA 3BW7A 2UUVA 3ETRB 1ZR6A 2BVGA 3NS1B 1E8GA 2P4PA 3RJAA 3TSHA 1DIIA 4PVEA 2VFRA 3S1EA 3NVZB 4PZFA 4BBYA 1FFUC 3S1CA 4PWBA 3NVYB 1WVFA 3AMZA 3LAEA 2QPMA 3S1FA 5G5GB 4EC3A 5AE3A 1DIQA 4OALA 5FXDA 3VTEA 3KJMA 3W8XA 3PM9A 1JROA 1UXYA 3NRZB 4PWCA 1W1RA 5G5HB 4O95A 2Y3SA 3D2DA 5AE1A 3B9JB 3FWAA 1AHZA 2E3TA 5I1WA 2W3RA 3D2HA 1VDVA 4UD8A 1N5XA 5K8EA 1MBTA 4PVHA 3FW7A 5HHZA 5L6FA 2P3HA 1N60C 1W1MA 5L6GA 2WDWA 1F0XA 2Y08A 2UUUA 2PLSA 3AN1A 4BC9A 4XLOA 4JAYA 5FXFA 5D79A 4DNSA 3W8WA 1WYGA 1ZXIC 1AHUA 2GQTA 3HRDC 1HSKA 1W1LA 3D2JA 1W1JA 3EUB3 2NQWA 2PLIA 1N62C 3LLBA 3NVVB 2QKNA 1V97A 2VFVA 1MBBA 2YVSA 1AHVA 1QLUA 1W1QA 3SR6B 2R8DA 3FW8A 2Y4GA 3DEDA 4ML8A 2Y3RA 1QLTA 3C0PA 4PVJA 1W1KA 2RK5A 4PVKA 3NVWB 2R2ZA 1SB3B 1N61C 2P13A 3GSYA 3W8ZA 5AWVA 2VFTA 2W3SA 4PYTA 2IPIA 5HMRA 1WVEA 1W1OA 3PQBA 1N5WC 3HSUA 4HG0A 2Q85A 2BVHA 4ZOHB 3I99A 2BVFA 2Q4WA 2I0KA 3AM9A 1FO4A 4BCAA 2W55A 1RM6B 1N63C 2AXRA 5ADZA 2VFUA 3DQ0A 3POPA 1E0YA 4MLAA 5FXEA 2VFSA 1T3QC 4JB1A 3FW9A 3JS8A 2GQUA 1I19A 1W1SA 5FXPA 2VAOA 1JRPA 5AE2A 3TX1A 1VAOA 2OAIA 3S1DA 2W54A 3TSJA 2O3GA 1E8FA 5HQXA 3RJ8A 1FFVC 1FIQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8H A;  2EXR A;  4BC7 A;  5I1V A;  2MBR A;  1DZN A;  3BW7 A;  3ETR B;  1ZR6 A;  2BVG A;  3NS1 B;  1E8G A;  3RJA A;  3TSH A;  1DII A;  4PVE A;  2VFR A;  3S1E A;  3NVZ B;  4PZF A;  4BBY A;  1FFU C;  3S1C A;  4PWB A;  1WVF A;  3AMZ A;  2QPM A;  3S1F A;  4EC3 A;  5AE3 A;  1DIQ A;  4OAL A;  5FXD A;  3VTE A;  3KJM A;  3W8X A;  3PM9 A;  1JRO A;  1UXY A;  3NRZ B;  4PWC A;  1W1R A;  4O95 A;  2Y3S A;  3D2D A;  5AE1 A;  3B9J B;  3FWA A;  1AHZ A;  2E3T A;  5I1W A;  2W3R A;  3D2H A;  1VDV A;  4UD8 A;  1N5X A;  5K8E A;  1MBT A;  4PVH A;  3FW7 A;  5HHZ A;  5L6F A;  1N60 C;  1W1M A;  5L6G A;  2WDW A;  1F0X A;  2Y08 A;  3AN1 A;  4BC9 A;  4XLO A;  4JAY A;  5FXF A;  5D79 A;  4DNS A;  3W8W A;  1WYG A;  1ZXI C;  1AHU A;  2GQT A;  1HSK A;  1W1L A;  3D2J A;  1W1J A;  3EUB 3;  1N62 C;  2QKN A;  1V97 A;  2VFV A;  1MBB A;  1AHV A;  1QLU A;  1W1Q A;  3SR6 B;  2Y4G A;  3FW8 A;  4ML8 A;  2Y3R A;  1QLT A;  3C0P A;  4PVJ A;  1W1K A;  4PVK A;  1N61 C;  3GSY A;  3W8Z A;  5AWV A;  2VFT A;  2W3S A;  4PYT A;  2IPI A;  5HMR A;  1WVE A;  1W1O A;  3PQB A;  1N5W C;  3HSU A;  2Q85 A;  2BVH A;  4ZOH B;  3I99 A;  2BVF A;  2Q4W A;  2I0K A;  3AM9 A;  1FO4 A;  4BCA A;  2W55 A;  1N63 C;  2AXR A;  5ADZ A;  2VFU A;  3DQ0 A;  3POP A;  1E0Y A;  4MLA A;  5FXE A;  2VFS A;  1T3Q C;  4JB1 A;  3FW9 A;  3JS8 A;  2GQU A;  1I19 A;  1W1S A;  5FXP A;  2VAO A;  5AE2 A;  3TX1 A;  1VAO A;  3S1D A;  2W54 A;  3TSJ A;  1E8F A;  5HQX A;  3RJ8 A;  1FFV C;  1FIQ B; 
#chains in the Genus database with same CATH topology
 1E8H A;  2EXR A;  4BC7 A;  5I1V A;  2MBR A;  1DZN A;  3BW7 A;  2UUV A;  3ETR B;  1ZR6 A;  2BVG A;  3NS1 B;  1E8G A;  2P4P A;  3RJA A;  3TSH A;  1DII A;  4PVE A;  2VFR A;  3S1E A;  3NVZ B;  4PZF A;  4BBY A;  1FFU C;  3EJB B;  3S1C A;  4PWB A;  3NVY B;  1WVF A;  3AMZ A;  3LAE A;  2QPM A;  3S1F A;  5G5G B;  4EC3 A;  3EJD B;  5AE3 A;  1DIQ A;  4OAL A;  5FXD A;  3VTE A;  3KJM A;  3W8X A;  3PM9 A;  1JRO A;  1UXY A;  3NRZ B;  4PWC A;  1W1R A;  5G5H B;  4O95 A;  2Y3S A;  3D2D A;  5AE1 A;  3B9J B;  3FWA A;  1AHZ A;  2E3T A;  5I1W A;  2W3R A;  3D2H A;  1VDV A;  4UD8 A;  1N5X A;  5K8E A;  1MBT A;  4PVH A;  3FW7 A;  5HHZ A;  5L6F A;  2P3H A;  1N60 C;  1W1M A;  5L6G A;  3EJE B;  2WDW A;  1F0X A;  2Y08 A;  2UUU A;  2PLS A;  3AN1 A;  4BC9 A;  4XLO A;  4JAY A;  5FXF A;  5D79 A;  4DNS A;  3W8W A;  1WYG A;  1ZXI C;  1AHU A;  2GQT A;  3HRD C;  1HSK A;  1W1L A;  3D2J A;  1W1J A;  3EUB 3;  2NQW A;  2PLI A;  1N62 C;  3LLB A;  3NVV B;  2QKN A;  1V97 A;  2VFV A;  1MBB A;  2YVS A;  1AHV A;  1QLU A;  1W1Q A;  3SR6 B;  2R8D A;  3FW8 A;  2Y4G A;  3DED A;  4ML8 A;  2Y3R A;  1QLT A;  3C0P A;  4PVJ A;  1W1K A;  2RK5 A;  4PVK A;  3NVW B;  2R2Z A;  1SB3 B;  1N61 C;  2P13 A;  3GSY A;  3W8Z A;  5AWV A;  2VFT A;  2W3S A;  4PYT A;  2IPI A;  5HMR A;  1WVE A;  1W1O A;  3PQB A;  1N5W C;  3HSU A;  4HG0 A;  2Q85 A;  2BVH A;  4ZOH B;  3I99 A;  2BVF A;  2Q4W A;  2I0K A;  3AM9 A;  1FO4 A;  4BCA A;  2W55 A;  1RM6 B;  1N63 C;  2AXR A;  5ADZ A;  2VFU A;  3DQ0 A;  3POP A;  1E0Y A;  4MLA A;  5FXE A;  2VFS A;  1T3Q C;  4JB1 A;  3FW9 A;  3JS8 A;  2GQU A;  1I19 A;  1W1S A;  5FXP A;  2VAO A;  1JRP A;  5AE2 A;  3TX1 A;  1VAO A;  2OAI A;  3S1D A;  2W54 A;  3TSJ A;  2O3G A;  1E8F A;  5HQX A;  3RJ8 A;  1FFV C;  1FIQ B; 
#chains in the Genus database with same CATH homology
 1E8H A;  2EXR A;  4BC7 A;  5I1V A;  2MBR A;  1DZN A;  3BW7 A;  2UUV A;  3ETR B;  1ZR6 A;  2BVG A;  3NS1 B;  1E8G A;  2P4P A;  3RJA A;  3TSH A;  1DII A;  4PVE A;  2VFR A;  3S1E A;  3NVZ B;  4PZF A;  4BBY A;  1FFU C;  3S1C A;  4PWB A;  3NVY B;  1WVF A;  3AMZ A;  3LAE A;  2QPM A;  3S1F A;  5G5G B;  4EC3 A;  5AE3 A;  1DIQ A;  4OAL A;  5FXD A;  3VTE A;  3KJM A;  3W8X A;  3PM9 A;  1JRO A;  1UXY A;  3NRZ B;  4PWC A;  1W1R A;  5G5H B;  4O95 A;  2Y3S A;  3D2D A;  5AE1 A;  3B9J B;  3FWA A;  1AHZ A;  2E3T A;  5I1W A;  2W3R A;  3D2H A;  1VDV A;  4UD8 A;  1N5X A;  5K8E A;  1MBT A;  4PVH A;  3FW7 A;  5HHZ A;  5L6F A;  2P3H A;  1N60 C;  1W1M A;  5L6G A;  2WDW A;  1F0X A;  2Y08 A;  2UUU A;  2PLS A;  3AN1 A;  4BC9 A;  4XLO A;  4JAY A;  5FXF A;  5D79 A;  4DNS A;  3W8W A;  1WYG A;  1ZXI C;  1AHU A;  2GQT A;  3HRD C;  1HSK A;  1W1L A;  3D2J A;  1W1J A;  3EUB 3;  2NQW A;  2PLI A;  1N62 C;  3LLB A;  3NVV B;  2QKN A;  1V97 A;  2VFV A;  1MBB A;  2YVS A;  1AHV A;  1QLU A;  1W1Q A;  3SR6 B;  2R8D A;  3FW8 A;  2Y4G A;  3DED A;  4ML8 A;  2Y3R A;  1QLT A;  3C0P A;  4PVJ A;  1W1K A;  2RK5 A;  4PVK A;  3NVW B;  2R2Z A;  1SB3 B;  1N61 C;  2P13 A;  3GSY A;  3W8Z A;  5AWV A;  2VFT A;  2W3S A;  4PYT A;  2IPI A;  5HMR A;  1WVE A;  1W1O A;  3PQB A;  1N5W C;  3HSU A;  4HG0 A;  2Q85 A;  2BVH A;  4ZOH B;  3I99 A;  2BVF A;  2Q4W A;  2I0K A;  3AM9 A;  1FO4 A;  4BCA A;  2W55 A;  1RM6 B;  1N63 C;  2AXR A;  5ADZ A;  2VFU A;  3DQ0 A;  3POP A;  1E0Y A;  4MLA A;  5FXE A;  2VFS A;  1T3Q C;  4JB1 A;  3FW9 A;  3JS8 A;  2GQU A;  1I19 A;  1W1S A;  5FXP A;  2VAO A;  1JRP A;  5AE2 A;  3TX1 A;  1VAO A;  2OAI A;  3S1D A;  2W54 A;  3TSJ A;  2O3G A;  1E8F A;  5HQX A;  3RJ8 A;  1FFV C;  1FIQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...