2PLIA

Crystal structure of putative mg2+ and co2+ transporter(corc)associated region from neisseria meningitidis mc58
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58.
rcsb
source organism Neisseria meningitidis
total genus 18
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2pliA00
2BVFA 1V97A 1W1QA 2RK5A 4ML8A 1T3QC 2VFRA 5AE3A 1N5XA 1JROA 4JB1A 3NVWB 4XLOA 3JS8A 4BCAA 3DQ0A 5FXEA 2P4PA 1WVFA 3NVYB 1SB3B 2YVSA 3C0PA 1W1MA 4HG0A 2MBRA 4JAYA 1RM6B 3S1DA 2W3RA 3W8XA 2P13A 3S1FA 5AE2A 3I99A 1W1OA 2OAIA 2W55A 3KJMA 5HQXA 3DEDA 1E0YA 2NQWA 1DIIA 5FXFA 4MLAA 5HHZA 3ETRB 1AHVA 2VFTA 3AN1A 1N62C 3NVVB 3W8ZA 2Q85A 1VAOA 2QPMA 2VFSA 1W1RA 2O3GA 3NS1B 1W1LA 1N61C 3W8WA 3NVZB 2Q4WA 2VFUA 2BVHA 5G5GB 5FXDA 1UXYA 1E8HA 1FFUC 3AMZA 2PLIA 1VDVA 2GQUA 1WYGA 1N63C 4BC7A 1W1SA 3EUB3 3AM9A 1JRPA 2P3HA 5HMRA 4BBYA 2PLSA 1I19A 1MBBA 4ZOHB 1E8GA 3B9JB 3LAEA 5G5HB 2R2ZA 1N60C 1AHZA 1FIQB 2VFVA 1AHUA 2R8DA 1N5WC 2AXRA 1QLTA 5ADZA 3PM9A 4BC9A 1QLUA 2E3TA 2GQTA 1E8FA 1HSKA 3S1CA 1DZNA 1DIQA 3SR6B 4PYTA 1F0XA 2EXRA 1WVEA 2QKNA 1ZXIC 3BW7A 5AE1A 5FXPA 4O95A 3S1EA 2BVGA 1W1KA 3NRZB 4OALA 3TX1A 3HRDC 2W3SA 1FFVC 2VAOA 2W54A 1MBTA 2I0KA 3LLBA 1FO4A 1W1JA 1ZR6A
chains in the Genus database with same CATH superfamily
2BVFA 1V97A 1W1QA 2RK5A 4ML8A 1T3QC 2VFRA 5AE3A 1N5XA 1JROA 4JB1A 3NVWB 4XLOA 3JS8A 5L6GA 4BCAA 3DQ0A 5FXEA 2P4PA 1WVFA 3NVYB 1SB3B 2YVSA 3C0PA 1W1MA 4HG0A 2MBRA 4JAYA 1RM6B 3S1DA 2W3RA 3W8XA 3FW7A 2P13A 3S1FA 4PZFA 5AE2A 3I99A 1W1OA 2OAIA 2W55A 3KJMA 5HQXA 3DEDA 1E0YA 2NQWA 1DIIA 2Y3SA 5FXFA 4MLAA 4EC3A 5HHZA 3ETRB 1AHVA 2VFTA 3AN1A 1N62C 3D2HA 3NVVB 3W8ZA 2Q85A 1VAOA 2QPMA 2VFSA 3FW9A 1W1RA 2O3GA 3NS1B 1W1LA 4PWBA 4PVHA 1N61C 3W8WA 3NVZB 4UD8A 2Q4WA 2VFUA 2BVHA 5G5GB 3PQBA 5FXDA 5AWVA 3D2JA 1UXYA 1E8HA 1FFUC 3AMZA 2PLIA 1VDVA 2GQUA 2Y3RA 1WYGA 1N63C 4BC7A 1W1SA 3EUB3 3TSHA 3AM9A 1JRPA 2P3HA 5HMRA 4BBYA 5L6FA 5I1VA 2PLSA 1I19A 5K8EA 1MBBA 4ZOHB 1E8GA 3B9JB 2UUUA 3LAEA 5G5HB 2R2ZA 1N60C 1AHZA 1FIQB 2VFVA 2Y4GA 3FW8A 3POPA 1AHUA 2R8DA 3D2DA 3RJAA 1N5WC 2AXRA 3FWAA 1QLTA 5ADZA 3PM9A 3VTEA 4BC9A 1QLUA 2E3TA 2GQTA 2Y08A 4PVEA 1E8FA 1HSKA 3S1CA 1DZNA 1DIQA 3SR6B 4PYTA 1F0XA 4PWCA 2EXRA 3TSJA 1WVEA 4PVKA 2QKNA 1ZXIC 3BW7A 5AE1A 5FXPA 4O95A 3S1EA 4DNSA 2BVGA 1W1KA 3HSUA 3NRZB 4OALA 3TX1A 5I1WA 2IPIA 2W3SA 3HRDC 1FFVC 2WDWA 2VAOA 2UUVA 2W54A 1MBTA 2I0KA 3LLBA 5D79A 1FO4A 1W1JA 1ZR6A 4PVJA 3RJ8A 3GSYA
chains in the Genus database with same CATH topology
2BVFA 1V97A 1W1QA 2RK5A 4ML8A 1T3QC 2VFRA 5AE3A 1N5XA 1JROA 4JB1A 3NVWB 4XLOA 3JS8A 5L6GA 4BCAA 3DQ0A 5FXEA 2P4PA 1WVFA 3NVYB 1SB3B 2YVSA 3C0PA 1W1MA 4HG0A 2MBRA 4JAYA 1RM6B 3S1DA 2W3RA 3W8XA 3FW7A 2P13A 3S1FA 4PZFA 5AE2A 3I99A 1W1OA 2OAIA 2W55A 3KJMA 5HQXA 3DEDA 1E0YA 2NQWA 1DIIA 2Y3SA 5FXFA 4MLAA 4EC3A 5HHZA 3ETRB 1AHVA 2VFTA 3AN1A 1N62C 3D2HA 3NVVB 3W8ZA 2Q85A 1VAOA 2QPMA 2VFSA 3FW9A 1W1RA 2O3GA 3NS1B 1W1LA 4PWBA 4PVHA 1N61C 3W8WA 3NVZB 4UD8A 2Q4WA 2VFUA 2BVHA 5G5GB 3PQBA 5FXDA 5AWVA 3D2JA 1UXYA 1E8HA 1FFUC 3AMZA 2PLIA 1VDVA 2GQUA 2Y3RA 1WYGA 1N63C 4BC7A 1W1SA 3EUB3 3TSHA 3AM9A 1JRPA 2P3HA 5HMRA 4BBYA 5L6FA 5I1VA 2PLSA 1I19A 5K8EA 1MBBA 4ZOHB 1E8GA 3B9JB 2UUUA 3LAEA 5G5HB 2R2ZA 1N60C 1AHZA 1FIQB 2VFVA 2Y4GA 3FW8A 3POPA 1AHUA 2R8DA 3D2DA 3RJAA 1N5WC 2AXRA 3FWAA 1QLTA 5ADZA 3PM9A 3VTEA 4BC9A 1QLUA 2E3TA 2GQTA 2Y08A 4PVEA 1E8FA 1HSKA 3S1CA 1DZNA 1DIQA 3SR6B 4PYTA 1F0XA 4PWCA 2EXRA 3TSJA 1WVEA 4PVKA 2QKNA 1ZXIC 3BW7A 5AE1A 5FXPA 4O95A 3S1EA 4DNSA 2BVGA 1W1KA 3HSUA 3NRZB 4OALA 3TX1A 5I1WA 2IPIA 2W3SA 3HRDC 1FFVC 2WDWA 2VAOA 2UUVA 2W54A 1MBTA 2I0KA 3LLBA 5D79A 1FO4A 1W1JA 1ZR6A 4PVJA 3RJ8A 3GSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BVF A;  1V97 A;  1W1Q A;  2RK5 A;  4ML8 A;  1T3Q C;  2VFR A;  5AE3 A;  1N5X A;  1JRO A;  4JB1 A;  3NVW B;  4XLO A;  3JS8 A;  4BCA A;  3DQ0 A;  5FXE A;  2P4P A;  1WVF A;  3NVY B;  1SB3 B;  2YVS A;  3C0P A;  1W1M A;  4HG0 A;  2MBR A;  4JAY A;  1RM6 B;  3S1D A;  2W3R A;  3W8X A;  2P13 A;  3S1F A;  5AE2 A;  3I99 A;  1W1O A;  2OAI A;  2W55 A;  3KJM A;  5HQX A;  3DED A;  1E0Y A;  2NQW A;  1DII A;  5FXF A;  4MLA A;  5HHZ A;  3ETR B;  1AHV A;  2VFT A;  3AN1 A;  1N62 C;  3NVV B;  3W8Z A;  2Q85 A;  1VAO A;  2QPM A;  2VFS A;  1W1R A;  2O3G A;  3NS1 B;  1W1L A;  1N61 C;  3W8W A;  3NVZ B;  2Q4W A;  2VFU A;  2BVH A;  5G5G B;  5FXD A;  1UXY A;  1E8H A;  1FFU C;  3AMZ A;  2PLI A;  1VDV A;  2GQU A;  1WYG A;  1N63 C;  4BC7 A;  1W1S A;  3EUB 3;  3AM9 A;  1JRP A;  2P3H A;  5HMR A;  4BBY A;  2PLS A;  1I19 A;  1MBB A;  4ZOH B;  1E8G A;  3B9J B;  3LAE A;  5G5H B;  2R2Z A;  1N60 C;  1AHZ A;  1FIQ B;  2VFV A;  1AHU A;  2R8D A;  1N5W C;  2AXR A;  1QLT A;  5ADZ A;  3PM9 A;  4BC9 A;  1QLU A;  2E3T A;  2GQT A;  1E8F A;  1HSK A;  3S1C A;  1DZN A;  1DIQ A;  3SR6 B;  4PYT A;  1F0X A;  2EXR A;  1WVE A;  2QKN A;  1ZXI C;  3BW7 A;  5AE1 A;  5FXP A;  4O95 A;  3S1E A;  2BVG A;  1W1K A;  3NRZ B;  4OAL A;  3TX1 A;  3HRD C;  2W3S A;  1FFV C;  2VAO A;  2W54 A;  1MBT A;  2I0K A;  3LLB A;  1FO4 A;  1W1J A;  1ZR6 A; 
#chains in the Genus database with same CATH topology
 2BVF A;  1V97 A;  1W1Q A;  2RK5 A;  4ML8 A;  1T3Q C;  2VFR A;  5AE3 A;  1N5X A;  1JRO A;  4JB1 A;  3NVW B;  4XLO A;  3JS8 A;  5L6G A;  4BCA A;  3DQ0 A;  5FXE A;  2P4P A;  1WVF A;  3NVY B;  1SB3 B;  2YVS A;  3C0P A;  1W1M A;  4HG0 A;  2MBR A;  4JAY A;  1RM6 B;  3S1D A;  2W3R A;  3W8X A;  3FW7 A;  2P13 A;  3S1F A;  4PZF A;  5AE2 A;  3I99 A;  1W1O A;  2OAI A;  2W55 A;  3KJM A;  5HQX A;  3DED A;  1E0Y A;  2NQW A;  1DII A;  2Y3S A;  5FXF A;  4MLA A;  4EC3 A;  5HHZ A;  3ETR B;  1AHV A;  2VFT A;  3AN1 A;  1N62 C;  3D2H A;  3NVV B;  3W8Z A;  2Q85 A;  1VAO A;  2QPM A;  2VFS A;  3FW9 A;  1W1R A;  2O3G A;  3NS1 B;  1W1L A;  4PWB A;  4PVH A;  1N61 C;  3W8W A;  3NVZ B;  4UD8 A;  2Q4W A;  2VFU A;  2BVH A;  5G5G B;  3PQB A;  5FXD A;  5AWV A;  3D2J A;  1UXY A;  1E8H A;  1FFU C;  3AMZ A;  2PLI A;  1VDV A;  2GQU A;  2Y3R A;  1WYG A;  1N63 C;  4BC7 A;  1W1S A;  3EUB 3;  3TSH A;  3AM9 A;  1JRP A;  2P3H A;  5HMR A;  4BBY A;  5L6F A;  5I1V A;  2PLS A;  1I19 A;  5K8E A;  1MBB A;  4ZOH B;  1E8G A;  3B9J B;  2UUU A;  3LAE A;  5G5H B;  2R2Z A;  1N60 C;  1AHZ A;  1FIQ B;  2VFV A;  2Y4G A;  3FW8 A;  3POP A;  1AHU A;  2R8D A;  3D2D A;  3RJA A;  1N5W C;  2AXR A;  3FWA A;  1QLT A;  5ADZ A;  3PM9 A;  3VTE A;  4BC9 A;  1QLU A;  2E3T A;  2GQT A;  2Y08 A;  4PVE A;  1E8F A;  1HSK A;  3S1C A;  1DZN A;  1DIQ A;  3SR6 B;  4PYT A;  1F0X A;  4PWC A;  2EXR A;  3TSJ A;  1WVE A;  4PVK A;  2QKN A;  1ZXI C;  3BW7 A;  5AE1 A;  5FXP A;  4O95 A;  3S1E A;  4DNS A;  2BVG A;  1W1K A;  3HSU A;  3NRZ B;  4OAL A;  3TX1 A;  5I1W A;  2IPI A;  2W3S A;  3HRD C;  1FFV C;  2WDW A;  2VAO A;  2UUV A;  2W54 A;  1MBT A;  2I0K A;  3LLB A;  5D79 A;  1FO4 A;  1W1J A;  1ZR6 A;  4PVJ A;  3RJ8 A;  3GSY A; 
#chains in the Genus database with same CATH homology
 2BVF A;  1V97 A;  1W1Q A;  2RK5 A;  4ML8 A;  1T3Q C;  2VFR A;  5AE3 A;  1N5X A;  1JRO A;  4JB1 A;  3NVW B;  4XLO A;  3JS8 A;  5L6G A;  4BCA A;  3DQ0 A;  5FXE A;  2P4P A;  1WVF A;  3NVY B;  1SB3 B;  2YVS A;  3C0P A;  1W1M A;  4HG0 A;  2MBR A;  4JAY A;  1RM6 B;  3S1D A;  2W3R A;  3W8X A;  3FW7 A;  2P13 A;  3S1F A;  4PZF A;  5AE2 A;  3I99 A;  1W1O A;  2OAI A;  2W55 A;  3KJM A;  5HQX A;  3DED A;  1E0Y A;  2NQW A;  1DII A;  2Y3S A;  5FXF A;  4MLA A;  4EC3 A;  5HHZ A;  3ETR B;  1AHV A;  2VFT A;  3AN1 A;  1N62 C;  3D2H A;  3NVV B;  3W8Z A;  2Q85 A;  1VAO A;  2QPM A;  2VFS A;  3FW9 A;  1W1R A;  2O3G A;  3NS1 B;  1W1L A;  4PWB A;  4PVH A;  1N61 C;  3W8W A;  3NVZ B;  4UD8 A;  2Q4W A;  2VFU A;  2BVH A;  5G5G B;  3PQB A;  5FXD A;  5AWV A;  3D2J A;  1UXY A;  1E8H A;  1FFU C;  3AMZ A;  2PLI A;  1VDV A;  2GQU A;  2Y3R A;  1WYG A;  1N63 C;  4BC7 A;  1W1S A;  3EUB 3;  3TSH A;  3AM9 A;  1JRP A;  2P3H A;  5HMR A;  4BBY A;  5L6F A;  5I1V A;  2PLS A;  1I19 A;  5K8E A;  1MBB A;  4ZOH B;  1E8G A;  3B9J B;  2UUU A;  3LAE A;  5G5H B;  2R2Z A;  1N60 C;  1AHZ A;  1FIQ B;  2VFV A;  2Y4G A;  3FW8 A;  3POP A;  1AHU A;  2R8D A;  3D2D A;  3RJA A;  1N5W C;  2AXR A;  3FWA A;  1QLT A;  5ADZ A;  3PM9 A;  3VTE A;  4BC9 A;  1QLU A;  2E3T A;  2GQT A;  2Y08 A;  4PVE A;  1E8F A;  1HSK A;  3S1C A;  1DZN A;  1DIQ A;  3SR6 B;  4PYT A;  1F0X A;  4PWC A;  2EXR A;  3TSJ A;  1WVE A;  4PVK A;  2QKN A;  1ZXI C;  3BW7 A;  5AE1 A;  5FXP A;  4O95 A;  3S1E A;  4DNS A;  2BVG A;  1W1K A;  3HSU A;  3NRZ B;  4OAL A;  3TX1 A;  5I1W A;  2IPI A;  2W3S A;  3HRD C;  1FFV C;  2WDW A;  2VAO A;  2UUV A;  2W54 A;  1MBT A;  2I0K A;  3LLB A;  5D79 A;  1FO4 A;  1W1J A;  1ZR6 A;  4PVJ A;  3RJ8 A;  3GSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...