2PLIA

Crystal structure of putative mg2+ and co2+ transporter(corc)associated region from neisseria meningitidis mc58
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
b'SADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2pliA00
1MBTA 3C0PA 2OAIA 3I99A 1E8HA 1ZXIC 2GQTA 1DIIA 1MBBA 1QLTA 1E0YA 1WYGA 2VFUA 2PLIA 1W1SA 1N63C 1V97A 2QKNA 4ZOHB 1WVFA 2EXRA 2P4PA 2YVSA 3ETRB 5AE2A 1E8FA 3S1DA 1AHUA 1W1LA 4O95A 4BC7A 2E3TA 3AM9A 1DIQA 2PLSA 3TX1A 3DEDA 3DQ0A 5AE1A 3BW7A 2NQWA 3NVVB 3NVYB 1FIQB 1SB3B 5FXFA 3W8ZA 1W1RA 1N5WC 3S1CA 2P13A 3W8WA 2RK5A 1FFVC 3JS8A 3B9JB 3W8XA 1WVEA 1N62C 1AHVA 3NRZB 5FXDA 4XLOA 5HHZA 1QLUA 1N5XA 3NVZB 1HSKA 1T3QC 3S1FA 2VFSA 1VDVA 4PYTA 1ZR6A 2VFTA 2VFVA 1UXYA 4BCAA 5AE3A 1DZNA 3SR6B 5HMRA 2MBRA 4BBYA 2BVHA 2P3HA 5FXEA 5HQXA 2VFRA 5FXPA 1W1MA 2W3SA 1F0XA 1N60C 1W1QA 4JAYA 4ML8A 2GQUA 2R8DA 3EUB3 4JB1A 1AHZA 1W1OA 2W3RA 3AMZA 5ADZA 2VAOA 2QPMA 1I19A 1FFUC 3KJMA 2Q4WA 2BVGA 2W54A 1RM6B 2O3GA 3LAEA 3NVWB 1E8GA 1W1KA 3AN1A 4OALA 5G5GB 4MLAA 2Q85A 4BC9A 3LLBA 4HG0A 3HRDC 2W55A 1JROA 2AXRA 1VAOA 1N61C 2R2ZA 1JRPA 2BVFA 1FO4A 3S1EA 3PM9A 1W1JA 5G5HB 3NS1B 2I0KA
chains in the Genus database with same CATH superfamily
5AWVA 1MBTA 2Y3RA 2OAIA 3C0PA 3I99A 3POPA 1E8HA 1ZXIC 2GQTA 1DIIA 1MBBA 2UUUA 1QLTA 3RJ8A 5L6GA 1E0YA 1WYGA 2VFUA 3FW8A 2PLIA 3FW7A 1W1SA 2Y3SA 1N63C 1V97A 2QKNA 2Y08A 5K8EA 4ZOHB 1WVFA 2EXRA 2P4PA 2YVSA 3ETRB 5AE2A 1E8FA 3S1DA 1AHUA 1W1LA 4O95A 4BC7A 4DNSA 3FWAA 2E3TA 2WDWA 4PVJA 3AM9A 1DIQA 2PLSA 3TX1A 5I1VA 3DEDA 3DQ0A 3HSUA 5AE1A 3TSHA 3BW7A 2NQWA 2UUVA 3D2HA 3NVVB 5D79A 3NVYB 1FIQB 1SB3B 5FXFA 3W8ZA 1W1RA 1N5WC 3S1CA 2P13A 3W8WA 2RK5A 1FFVC 3JS8A 3B9JB 4UD8A 3W8XA 1WVEA 1N62C 2IPIA 1AHVA 3NRZB 5FXDA 5L6FA 4XLOA 5HHZA 1QLUA 1N5XA 3NVZB 4PVHA 1HSKA 1T3QC 3S1FA 2VFSA 3VTEA 1VDVA 4PYTA 1ZR6A 2VFTA 2VFVA 1UXYA 4BCAA 5AE3A 1DZNA 3SR6B 4PZFA 5HMRA 2MBRA 4BBYA 2BVHA 2P3HA 5FXEA 5HQXA 2VFRA 5FXPA 1W1MA 2W3SA 3FW9A 1F0XA 1N60C 1W1QA 4JAYA 4PWCA 4ML8A 2GQUA 2R8DA 3EUB3 4JB1A 1AHZA 1W1OA 2W3RA 3AMZA 5ADZA 2VAOA 3TSJA 2QPMA 1I19A 1FFUC 3KJMA 2Q4WA 2BVGA 3GSYA 2W54A 1RM6B 2O3GA 3LAEA 3NVWB 1E8GA 1W1KA 3AN1A 4OALA 5G5GB 4MLAA 2Q85A 4BC9A 3RJAA 4PVKA 4PVEA 3LLBA 4HG0A 3HRDC 4EC3A 2W55A 1JROA 2AXRA 4PWBA 1VAOA 1N61C 2R2ZA 1JRPA 3PQBA 2BVFA 1FO4A 3D2DA 3S1EA 3PM9A 1W1JA 2Y4GA 5I1WA 5G5HB 3D2JA 3NS1B 2I0KA
chains in the Genus database with same CATH topology
5AWVA 1MBTA 2Y3RA 2OAIA 3C0PA 3I99A 3POPA 1E8HA 1ZXIC 2GQTA 1DIIA 1MBBA 2UUUA 1QLTA 3RJ8A 5L6GA 1E0YA 1WYGA 2VFUA 3FW8A 2PLIA 3FW7A 1W1SA 2Y3SA 1N63C 1V97A 2QKNA 2Y08A 5K8EA 4ZOHB 1WVFA 2EXRA 2P4PA 2YVSA 3ETRB 5AE2A 1E8FA 3S1DA 1AHUA 1W1LA 4O95A 4BC7A 4DNSA 3FWAA 2E3TA 2WDWA 4PVJA 3AM9A 1DIQA 2PLSA 3TX1A 5I1VA 3DEDA 3DQ0A 3HSUA 5AE1A 3TSHA 3BW7A 2NQWA 2UUVA 3D2HA 3NVVB 5D79A 3NVYB 1FIQB 1SB3B 5FXFA 3W8ZA 1W1RA 1N5WC 3S1CA 2P13A 3W8WA 2RK5A 1FFVC 3JS8A 3B9JB 4UD8A 3W8XA 1WVEA 1N62C 2IPIA 1AHVA 3NRZB 5FXDA 5L6FA 4XLOA 5HHZA 1QLUA 1N5XA 3NVZB 4PVHA 1HSKA 1T3QC 3S1FA 2VFSA 3VTEA 1VDVA 4PYTA 1ZR6A 2VFTA 2VFVA 1UXYA 4BCAA 5AE3A 1DZNA 3SR6B 4PZFA 5HMRA 2MBRA 4BBYA 2BVHA 2P3HA 5FXEA 5HQXA 2VFRA 5FXPA 1W1MA 2W3SA 3FW9A 1F0XA 1N60C 1W1QA 4JAYA 4PWCA 4ML8A 2GQUA 2R8DA 3EUB3 4JB1A 1AHZA 1W1OA 2W3RA 3AMZA 5ADZA 2VAOA 3TSJA 2QPMA 1I19A 1FFUC 3KJMA 2Q4WA 2BVGA 3GSYA 2W54A 1RM6B 2O3GA 3LAEA 3NVWB 1E8GA 1W1KA 3AN1A 4OALA 5G5GB 4MLAA 2Q85A 4BC9A 3RJAA 4PVKA 4PVEA 3LLBA 4HG0A 3HRDC 4EC3A 2W55A 1JROA 2AXRA 4PWBA 1VAOA 1N61C 2R2ZA 1JRPA 3PQBA 2BVFA 1FO4A 3D2DA 3S1EA 3PM9A 1W1JA 2Y4GA 5I1WA 5G5HB 3D2JA 3NS1B 2I0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBT A;  3C0P A;  2OAI A;  3I99 A;  1E8H A;  1ZXI C;  2GQT A;  1DII A;  1MBB A;  1QLT A;  1E0Y A;  1WYG A;  2VFU A;  2PLI A;  1W1S A;  1N63 C;  1V97 A;  2QKN A;  4ZOH B;  1WVF A;  2EXR A;  2P4P A;  2YVS A;  3ETR B;  5AE2 A;  1E8F A;  3S1D A;  1AHU A;  1W1L A;  4O95 A;  4BC7 A;  2E3T A;  3AM9 A;  1DIQ A;  2PLS A;  3TX1 A;  3DED A;  3DQ0 A;  5AE1 A;  3BW7 A;  2NQW A;  3NVV B;  3NVY B;  1FIQ B;  1SB3 B;  5FXF A;  3W8Z A;  1W1R A;  1N5W C;  3S1C A;  2P13 A;  3W8W A;  2RK5 A;  1FFV C;  3JS8 A;  3B9J B;  3W8X A;  1WVE A;  1N62 C;  1AHV A;  3NRZ B;  5FXD A;  4XLO A;  5HHZ A;  1QLU A;  1N5X A;  3NVZ B;  1HSK A;  1T3Q C;  3S1F A;  2VFS A;  1VDV A;  4PYT A;  1ZR6 A;  2VFT A;  2VFV A;  1UXY A;  4BCA A;  5AE3 A;  1DZN A;  3SR6 B;  5HMR A;  2MBR A;  4BBY A;  2BVH A;  2P3H A;  5FXE A;  5HQX A;  2VFR A;  5FXP A;  1W1M A;  2W3S A;  1F0X A;  1N60 C;  1W1Q A;  4JAY A;  4ML8 A;  2GQU A;  2R8D A;  3EUB 3;  4JB1 A;  1AHZ A;  1W1O A;  2W3R A;  3AMZ A;  5ADZ A;  2VAO A;  2QPM A;  1I19 A;  1FFU C;  3KJM A;  2Q4W A;  2BVG A;  2W54 A;  1RM6 B;  2O3G A;  3LAE A;  3NVW B;  1E8G A;  1W1K A;  3AN1 A;  4OAL A;  5G5G B;  4MLA A;  2Q85 A;  4BC9 A;  3LLB A;  4HG0 A;  3HRD C;  2W55 A;  1JRO A;  2AXR A;  1VAO A;  1N61 C;  2R2Z A;  1JRP A;  2BVF A;  1FO4 A;  3S1E A;  3PM9 A;  1W1J A;  5G5H B;  3NS1 B;  2I0K A; 
#chains in the Genus database with same CATH topology
 5AWV A;  1MBT A;  2Y3R A;  2OAI A;  3C0P A;  3I99 A;  3POP A;  1E8H A;  1ZXI C;  2GQT A;  1DII A;  1MBB A;  2UUU A;  1QLT A;  3RJ8 A;  5L6G A;  1E0Y A;  1WYG A;  2VFU A;  3FW8 A;  2PLI A;  3FW7 A;  1W1S A;  2Y3S A;  1N63 C;  1V97 A;  2QKN A;  2Y08 A;  5K8E A;  4ZOH B;  1WVF A;  2EXR A;  2P4P A;  2YVS A;  3ETR B;  5AE2 A;  1E8F A;  3S1D A;  1AHU A;  1W1L A;  4O95 A;  4BC7 A;  4DNS A;  3FWA A;  2E3T A;  2WDW A;  4PVJ A;  3AM9 A;  1DIQ A;  2PLS A;  3TX1 A;  5I1V A;  3DED A;  3DQ0 A;  3HSU A;  5AE1 A;  3TSH A;  3BW7 A;  2NQW A;  2UUV A;  3D2H A;  3NVV B;  5D79 A;  3NVY B;  1FIQ B;  1SB3 B;  5FXF A;  3W8Z A;  1W1R A;  1N5W C;  3S1C A;  2P13 A;  3W8W A;  2RK5 A;  1FFV C;  3JS8 A;  3B9J B;  4UD8 A;  3W8X A;  1WVE A;  1N62 C;  2IPI A;  1AHV A;  3NRZ B;  5FXD A;  5L6F A;  4XLO A;  5HHZ A;  1QLU A;  1N5X A;  3NVZ B;  4PVH A;  1HSK A;  1T3Q C;  3S1F A;  2VFS A;  3VTE A;  1VDV A;  4PYT A;  1ZR6 A;  2VFT A;  2VFV A;  1UXY A;  4BCA A;  5AE3 A;  1DZN A;  3SR6 B;  4PZF A;  5HMR A;  2MBR A;  4BBY A;  2BVH A;  2P3H A;  5FXE A;  5HQX A;  2VFR A;  5FXP A;  1W1M A;  2W3S A;  3FW9 A;  1F0X A;  1N60 C;  1W1Q A;  4JAY A;  4PWC A;  4ML8 A;  2GQU A;  2R8D A;  3EUB 3;  4JB1 A;  1AHZ A;  1W1O A;  2W3R A;  3AMZ A;  5ADZ A;  2VAO A;  3TSJ A;  2QPM A;  1I19 A;  1FFU C;  3KJM A;  2Q4W A;  2BVG A;  3GSY A;  2W54 A;  1RM6 B;  2O3G A;  3LAE A;  3NVW B;  1E8G A;  1W1K A;  3AN1 A;  4OAL A;  5G5G B;  4MLA A;  2Q85 A;  4BC9 A;  3RJA A;  4PVK A;  4PVE A;  3LLB A;  4HG0 A;  3HRD C;  4EC3 A;  2W55 A;  1JRO A;  2AXR A;  4PWB A;  1VAO A;  1N61 C;  2R2Z A;  1JRP A;  3PQB A;  2BVF A;  1FO4 A;  3D2D A;  3S1E A;  3PM9 A;  1W1J A;  2Y4G A;  5I1W A;  5G5H B;  3D2J A;  3NS1 B;  2I0K A; 
#chains in the Genus database with same CATH homology
 5AWV A;  1MBT A;  2Y3R A;  2OAI A;  3C0P A;  3I99 A;  3POP A;  1E8H A;  1ZXI C;  2GQT A;  1DII A;  1MBB A;  2UUU A;  1QLT A;  3RJ8 A;  5L6G A;  1E0Y A;  1WYG A;  2VFU A;  3FW8 A;  2PLI A;  3FW7 A;  1W1S A;  2Y3S A;  1N63 C;  1V97 A;  2QKN A;  2Y08 A;  5K8E A;  4ZOH B;  1WVF A;  2EXR A;  2P4P A;  2YVS A;  3ETR B;  5AE2 A;  1E8F A;  3S1D A;  1AHU A;  1W1L A;  4O95 A;  4BC7 A;  4DNS A;  3FWA A;  2E3T A;  2WDW A;  4PVJ A;  3AM9 A;  1DIQ A;  2PLS A;  3TX1 A;  5I1V A;  3DED A;  3DQ0 A;  3HSU A;  5AE1 A;  3TSH A;  3BW7 A;  2NQW A;  2UUV A;  3D2H A;  3NVV B;  5D79 A;  3NVY B;  1FIQ B;  1SB3 B;  5FXF A;  3W8Z A;  1W1R A;  1N5W C;  3S1C A;  2P13 A;  3W8W A;  2RK5 A;  1FFV C;  3JS8 A;  3B9J B;  4UD8 A;  3W8X A;  1WVE A;  1N62 C;  2IPI A;  1AHV A;  3NRZ B;  5FXD A;  5L6F A;  4XLO A;  5HHZ A;  1QLU A;  1N5X A;  3NVZ B;  4PVH A;  1HSK A;  1T3Q C;  3S1F A;  2VFS A;  3VTE A;  1VDV A;  4PYT A;  1ZR6 A;  2VFT A;  2VFV A;  1UXY A;  4BCA A;  5AE3 A;  1DZN A;  3SR6 B;  4PZF A;  5HMR A;  2MBR A;  4BBY A;  2BVH A;  2P3H A;  5FXE A;  5HQX A;  2VFR A;  5FXP A;  1W1M A;  2W3S A;  3FW9 A;  1F0X A;  1N60 C;  1W1Q A;  4JAY A;  4PWC A;  4ML8 A;  2GQU A;  2R8D A;  3EUB 3;  4JB1 A;  1AHZ A;  1W1O A;  2W3R A;  3AMZ A;  5ADZ A;  2VAO A;  3TSJ A;  2QPM A;  1I19 A;  1FFU C;  3KJM A;  2Q4W A;  2BVG A;  3GSY A;  2W54 A;  1RM6 B;  2O3G A;  3LAE A;  3NVW B;  1E8G A;  1W1K A;  3AN1 A;  4OAL A;  5G5G B;  4MLA A;  2Q85 A;  4BC9 A;  3RJA A;  4PVK A;  4PVE A;  3LLB A;  4HG0 A;  3HRD C;  4EC3 A;  2W55 A;  1JRO A;  2AXR A;  4PWB A;  1VAO A;  1N61 C;  2R2Z A;  1JRP A;  3PQB A;  2BVF A;  1FO4 A;  3D2D A;  3S1E A;  3PM9 A;  1W1J A;  2Y4G A;  5I1W A;  5G5H B;  3D2J A;  3NS1 B;  2I0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...