2PLIA

Crystal structure of putative mg2+ and co2+ transporter(corc)associated region from neisseria meningitidis mc58
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
total genus 18
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2pliA00
1VDVA 1VAOA 2BVFA 1N60C 2VFVA 5AE2A 1WVEA 5FXFA 3LAEA 1RM6B 2PLSA 5FXEA 5HQXA 3NVZB 1WVFA 1DIIA 4BCAA 1FIQB 1FFUC 5G5HB 2GQTA 4ML8A 3NS1B 4PYTA 1N5WC 5HMRA 1N63C 2OAIA 2W55A 3S1EA 1DZNA 1E8HA 1W1MA 2BVHA 1QLTA 3JS8A 5AE3A 4JB1A 1N62C 1W1OA 2NQWA 2VFUA 1E0YA 1JRPA 1T3QC 2P13A 3LLBA 3B9JB 3NRZB 2P4PA 2QPMA 2VFSA 5ADZA 3W8XA 3AM9A 1W1JA 3S1CA 3TX1A 4O95A 2W3SA 1W1LA 2Q85A 2PLIA 1E8FA 1W1QA 1W1SA 3NVVB 2VFTA 2QKNA 1AHZA 1WYGA 3S1DA 5FXPA 1W1KA 3I99A 1N61C 2VAOA 3DQ0A 5AE1A 4HG0A 2GQUA 1E8GA 2RK5A 3AN1A 5HHZA 1HSKA 2E3TA 1W1RA 3NVYB 1N5XA 2I0KA 4BC9A 1QLUA 3S1FA 1I19A 1V97A 4BC7A 3EUB3 4OALA 3NVWB 2W54A 3BW7A 2VFRA 1UXYA 2R2ZA 1ZXIC 2EXRA 5G5GB 2W3RA 3W8ZA 3SR6B 1MBBA 2R8DA 4JAYA 4XLOA 2MBRA 5FXDA 3HRDC 4ZOHB 3PM9A 4BBYA 1MBTA 3C0PA 3KJMA 1ZR6A 2YVSA 1FO4A 1SB3B 1DIQA 3AMZA 1AHUA 2AXRA 1F0XA 1FFVC 2P3HA 2BVGA 3ETRB 2O3GA 3DEDA 1AHVA 1JROA 3W8WA 2Q4WA 4MLAA
chains in the Genus database with same CATH superfamily
1VDVA 1VAOA 4PVEA 2BVFA 1N60C 2VFVA 5AE2A 1WVEA 5FXFA 3LAEA 5D79A 3D2HA 1RM6B 2PLSA 2Y4GA 3PQBA 5FXEA 5HQXA 3NVZB 1WVFA 1DIIA 3GSYA 3FW8A 4BCAA 1FIQB 1FFUC 5G5HB 2GQTA 4ML8A 3NS1B 5AWVA 4PYTA 1N5WC 5HMRA 1N63C 4PWCA 2OAIA 2UUVA 2W55A 3S1EA 1DZNA 1E8HA 1W1MA 2BVHA 2UUUA 1QLTA 3JS8A 5AE3A 4JB1A 4EC3A 4DNSA 3HSUA 3VTEA 1N62C 1W1OA 2NQWA 2VFUA 1E0YA 1JRPA 1T3QC 2P13A 3LLBA 3B9JB 3NRZB 5I1VA 2P4PA 3FW9A 2Y3SA 2QPMA 4PVJA 2VFSA 5ADZA 3W8XA 3AM9A 1W1JA 3S1CA 3FWAA 3TX1A 4O95A 2W3SA 1W1LA 2Q85A 2PLIA 3TSHA 1E8FA 1W1QA 5K8EA 2Y08A 1W1SA 3NVVB 2VFTA 3D2JA 2QKNA 1AHZA 1WYGA 3S1DA 5FXPA 1W1KA 3I99A 1N61C 2VAOA 3DQ0A 3POPA 5AE1A 4HG0A 2GQUA 1E8GA 2RK5A 3AN1A 5HHZA 3RJAA 1HSKA 2E3TA 1W1RA 4PVHA 3D2DA 3NVYB 2Y3RA 3FW7A 4PVKA 1N5XA 4PWBA 2I0KA 4BC9A 1QLUA 3S1FA 1I19A 1V97A 4BC7A 3EUB3 4OALA 3NVWB 2W54A 3TSJA 3BW7A 2VFRA 1UXYA 2R2ZA 1ZXIC 2EXRA 5G5GB 2IPIA 2W3RA 3W8ZA 4PZFA 3SR6B 1MBBA 2R8DA 4JAYA 4XLOA 2MBRA 3RJ8A 5FXDA 3HRDC 4ZOHB 3PM9A 2WDWA 4BBYA 1MBTA 3C0PA 3KJMA 1ZR6A 2YVSA 4UD8A 1FO4A 1SB3B 1DIQA 3AMZA 5I1WA 1AHUA 2AXRA 5L6FA 1F0XA 1FFVC 2P3HA 5L6GA 2BVGA 3ETRB 2O3GA 3DEDA 1AHVA 1JROA 3W8WA 2Q4WA 4MLAA
chains in the Genus database with same CATH topology
1VDVA 1VAOA 4PVEA 2BVFA 1N60C 2VFVA 5AE2A 1WVEA 5FXFA 3LAEA 5D79A 3D2HA 1RM6B 2PLSA 2Y4GA 3PQBA 5FXEA 5HQXA 3NVZB 1WVFA 1DIIA 3GSYA 3FW8A 4BCAA 1FIQB 1FFUC 5G5HB 2GQTA 4ML8A 3NS1B 5AWVA 4PYTA 1N5WC 5HMRA 1N63C 4PWCA 2OAIA 2UUVA 2W55A 3S1EA 1DZNA 1E8HA 1W1MA 2BVHA 2UUUA 1QLTA 3JS8A 5AE3A 4JB1A 4EC3A 4DNSA 3HSUA 3VTEA 1N62C 1W1OA 2NQWA 2VFUA 1E0YA 1JRPA 1T3QC 2P13A 3LLBA 3B9JB 3NRZB 5I1VA 2P4PA 3FW9A 2Y3SA 2QPMA 4PVJA 2VFSA 5ADZA 3W8XA 3AM9A 1W1JA 3S1CA 3FWAA 3TX1A 4O95A 2W3SA 1W1LA 2Q85A 2PLIA 3TSHA 1E8FA 1W1QA 5K8EA 2Y08A 1W1SA 3NVVB 2VFTA 3D2JA 2QKNA 1AHZA 1WYGA 3S1DA 5FXPA 1W1KA 3I99A 1N61C 2VAOA 3DQ0A 3POPA 5AE1A 4HG0A 2GQUA 1E8GA 2RK5A 3AN1A 5HHZA 3RJAA 1HSKA 2E3TA 1W1RA 4PVHA 3D2DA 3NVYB 2Y3RA 3FW7A 4PVKA 1N5XA 4PWBA 2I0KA 4BC9A 1QLUA 3S1FA 1I19A 1V97A 4BC7A 3EUB3 4OALA 3NVWB 2W54A 3TSJA 3BW7A 2VFRA 1UXYA 2R2ZA 1ZXIC 2EXRA 5G5GB 2IPIA 2W3RA 3W8ZA 4PZFA 3SR6B 1MBBA 2R8DA 4JAYA 4XLOA 2MBRA 3RJ8A 5FXDA 3HRDC 4ZOHB 3PM9A 2WDWA 4BBYA 1MBTA 3C0PA 3KJMA 1ZR6A 2YVSA 4UD8A 1FO4A 1SB3B 1DIQA 3AMZA 5I1WA 1AHUA 2AXRA 5L6FA 1F0XA 1FFVC 2P3HA 5L6GA 2BVGA 3ETRB 2O3GA 3DEDA 1AHVA 1JROA 3W8WA 2Q4WA 4MLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDV A;  1VAO A;  2BVF A;  1N60 C;  2VFV A;  5AE2 A;  1WVE A;  5FXF A;  3LAE A;  1RM6 B;  2PLS A;  5FXE A;  5HQX A;  3NVZ B;  1WVF A;  1DII A;  4BCA A;  1FIQ B;  1FFU C;  5G5H B;  2GQT A;  4ML8 A;  3NS1 B;  4PYT A;  1N5W C;  5HMR A;  1N63 C;  2OAI A;  2W55 A;  3S1E A;  1DZN A;  1E8H A;  1W1M A;  2BVH A;  1QLT A;  3JS8 A;  5AE3 A;  4JB1 A;  1N62 C;  1W1O A;  2NQW A;  2VFU A;  1E0Y A;  1JRP A;  1T3Q C;  2P13 A;  3LLB A;  3B9J B;  3NRZ B;  2P4P A;  2QPM A;  2VFS A;  5ADZ A;  3W8X A;  3AM9 A;  1W1J A;  3S1C A;  3TX1 A;  4O95 A;  2W3S A;  1W1L A;  2Q85 A;  2PLI A;  1E8F A;  1W1Q A;  1W1S A;  3NVV B;  2VFT A;  2QKN A;  1AHZ A;  1WYG A;  3S1D A;  5FXP A;  1W1K A;  3I99 A;  1N61 C;  2VAO A;  3DQ0 A;  5AE1 A;  4HG0 A;  2GQU A;  1E8G A;  2RK5 A;  3AN1 A;  5HHZ A;  1HSK A;  2E3T A;  1W1R A;  3NVY B;  1N5X A;  2I0K A;  4BC9 A;  1QLU A;  3S1F A;  1I19 A;  1V97 A;  4BC7 A;  3EUB 3;  4OAL A;  3NVW B;  2W54 A;  3BW7 A;  2VFR A;  1UXY A;  2R2Z A;  1ZXI C;  2EXR A;  5G5G B;  2W3R A;  3W8Z A;  3SR6 B;  1MBB A;  2R8D A;  4JAY A;  4XLO A;  2MBR A;  5FXD A;  3HRD C;  4ZOH B;  3PM9 A;  4BBY A;  1MBT A;  3C0P A;  3KJM A;  1ZR6 A;  2YVS A;  1FO4 A;  1SB3 B;  1DIQ A;  3AMZ A;  1AHU A;  2AXR A;  1F0X A;  1FFV C;  2P3H A;  2BVG A;  3ETR B;  2O3G A;  3DED A;  1AHV A;  1JRO A;  3W8W A;  2Q4W A;  4MLA A; 
#chains in the Genus database with same CATH topology
 1VDV A;  1VAO A;  4PVE A;  2BVF A;  1N60 C;  2VFV A;  5AE2 A;  1WVE A;  5FXF A;  3LAE A;  5D79 A;  3D2H A;  1RM6 B;  2PLS A;  2Y4G A;  3PQB A;  5FXE A;  5HQX A;  3NVZ B;  1WVF A;  1DII A;  3GSY A;  3FW8 A;  4BCA A;  1FIQ B;  1FFU C;  5G5H B;  2GQT A;  4ML8 A;  3NS1 B;  5AWV A;  4PYT A;  1N5W C;  5HMR A;  1N63 C;  4PWC A;  2OAI A;  2UUV A;  2W55 A;  3S1E A;  1DZN A;  1E8H A;  1W1M A;  2BVH A;  2UUU A;  1QLT A;  3JS8 A;  5AE3 A;  4JB1 A;  4EC3 A;  4DNS A;  3HSU A;  3VTE A;  1N62 C;  1W1O A;  2NQW A;  2VFU A;  1E0Y A;  1JRP A;  1T3Q C;  2P13 A;  3LLB A;  3B9J B;  3NRZ B;  5I1V A;  2P4P A;  3FW9 A;  2Y3S A;  2QPM A;  4PVJ A;  2VFS A;  5ADZ A;  3W8X A;  3AM9 A;  1W1J A;  3S1C A;  3FWA A;  3TX1 A;  4O95 A;  2W3S A;  1W1L A;  2Q85 A;  2PLI A;  3TSH A;  1E8F A;  1W1Q A;  5K8E A;  2Y08 A;  1W1S A;  3NVV B;  2VFT A;  3D2J A;  2QKN A;  1AHZ A;  1WYG A;  3S1D A;  5FXP A;  1W1K A;  3I99 A;  1N61 C;  2VAO A;  3DQ0 A;  3POP A;  5AE1 A;  4HG0 A;  2GQU A;  1E8G A;  2RK5 A;  3AN1 A;  5HHZ A;  3RJA A;  1HSK A;  2E3T A;  1W1R A;  4PVH A;  3D2D A;  3NVY B;  2Y3R A;  3FW7 A;  4PVK A;  1N5X A;  4PWB A;  2I0K A;  4BC9 A;  1QLU A;  3S1F A;  1I19 A;  1V97 A;  4BC7 A;  3EUB 3;  4OAL A;  3NVW B;  2W54 A;  3TSJ A;  3BW7 A;  2VFR A;  1UXY A;  2R2Z A;  1ZXI C;  2EXR A;  5G5G B;  2IPI A;  2W3R A;  3W8Z A;  4PZF A;  3SR6 B;  1MBB A;  2R8D A;  4JAY A;  4XLO A;  2MBR A;  3RJ8 A;  5FXD A;  3HRD C;  4ZOH B;  3PM9 A;  2WDW A;  4BBY A;  1MBT A;  3C0P A;  3KJM A;  1ZR6 A;  2YVS A;  4UD8 A;  1FO4 A;  1SB3 B;  1DIQ A;  3AMZ A;  5I1W A;  1AHU A;  2AXR A;  5L6F A;  1F0X A;  1FFV C;  2P3H A;  5L6G A;  2BVG A;  3ETR B;  2O3G A;  3DED A;  1AHV A;  1JRO A;  3W8W A;  2Q4W A;  4MLA A; 
#chains in the Genus database with same CATH homology
 1VDV A;  1VAO A;  4PVE A;  2BVF A;  1N60 C;  2VFV A;  5AE2 A;  1WVE A;  5FXF A;  3LAE A;  5D79 A;  3D2H A;  1RM6 B;  2PLS A;  2Y4G A;  3PQB A;  5FXE A;  5HQX A;  3NVZ B;  1WVF A;  1DII A;  3GSY A;  3FW8 A;  4BCA A;  1FIQ B;  1FFU C;  5G5H B;  2GQT A;  4ML8 A;  3NS1 B;  5AWV A;  4PYT A;  1N5W C;  5HMR A;  1N63 C;  4PWC A;  2OAI A;  2UUV A;  2W55 A;  3S1E A;  1DZN A;  1E8H A;  1W1M A;  2BVH A;  2UUU A;  1QLT A;  3JS8 A;  5AE3 A;  4JB1 A;  4EC3 A;  4DNS A;  3HSU A;  3VTE A;  1N62 C;  1W1O A;  2NQW A;  2VFU A;  1E0Y A;  1JRP A;  1T3Q C;  2P13 A;  3LLB A;  3B9J B;  3NRZ B;  5I1V A;  2P4P A;  3FW9 A;  2Y3S A;  2QPM A;  4PVJ A;  2VFS A;  5ADZ A;  3W8X A;  3AM9 A;  1W1J A;  3S1C A;  3FWA A;  3TX1 A;  4O95 A;  2W3S A;  1W1L A;  2Q85 A;  2PLI A;  3TSH A;  1E8F A;  1W1Q A;  5K8E A;  2Y08 A;  1W1S A;  3NVV B;  2VFT A;  3D2J A;  2QKN A;  1AHZ A;  1WYG A;  3S1D A;  5FXP A;  1W1K A;  3I99 A;  1N61 C;  2VAO A;  3DQ0 A;  3POP A;  5AE1 A;  4HG0 A;  2GQU A;  1E8G A;  2RK5 A;  3AN1 A;  5HHZ A;  3RJA A;  1HSK A;  2E3T A;  1W1R A;  4PVH A;  3D2D A;  3NVY B;  2Y3R A;  3FW7 A;  4PVK A;  1N5X A;  4PWB A;  2I0K A;  4BC9 A;  1QLU A;  3S1F A;  1I19 A;  1V97 A;  4BC7 A;  3EUB 3;  4OAL A;  3NVW B;  2W54 A;  3TSJ A;  3BW7 A;  2VFR A;  1UXY A;  2R2Z A;  1ZXI C;  2EXR A;  5G5G B;  2IPI A;  2W3R A;  3W8Z A;  4PZF A;  3SR6 B;  1MBB A;  2R8D A;  4JAY A;  4XLO A;  2MBR A;  3RJ8 A;  5FXD A;  3HRD C;  4ZOH B;  3PM9 A;  2WDW A;  4BBY A;  1MBT A;  3C0P A;  3KJM A;  1ZR6 A;  2YVS A;  4UD8 A;  1FO4 A;  1SB3 B;  1DIQ A;  3AMZ A;  5I1W A;  1AHU A;  2AXR A;  5L6F A;  1F0X A;  1FFV C;  2P3H A;  5L6G A;  2BVG A;  3ETR B;  2O3G A;  3DED A;  1AHV A;  1JRO A;  3W8W A;  2Q4W A;  4MLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...