2PLIA

Crystal structure of putative mg2+ and co2+ transporter(corc)associated region from neisseria meningitidis mc58
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
84
structure length
84
Chain Sequence
SADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGHLPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative Mg2+ and Co2+ transporter(CorC)associated region from Neisseria meningitidis MC58.
rcsb
source organism Neisseria meningitidis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 18
structure length 84
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2pliA00
5FXFA 1VDVA 1VAOA 4O95A 3W8ZA 1N61C 1MBTA 4JAYA 1AHZA 1SB3B 2O3GA 3LLBA 3KJMA 2W54A 1DIQA 3EUB3 1QLTA 1N5XA 4PYTA 4BC9A 2E3TA 3NVZB 1N60C 3NVYB 2VFVA 3AM9A 1AHVA 3S1FA 1W1MA 1N62C 3JS8A 4ZOHB 2W55A 1E8GA 1E8FA 1F0XA 2Q85A 2OAIA 3DQ0A 3AMZA 5HQXA 1FO4A 4XLOA 3S1EA 3B9JB 1W1QA 2PLIA 1QLUA 4BC7A 1FIQB 3S1CA 1WVEA 3NS1B 3W8XA 4MLAA 3LAEA 2I0KA 1JRPA 1I19A 2YVSA 1W1RA 3AN1A 1V97A 5FXEA 1W1JA 1W1LA 4OALA 2R2ZA 2VFUA 2BVGA 3W8WA 1ZXIC 2P4PA 1W1OA 2Q4WA 2R8DA 5ADZA 2MBRA 1W1SA 2VFSA 3ETRB 5AE1A 1N5WC 2RK5A 1N63C 1W1KA 3S1DA 1FFVC 1T3QC 2GQTA 2P13A 4JB1A 3PM9A 5HMRA 1E0YA 2VFRA 3DEDA 3NVWB 1UXYA 2NQWA 2AXRA 2P3HA 4BBYA 3C0PA 3BW7A 4ML8A 2QKNA 1FFUC 1ZR6A 1E8HA 3NRZB 1AHUA 4HG0A 3SR6B 5HHZA 2BVHA 1WVFA 3HRDC 2GQUA 5AE2A 2VAOA 1HSKA 2W3SA 2PLSA 1DIIA 5G5HB 1MBBA 2BVFA 2VFTA 5FXDA 5G5GB 3TX1A 2EXRA 1WYGA 3NVVB 4BCAA 5FXPA 1JROA 3I99A 2W3RA 1DZNA 5AE3A 1RM6B 2QPMA
chains in the Genus database with same CATH superfamily
5FXFA 1VDVA 1VAOA 4O95A 3W8ZA 5L6GA 1N61C 1MBTA 4JAYA 1AHZA 1SB3B 2O3GA 3LLBA 5K8EA 3KJMA 2W54A 2Y08A 1DIQA 3EUB3 1QLTA 1N5XA 4PYTA 4BC9A 2Y3SA 2E3TA 3NVZB 1N60C 3NVYB 3FW8A 2VFVA 3AM9A 1AHVA 3S1FA 1W1MA 1N62C 3JS8A 3POPA 4ZOHB 2W55A 1E8GA 1E8FA 3FWAA 1F0XA 5AWVA 2Q85A 2OAIA 3DQ0A 3AMZA 3TSJA 5HQXA 1FO4A 4XLOA 3S1EA 3B9JB 1W1QA 2PLIA 1QLUA 4BC7A 1FIQB 3S1CA 4PWCA 1WVEA 3RJ8A 2Y4GA 3NS1B 3W8XA 2Y3RA 4UD8A 4MLAA 3LAEA 2I0KA 1JRPA 1I19A 2YVSA 1W1RA 3AN1A 1V97A 5FXEA 1W1JA 1W1LA 2UUVA 4OALA 2R2ZA 2VFUA 2BVGA 3W8WA 2IPIA 1ZXIC 5I1VA 2P4PA 1W1OA 2Q4WA 2R8DA 5ADZA 2MBRA 1W1SA 3D2HA 2VFSA 3FW9A 3ETRB 4PZFA 5AE1A 1N5WC 2RK5A 3D2DA 1N63C 1W1KA 4EC3A 3S1DA 1FFVC 1T3QC 2GQTA 2P13A 4PWBA 4JB1A 5I1WA 3PM9A 5L6FA 5HMRA 1E0YA 2VFRA 3DEDA 3PQBA 3NVWB 1UXYA 2NQWA 2AXRA 2P3HA 3D2JA 3C0PA 3BW7A 4PVEA 4BBYA 4ML8A 2QKNA 1FFUC 1ZR6A 1E8HA 3NRZB 2UUUA 1AHUA 3HSUA 4HG0A 3GSYA 4PVKA 3SR6B 5HHZA 2BVHA 1WVFA 3HRDC 2GQUA 5AE2A 2VAOA 4DNSA 1HSKA 2W3SA 2PLSA 1DIIA 5G5HB 4PVHA 3RJAA 1MBBA 2BVFA 2VFTA 5FXDA 5G5GB 3FW7A 5D79A 2EXRA 1WYGA 3NVVB 4PVJA 3TX1A 1JROA 3I99A 4BCAA 5FXPA 2W3RA 1DZNA 5AE3A 3TSHA 3VTEA 1RM6B 2WDWA 2QPMA
chains in the Genus database with same CATH topology
5FXFA 1VDVA 1VAOA 4O95A 3W8ZA 5L6GA 1N61C 1MBTA 4JAYA 1AHZA 1SB3B 2O3GA 3LLBA 5K8EA 3KJMA 2W54A 2Y08A 1DIQA 3EUB3 1QLTA 1N5XA 4PYTA 4BC9A 2Y3SA 2E3TA 3NVZB 1N60C 3NVYB 3FW8A 2VFVA 3AM9A 1AHVA 3S1FA 1W1MA 1N62C 3JS8A 3POPA 4ZOHB 2W55A 1E8GA 1E8FA 3FWAA 1F0XA 5AWVA 2Q85A 2OAIA 3DQ0A 3AMZA 3TSJA 5HQXA 1FO4A 4XLOA 3S1EA 3B9JB 1W1QA 2PLIA 1QLUA 4BC7A 1FIQB 3S1CA 4PWCA 1WVEA 3RJ8A 2Y4GA 3NS1B 3W8XA 2Y3RA 4UD8A 4MLAA 3LAEA 2I0KA 1JRPA 1I19A 2YVSA 1W1RA 3AN1A 1V97A 5FXEA 1W1JA 1W1LA 2UUVA 4OALA 2R2ZA 2VFUA 2BVGA 3W8WA 2IPIA 1ZXIC 5I1VA 2P4PA 1W1OA 2Q4WA 2R8DA 5ADZA 2MBRA 1W1SA 3D2HA 2VFSA 3FW9A 3ETRB 4PZFA 5AE1A 1N5WC 2RK5A 3D2DA 1N63C 1W1KA 4EC3A 3S1DA 1FFVC 1T3QC 2GQTA 2P13A 4PWBA 4JB1A 5I1WA 3PM9A 5L6FA 5HMRA 1E0YA 2VFRA 3DEDA 3PQBA 3NVWB 1UXYA 2NQWA 2AXRA 2P3HA 3D2JA 3C0PA 3BW7A 4PVEA 4BBYA 4ML8A 2QKNA 1FFUC 1ZR6A 1E8HA 3NRZB 2UUUA 1AHUA 3HSUA 4HG0A 3GSYA 4PVKA 3SR6B 5HHZA 2BVHA 1WVFA 3HRDC 2GQUA 5AE2A 2VAOA 4DNSA 1HSKA 2W3SA 2PLSA 1DIIA 5G5HB 4PVHA 3RJAA 1MBBA 2BVFA 2VFTA 5FXDA 5G5GB 3FW7A 5D79A 2EXRA 1WYGA 3NVVB 4PVJA 3TX1A 1JROA 3I99A 4BCAA 5FXPA 2W3RA 1DZNA 5AE3A 3TSHA 3VTEA 1RM6B 2WDWA 2QPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXF A;  1VDV A;  1VAO A;  4O95 A;  3W8Z A;  1N61 C;  1MBT A;  4JAY A;  1AHZ A;  1SB3 B;  2O3G A;  3LLB A;  3KJM A;  2W54 A;  1DIQ A;  3EUB 3;  1QLT A;  1N5X A;  4PYT A;  4BC9 A;  2E3T A;  3NVZ B;  1N60 C;  3NVY B;  2VFV A;  3AM9 A;  1AHV A;  3S1F A;  1W1M A;  1N62 C;  3JS8 A;  4ZOH B;  2W55 A;  1E8G A;  1E8F A;  1F0X A;  2Q85 A;  2OAI A;  3DQ0 A;  3AMZ A;  5HQX A;  1FO4 A;  4XLO A;  3S1E A;  3B9J B;  1W1Q A;  2PLI A;  1QLU A;  4BC7 A;  1FIQ B;  3S1C A;  1WVE A;  3NS1 B;  3W8X A;  4MLA A;  3LAE A;  2I0K A;  1JRP A;  1I19 A;  2YVS A;  1W1R A;  3AN1 A;  1V97 A;  5FXE A;  1W1J A;  1W1L A;  4OAL A;  2R2Z A;  2VFU A;  2BVG A;  3W8W A;  1ZXI C;  2P4P A;  1W1O A;  2Q4W A;  2R8D A;  5ADZ A;  2MBR A;  1W1S A;  2VFS A;  3ETR B;  5AE1 A;  1N5W C;  2RK5 A;  1N63 C;  1W1K A;  3S1D A;  1FFV C;  1T3Q C;  2GQT A;  2P13 A;  4JB1 A;  3PM9 A;  5HMR A;  1E0Y A;  2VFR A;  3DED A;  3NVW B;  1UXY A;  2NQW A;  2AXR A;  2P3H A;  4BBY A;  3C0P A;  3BW7 A;  4ML8 A;  2QKN A;  1FFU C;  1ZR6 A;  1E8H A;  3NRZ B;  1AHU A;  4HG0 A;  3SR6 B;  5HHZ A;  2BVH A;  1WVF A;  3HRD C;  2GQU A;  5AE2 A;  2VAO A;  1HSK A;  2W3S A;  2PLS A;  1DII A;  5G5H B;  1MBB A;  2BVF A;  2VFT A;  5FXD A;  5G5G B;  3TX1 A;  2EXR A;  1WYG A;  3NVV B;  4BCA A;  5FXP A;  1JRO A;  3I99 A;  2W3R A;  1DZN A;  5AE3 A;  1RM6 B;  2QPM A; 
#chains in the Genus database with same CATH topology
 5FXF A;  1VDV A;  1VAO A;  4O95 A;  3W8Z A;  5L6G A;  1N61 C;  1MBT A;  4JAY A;  1AHZ A;  1SB3 B;  2O3G A;  3LLB A;  5K8E A;  3KJM A;  2W54 A;  2Y08 A;  1DIQ A;  3EUB 3;  1QLT A;  1N5X A;  4PYT A;  4BC9 A;  2Y3S A;  2E3T A;  3NVZ B;  1N60 C;  3NVY B;  3FW8 A;  2VFV A;  3AM9 A;  1AHV A;  3S1F A;  1W1M A;  1N62 C;  3JS8 A;  3POP A;  4ZOH B;  2W55 A;  1E8G A;  1E8F A;  3FWA A;  1F0X A;  5AWV A;  2Q85 A;  2OAI A;  3DQ0 A;  3AMZ A;  3TSJ A;  5HQX A;  1FO4 A;  4XLO A;  3S1E A;  3B9J B;  1W1Q A;  2PLI A;  1QLU A;  4BC7 A;  1FIQ B;  3S1C A;  4PWC A;  1WVE A;  3RJ8 A;  2Y4G A;  3NS1 B;  3W8X A;  2Y3R A;  4UD8 A;  4MLA A;  3LAE A;  2I0K A;  1JRP A;  1I19 A;  2YVS A;  1W1R A;  3AN1 A;  1V97 A;  5FXE A;  1W1J A;  1W1L A;  2UUV A;  4OAL A;  2R2Z A;  2VFU A;  2BVG A;  3W8W A;  2IPI A;  1ZXI C;  5I1V A;  2P4P A;  1W1O A;  2Q4W A;  2R8D A;  5ADZ A;  2MBR A;  1W1S A;  3D2H A;  2VFS A;  3FW9 A;  3ETR B;  4PZF A;  5AE1 A;  1N5W C;  2RK5 A;  3D2D A;  1N63 C;  1W1K A;  4EC3 A;  3S1D A;  1FFV C;  1T3Q C;  2GQT A;  2P13 A;  4PWB A;  4JB1 A;  5I1W A;  3PM9 A;  5L6F A;  5HMR A;  1E0Y A;  2VFR A;  3DED A;  3PQB A;  3NVW B;  1UXY A;  2NQW A;  2AXR A;  2P3H A;  3D2J A;  3C0P A;  3BW7 A;  4PVE A;  4BBY A;  4ML8 A;  2QKN A;  1FFU C;  1ZR6 A;  1E8H A;  3NRZ B;  2UUU A;  1AHU A;  3HSU A;  4HG0 A;  3GSY A;  4PVK A;  3SR6 B;  5HHZ A;  2BVH A;  1WVF A;  3HRD C;  2GQU A;  5AE2 A;  2VAO A;  4DNS A;  1HSK A;  2W3S A;  2PLS A;  1DII A;  5G5H B;  4PVH A;  3RJA A;  1MBB A;  2BVF A;  2VFT A;  5FXD A;  5G5G B;  3FW7 A;  5D79 A;  2EXR A;  1WYG A;  3NVV B;  4PVJ A;  3TX1 A;  1JRO A;  3I99 A;  4BCA A;  5FXP A;  2W3R A;  1DZN A;  5AE3 A;  3TSH A;  3VTE A;  1RM6 B;  2WDW A;  2QPM A; 
#chains in the Genus database with same CATH homology
 5FXF A;  1VDV A;  1VAO A;  4O95 A;  3W8Z A;  5L6G A;  1N61 C;  1MBT A;  4JAY A;  1AHZ A;  1SB3 B;  2O3G A;  3LLB A;  5K8E A;  3KJM A;  2W54 A;  2Y08 A;  1DIQ A;  3EUB 3;  1QLT A;  1N5X A;  4PYT A;  4BC9 A;  2Y3S A;  2E3T A;  3NVZ B;  1N60 C;  3NVY B;  3FW8 A;  2VFV A;  3AM9 A;  1AHV A;  3S1F A;  1W1M A;  1N62 C;  3JS8 A;  3POP A;  4ZOH B;  2W55 A;  1E8G A;  1E8F A;  3FWA A;  1F0X A;  5AWV A;  2Q85 A;  2OAI A;  3DQ0 A;  3AMZ A;  3TSJ A;  5HQX A;  1FO4 A;  4XLO A;  3S1E A;  3B9J B;  1W1Q A;  2PLI A;  1QLU A;  4BC7 A;  1FIQ B;  3S1C A;  4PWC A;  1WVE A;  3RJ8 A;  2Y4G A;  3NS1 B;  3W8X A;  2Y3R A;  4UD8 A;  4MLA A;  3LAE A;  2I0K A;  1JRP A;  1I19 A;  2YVS A;  1W1R A;  3AN1 A;  1V97 A;  5FXE A;  1W1J A;  1W1L A;  2UUV A;  4OAL A;  2R2Z A;  2VFU A;  2BVG A;  3W8W A;  2IPI A;  1ZXI C;  5I1V A;  2P4P A;  1W1O A;  2Q4W A;  2R8D A;  5ADZ A;  2MBR A;  1W1S A;  3D2H A;  2VFS A;  3FW9 A;  3ETR B;  4PZF A;  5AE1 A;  1N5W C;  2RK5 A;  3D2D A;  1N63 C;  1W1K A;  4EC3 A;  3S1D A;  1FFV C;  1T3Q C;  2GQT A;  2P13 A;  4PWB A;  4JB1 A;  5I1W A;  3PM9 A;  5L6F A;  5HMR A;  1E0Y A;  2VFR A;  3DED A;  3PQB A;  3NVW B;  1UXY A;  2NQW A;  2AXR A;  2P3H A;  3D2J A;  3C0P A;  3BW7 A;  4PVE A;  4BBY A;  4ML8 A;  2QKN A;  1FFU C;  1ZR6 A;  1E8H A;  3NRZ B;  2UUU A;  1AHU A;  3HSU A;  4HG0 A;  3GSY A;  4PVK A;  3SR6 B;  5HHZ A;  2BVH A;  1WVF A;  3HRD C;  2GQU A;  5AE2 A;  2VAO A;  4DNS A;  1HSK A;  2W3S A;  2PLS A;  1DII A;  5G5H B;  4PVH A;  3RJA A;  1MBB A;  2BVF A;  2VFT A;  5FXD A;  5G5G B;  3FW7 A;  5D79 A;  2EXR A;  1WYG A;  3NVV B;  4PVJ A;  3TX1 A;  1JRO A;  3I99 A;  4BCA A;  5FXP A;  2W3R A;  1DZN A;  5AE3 A;  3TSH A;  3VTE A;  1RM6 B;  2WDW A;  2QPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...