1JROA

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 129
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jroA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jroA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1jroA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jroA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jroA04
1E7PB 4IDIA 4TVWA 2PVOD 1FRDA 1TKEA 2FBWB 3CWIA 3HRDC 2BS2B 1TJEA 3LXFA 3TSJA 4EC3A 1QOFA 3S1CA 1FXIA 2OHFA 1MBTA 3WCQA 1B9RA 2QJLA 1T3QC 2WS3B 3P4PB 1VQZA 1E0ZA 1DIQA 1WYGA 2EXRA 1R7SA 5FXDA 1PFDA 3NRZB 3FW9A 1AWDA 3W8XA 3KWLA 3S1DA 4YTMB 1T3QA 1L0VB 3JS8A 5AE2A 1FIQB 1NVID 4WWMA 1J7AA 4ZOHC 1QT9A 1KFYB 1XLPA 3NVYA 3W9CB 1ZXIA 4JB1A 4PWBA 2BS4B 4YSZB 1PUTA 2MBRA 2P4PA 1W1OA 2W3SA 1FO4A 5EE9A 1NYRA 3NVZB 1SB3C 2E5AA 4YXDB 3NVVA 3HVZA 3TX1A 2JQRB 3B2FA 3B9JB 1XO3A 1L6VA 3AM9A 1YQ4B 3PM9A 3AE1B 3AEEB 3EUB3 3SR6A 2I0KA 2WU2B 1RYJA 4USAA 2WP9B 3AEAB 4JWSC 3EUB2 1JROA 3ETRA 4FXCA 3C0PA 1QLTA 5MPOA 3BIID 4BCAA 1JALA 3NS1A 4MLAA 4BC9A 2DWQA 2YVSA 2W54A 1QLUA 4HROA 3A7RA 2PIAA 3S1FA 1YJIA 2HTME 1CZPA 1QOGA 1UWMA 2O3GA 5HHZA 2Q5WD 1DGJA 1JWBD 1W1JA 3FC4A 2DBYA 4ITKA 3AE7B 1VJKA 3NVWA 5D79A 2BVHA 1W1SA 3VTEA 5C2TB 1FFVA 4C7YA 1V97A 1NYQA 3BW7A 2K9XA 4PYTA 3PO0A 5EE1A 1AYFA 5AE1A 4JAYA 1CJEA 2WLBA 2RK5A 3AE9B 4JWUC 1RWSA 3LLBA 1J7CA 5EE3A 4PWCA 5FXFA 3W8WA 2M56B 5GXGB 3P63A 4HG0A 1I7HA 3NRZA 2QPMA 2BVFA 4DNSA 2M19A 1VAOA 1ZXIC 2LEKA 2WQYB 2B76B 1FIQA 2VFSA 5G5GB 3VR8B 1QOAA 1QF6A 2WDVB 1XLQA 1N63A 1TKYA 3AN1A 4C80A 3TSHA 2H88B 1DOXA 3NVZA 1XLNA 4YSYB 4YTPB 1DOYA 3GSYA 3P4RB 3B9JA 5AUIA 4WQMA 1RM6C 2OAIA 4OALA 3DWGC 2AXRA 1YQ3B 2GQTA 3FWAA 3B2GA 5H8YE 1F0ZA 4XLOA 3VRAB 5AUKA 1FFUA 1N5XA 1JWAD 3D2JA 1YJJA 2VAOA 2AX5A 4N58A 1DOIA 1ZP0B 3L4PA 1OQQA 1MBBA 4US8A 2PKOA 2P3HA 4ZOHB 4PVEA 1JW9D 2NQWA 2KAJA 1PDXA 3SFEB 1N60A 1SF0A 2WDQB 3R07C 4BC7A 4TVYA 1N62A 1WWTA 1SB3B 5G5HB 1HSKA 2R8DA 3DWMA 1FFVC 2QIEB 3S1EA 2G1EA 3W5VB 1VLBA 1NENB 2PVGC 3LAEA 3AECB 3AV8A 4PVHA 3AEGB 3AEBB 1FRRA 1FMAD 2CU3A 4US9A 1X2HA 5ADZA 1WRIA 1E8GA 1F0XA 3FAHA 1ZUD2 1E0YA 4N6EB 5FXPA 3AMZA 5HMRA 1W1QA 2K22A 3A7AA 1DZNA 4LTUA 2Q4WA 3RPFC 4BBYA 1TKGA 4N59A 4A9AA 2R2ZA 2CJNA 1E10A 4ZHPA 1NI3A 1N61A 1E9MA 1VDVA 4PVKA 2KMMA 3VRBB 3D2HA 2K5PA 1AHUA 3DEDA 1NEKB 2EKIA 1E8FA 2BT6A 1N5WA 1JRPA 2JX5A 2MJDA 1RFKA 4YT0B 4ZHOA 3AE2B 1N63C 1UXYA 1W1MA 2PLSA 2PLIA 4HRSA 5C3JB 3DQ0A 3HRDD 1QOBA 4PVJA 5G5GA 1IUEA 3P1MA 1E8HA 2E3TA 3AE6B 3AEDB 1WGKA 1FM0D 3W5UB 1OQRA 2L52A 3SFDB 4ML8A 1FXAA 1JQ4A 3AE5B 1L6UA 1AHZA 4YTNB 1AHVA 1XLOA 2Q85A 1FFUC 3CIRB 1OFFA 3FW7A 4C7ZA 1W1LA 1ZOYB 1X2GA 3AB5A 2VFUA 1QLBB 4P6VF 3NVYB 2CJOA 1N60C 1EWYC 1WVEA 1N62C 2WU5B 3VR9B 5AE3A 3NVVB 2VFTA 2BS3B 2MH7A 2QKNA 1J7BA 1W1KA 3W8ZA 2GQUA 5G5HA 4KX6B 3SR6B 1GPXA 1SIJA 5EE0A 3AE3B 2ACZB 1RM6B 4PZFA 4UD8A 3FW8A 5HQXA 1A70A 1DIIA 3I99A 4YSXB 2MJ3A 3AH7A 3AE4B 5H92C 2BVGA 2VFVA 3ETRB 3AE8B 2VFRA 3NS1B 2W3RA 1WVFA 3AEFB 3KJMA 3A7UA 3D2DA 3ABVB 1TYGB 2H89B 1I19A 1N61C 1ZR6A 1V8CA 3HUIA 1WXQA 3P4QB 1KF6B 2Y5CA 3LB8C 3P4SB 1GAQB 1KRHA 1W1RA 2W55A 1L5PA 2L83A 4JX1C 3ZYYX 1N5WC 2MJEA 2N0SB 3NVWB 2P13A 5FXEA 1E6EB 4O95A 1ROEA 2WDRB
chains in the Genus database with same CATH superfamily
3PT2B 4D2KA 4ICAA 1ZQAA 4EZJA 4EZLA 2KZZA 3IDWA 2KDFB 4DXGA 2EMTA 1TKEA 2X8XX 5IDZA 4Q43A 3CWIA 3ONSA 2ZC8A 4RU9A 1WGGA 4QW9A 3Q69A 5AM1A 3RULA 4ZRIA 1FEZA 3KKAA 1ZQGA 4PPXA 3TSJA 1PGAA 4H4VA 3WAOA 4EC3A 4ED8A 1ZYQA 2EAMA 4KV2A 4NQKE 2FYMA 4ARIA 1WFYA 2UVRA 2BC0A 1COOA 2D2QA 4NEVA 3HPFA 5ALDA 3HP6A 1MBTA 1GC7A 3SYZA 4IWOA 2NTSA 4IL6U 3AL0B 4Z6DA 2GBKA 3RJIA 1L8LA 2YB1A 4NY8A 1VJ5A 2L0TA 2WS3B 4FS2A 3KVFB 3P4PB 5CB1A 1K1QA 2F1IA 5J29A 1DIQA 1JXLA 5TISU 1K52A 1WYGA 4G50A 4MGIE 1R7SA 2M4NA 5ALKA 5FXDA 2ZUCA 3NRZB 3FW9A 2Y3RA 1XEEA 1YX6B 3W8XA 3Q6JA 4BDPA 1ZQXA 3RZFA 3ZO5B 3ICXA 3VC8A 1KM7A 2Y1JA 4OZCA 1ENFA 3LJ3A 1L0VB 1ZQQA 5KT7A 2YVGA 3OHBA 2K0PA 3QPEA 1BPDA 2A3VA 3TI0A 2ZJ5A 2IBKA 2ZADA 3DBLI 3NZ3A 2V3AA 1WZ0A 4IHCA 1ZDVA 2ON8A 3KWVA 1Z2MA 2JR5A 3W9CB 4UB8U 2RDXA 5KT3A 2PFNA 4CDGA 1ZXIA 3BQTA 4NLKA 4ED0A 2E6XA 2JUOA 2DFLA 4PWBA 5BMIA 3N7PD 2JZZA 2MBRA 5HR6A 3TJ4A 2FCQA 1W1OA 3TOYA 2AAQA 2UUUA 1FO4A 1D5MC 1NYRA 4OJOA 4WJNA 4B9UA 1ECWA 4MFFA 3CAWA 1TK8A 1M6IA 4FZMA 1SEBD 9ICJA 3B9JB 1SGGA 3P0WA 4P1BC 4GDLB 2PU1A 1RXWA 8ICUA 2WF5A 3PV8A 2AJQA 2KFJA 2Z0DB 4LNIA 3HKZC 2GSHA 1B22A 3FG2P 2ZIUA 8ICOA 1WMHB 5FS9A 2HOQA 1DXLA 4P0QA 3HILA 2LJIA 3AEEB 3ZKJC 3EWAA 4M2YA 3BVZA 1SL2A 4PJ0U 4YMMA 1MHXA 2WU2B 3S5SA 2EQ7A 2YTUA 2J7QB 4J9PA 3RH5A 1K53A 1R4MI 5E79U 4LNFA 2A1JB 4DSKA 3EUB2 2DYBA 2KYWA 5IIMA 3MQTA 3TIXA 2K39A 1JROA 4M00A 4UW9A 1I42A 5J2HA 1CK1A 4I6NB 4RNAA 2ZW0A 3J9CA 2EQYA 1ZQFA 1TYPA 4QWBA 1UWXA 5BOFA 3IN5A 3N30A 4EM3A 5KT5A 4F5RA 4BFRA 5FJUA 1RVKA 4F8RA 2DWQA 2ZW1A 2A1AA 4OJ6A 2AL1A 2GRIA 4G7FA 2YVSA 2EANA 2KTFA 4HROA 4C4VB 1ZX9A 4ZRJA 3A7RA 3MABA 3L13A 1CZPA 3SD5A 1WG8A 1U47A 3UJFA 1DGSA 3EW9A 2V9WA 3DIPA 1C77A 2PCEA 4BXOA 1JI7A 1D9FA 2ZIWA 1KFTA 1KQQA 2SAKA 5IO9A 3L16A 4GMVA 4F4XA 2ZVOA 1W1JA 5DPRA 1BUIC 1D5XC 2QHOA 3AE7B 5JCMA 1VJKA 4ZRKA 2B6GA 3T79A 2RGFA 2BVHA 4P4PA 7ICRA 3Q45A 3VC6A 4M0WB 3GD4A 1YT3A 5IIKA 1B4FA 2ZJAA 4ECWA 1TS4A 1TAUA 4WWNA 3VUWA 2V0GA 4OCZA 5KFXA 4UAYA 8ICXA 1Q10A 2WXHA 2JEFA 2VH1A 3PWGA 3LDZE 1NYQA 4ECRA 1Z1BA 2FI1A 2UU7A 1X40A 1SSNA 3STPA 4YQWA 1ZQNA 1KLNA 2KNJA 2N4FA 2ZZPB 5KFUA 5DB7A 2GLEA 1E7VA 2BPFA 5EE1A 2NR2A 4ICUA 1AYFA 4I2EA 3KFUF 4ZRPA 5AE1A 7ICNA 3DQVA 4OVVA 1J97A 2PFOA 1CJEA 2WLBA 4JAYA 1V49A 5L9XA 1EWCA 4R8UB 4U7CA 2MBBB 3RFAA 1WJ4A 5G2NA 4JWUC 5HR7A 2KIWA 4CCHA 4W9HA 2W8LA 1AARA 2M9NA 1JMLA 3LLBA 5AI8A 4QWCA 3BJSA 4EZ9A 4B9TA 4RQ1A 4RUCA 4PGQA 2KVSA 3ED5A 2BW2A 2DPJA 5J2IA 7ICFA 2ZNVC 4BX9C 4OJPA 3EJDB 2BCRA 1TGZB 3NRZA 2MBQA 3IG5A 1HA5A 2OPJA 5E6PA 5CA7A 5FKAC 1E5WA 4DQPA 4E74A 2KDBA 4RCOA 3Q3NC 3UMGA 3GIMA 3RBDA 1WGHA 2AKMA 3II4A 3OTRA 3WAMA 3H1UA 3B08A 3ORYA 4QIWC 1E7UA 3VTVA 2ISOA 1DK3A 3VR8B 1HZ5A 1QOAA 1QF6A 3TADA 2GLSA 4NAMA 1XLQA 3MJWA 3LYSA 3CB3A 4PHAA 1UELA 5J2AA 4AP4C 3N6JA 4R66A 3TSHA 3UQBA 2XVTA 3B0AA 2WPEA 2WHEA 3OTQA 3DHIC 3T9LA 1HTQA 3EHVA 3HSUA 4YTPB 1OQYA 4LZGA 3IG3A 4TSSA 4GXKA 1DOYA 1K4QA 3WKEA 1NELA 4ANUA 1ZD4A 2WFAA 1SXTA 3B9JA 5ALEA 3QK0A 4TUPA 5HHIA 4O3OA 4GDLA 5AUIA 4A55A 1NK9A 3VDGA 3TEYA 4ADWA 4G8TA 2OAIA 3LK9A 3IV6A 1V1OA 3SAHA 2AXRA 4UATA 2J6TA 1WMHA 3QZ8A 1YQ3B 2WF6A 3MR6A 1C4PA 1YN4A 4NXZA 2ZCBA 2FMPA 4ASWC 1SZHA 3H7SA 3QU2A 3SV4A 3BY4B 5IN7A 1S0MA 1IPGA 9ICPA 3QA8A 4KSKC 5AI6A 2ZIXB 5H8YE 2KANA 4DYEA 4W9FA 5AUKA 2J3NA 4EBDA 3KW5B 1ZQLA 1JWAD 2A1JA 4YCXA 3R1ZA 2NO5A 5DB6A 7ICGA 4RFBA 4CRXA 3PHWB 2KICA 3BDPA 1HQRD 2LMRA 4JMUA 2JPHA 2A5UA 5HKHA 1OQQA 1ZPSA 2QAEA 4F93B 4YR3A 4EE2A 3MC0B 1YN5A 3QAQA 4EMWA 2HI0A 3RH6A 2YMPA 1LKYB 2R8IA 4PVEA 4ZOHB 9ICAA 3H8AA 2HE7A 3V6CB 2NQWA 1UNSA 3CSTA 3ONNA 1PDXA 3KQ4A 5U25A 3ISDA 4A35A 2BCQA 3HVDA 4TV3A 2NPXA 4C4VA 5J8YA 3OP2A 2FPLA 2OKTA 2WDQB 4TVWA 2HVHA 3T5LA 1N62A 3GC2A 3H40A 4I2IA 3K75D 5KFHA 5AI0A 4HCHA 1OGWA 1MC8A 2JYEA 4L1BA 2QGYA 2LBOA 4TUSA 3IJQA 8ICQA 3UCCA 7ICVA 5GMVA 3V7LA 4X2PA 2QARB 1BPZA 4EEWA 3Q8MA 1CEZA 3W5VB 3L0WB 4GXBA 3H9DA 1X2IA 1D8BA 2OLAA 1L7OA 4M0WA 1EF5A 2WP5A 8ICSA 1H6VA 3O0HA 3THUA 2BYEA 5KFWA 4DOBA 1OTRB 4MM3B 3AV8A 4KIKA 4OHJA 2ZZ0A 2MRLA 4GN1A 3AEGB 2YEPF 2Y08A 2POZA 3E56A 5KFJA 3ZI4A 1GRBA 1NI2A 1OEYJ 3MFHA 2XBBC 1E8GA 2GGJA 2HXUA 3FAHA 5DBCA 4MFAA 1E0YA 2G4DB 3UPQA 9ICCA 2CS4A 2IYDB 4FHJA 4N6EB 5FXPA 3AMZA 4LZDA 2WXOA 4F2RA 2BDUA 2GBRA 1TAQA 4EWJA 3V60A 1LXDA 2Q4WA 3DGZA 4R8UA 5J2GA 1TKGA 5HFYA 3OJSA 2W03A 1RAXA 2HOIA 4OO1J 2N9LA 1SE2A 3RRGA 3FM9A 4ZHPA 1UHUA 1L5UA 2QDDA 5U1OA 3H8HA 4W9DA 2BC1A 1AROP 5EBKA 4LLGM 5IA7A 2W11A 2Y5BB 3VRBB 4DSLA 4ZRQA 3RD2A 4EQXA 2GB1A 3D2HA 1F0MA 1FEBA 3TQPA 4P0PB 4F8CB 4IUMB 4ZDVA 4G3XB 2NV3A 2WWZA 4AJYB 5FMHA 2NVUI 3UMCA 4HDOA 3CXBA 3UM9A 4KLEA 2HHUA 4LK0M 4K4IA 1NEKB 2P3ZA 4M6WA 2GR1A 1FEHA 4ICVA 3QXGA 3IT6B 3WKAA 4QZBA 3M9NB 3C29A 2MJDA 1KRPA 4ELVA 2V9HA 3AE2B 3N4MB 3B1LX 2I5QA 1L4ZB 3RFZB 4JWMA 1JOAA 2ASQA 1MJDA 3EA6A 4MELA 1SBBB 4JLCA 2IPIA 3T3FA 3VCBA 2REXA 5B5EU 2J0KA 1LPFA 2Z8LA 4DDID 1WX9A 2NQLA 2OQHA 3UMBA 3T4WA 2ZEQA 3M63B 5F3XB 4UAUA 2BCUA 2H3FA 3VAWA 2QC8A 2C28A 3AQFA 1IYFA 1H8CA 2LGYA 1ZETA 2W82A 9ICIA 1C20A 3D9XA 2V6OA 1N2XA 2GGGA 5DLGA 1YIWA 4J9LA 3S6JA 5ALJA 3CXOA 3H4BA 3R0UA 1I4RA 1B1ZA 3EAOA 1FXAA 4A3PA 3KH0A 3I9V1 3JPOA 1V80A 5KL8B 5BOMA 3O65B 3H8MA 2VA3A 1BMLC 1AHVA 2N1WA 2RDGA 1NZPA 1FFUC 2MSNA 3M8RA 4B9VA 2Q85A 3A0BU 2WOVA 2Y4GA 1BPEA 1SWVA 2FE9A 1BKHA 1WUEA 1C1YB 3JPTA 1TVAA 1FCLA 3TWBA 1GRGA 3UQAA 1OFFA 5ALXA 1W1LA 4EELA 4F4WA 1X2GA 3H70A 3AB5A 2XH4A 3H7VA 1EO6A 2ZIXA 2XGPA 1QLBB 9ICTA 5CHVC 1K5OA 5AK5A 2CHRA 1ZOLA 3VFCA 4IP5A 4RQMA 2LXCA 5E6OA 3NVYB 2TPRA 3H8JA 3NTUA 4NJ8A 1BPXA 3HWTA 1ZQBA 4IR1A 4KLFA 2QSDA 5DDMA 4AYBC 1P98A 8ICBA 2I5HA 8ICPA 3BK2A 3SJNA 3C2KA 4HN8A 1WZ3A 3RO6A 4DSEA 3RI7C 3PVXA 1RYRA 3A9KB 2EELA 2WXRA 3BWUD 1LKYA 5AM3A 3VR9B 4ED2A 3NVVB 3DJGX 2VFTA 3VFKA 5JRBA 3IG8A 1E8WA 3OHAA 2KXJA 2YAUA 2NRTA 2L0FA 2V3SA 3Q3MC 4JE3B 1UUPA 4KGTA 1L7NA 5DPTA 1J8CA 4KKIA 1MA7A 2MH7A 4NL9A 5L6GA 3W1YA 5AM5A 3RNBC 3KHHA 1QSSA 4B9NA 1J7BA 1QZEA 1W1KA 2HJ8A 3ZDAA 3SR6B 1GPXA 4DOCA 1SIJA 5EE0A 3RR8A 2WF7A 2GH5A 5ALNA 4EKUA 1BNPA 2YMMA 2QARA 4O3PA 4Q44A 4I27A 1C3TA 3IFWB 1DIIA 4BWMA 3UIPB 4YSXB 1ZQZA 4CF4A 2JH7A 4O5EA 2IOFK 3APDA 4FA6A 1UT5A 4B9SA 4JQWC 3D2QA 4MM3A 2VFRA 4U6PA 1KBUA 3LWMA 4QJFB 4Y2UA 8ICWA 1FHVA 2IO0B 1I4PA 3NS1B 2W3RA 1MNSA 5IINA 2VH2A 4ANXA 2MRPA 2E8PA 1XS9D 3ZJTA 1ZDLA 4GLSC 3QWZB 2I1QA 1QQ6A 3ABVB 2CRXA 2K8BB 2H89B 4RNOA 4UB1A 1R6WA 1MHHE 1I19A 3MWCA 1N61C 3C23A 4HPPA 2QMTA 1ECQA 2CR5A 2FAZA 1KW4A 1IG6A 3QHTA 2WP6A 4ROPA 1ZD5A 5I1VA 2KX0A 4HWIB 3A4SC 4KZ0A 4KLGA 1QQ7A 4IP4A 3RTVA 3B0XA 1KRHA 4GFJA 1PZNA 1ZDXA 3V5FA 3DG7A 2W55A 1ACCA 1Z00B 1C76A 4JX1C 3N28A 1W6TA 2R9ZA 3KKAC 3QU9A 3OLMD 4KGSA 1KL9A 4M6UA 2P13A 1WXSA 2BWES 2ZXIA 2YVCA 5KFZA 4IS7A 4TKNA 4P0PA 5CTRC 3IT4B 4RQ6A 5KFDA 1E7PB 2J42A 3JW0X 4YFKA 4CHKA 1PDZA 3TAPA 3RJGA 1VRAB 2FUG1 3I57A 1QH9A 1I4HA 3IVFA 3JPRA 4TQ1A 2PVOD 1NU5A 2XH2A 4H83A 2RDBC 1ZQUA 2UVVA 2W8KA 2XIDA 3Q3FA 2OYYA 1KJTA 2C7MB 4MDKE 4FI4A 1L0YB 4DX3A 4WAFA 2DZKA 5D4BA 4JDRA 1P9DU 3JVAA 4WJ3B 2FLNA 3SBFA 3SQPA 4QZDA 1WRDB 1EU3A 1TY2A 1L2NA 2LXAA 2OZ8A 1X9WA 2G07A 1WJUA 1XANA 2GR3A 4DLEA 4ZYSA 3V5CA 2ZUDA 1ZD2P 1U49A 3OZMA 5KG6A 3V7JA 4K3CA 1NJXA 2CXYA 4J9RA 3RT3B 1NK4A 5DLFA 4EBCA 3SHQA 2X38A 1AN8A 5AKHA 2QJLA 1GB1A 2XEWA 3ZDEA 3D47A 1NK6A 2WBAA 3V3WA 3GZNB 1EBHA 1M94A 3DVGX 7ICTA 5JCNA 2WF8A 4M0XA 4XWTA 1I35A 1MDLA 4W9GA 3DG6A 2FPKA 5D94A 2DAJA 1E0ZA 1XWLA 2WAQC 2LGDA 3WK8A 4DFMA 4UBBA 4DF8A 3E9SA 3ZNZB 3D2SA 2BKRB 1PFDA 3RNFC 2JYTA 4PS7A 2KKPA 1ZQTA 5AM2A 4AP9A 4K7ZA 5FK9C 2ZPYA 2WXQA 3OSNA 2BZFA 3DDCB 2BBCA 4Z6EA 3K4GA 2DZMA 3RB3A 2UVWA 4KLHA 3JZUA 3ZRFA 1T3QA 2XH0A 2ZTDA 3TEXA 3LVVA 2FLPA 3PRPB 1ZQVA 2G08A 2E8OA 2J52A 2OH2A 3ZLGA 3RJAA 2OM6A 4Y2PA 3CK5A 1NVID 4ENLA 4KSLC 3KOOA 1QT9A 2FKPA 2AH5A 3NVYA 1ZQSA 3CGDA 4C8LA 4KLMA 5DBBA 4UARA 8ICTA 1KLVA 1NHQA 4KEMA 4I2BA 4ECZA 2XSXA 3O13A 4HYKA 5KFVA 1V85A 1X9SA 3N1ZC 3A9KA 1BVSA 4ED7A 1MG8A 4YXDB 4YVZA 1L3VA 3SEIA 3NVVA 1UF0A 4GB9A 5ALZA 3TX1A 4UB5A 2V4QA 3B0YA 2LGXA 3C1ZA 3B2FA 2QQ6A 2DENB 5JCKA 5KG0A 1GSNA 1Z1VA 4KDIC 1L6VA 2GBMA 1L8PA 4F1SA 2KE7A 1YQ4B 2KVZA 2LWPA 1WX7A 2LGSA 2X8GA 1NZBA 2OCEA 3SR6A 3SEBA 3M7DA 3WK6A 1EC8A 2I0KA 3TW9A 3H0RB 3H8SA 5CP2A 3U26A 4P0QB 8ICKA 4USAA 1B0XA 1HJPA 3TCAA 1U4AA 2EQ8A 5ALFA 1QSYA 2G0AA 2N9EB 4UAWA 2GOWA 4YXMA 1JPMA 4EZ6A 3RGTA 5KFIA 5KG5A 3M8SA 3PRMB 4J3OD 3CF6E 2Q0ZX 3F5AA 7ICLA 3RNCC 1L3UA 2I38A 5BYQA 3TKAA 3Q4DA 4J3ZA 2WXLA 2WTFA 5BMGA 4ECYA 2F1HA 1C4CA 4DQOC 3C0PA 4BCAA 3M62B 1JALA 3NS1A 4WURA 4ED3A 2LUMA 4HDQA 3HM6X 4KPRA 1JWUD 5L1KA 5ALIA 1Q3UA 2X8CA 3ZD8A 4PGYA 1QLUA 3KUMA 2K8BA 1SXEA 4BBNC 3VC5A 3GY1A 2PIAA 3RB0A 1EUVB 1KSPA 3PZ7A 3S1FA 4C0ZA 1CI4A 3JW7A 1QOGA 4YR0A 1UWMA 1V1PB 4LJOB 4R64A 3BQ2A 8ICEA 2KQ4X 3PV1A 3DFHA 3U4FA 5L1JA 4P4MA 2DBYA 1Z00A 4M04A 1KFSA 5ALUA 1F5SA 2LI5A 3R11A 4NJ7A 2LMCA 9ICKA 2C2EA 1BXTA 2RP5A 5KTQA 1NJWA 3DDMA 2BHNA 3M6KA 2MSED 1VZ7A 3APFA 4HYRA 3ZNGC 2LYBA 1ED1A 4PZOA 3U8ZA 4EQWA 4C4TA 1FECA 3POPA 2LYHA 3RNGC 4UDUC 4IC9A 1MG4A 4RZRA 2RQ5A 1S0NA 1LM8B 4BJQA 1M6YA 4DL7A 5KFOA 1IXRA 2AKZA 2MNRA 3QFBA 2KD0A 3UXKA 1ZJNA 3I6TA 5FJPA 2I9GA 3N7SC 3TWAA 4F4ZA 3P42A 1T4GA 3QUQA 2RK5A 4W9IA 4MSQB 4O3QA 4FDCB 3PX6A 2D07B 3RN9C 3L8KA 4YP3A 1HTOA 2JSVX 2LHEA 3R7RA 4ARCA 3IXSA 1J7CA 4UAZA 4LNNA 4KN4A 4NLCA 4KLIA 2WHIA 4XZ4A 2PS2A 5HMMA 3W8WA 3QUCA 1TKKA 4A3RA 5GXGB 1TV9A 3ZXRA 5GRTA 4Z1YA 2D3GA 1R4NB 3MDCA 2VIXA 2KZMA 1WXMA 4GRTA 3WK5A 2DF4B 3UXNA 3OWEB 4JV2A 3ZVHB 3QQ8B 4IKGA 3TJIA 4UB2A 2BVFA 5ALVA 2XGQA 3Q2AC 4DHJB 2WPFA 3MKCA 2HZGA 1C4AA 2MBEA 1IV8A 1PGXA 1VAOA 5KFYA 5AM0A 2HHXA 1FPYA 2B76B 4QZFA 5KT4A 2L00B 3ZVIA 1A6SA 5CHGA 3BYYB 3OG5A 4X57B 1T0YA 2ZUBA 1QQ5A 4QZGA 1B43A 5J0PA 3U52E 3CP8A 3LXDA 3T6CA 3C2MA 5J18A 4P7IA 3CGEA 3FJ4A 1N63A 4JB3A 3WAPA 3ZXVA 3AN1A 2B3AA 1X42A 1GC6A 4M9JA 2H88B 5KAIU 4O0IA 5KFFA 2LFIA 3I63C 1JX4A 4YSYB 3E0FA 4LDTB 4PH5A 1TYTA 1ZQWA 4FX9A 3AEVA 4BGDA 3UCDA 3P4RB 2BVCA 1BQGA 1C9FA 2WXIA 4H1ZA 2K4HA 5KG4A 2JEJA 4ZH4A 4WQMA 4EOYA 4OZBA 1RM6C 4OALA 2AGQA 4DL5A 3DWGC 4I6LB 2O6KA 3ENEA 4WJPA 2ZTCA 3ZLZA 3DOWA 2M0XA 3W1SA 2K8CB 4P16A 3QEBZ 4MJSB 4CO7A 2GQTA 1ZQCA 3FWAA 4DSIA 4RPZA 4BBNF 1HIWA 2IO3B 2D3BA 2VANA 1UGMA 1F0ZA 4XC2A 4HCDA 2N7JA 1HUZA 1N5XA 1IGCA 4A3OA 3DEEA 2G09A 2G45B 5E6JA 3CMMB 1TFRA 2NBWB 1P1AA 4FS1A 2ATLA 2FCNA 2RD0A 2KN5A 1V9JA 4FJVB 3H12A 2MA1A 2ONQA 9ICWA 3BJYA 5DDYA 5HP4A 3ZDBA 3VH3B 4Y2YA 4APNA 3ES7A 1YN3A 4DFKA 2KDMA 2PKOA 4K7UA 3VCNA 5KAFU 5ENLA 4JGHB 4RPXA 4F91B 3VA8A 5FP0A 1ZQHA 4RQ0A 1ZKHA 3PW4A 2D10A 1XSLA 2Q4TA 1N60A 3GZFA 2D6FC 2JY6A 4KMUA 5KT2A 5LXIB 2PGWA 5J0TA 4QWDA 1SF0A 4C56C 3R07C 2P88A 5G5HB 2OZTA 4RPYA 1XS2A 1SE9A 9ICRA 2YLMA 1WGDA 4J9SA 2KC1A 4EEYA 1V1PA 3MR5A 2UYZB 2R8DA 5BPCA 3DWMA 1FFVC 3EJBB 2CU1A 2NTTA 2PMQA 4AQ7A 2QIEB 3ETLA 4A8EA 3S1EA 1JDFA 2PPHA 3MR3A 3C28A 1JMSA 2C3CA 3KLJA 4K8GA 2RMMA 2LRWA 2FIDA 5CX3A 3WU2U 1XO0A 2BPSA 3AECB 1K51A 2DYMA 3NUHB 3SU8X 4HVBA 5T8IA 4HPLB 2JEGA 4J1OA 1F1HA 2M1MA 2X50A 3SI8A 1WX8A 2DW7A 4B6WA 1TT5B 1FMAD 4US9A 4PGXA 2EAOA 4KIKB 5ADZA 4YG2A 3ENLA 3WALA 8ICAA 2Z59B 4KX3A 3FXGA 3C21A 2PXIA 3TFRA 3T5JA 2UVUA 1T3NA 1Q46A 4YD1A 2K22A 2QLTA 1I4XA 1DZNA 2Z7JA 4Y2SA 2K8AA 1KTKA 5A0LA 2XO7A 3DH9A 4A9AA 1A77A 3JSVB 4FHKA 3GV5B 4XDCA 1DXSA 2GGEA 4I2JA 3U4EG 3C8YA 1LO5D 7ICUA 2F8KA 5IP4D 2D5GA 5BOLA 4PVKA 3DBHI 1S1QB 3ZLFA 2I2YA 1O08A 3D46A 3ZTCA 1XQQA 3NJTA 3R2IA 3LB8A 1BZLA 1S7MA 3AXCA 4DHJD 1PK1B 2A19A 2DUYA 1D6EC 4NNJB 1AHUA 4UASA 2JRHA 1T6BX 3R7QA 1ZKQA 3ZVHA 2EKIA 4OVZA 3GO2A 4X5VA 3PGEA 3S2AA 5ALHA 3EPGA 3KYCD 1RLFA 2QJJA 1GERA 2JX5A 1GRHA 4E5TA 4M6WB 4F2SA 1UXYA 3UJRA 2PLIA 2HDOA 5J0UA 5AK4A 2YVFA 4Q8EA 4K8DA 1S97A 1F2RI 2V3BA 4FADA 2OWOA 2KK8A 1QOBA 2P6RA 2DYOA 2KOXA 9ICGA 1IBXB 2BPGA 3DQ0A 4B0MA 3P1MA 4A6GA 3HKZF 3JPQA 4BKTA 2W9MA 2DLBA 3TL5A 2JGAA 1WR6E 5AZGA 1PGBA 3AE6B 2FUHB 4LDTD 1YNTE 1UA0A 3AEDB 1SWWA 5KFCA 5J2KA 1U45A 3DV9A 1ISNA 2DKXA 2HSZA 4E71A 3RRAA 3GU3A 2V3PA 2ONEA 2KNBA 1SV0C 1X6IA 2DKZA 4RQNA 2L7RA 3H4KA 1V81A 2GR2A 4DCCA 3DBLB 3E58A 4IW0A 3BVMA 5KHOA 2QB0B 2RSUA 5DG9A 4YMOA 1GXFA 2YEPB 3CYMA 3DK9A 3ZDCA 3NHEB 2K8CA 4WAAA 1RYSA 2NBUA 4MJSA 2ZNVB 3QZ7A 3RH4A 4B9LA 2C7NB 4PL2A 4FBUA 2HHSA 4C7ZA 1S9FA 3VTWA 4AUQC 4QNLA 4GGQA 1V86A 2K89A 3QARA 2M17A 4LCDE 2I1KA 4EX7A 4NV0A 9ICXA 2DNFA 4O3RA 2N7DA 2WXGA 3APCA 4P6VF 4PS8A 4GYPC 4H4YA 3CGCA 2VRRB 5EWGA 3Q14C 4REZA 4HK2A 3DJJA 2YN4A 3DDHA 2NPTB 3Q8QB 3V61A 2DAFA 3LYYA 4RGTA 3FVDA 5J0QA 5EDSA 1WIAA 2LPEA 5AKLA 1RG6A 4PL1A 5AI9A 3PS6A 1KTQA 2H3QA 2ASDA 3VTUA 1SXDA 2BF8B 3UGBB 2BB5A 3CT2A 3RB6A 2KV2A 1UZXB 2BS3B 5AM4A 1NDAA 1R4MB 2V4RA 1EM7A 2DX5B 2DPIA 2C22A 1UGJA 1WXAA 3L10B 2GQWA 2L5YA 4E8GA 4WQOB 1UD7A 3WK7A 3DGHA 8ICCA 2ASLA 2KFKB 4E0DA 5G5HA 5H2FU 3U30A 3EJEB 2GBNA 5ALMA 5J2BA 4IL2A 4CF3A 5DB8A 2O6VB 2AQ2B 2WOWA 2JXJA 1Y88A 4NLNA 1JXEA 2JXTA 5K8EA 1S5LU 2ACZB 2LD9A 3NS8A 3H7IA 4NPNA 5KG1A 1A70A 4EFOA 4H4ZA 1SKWA 7ICEA 2PP3A 3I99A 3F53A 5KFSA 1ZQPA 4I2AA 3AE4B 2W9AA 3GD3A 3EEZA 3ETRB 5AZFA 1COKA 4DQIA 4F92B 3MGIA 2QILA 4QZCA 4Z6CA 8ICJA 5C23A 5FS6A 1WVFA 3FKYA 1BNOA 4XQ8A 2D3AA 4G11A 5HNKA 2M0NA 3GE3C 4WIPA 3FYYA 3BS7A 5TR3A 5AEKB 2J0MA 3EF6A 8ICIA 2MW5A 1SJDA 5L1LA 5CWRA 5DB9A 4DOAA 4WJQA 3HIZA 2KOBA 2JEIA 4KTQA 3R3MA 1GV4A 1STZA 3BZCA 1RPLA 3H0MB 1A76A 1NJZA 4G3IA 8ICFA 3U9IA 3P4QB 1L3SA 5J2EA 3IJLA 3D2NA 3JSVA 4IC7B 1F2RC 1IM4A 9ICQA 4J9KA 3PSIA 4MGKE 5CHFA 4WWOA 4GU2A 5D3IB 4FJYA 1W1RA 2HBLA 4DHGA 4NZLB 5KFNA 1J0GA 4QIWF 1L5PA 4JQ9A 1S0OA 3ZYYX 1N5WC 2MJEA 4J57A 2EH9A 4H4XA 1NK0A 4DHZB 1CUKA 4KGRA 2FMSA 3K1ZA 2XY6A 2YQEA 1ROEA 2MHJA 2WDRB 1V59A 4UB4A 1PK1A 1TY0A 2FMQA 3PY8A 2LJ5A 4IDIA 4N9F4 5IKCM 7ICIA 2GRTA 4ZCWA 5CR0A 3M1YA 3PMLA 2GDQA 2NRZA 4DFJA 2PTWA 4RQ4A 5EWEA 1VR9A 2FBWB 4NQLB 3HRDC 2IOFA 3BS5B 3H0LB 1TJEA 2L32A 2CHZA 2XGZA 1JN3A 1I4GA 5JHBA 5AICA 2PMZC 4ELTA 4KVGB 1IBXA 4M9NA 1YMHE 2AEHA 5ALPA 4II2B 1SKSA 2PSNA 1UH6A 4ELUA 1RDFA 1FXIA 4QAYA 1T7PA 2EZZA 2OHFA 4CNQA 2V3NA 4ECVA 3TJPA 3WCQA 5LNK1 1WXVA 5KFTA 4HKQA 2JF5A 2DL0A 4FFDA 4ECXA 1T3QC 2ZVNA 4NM1A 4PHEA 2K3UA 4KLTA 3PNCA 4H4RA 1VZ8A 3PSFA 4YWGG 1SJCA 4YWSA 2IGHA 2WXMA 5JUMA 2MU2A 4IM0A 1DRGA 4DK5A 2VA8A 8ICZA 1AWDA 3V05A 2HHTA 2KMAA 3Q8EA 4G0NB 3V62A 4AS1A 2QB0A 3R25A 3KUDB 1QSLA 2JHDA 2W0HA 3PZPA 2BGFA 4L23A 4YTMB 4YXJA 2MUCA 4ANWA 1UQVA 3JS8A 1E9IA 3U7DA 1NHRA 2KWCA 5AE2A 3GV8B 4PT5A 4FZLA 4B9KA 4UB3A 4WWMA 1J7AA 5DGBA 7ICQA 1XSNA 2MEKA 4IL0A 1SL0A 2K8HA 5IIOA 1ZQ1C 2WXPA 4IWPA 2ICIA 4OJLA 2LUEA 2NPTA 4JB1A 1Q1RA 2PTXA 4HXDA 2FLLA 1X66A 1PUTA 3N9YC 2P4PA 2H5XA 2W3SA 1EU4A 3NVZB 2MP2B 3L17A 1SB3C 2E5AA 5J2JA 4NJ6A 2JZBB 4F5OA 5DQHA 3PW2A 4KLSA 2JQRB 1X9XA 2YVJA 5AKXA 1NPXA 4NEWA 3R8BA 2N9XA 1Q1WA 2HBKA 2P6UA 2R2OA 2QVHA 1DOQA 1KFDA 2NRVA 2O6VD 3ALBA 3ZJUA 5KFLA 3NZGA 3N7RC 2IO2B 5KNIA 2KFKA 1RZTA 3AE1B 5JZEB 2OOBB 1UBQA 2O6VA 2KC2A 1J2MA 2EZXA 1RYJA 2XK5B 5TSSA 4XYCA 5J17A 5EU9A 2WP9B 4OD0A 1SKRA 4M47A 2HD5B 2HJ1A 3AEAB 2G5HB 2PTLA 3DHHC 3RUIB 4JIOU 5BMHA 3DGBA 1YOVB 1XPYA 4EYHB 1IP9A 2KDEB 3OW1A 2BDPA 3J81j 4KT2A 1T5XD 3ETRA 3Q8CA 5TR5A 3JPNA 4XE0A 2Y0SC 1QLTA 1F8WA 3BIID 4TURA 2G3QB 1XC9A 1GETA 4EBEA 1XDIA 2KACA 2LYAA 4DEZA 4KPLA 4S0RA 2INDC 5L6FA 1WSPA 2AWTA 4MSMB 2DW6A 4JK1A 1FNWA 2DGZA 1RFAA 4QZHA 1GESA 4H4QA 1U4BA 4WWPA 1WM2A 3CSFA 4ECUA 1QLNA 2M0AA 2HTME 3DBRI 1L7YA 4HAIA 1RQNA 3MBYA 3N20C 2H3VA 5ALTA 1WH3A 1ZRMA 3A4RA 1STEA 3AU2A 3DERA 2O3GA 2Y3SA 2GOLA 5HHZA 9ICOA 1CQVA 1A5RA 3U7ZA 3C19A 1JIHA 2CN1A 1S3SG 2FJ6A 1YQBA 2ASJA 4M0AA 2K4PA 3SMVA 8ICLA 2JU6X 3T8MA 4H50A 4JHMA 4GXIA 3PW7A 3JPSA 4K3BA 3WK4A 4MGGA 4DLGA 3OSPA 1L3TA 3LDAA 5C2TB 2GMIC 2JWUA 3AULA 1MOKA 3BW7A 2AXTU 3E2EA 5KG3A 4PYTA 5ALOA 3SN0A 3BS5A 4ACOA 4ANVA 3ZVVA 1D3ZA 2GO7A 3HM3A 3NRWA 4R63A 2INCC 4BVUC 2DQNB 5J0WA 1ZQDA 1SV4A 5KFMA 1P7EA 2KMCA 2LASA 2R8JA 1L8OA 3TSSA 2N1RA 3H7PB 2K1FA 3TTEA 4IQVA 4TQRA 3AU4A 1LQBA 5BO4B 3FCPA 1ZQOA 2NYVA 2KHQA 2J6SA 4O5CA 4GISA 2EQ9A 3B97A 3DEQA 3DVNV 2AQ4A 9ICFA 3P2BA 5J0OA 3SV3A 4RNMA 3UQ2A 3PX4A 1I7HA 3WK9A 3UQ0A 2BCPA 3EKGA 2OEHA 4HG0A 2GL5A 2E8NA 1E8YA 2QPMA 4AYBF 2MQJA 4WH4A 1EBGA 1EF1A 3C1YA 1WGYA 1R0MA 1T0RC 3UJ2A 4HEA1 4C8NA 4DNSA 1ZXIC 2EKEC 1WCLA 2KJ5A 4QZ8A 2LEKA 2E1EA 2IHNA 3PZDA 2QB1A 2KX3A 1U48A 3QKEA 2G06A 4MF2A 2E1FA 2VFSA 3GRTA 4Y2QA 4CF5A 3K9OB 4TUQA 3V4BA 3OJUA 3R66C 1TBEA 3RITA 2WDVB 1LVLA 2R2QA 4OVUA 1CRXA 2FE8A 3HW2A 3OJ3A 3RJEA 1TKYA 2MAXA 4C80A 2L8JA 2ZJDA 3Q8AA 2BWFA 3NVZA 2MP2A 3RZWC 2KJHB 3RCZA 1JWMD 1XLNA 3DG3A 2JZBA 5JCLA 2AYOB 3MUCA 4K4HA 2C2RA 2C2DA 1HEZE 2CPRA 3SN1A 1SJED 3KLSX 2NS5A 4B0EA 3NG0A 1F9CA 1TZ1A 5FS7A 4AWJA 2YB4A 7ICOA 5ALGA 4LJXA 1S77D 3EECA 1SJHD 1NK5A 1ZQEA 2JVCA 3PW5A 4LVSA 4KZCA 2NMQA 4Q2JA 3RNAC 5JH5C 5F9LA 2KJ8A 2W7OA 5J2RA 4IM3A 2JZPA 3VQIA 3MDAA 1X9MA 3B2GA 2XK5A 3Q8BA 3UXLA 7ICPA 3WANA 3WIMA 1FEAA 4IM2A 4XLOA 2R61A 3VRAB 2HBJA 1WWUA 3SENA 1FFUA 2XNAC 5DPSA 3TMPB 3I3TB 2WX1A 5ALRA 5JTIA 3SAGA 3D2JA 4N58A 4KLQA 4CYEA 2BQQA 2GGHA 4GXJA 4DXFA 1GREA 1ZP0B 2W04A 1SJAA 5J2CA 3URHA 1D7YA 3L4PA 1RXVA 7ICHA 4QZIA 1KDHA 4FP1A 4JN7A 3SDLC 4QZAA 2WXJA 3TEZA 4LNOA 4ECTA 4M8NA 4CQNA 3RMKC 2KTRB 3WKCA 3MFIA 1PVPA 3SFEB 4PHPA 3LADA 3QN3A 3PG6A 3SN4A 4YWOA 3WKBA 2M8SA 1ZQRA 1SIFA 1WGRA 2OJRA 4WJOA 3SSZA 2XY5A 5DBAA 1C78A 4NAWB 2KFNA 1ET9A 5C5JA 3VUYA 4MHVA 4GMEA 2KD1A 1WWTA 4GIBA 2UWQA 2QJMA 1K8RB 2XICA 4MH0E 1MDRA 1Z5SB 1HSKA 1H4RA 5J04A 4JWNA 1SE3A 4XWWA 4GGBA 4FO6A 1FD6A 2XI9A 1TAMA 1S76D 5I1WA 5DG7A 1LVHA 3FDSA 2V4IB 1D8LA 1VLBA 2EAPA 1NENB 1F52A 2AL6A 1Z19A 2GH1A 2BQ3A 1E8XA 1WJNA 1D5ZC 3QX7A 2J53A 4NJCA 2XN9C 4C4RA 2EDUA 1PUZA 4M01A 4PVHA 2P8BA 3AEBB 8ICRA 4IR9A 2CU3A 4GSWA 1P43A 1X2HA 3DESA 3NFUA 1WRIA 3GP7A 2C7HA 4P4OA 4MGZE 7ENLA 5BOEA 1ZUD2 1JCTA 1YZ7A 1JRUA 4E4UA 2HDEA 2BYTA 4IRDA 2ALZA 2WAQF 2OEDA 1NKCA 4MT5A 1E8ZA 3L3FX 2QCZA 4KDLB 3TCSA 5JCIA 2B21A 3V6EB 3VCCA 3VHTC 2XH7A 4KITB 5E6NA 2INPE 4LTUA 3RPFC 4N59A 3Q8RB 2KEYA 1JWSD 3AI5A 3RB4A 2IO1B 2CJNA 3H7PA 4F4KA 3MP9A 3HPOA 2R2ZA 4DO9A 3PSPA 3PLVA 1NI3A 5FJOA 5LXHA 3FILB 2BYVE 1N61A 4Y2JA 5AKYA 1E9MA 4FN2A 3PFRA 4DXKA 1VDVA 2CHWA 1NHPA 4UQGA 5I4DA 4O1NA 2GR0A 4DHZE 3EC8A 4RGMA 2K5PA 3ZIMA 1NK8A 7ICMA 3DEDA 1HE8A 2ZIVB 4K1WA 3MY9A 1TZOA 2AL3A 1D4BA 3QE9Y 5B66U 2JRIB 4BOZB 3TADC 2J4XA 4P1CC 3IBEA 1VCBA 2BT6A 1JRPA 2E8MA 3AQEA 3OPXA 2Y5PA 9ICEA 3ISBA 3C0RB 2NBVB 3A33B 1WE7A 2L3ZA 4R3DA 2F76X 4JL9A 4HRSA 5C3JB 4B9MA 4I29A 5KFRA 4XRHA 4J9MA 3SQIA 4W9KA 2IZVB 5DPWA 1HEKA 4DF4A 2ZXHA 3UGVA 2PP1A 1VZ6A 1MRAA 2E3TA 1E8HA 4A8XC 4IWQA 2AGOA 3LWLA 3V6KA 4G9BA 2KJ6A 1S0VA 4W9LA 1ET6A 4OZAA 3W5UB 1LB2B 2K60A 1OQRA 1TIFA 2VJ5A 1MVKA 2O2VB 3ZDDA 2QEJC 3BOXA 4K81A 1JCKB 4ML8A 1MO9A 5IIIA 2WXNA 4F72A 3GIKA 4JN8A 1V5TA 1Z4OA 1L6UA 2HHVA 1AHZA 4QZEA 5ALYA 1NNLA 3C5GA 2TSSA 3PTFC 4A20A 3UIOB 2RR9A 2K6DB 4I2CA 1AOGA 4HJGE 1Q8KA 3NZUA 5LLIA 5J2DA 4H4WA 1IGDA 2K4IA 4FZNA 2NRXA 2OFJA 1YX5B 5FJRA 1O03A 4DFDA 3UI3A 3H8WA 4HCLA 2KSOB 1XT9B 3V7KA 2IOHA 4O5KA 2KK0A 3QEAZ 2QKQA 4O9MA 1ZXHA 4XA5A 5DKWA 5EWFA 5AKEA 1L7MA 5FR6A 4RF0A 4C8OA 3NXLA 1BT0A 2AHOB 3DBSA 3KHGA 4Y2TA 5J8YC 2IJ0A 2GWSA 3VXWA 2R8GA 1EWYC 1OEPA 2W9CB 5DG8A 1N62C 2WU5B 4H2HA 5L95C 5ALLA 3G6XA 8ICHA 3Q3OC 5AI4A 3G6YA 5AE3A 4M8MA 2MUTB 2KTRA 4NLGA 3V6JA 3RBEA 2WNMA 4MACA 2WF9A 5J0RA 2AL2B 2LVPA 3RNEC 2HTHA 4NAWA 2IPKD 3QTPA 3W8ZA 4ED6A 3HJEA 2Y1IA 2GQUA 4FBJB 3Q8SB 4KX6B 3Q8FA 5C1ZA 2B0CA 4FE3A 5DGAA 5KFPA 5CHWA 2YX8A 3AE3B 1RM6B 5KT6A 4UD8A 4F71A 3I4KA 5AI5A 1YD8U 2BPCA 2K4EA 2MJ3A 3BSMA 4IOIE 4KWSA 1OXJA 2E5SA 2FPMA 1RYUA 1N48A 1ZQJA 1TS5A 3PREA 2BVGA 5AIAA 2VFVA 1ONFA 4UB6U 1MI0A 1WF9A 3AE8B 3M95A 3NZSA 4L2YA 3RJHA 1FXTB 2LHDA 4RF1A 2AGPA 2OZ3A 2WOIA 3Q8LA 4DFPA 1YJ1A 4W9EA 4Z6FA 3AEFB 5KVHA 3IHPC 1WYWB 3RF9A 1D9DA 2JT4B 3D2DA 2OG9A 4BV6A 9ICSA 3IHQB 4MEMA 2WXFA 2PEAA 1WCNA 3LVWA 4F4YA 1V8CA 2HBMA 1TK5A 4JPSA 3HUIA 4J6IA 3WA0A 4XX5A 3MGHA 3NUQA 3QU4A 3PO4A 2KZRA 2LRUA 2KKVA 3KUZA 3A0HU 2CHXA 5HG2A 3P4SB 3N4EA 3G6VA 5KG7A 3FILA 3ZDTA 1ZQIA 9ICMA 1FNUA 1NDDA 1ZQKA 6ENLA 3UJSA 2N9KA 3NVWB 2HVIA 3QNMA 1MPEA 5FXEA 1ZJMA 3VH4B 3KUCB 1HUOA 3KZIU 4GDKB 4RGOS 3NASA 3UXPA 3GS2A 4M52A 2VKQA 1DYQA 5D3DA 5TZVA 2ZIVA 3UXOA 2KWUB 1DK2A 1P0RA 1XO1A 1FRDA 3IC9A 8ICNA 1P7DA 2INNE 3T3OA 3PK7A 4RNNA 4F50A 3ISCA 3PLUA 1NHSA 5ALWA 2PI5A 4LA1A 1ZMDA 3ZGZA 2BS2B 5AHXA 3ZD9A 2RDJA 1KOTA 3LXFA 3BYTB 3H4DA 1Q1OA 2OO6A 1QOFA 3D6JA 4IG7B 1VD2A 3EYZA 1YZ6A 3AU6A 1NOMA 3TARA 3S1CA 3JPPA 3DPDA 1K50A 4K2SA 3L54A 3GIJA 4P2HA 1TTNA 1B9RA 3RJFA 4GC6A 2IA6A 5CEHA 4ED1A 2BKFA 1XD3B 2MA9B 3DK8A 1OUQA 2IMWP 3GB1A 2JWZA 2O2VA 1F9JA 5ER0A 4MGYE 2Y9UA 1VQZA 4DS5A 2L1AA 2SEBD 4K7SA 5BYRA 3I6EA 2D3DA 3ZLHA 3HK0A 4H4SA 1OEYA 4TQ0A 4H19A 2OQYA 1KLGD 2EXRA 3DCGA 2N7EA 3QU5A 2WGSA 3BZDB 2XCAA 5J0SA 3MC9A 3N1YC 3QIJA 3DFYA 3KHRA 2QJNA 2JK6A 2VA2A 4O3SA 1EBDA 3KWLA 5IIJA 3ML9A 3PR5B 3GILA 3N3KB 3S1DA 3EFCA 3GE8C 3N32A 1PQSA 1KEJA 3R0KA 4RQ2A 3GDXA 3EPIA 4QWEA 4TQSA 7ICKA 2IY0B 1FIQB 4FULA 1L7PA 1URJA 2KSOA 2YMLA 3X23A 3MZNA 2D8CA 3QYPA 5KFEA 4ZOHC 5JU5A 4NWIA 2KN7A 1KFYB 1XLPA 4RUAA 1F3PA 2K25A 5AK6A 1ESFA 1T94A 2KHWB 1J2NA 1Q5WB 2K6QA 1T0SC 4EENA 5D46A 2PJHA 2F8LA 2GBJA 2R8KA 2JV3A 1D8YA 2BS4B 4YSZB 3P3BA 1GEUA 2KO3A 3ZNID 4NL9C 2W9CA 5EE9A 3OJ4B 4BWJA 3CRXA 2C3DA 1S8OA 3HVZA 2I6XA 2MUTA 1J19A 2PLPA 4I2DA 4BKGA 4HLEA 3RNMA 3V3XA 1XO3A 3QU7A 1V2YA 2YY6A 2WB1C 1XSPA 3ZW3A 2AL2A 2PP0A 1TZZA 2KFZA 2FIFA 2XC9A 1BPBA 1F77A 4C8MA 1TS3A 4RM8A 1Y56A 2OX4A 2BR0A 3VVWB 3AM9A 3PSEB 2P0IA 4AOFA 3PM9A 3N4FA 3ECIA 3EUB3 2KMDA 3ZRCA 2RRDA 5G55A 3AU5A 2PE9A 1PDYA 2KLGA 7ICJA 1IYXA 2P66A 3U2SC 4JWSC 2DZIA 4YMNA 3ZJVA 1X6JA 1Q3VA 2MLBA 2JH1A 3GRSA 3HW8A 3T5KA 2HNEA 3F2CA 5DQIA 1SJBA 3OGUA 3TQ1A 4FXCA 5MPOA 3C2LA 1LFDA 1PVRA 2FNJB 5FR3A 2WDWA 2MBHA 4RT2A 2BCSA 4MLAA 4BC9A 2J6UA 3L5KA 1SE4A 1ZK7A 4PZNA 4DDGD 3JYUA 1JPDX 4MH8A 2PTYA 2KZ3A 3Q8PB 3KZXA 1MQ3A 2YMQA 4KLUA 2W54A 4KMOB 4DSFA 1GUAB 3ZTDA 3MR2A 2VZKB 3QJZA 1CMXB 1TE6A 2PTZA 2C5LC 3R10A 2PE6B 2WYQA 3IAM1 3GIIA 2WXKA 3T3NA 2KIVA 3SD7A 1YJIA 3EANA 3TFSA 3RAXA 3TAQA 4KLJA 1NKBA 2HHQA 3T5HA 4KN7A 3PZ8A 3UINB 4EM4A 1ZQMA 4F4RA 3PQBA 3HT3A 1TS2A 4NM2A 2Q5WD 1DGJA 4DXAB 2IY1B 3GQCA 3Q6BA 5KG2A 2H3IA 1JWBD 3FC4A 2DHZA 2GI9A 4URKA 4ITKA 3RJ8A 4KLDA 1K1SA 3OC4A 2A8XA 1OW5A 8ICYA 3NVWA 4RH6A 1T0QC 5D79A 2IBIB 4IRKA 3ML8A 4GDKA 3K1RB 3BQ7A 1C79A 2ZPNA 2JMGA 1W1SA 2F5ZA 2C60A 1KLUD 4CE6A 3GOEA 3VTEA 5ALSA 1FFVA 1KCZA 4C7YA 4DS4A 4H4UA 3QX1A 3T9PA 3N6HA 2NCNA 1V97A 1ZY8A 4MEXA 5AKJA 2BYFA 5IOIA 9ICUA 3PX0A 2K9XA 4DN1A 4DL2A 2JRZA 5GTIU 9ICVA 2KG5A 3TACB 2QDFA 2BGWA 1V38A 4DSJA 2HMXA 4M9LA 4W9JA 3T8QA 1WR1A 3PO0A 3URYA 4W9CA 3Q3JA 4Y2XA 4E3CA 1C7YA 3DVNU 4Y2VA 1XCQL 3QC8B 2FDRA 3VDZA 3DBHB 2UUVA 3CNHA 3CYJA 5HHDG 7ICSA 3TEWA 4S17A 3AE9B 3HHMA 2JZ3B 2L05A 3ES8A 3ZNHB 3OZYA 1RWSA 5CJ7A 1UPHA 3V72A 4OJ5A 5EE3A 4IRCA 2KT7A 1IIPA 4PWCA 3NO1A 5J0XA 3FYHA 4DWFA 1NBFC 5FXFA 2G5IB 4FJZA 3S47A 1V5OA 2M56B 2BQUA 1QILA 5K4LA 3P63A 4RMAA 4J56A 4KLOA 1AQ6A 5C0YA 1HZ6A 4JV0A 3KYDD 3OPSA 1ZRNA 2YQUA 1EXNA 1ZD3A 4RQ3A 3RR7A 3R9KA 4JV1A 2LVOA 2FCMA 3EFUA 2MCNB 2KLCA 3I28A 3GZNI 3A1QB 5ALQA 5KL1B 3BQ1A 3BZKA 3HX0A 2ESEA 3PR4A 2M19A 2PFPA 1KN0A 2WB1F 1N56A 2WQYB 5AWVA 1FIQA 4RM9A 4PHDA 4HKZE 2O56A 4KKJA 5FS8A 4M9GA 3K9PB 5G5GB 1LV5A 4EQRA 2H3ZA 1UBIA 2KKCA 1BWCA 4E4FA 1M4VA 3SZ2A 2HOFA 4RQ8A 4MFCA 2KWVB 5J0YA 2F77X 1ZW7A 2L76A 5KFKA 1DOXA 5AZHA 5GTHU 3TBLD 4NLZA 2XY7A 2V1YA 4IQTA 3BQ0A 4XDDA 1EC7A 2W9NA 3M9OB 1PK3A 4ACFA 1JUDA 5KFGA 3GSYA 1XF5L 3QLDA 4IZGA 2WDTB 4RT3A 1KKXA 5D7GA 4Z17A 3BVGA 3ZDMC 4I28A 4IQWA 4I6PA 4F7ZA 2AU0A 5HMLA 1Z4NA 2KP7A 4ZYNA 2QDEA 4DBGA 3PRZA 2Z0EB 3M6ZA 4F5QA 4EEKA 1SL1A 1QCKA 2KVRA 4HCNB 2P3HA 4GOCA 1G6JA 1SV0A 5IILA 2RHFA 4BZAA 3F2DA 1RQLA 4ECSA 1WUFA 2RABA 3JVZX 3PMNA 2ZJ8A 5DCNA 1WUDA 3P93A 2W43A 9ICHA 4XUSA 4TMAB 1YJJA 2KQSA 3VUXA 2VAOA 1OJTA 4HPNA 1UCVA 4E6MA 1XXGA 2AX5A 2KVCA 1DOIA 2D3CA 3EGRA 2W9BB 3PO5A 5JHAA 3V6HA 1WWVA 5AIBA 3RYTA 1H38A 2HHWA 2IHMA 2Y3AA 1MBBA 5D49A 4US8A 2VZKD 1JW9D 3ZQ4A 4KX5A 2KAJA 4GYPA 3PVLA 4K7WA 4RQ5A 5AKKA 4M02A 3MC1A 2NO4A 2AQ0A 2F44A 4UBCA 1L6NA 3MHZA 9ICBA 1DNCA 2ZZBA 2BCVA 4DWIA 4M9HA 3MJ5A 4II3B 5L83A 4AJWA 2IGGA 4GIVA 4BC7A 4TVYA 3RRHA 1SB3B 4CGZA 4A6QA 4HPMB 3A9JB 3F2BA 2F1JA 5KFQA 2LVQA 5KHQA 3FV9A 3PW0A 4F5PA 1JEHA 3NGDA 1SZPA 1GRTA 5L1IA 3BK1A 5JRTA 3RCYA 3QFAA 2BB6A 2C9WB 3KHLA 3AUOA 2G1EA 3I5JC 3TUOA 2PMZF 3SQSA 1BPYA 2BKEA 1P3QU 5D6JB 3DK4A 1QTMA 4RQ7A 4PYUA 2PVGC 3LAEA 1GB4A 2KTQA 1H2IA 1P7FA 2PU0A 3L5OA 2OJWA 1XHCA 3QUTA 5HHHA 2FCSA 2V4LA 4LNKA 2GGIA 1FNVA 5F9NA 1FRRA 2VJ4A 1ZMCA 3IP4B 3DHGC 2Y9TA 4H4TA 4KLLA 4DL3A 1F0XA 1GRFA 4MF8A 3I76A 3OAWA 3RAQA 1TKDA 2G4SA 2HQMA 3IRUA 2HW3A 2J0JA 2LI6A 2A4ZA 2WX0A 5HMRA 2CFYA 8ICGA 1W1QA 3A7AA 2MBOA 3M3JA 3CW2C 4J03A 4EZKA 4BBYA 2HXTA 4GIRA 4MKSA 2KJRA 3IM1A 3NY5A 3C5FA 1E10A 3RR1A 2KHVA 1T8EA 1KKRA 3MSYA 4BURA 2LM1A 5KFAA 3D32A 4EQSA 3R2TA 3ZUNA 4HNCA 4EMIA 3O0FA 3KTQA 2ZZCA 3RJJA 2PMVA 2OVLA 2G9HD 2KMMA 4ZA0A 5FJTA 1TE2A 2ZCCA 4XGAB 4F3OA 4I2GA 1PYWD 2ZTEA 5L1MA 5KFBA 1WE6A 2MWSB 4IQUA 4B6JA 4GR1A 1NKEA 2W7PA 1E8FA 1L4DB 1N5WA 2LKYA 3A1QA 4J9OA 4MEYA 2N1VA 3DVGY 4LJPB 4YT0B 5D2MB 1RFKA 4ZHOA 1N63C 1W1MA 2PLSA 4BKSD 2ES6A 5HI1A 3WKDA 5AK3A 1DTNA 1R4NI 3TANA 2EQ6A 2HCFA 3HRDD 4C8KA 1LGRA 4NLBA 4PVJA 5G5GA 1IUEA 2XCPA 4BKSA 2IDYA 3MTNB 4LIIA 4DWDA 2LHTA 3M9MB 2D11A 4FLHA 4C4SA 4EYIB 4YL8A 3X0WA 1NJYA 1EC9A 4NY0A 4BOSC 1WGKA 1FM0D 9ICLA 1Q0WB 4IT1A 5KVIA 4MMWA 2L52A 1ZQYA 4YD2A 3W1SC 3SFDB 3PSTA 2BQRA 5BYSA 1S10A 1JQ4A 2PPGA 3AE5B 1N6ZA 1PVQA 2PI4A 3KD3A 2N9PC 4YTNB 4Y2RA 2P8CA 3Q8KA 4O3NA 1WY8A 4J9NA 1XLOA 4I2HA 3UF8A 4OW0A 1SGHA 1YQZA 2Y0SF 3GFKB 2KJ9A 2OXOA 3ALRA 1U9LA 4QW8A 4QZ9A 1UA1A 2PFQA 1ZGUB 2AQ3B 3CIRB 4BAXA 4TUUA 2KWDA 1GRAA 2PA6A 1MFWA 1GOZA 3CGBA 1HXYD 1V9PA 4K1RB 3FW7A 4GGHA 1XU4A 1ZOYB 2MX2A 2RPVA 3MC8A 2JXXA 2VFUA 1ZE3D 3GV7B 5AKIA 1WJ6A 5EOZA 1WI0A 2ISPA 2LGIA 2PW9A 2PGEA 2I1JA 4I2FA 1KKOA 3I1YA 3IJIA 1QKZA 2CJOA 3PWIA 3EZ5A 2RDHA 4A90A 2NRWA 2W9BA 4F5NA 1N60C 1ONEA 1MQ2A 4H4PA 1GO3F 1WVEA 2KN4A 5AKZA 3IK4A 1F44A 4DQSA 5J2FA 4EUTA 3H6NA 1GNUA 4K4GA 2KDIA 3NOBA 1MN8A 3THVA 4C00A 4O3MA 4DNAA 1QQRA 1UT8A 4DL6A 4J9QA 4HCPB 1X1MA 2R18A 1ELSA 4UAVA 2RPQA 2ZIUB 1RRBA 1I4QA 3IAS1 3MHSD 8ICMA 4YR2A 2RDIA 4Q45A 2EZYA 2QKNA 4YN4A 9ICNA 3BINA 4DL4A 2ZG6A 2NVKX 3A9JA 5T14A 2WPCA 4FBTA 3KBBA 3RJKA 5JXVA 1P48A 3MGVA 2EMSA 4GFIA 4GC7A 3QUBA 3PHXB 4PZFA 1L0XB 3QCAA 3FW8A 5HQXA 3SAFA 2X99A 4DQRA 2IGDA 2RLTA 3AH7A 3L08A 3N1XC 1E90A 5H92C 4QWAA 3F5EA 4B95A 4R65A 5CRXA 3W2DA 4HJKA 2PKEA 3UJEA 2F3NA 1YEYA 1KH0A 3DBRB 2DZJA 2X8HA 1NK7A 1FCCC 8ICVA 4PYZA 2LM4A 3KJMA 4RGNA 2KQ7A 1KD0A 1GG3A 3A7UA 1XNSA 1MUCA 1TYGB 4EX6A 1KN5A 2F2AB 1WM3A 1BGXT 2LZ6A 3PPAA 4EMJA 2PODA 2CKHB 4H2AA 1V6EA 1ZR6A 1FHUA 1Y8RC 4Q8FA 4BUGA 4DQQA 1AW7A 1WXQA 4GLXA 1XCTL 1KF6B 2Y5CA 3LB8C 2CDUA 1TK0A 5IAAC 1GJZA 1Z3EB 4BXOB 1A0PA 1GAQB 2ZIWB 3GD6A 3K1GA 5AKGA 2BTEA 3N97B 2P35A 2L83A 4ECQA 5DQGA 2ODGA 4HNLA 1MSWD 2N0SB 3MFGA 4PS3A 1E6EB 4PK1A 4O95A 2AQ1B 4JUZA 2R8HA
chains in the Genus database with same CATH topology
3IT4B 1E7PB 2J42A 3GS2A 1TY0A 1DYQA 4IDIA 5D3DA 4D2KA 2FUG1 1VRAB 3I57A 4TQ1A 4TVWA 1I4HA 2PVOD 1FRDA 2INNE 3T3OA 1TKEA 1VR9A 2FBWB 3CWIA 3HRDC 1L0YB 3Q69A 4WAFA 3ZGZA 2BS2B 1TJEA 2L32A 3LXFA 1I4GA 3BYTB 3TSJA 1EU3A 1PGAA 1TY2A 4EC3A 1IBXA 1QOFA 4ZYSA 4ARIA 1YMHE 3S1CA 1FXIA 1K50A 2OHFA 2V3NA 1MBTA 3WCQA 2X38A 1AN8A 5LNK1 1B9RA 2NTSA 2QJLA 1GB1A 4HKQA 3GB1A 1T3QC 2K3UA 2WS3B 3P4PB 1VQZA 2SEBD 2L1AA 4XWTA 5BYRA 1VZ8A 1E0ZA 1DIQA 4YWGG 4TQ0A 1K52A 1WYGA 1KLGD 3E9SA 2EXRA 1R7SA 2IGHA 2WXMA 5FXDA 1PFDA 3BZDB 3NRZB 2JYTA 3FW9A 1AWDA 2Y3RA 1XEEA 3V05A 3W8XA 3KWLA 5FK9C 3Q8EA 4AS1A 2WXQA 3S1DA 2BBCA 4L23A 4YTMB 1T3QA 4OZCA 1ENFA 1L0VB 3TEXA 3JS8A 2K0PA 5AE2A 2J52A 1FIQB 3RJAA 4PT5A 1NVID 4WWMA 3NZ3A 1J7AA 4ZOHC 1QT9A 1KFYB 1XLPA 1ZDVA 2MEKA 2ON8A 3NVYA 3KWVA 3W9CB 1ESFA 2WXPA 1ZXIA 2ICIA 4JB1A 2E6XA 4PWBA 2BS4B 4YSZB 3O13A 5BMIA 1PUTA 3N9YC 2MBRA 2P4PA 1W1OA 2UUUA 2W3SA 1EU4A 1FO4A 1D5MC 1NYRA 5EE9A 3NVZB 1SB3C 2E5AA 4YXDB 3NVVA 1SEBD 3HVZA 3TX1A 2PLPA 2JQRB 3V3XA 3B2FA 3B9JB 1XO3A 3R8BA 4GDLB 1L6VA 1TS3A 1F77A 1Y56A 3ZJUA 3AM9A 1YQ4B 3PM9A 2LJIA 3AE1B 3AEEB 3EUB3 3SR6A 3BVZA 3SEBA 2I0KA 1MHXA 2WU2B 1RYJA 4USAA 5TSSA 2WP9B 3AEAB 1K53A 2PTLA 3U2SC 4JWSC 3EUB2 5BMHA 3ZJVA 4J3OD 1JROA 1T5XD 1CK1A 3ETRA 2I38A 3Q8CA 4RNAA 5BYQA 2ZW0A 4FXCA 2WXLA 3J9CA 4XE0A 5BMGA 1C4CA 3BIID 4DQOC 5MPOA 1UWXA 1QLTA 3C0PA 4BCAA 1JALA 3NS1A 4WURA 5FR3A 2LUMA 2WDWA 2KACA 4MLAA 4BC9A 1JWUD 1SE4A 2DWQA 2ZW1A 4MH8A 1WSPA 5L6FA 2GRIA 2YVSA 2W54A 1FNWA 1QLUA 2VZKB 4HROA 3A7RA 2PIAA 3IAM1 3PZ7A 3S1FA 2WXKA 3T3NA 2M0AA 1YJIA 2HTME 1CZPA 3PZ8A 1QOGA 2Y3SA 1UWMA 1STEA 1V1PB 1C77A 2O3GA 3PQBA 1TS2A 5HHZA 1CQVA 2KQ4X 2Q5WD 2SAKA 3U7ZA 1DGJA 1JWBD 1W1JA 3FC4A 2DBYA 2GI9A 4ITKA 3RJ8A 1BUIC 1D5XC 3AE7B 1VJKA 3NVWA 4RH6A 2JU6X 5D79A 2LMCA 2BVHA 1BXTA 1C79A 2V0GA 1W1SA 1TS4A 1KLUD 1Q10A 3VTEA 2WXHA 5C2TB 1VZ7A 1FFVA 4C7YA 2JWUA 1V97A 1NYQA 3BW7A 2K9XA 3POPA 1SSNA 4PYTA 4UDUC 3URYA 3PO0A 5EE1A 1AYFA 4ZRPA 1XCQL 5AE1A 2UUVA 4JAYA 1CJEA 2WLBA 3P42A 1EWCA 1P7EA 5HHDG 2RK5A 3TEWA 3TSSA 3AE9B 4JWUC 4ARCA 2JSVX 2LHEA 1RWSA 1JMLA 1J7CA 3IXSA 5EE3A 3LLBA 4PWCA 5FXFA 3W8WA 2BW2A 2M56B 5GXGB 1QILA 3P63A 1HZ6A 4HG0A 1I7HA 3NRZA 1HA5A 2QPMA 4WH4A 3OWEB 5FKAC 4IKGA 2BVFA 4HEA1 4DNSA 4RCOA 1C4AA 1PGXA 2M19A 1VAOA 1ZXIC 2LEKA 5AWVA 2WQYB 2B76B 1FIQA 4HKZE 2VFSA 4KKJA 3BYYB 5G5GB 3VR8B 1HZ5A 1QOAA 3U52E 1QF6A 1M4VA 2WDVB 4NAMA 1XLQA 2FE8A 1N63A 1TKYA 3AN1A 4C80A 3TSHA 2H88B 3Q8AA 1DOXA 2PLSA 2LFIA 3HSUA 3NVZA 1JWMD 1XLNA 4XDDA 4YSYB 4YTPB 4TSSA 1DOYA 3GSYA 3P4RB 1SXTA 1XF5L 1C9FA 3B9JA 2WXIA 4A55A 1HEZE 5AUIA 5D7GA 1SJED 3KLSX 4B0EA 4DXGA 4WQMA 3BVGA 3TEYA 4OZBA 1RM6C 2OAIA 4OALA 1V1OA 3DWGC 2AXRA 1YQ3B 1SJHD 3W1SA 1C4PA 4Q2JA 4P16A 2NMQA 1YN4A 2JZPA 3VQIA 2GQTA 3FWAA 3B2GA 3Q8BA 5H8YE 1F0ZA 4XLOA 2R61A 3VRAB 2N7JA 2XNAC 5AUKA 1FFUA 1N5XA 1IGCA 1JWAD 5E6JA 4TMAB 3D2JA 1YJJA 2VAOA 4RFBA 1XXGA 2AX5A 4N58A 1DOIA 3EGRA 4DXFA 1HQRD 1ZP0B 3L4PA 2ONQA 1OQQA 1ZPSA 4EE2A 3MC0B 1YN5A 2WXJA 1YN3A 2KDMA 2Y3AA 4US8A 2PKOA 2VZKD 3TEZA 1MBBA 4ZOHB 4PVEA 1JW9D 3ZQ4A 2NQWA 4CQNA 2P3HA 2KAJA 1UNSA 1PDXA 3KQ4A 3SFEB 1N60A 3MHZA 3HVDA 1C78A 4NAWB 1SF0A 1ET9A 2WDQB 3MJ5A 4C56C 1N62A 4BC7A 2IGGA 3R07C 4TVYA 1WWTA 1SB3B 5G5HB 4A6QA 1HSKA 1V1PA 2JYEA 4L1BA 2R8DA 3DWMA 1SE3A 4XWWA 1FFVC 3BK1A 2NTTA 4AQ7A 2QIEB 1FD6A 2BB6A 3S1EA 5I1WA 3TUOA 2G1EA 3W5VB 2V4IB 1VLBA 1NENB 2RMMA 2PVGC 3LAEA 3AECB 1GB4A 4M0WA 1K51A 2DYMA 3NUHB 1P7FA 1D5ZC 5T8IA 2J53A 4MM3B 4NJCA 2XN9C 3AV8A 1FNVA 4OHJA 4PVHA 3AEGB 2YEPF 3AEBB 2Y08A 1FRRA 1FMAD 2CU3A 4US9A 3E56A 1X2HA 5ADZA 1WRIA 3GP7A 1E8GA 1F0XA 3FAHA 1ZUD2 1E0YA 2HDEA 2BYTA 4N6EB 5FXPA 3AMZA 2OEDA 5HMRA 4MT5A 2WXOA 1W1QA 2K22A 3A7AA 1I4XA 1DZNA 2INPE 4LTUA 1KTKA 3RPFC 2Q4WA 4BBYA 1TKGA 4N59A 5HFYA 1JWSD 4A9AA 3MP9A 2R2ZA 2CJNA 2N9LA 4XDCA 1E10A 1SE2A 4ZHPA 1NI3A 3R2TA 3H8HA 3U4EG 3FILB 3C8YA 1N61A 4LLGM 1E9MA 1LO5D 2PMVA 1VDVA 2D5GA 2G9HD 2KMMA 4ZRQA 3VRBB 4PVKA 2GB1A 2I2YA 5I4DA 4O1NA 3D2HA 1PYWD 3R2IA 4RGMA 2K5PA 1D6EC 1AHUA 3DEDA 1T6BX 4LK0M 1TZOA 1D4BA 1NEKB 2EKIA 4OVZA 2J4XA 1E8FA 2BT6A 1N5WA 1JRPA 1FEHA 1L4DB 2Y5PA 3IT6B 2JX5A 2MJDA 1RFKA 4YT0B 4ZHOA 3AE2B 1N63C 1UXYA 1W1MA 1L4ZB 4R3DA 3RFZB 2PLIA 4HRSA 5HI1A 5C3JB 3EA6A 2IPIA 1SBBB 1F2RI 1IBXB 3DQ0A 3HRDD 1QOBA 2DYOA 4PVJA 5G5GA 1IUEA 4B0MA 2Z8LA 2IDYA 3P1MA 2DLBA 1VZ6A 2E3TA 1E8HA 4A8XC 1PGBA 3AE6B 2W82A 1YNTE 3AEDB 1WGKA 1FM0D 1ET6A 4OZAA 3W5UB 1OQRA 1MVKA 2QEJC 2L52A 2V3PA 3SFDB 1JCKB 4ML8A 1I4RA 1B1ZA 5BYSA 1FXAA 2WXNA 1JQ4A 3AE5B 3I9V1 1L6UA 1AHZA 4YTNB 1BMLC 1AHVA 2TSSA 1XLOA 3BVMA 2RDGA 1FFUC 4OW0A 2Q85A 2Y4GA 2AQ3B 2YEPB 4HJGE 3CIRB 2KWDA 1IGDA 1FCLA 1GOZA 1HXYD 1OFFA 3FW7A 4C7ZA 1W1LA 3UI3A 1ZOYB 1X2GA 2RPVA 3AB5A 2VFUA 1QLBB 1ZE3D 2WXGA 4P6VF 1ZXHA 3NVYB 2PW9A 2LGIA 4RF0A 4REZA 2QSDA 1QKZA 2CJOA 2RDHA 3BK2A 4A90A 1N60C 2IJ0A 4RGTA 1EWYC 3LYYA 1WVEA 2KN4A 1N62C 2WU5B 3BWUD 2EELA 2WXRA 3VR9B 5AE3A 3NVVB 2VFTA 2BB5A 1QQRA 2BS3B 2WNMA 4MACA 4KGTA 4JE3B 1UUPA 1EM7A 1UGJA 4KKIA 2MH7A 5L6GA 2IPKD 1I4QA 3IAS1 2QKNA 1J7BA 1W1KA 3W8ZA 2GQUA 5G5HA 4KX6B 3SR6B 3Q8FA 1GPXA 5JXVA 2AQ2B 1SIJA 5EE0A 2JXTA 5K8EA 3AE3B 2ACZB 1RM6B 4PZFA 1L0XB 4UD8A 3FW8A 5HQXA 1A70A 1DIIA 2IGDA 4YSXB 3I99A 2MJ3A 3AH7A 4IOIE 3AE4B 5H92C 1TS5A 2BVGA 2VFVA 3ETRB 3W2DA 1MI0A 3AE8B 4L2YA 4RF1A 2VFRA 2LHDA 2QILA 1KH0A 1I4PA 3NS1B 2W3RA 1FCCC 1WVFA 3AEFB 3KJMA 4RGNA 3ZJTA 4WIPA 4GLSC 3A7UA 3D2DA 3ABVB 1TYGB 2H89B 1MHHE 1I19A 1N61C 2WXFA 4H2AA 2QMTA 1ZR6A 1V8CA 4JPSA 3HUIA 1AW7A 1WXQA 3P4QB 1XCTL 1KF6B 5I1VA 2Y5CA 3LB8C 1F2RC 5HG2A 3P4SB 1GAQB 1KRHA 5D3IB 1W1RA 1ZDXA 2BTEA 4NZLB 2W55A 1ACCA 1L5PA 1C76A 2L83A 1FNUA 3FILA 4JX1C 3ZYYX 1N5WC 2MJEA 2N9KA 2N0SB 3MFGA 4KGSA 3NVWB 1MPEA 5FXEA 1E6EB 2P13A 4KGRA 4O95A 2AQ1B 1ROEA 4GDKB 2WDRB 4RGOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7P B;  4IDI A;  4TVW A;  2PVO D;  1FRD A;  1TKE A;  2FBW B;  3CWI A;  3HRD C;  2BS2 B;  1TJE A;  3LXF A;  3TSJ A;  4EC3 A;  1QOF A;  3S1C A;  1FXI A;  2OHF A;  1MBT A;  3WCQ A;  1B9R A;  2QJL A;  1T3Q C;  2WS3 B;  3P4P B;  1VQZ A;  1E0Z A;  1DIQ A;  1WYG A;  2EXR A;  1R7S A;  5FXD A;  1PFD A;  3NRZ B;  3FW9 A;  1AWD A;  3W8X A;  3KWL A;  3S1D A;  4YTM B;  1T3Q A;  1L0V B;  3JS8 A;  5AE2 A;  1FIQ B;  1NVI D;  4WWM A;  1J7A A;  4ZOH C;  1QT9 A;  1KFY B;  1XLP A;  3NVY A;  3W9C B;  1ZXI A;  4JB1 A;  4PWB A;  2BS4 B;  4YSZ B;  1PUT A;  2MBR A;  2P4P A;  1W1O A;  2W3S A;  1FO4 A;  5EE9 A;  1NYR A;  3NVZ B;  1SB3 C;  2E5A A;  4YXD B;  3NVV A;  3HVZ A;  3TX1 A;  2JQR B;  3B2F A;  3B9J B;  1XO3 A;  1L6V A;  3AM9 A;  1YQ4 B;  3PM9 A;  3AE1 B;  3AEE B;  3EUB 3;  3SR6 A;  2I0K A;  2WU2 B;  1RYJ A;  4USA A;  2WP9 B;  3AEA B;  4JWS C;  3EUB 2;  1JRO A;  3ETR A;  4FXC A;  3C0P A;  1QLT A;  5MPO A;  3BII D;  4BCA A;  1JAL A;  3NS1 A;  4MLA A;  4BC9 A;  2DWQ A;  2YVS A;  2W54 A;  1QLU A;  4HRO A;  3A7R A;  2PIA A;  3S1F A;  1YJI A;  2HTM E;  1CZP A;  1QOG A;  1UWM A;  2O3G A;  5HHZ A;  2Q5W D;  1DGJ A;  1JWB D;  1W1J A;  3FC4 A;  2DBY A;  4ITK A;  3AE7 B;  1VJK A;  3NVW A;  5D79 A;  2BVH A;  1W1S A;  3VTE A;  5C2T B;  1FFV A;  4C7Y A;  1V97 A;  1NYQ A;  3BW7 A;  2K9X A;  4PYT A;  3PO0 A;  5EE1 A;  1AYF A;  5AE1 A;  4JAY A;  1CJE A;  2WLB A;  2RK5 A;  3AE9 B;  4JWU C;  1RWS A;  3LLB A;  1J7C A;  5EE3 A;  4PWC A;  5FXF A;  3W8W A;  2M56 B;  5GXG B;  3P63 A;  4HG0 A;  1I7H A;  3NRZ A;  2QPM A;  2BVF A;  4DNS A;  2M19 A;  1VAO A;  1ZXI C;  2LEK A;  2WQY B;  2B76 B;  1FIQ A;  2VFS A;  5G5G B;  3VR8 B;  1QOA A;  1QF6 A;  2WDV B;  1XLQ A;  1N63 A;  1TKY A;  3AN1 A;  4C80 A;  3TSH A;  2H88 B;  1DOX A;  3NVZ A;  1XLN A;  4YSY B;  4YTP B;  1DOY A;  3GSY A;  3P4R B;  3B9J A;  5AUI A;  4WQM A;  1RM6 C;  2OAI A;  4OAL A;  3DWG C;  2AXR A;  1YQ3 B;  2GQT A;  3FWA A;  3B2G A;  5H8Y E;  1F0Z A;  4XLO A;  3VRA B;  5AUK A;  1FFU A;  1N5X A;  1JWA D;  3D2J A;  1YJJ A;  2VAO A;  2AX5 A;  4N58 A;  1DOI A;  1ZP0 B;  3L4P A;  1OQQ A;  1MBB A;  4US8 A;  2PKO A;  2P3H A;  4ZOH B;  4PVE A;  1JW9 D;  2NQW A;  2KAJ A;  1PDX A;  3SFE B;  1N60 A;  1SF0 A;  2WDQ B;  3R07 C;  4BC7 A;  4TVY A;  1N62 A;  1WWT A;  1SB3 B;  5G5H B;  1HSK A;  2R8D A;  3DWM A;  1FFV C;  2QIE B;  3S1E A;  2G1E A;  3W5V B;  1VLB A;  1NEN B;  2PVG C;  3LAE A;  3AEC B;  3AV8 A;  4PVH A;  3AEG B;  3AEB B;  1FRR A;  1FMA D;  2CU3 A;  4US9 A;  1X2H A;  5ADZ A;  1WRI A;  1E8G A;  1F0X A;  3FAH A;  1ZUD 2;  1E0Y A;  4N6E B;  5FXP A;  3AMZ A;  5HMR A;  1W1Q A;  2K22 A;  3A7A A;  1DZN A;  4LTU A;  2Q4W A;  3RPF C;  4BBY A;  1TKG A;  4N59 A;  4A9A A;  2R2Z A;  2CJN A;  1E10 A;  4ZHP A;  1NI3 A;  1N61 A;  1E9M A;  1VDV A;  4PVK A;  2KMM A;  3VRB B;  3D2H A;  2K5P A;  1AHU A;  3DED A;  1NEK B;  2EKI A;  1E8F A;  2BT6 A;  1N5W A;  1JRP A;  2JX5 A;  2MJD A;  1RFK A;  4YT0 B;  4ZHO A;  3AE2 B;  1N63 C;  1UXY A;  1W1M A;  2PLS A;  2PLI A;  4HRS A;  5C3J B;  3DQ0 A;  3HRD D;  1QOB A;  4PVJ A;  5G5G A;  1IUE A;  3P1M A;  1E8H A;  2E3T A;  3AE6 B;  3AED B;  1WGK A;  1FM0 D;  3W5U B;  1OQR A;  2L52 A;  3SFD B;  4ML8 A;  1FXA A;  1JQ4 A;  3AE5 B;  1L6U A;  1AHZ A;  4YTN B;  1AHV A;  1XLO A;  2Q85 A;  1FFU C;  3CIR B;  1OFF A;  3FW7 A;  4C7Z A;  1W1L A;  1ZOY B;  1X2G A;  3AB5 A;  2VFU A;  1QLB B;  4P6V F;  3NVY B;  2CJO A;  1N60 C;  1EWY C;  1WVE A;  1N62 C;  2WU5 B;  3VR9 B;  5AE3 A;  3NVV B;  2VFT A;  2BS3 B;  2MH7 A;  2QKN A;  1J7B A;  1W1K A;  3W8Z A;  2GQU A;  5G5H A;  4KX6 B;  3SR6 B;  1GPX A;  1SIJ A;  5EE0 A;  3AE3 B;  2ACZ B;  1RM6 B;  4PZF A;  4UD8 A;  3FW8 A;  5HQX A;  1A70 A;  1DII A;  3I99 A;  4YSX B;  2MJ3 A;  3AH7 A;  3AE4 B;  5H92 C;  2BVG A;  2VFV A;  3ETR B;  3AE8 B;  2VFR A;  3NS1 B;  2W3R A;  1WVF A;  3AEF B;  3KJM A;  3A7U A;  3D2D A;  3ABV B;  1TYG B;  2H89 B;  1I19 A;  1N61 C;  1ZR6 A;  1V8C A;  3HUI A;  1WXQ A;  3P4Q B;  1KF6 B;  2Y5C A;  3LB8 C;  3P4S B;  1GAQ B;  1KRH A;  1W1R A;  2W55 A;  1L5P A;  2L83 A;  4JX1 C;  3ZYY X;  1N5W C;  2MJE A;  2N0S B;  3NVW B;  2P13 A;  5FXE A;  1E6E B;  4O95 A;  1ROE A;  2WDR B; 
#chains in the Genus database with same CATH topology
 3PT2 B;  4D2K A;  4ICA A;  1ZQA A;  4EZJ A;  4EZL A;  2KZZ A;  3IDW A;  2KDF B;  4DXG A;  2EMT A;  1TKE A;  2X8X X;  5IDZ A;  4Q43 A;  3CWI A;  3ONS A;  2ZC8 A;  4RU9 A;  1WGG A;  4QW9 A;  3Q69 A;  5AM1 A;  3RUL A;  4ZRI A;  1FEZ A;  3KKA A;  1ZQG A;  4PPX A;  3TSJ A;  1PGA A;  4H4V A;  3WAO A;  4EC3 A;  4ED8 A;  1ZYQ A;  2EAM A;  4KV2 A;  4NQK E;  2FYM A;  4ARI A;  1WFY A;  2UVR A;  2BC0 A;  1COO A;  2D2Q A;  4NEV A;  3HPF A;  5ALD A;  3HP6 A;  1MBT A;  1GC7 A;  3SYZ A;  4IWO A;  2NTS A;  4IL6 U;  3AL0 B;  4Z6D A;  2GBK A;  3RJI A;  1L8L A;  2YB1 A;  4NY8 A;  1VJ5 A;  2L0T A;  2WS3 B;  4FS2 A;  3KVF B;  3P4P B;  5CB1 A;  1K1Q A;  2F1I A;  5J29 A;  1DIQ A;  1JXL A;  5TIS U;  1K52 A;  1WYG A;  4G50 A;  4MGI E;  1R7S A;  2M4N A;  5ALK A;  5FXD A;  2ZUC A;  3NRZ B;  3FW9 A;  2Y3R A;  1XEE A;  1YX6 B;  3W8X A;  3Q6J A;  4BDP A;  1ZQX A;  3RZF A;  3ZO5 B;  3ICX A;  3VC8 A;  1KM7 A;  2Y1J A;  4OZC A;  1ENF A;  3LJ3 A;  1L0V B;  1ZQQ A;  5KT7 A;  2YVG A;  3OHB A;  2K0P A;  3QPE A;  1BPD A;  2A3V A;  3TI0 A;  2ZJ5 A;  2IBK A;  2ZAD A;  3DBL I;  3NZ3 A;  2V3A A;  1WZ0 A;  4IHC A;  1ZDV A;  2ON8 A;  3KWV A;  1Z2M A;  2JR5 A;  3W9C B;  4UB8 U;  2RDX A;  5KT3 A;  2PFN A;  4CDG A;  1ZXI A;  3BQT A;  4NLK A;  4ED0 A;  2E6X A;  2JUO A;  2DFL A;  4PWB A;  5BMI A;  3N7P D;  2JZZ A;  2MBR A;  5HR6 A;  3TJ4 A;  2FCQ A;  1W1O A;  3TOY A;  2AAQ A;  2UUU A;  1FO4 A;  1D5M C;  1NYR A;  4OJO A;  4WJN A;  4B9U A;  1ECW A;  4MFF A;  3CAW A;  1TK8 A;  1M6I A;  4FZM A;  1SEB D;  9ICJ A;  3B9J B;  1SGG A;  3P0W A;  4P1B C;  4GDL B;  2PU1 A;  1RXW A;  8ICU A;  2WF5 A;  3PV8 A;  2AJQ A;  2KFJ A;  2Z0D B;  4LNI A;  3HKZ C;  2GSH A;  1B22 A;  3FG2 P;  2ZIU A;  8ICO A;  1WMH B;  5FS9 A;  2HOQ A;  1DXL A;  4P0Q A;  3HIL A;  2LJI A;  3AEE B;  3ZKJ C;  3EWA A;  4M2Y A;  3BVZ A;  1SL2 A;  4PJ0 U;  4YMM A;  1MHX A;  2WU2 B;  3S5S A;  2EQ7 A;  2YTU A;  2J7Q B;  4J9P A;  3RH5 A;  1K53 A;  1R4M I;  5E79 U;  4LNF A;  2A1J B;  4DSK A;  3EUB 2;  2DYB A;  2KYW A;  5IIM A;  3MQT A;  3TIX A;  2K39 A;  1JRO A;  4M00 A;  4UW9 A;  1I42 A;  5J2H A;  1CK1 A;  4I6N B;  4RNA A;  2ZW0 A;  3J9C A;  2EQY A;  1ZQF A;  1TYP A;  4QWB A;  1UWX A;  5BOF A;  3IN5 A;  3N30 A;  4EM3 A;  5KT5 A;  4F5R A;  4BFR A;  5FJU A;  1RVK A;  4F8R A;  2DWQ A;  2ZW1 A;  2A1A A;  4OJ6 A;  2AL1 A;  2GRI A;  4G7F A;  2YVS A;  2EAN A;  2KTF A;  4HRO A;  4C4V B;  1ZX9 A;  4ZRJ A;  3A7R A;  3MAB A;  3L13 A;  1CZP A;  3SD5 A;  1WG8 A;  1U47 A;  3UJF A;  1DGS A;  3EW9 A;  2V9W A;  3DIP A;  1C77 A;  2PCE A;  4BXO A;  1JI7 A;  1D9F A;  2ZIW A;  1KFT A;  1KQQ A;  2SAK A;  5IO9 A;  3L16 A;  4GMV A;  4F4X A;  2ZVO A;  1W1J A;  5DPR A;  1BUI C;  1D5X C;  2QHO A;  3AE7 B;  5JCM A;  1VJK A;  4ZRK A;  2B6G A;  3T79 A;  2RGF A;  2BVH A;  4P4P A;  7ICR A;  3Q45 A;  3VC6 A;  4M0W B;  3GD4 A;  1YT3 A;  5IIK A;  1B4F A;  2ZJA A;  4ECW A;  1TS4 A;  1TAU A;  4WWN A;  3VUW A;  2V0G A;  4OCZ A;  5KFX A;  4UAY A;  8ICX A;  1Q10 A;  2WXH A;  2JEF A;  2VH1 A;  3PWG A;  3LDZ E;  1NYQ A;  4ECR A;  1Z1B A;  2FI1 A;  2UU7 A;  1X40 A;  1SSN A;  3STP A;  4YQW A;  1ZQN A;  1KLN A;  2KNJ A;  2N4F A;  2ZZP B;  5KFU A;  5DB7 A;  2GLE A;  1E7V A;  2BPF A;  5EE1 A;  2NR2 A;  4ICU A;  1AYF A;  4I2E A;  3KFU F;  4ZRP A;  5AE1 A;  7ICN A;  3DQV A;  4OVV A;  1J97 A;  2PFO A;  1CJE A;  2WLB A;  4JAY A;  1V49 A;  5L9X A;  1EWC A;  4R8U B;  4U7C A;  2MBB B;  3RFA A;  1WJ4 A;  5G2N A;  4JWU C;  5HR7 A;  2KIW A;  4CCH A;  4W9H A;  2W8L A;  1AAR A;  2M9N A;  1JML A;  3LLB A;  5AI8 A;  4QWC A;  3BJS A;  4EZ9 A;  4B9T A;  4RQ1 A;  4RUC A;  4PGQ A;  2KVS A;  3ED5 A;  2BW2 A;  2DPJ A;  5J2I A;  7ICF A;  2ZNV C;  4BX9 C;  4OJP A;  3EJD B;  2BCR A;  1TGZ B;  3NRZ A;  2MBQ A;  3IG5 A;  1HA5 A;  2OPJ A;  5E6P A;  5CA7 A;  5FKA C;  1E5W A;  4DQP A;  4E74 A;  2KDB A;  4RCO A;  3Q3N C;  3UMG A;  3GIM A;  3RBD A;  1WGH A;  2AKM A;  3II4 A;  3OTR A;  3WAM A;  3H1U A;  3B08 A;  3ORY A;  4QIW C;  1E7U A;  3VTV A;  2ISO A;  1DK3 A;  3VR8 B;  1HZ5 A;  1QOA A;  1QF6 A;  3TAD A;  2GLS A;  4NAM A;  1XLQ A;  3MJW A;  3LYS A;  3CB3 A;  4PHA A;  1UEL A;  5J2A A;  4AP4 C;  3N6J A;  4R66 A;  3TSH A;  3UQB A;  2XVT A;  3B0A A;  2WPE A;  2WHE A;  3OTQ A;  3DHI C;  3T9L A;  1HTQ A;  3EHV A;  3HSU A;  4YTP B;  1OQY A;  4LZG A;  3IG3 A;  4TSS A;  4GXK A;  1DOY A;  1K4Q A;  3WKE A;  1NEL A;  4ANU A;  1ZD4 A;  2WFA A;  1SXT A;  3B9J A;  5ALE A;  3QK0 A;  4TUP A;  5HHI A;  4O3O A;  4GDL A;  5AUI A;  4A55 A;  1NK9 A;  3VDG A;  3TEY A;  4ADW A;  4G8T A;  2OAI A;  3LK9 A;  3IV6 A;  1V1O A;  3SAH A;  2AXR A;  4UAT A;  2J6T A;  1WMH A;  3QZ8 A;  1YQ3 B;  2WF6 A;  3MR6 A;  1C4P A;  1YN4 A;  4NXZ A;  2ZCB A;  2FMP A;  4ASW C;  1SZH A;  3H7S A;  3QU2 A;  3SV4 A;  3BY4 B;  5IN7 A;  1S0M A;  1IPG A;  9ICP A;  3QA8 A;  4KSK C;  5AI6 A;  2ZIX B;  5H8Y E;  2KAN A;  4DYE A;  4W9F A;  5AUK A;  2J3N A;  4EBD A;  3KW5 B;  1ZQL A;  1JWA D;  2A1J A;  4YCX A;  3R1Z A;  2NO5 A;  5DB6 A;  7ICG A;  4RFB A;  4CRX A;  3PHW B;  2KIC A;  3BDP A;  1HQR D;  2LMR A;  4JMU A;  2JPH A;  2A5U A;  5HKH A;  1OQQ A;  1ZPS A;  2QAE A;  4F93 B;  4YR3 A;  4EE2 A;  3MC0 B;  1YN5 A;  3QAQ A;  4EMW A;  2HI0 A;  3RH6 A;  2YMP A;  1LKY B;  2R8I A;  4PVE A;  4ZOH B;  9ICA A;  3H8A A;  2HE7 A;  3V6C B;  2NQW A;  1UNS A;  3CST A;  3ONN A;  1PDX A;  3KQ4 A;  5U25 A;  3ISD A;  4A35 A;  2BCQ A;  3HVD A;  4TV3 A;  2NPX A;  4C4V A;  5J8Y A;  3OP2 A;  2FPL A;  2OKT A;  2WDQ B;  4TVW A;  2HVH A;  3T5L A;  1N62 A;  3GC2 A;  3H40 A;  4I2I A;  3K75 D;  5KFH A;  5AI0 A;  4HCH A;  1OGW A;  1MC8 A;  2JYE A;  4L1B A;  2QGY A;  2LBO A;  4TUS A;  3IJQ A;  8ICQ A;  3UCC A;  7ICV A;  5GMV A;  3V7L A;  4X2P A;  2QAR B;  1BPZ A;  4EEW A;  3Q8M A;  1CEZ A;  3W5V B;  3L0W B;  4GXB A;  3H9D A;  1X2I A;  1D8B A;  2OLA A;  1L7O A;  4M0W A;  1EF5 A;  2WP5 A;  8ICS A;  1H6V A;  3O0H A;  3THU A;  2BYE A;  5KFW A;  4DOB A;  1OTR B;  4MM3 B;  3AV8 A;  4KIK A;  4OHJ A;  2ZZ0 A;  2MRL A;  4GN1 A;  3AEG B;  2YEP F;  2Y08 A;  2POZ A;  3E56 A;  5KFJ A;  3ZI4 A;  1GRB A;  1NI2 A;  1OEY J;  3MFH A;  2XBB C;  1E8G A;  2GGJ A;  2HXU A;  3FAH A;  5DBC A;  4MFA A;  1E0Y A;  2G4D B;  3UPQ A;  9ICC A;  2CS4 A;  2IYD B;  4FHJ A;  4N6E B;  5FXP A;  3AMZ A;  4LZD A;  2WXO A;  4F2R A;  2BDU A;  2GBR A;  1TAQ A;  4EWJ A;  3V60 A;  1LXD A;  2Q4W A;  3DGZ A;  4R8U A;  5J2G A;  1TKG A;  5HFY A;  3OJS A;  2W03 A;  1RAX A;  2HOI A;  4OO1 J;  2N9L A;  1SE2 A;  3RRG A;  3FM9 A;  4ZHP A;  1UHU A;  1L5U A;  2QDD A;  5U1O A;  3H8H A;  4W9D A;  2BC1 A;  1ARO P;  5EBK A;  4LLG M;  5IA7 A;  2W11 A;  2Y5B B;  3VRB B;  4DSL A;  4ZRQ A;  3RD2 A;  4EQX A;  2GB1 A;  3D2H A;  1F0M A;  1FEB A;  3TQP A;  4P0P B;  4F8C B;  4IUM B;  4ZDV A;  4G3X B;  2NV3 A;  2WWZ A;  4AJY B;  5FMH A;  2NVU I;  3UMC A;  4HDO A;  3CXB A;  3UM9 A;  4KLE A;  2HHU A;  4LK0 M;  4K4I A;  1NEK B;  2P3Z A;  4M6W A;  2GR1 A;  1FEH A;  4ICV A;  3QXG A;  3IT6 B;  3WKA A;  4QZB A;  3M9N B;  3C29 A;  2MJD A;  1KRP A;  4ELV A;  2V9H A;  3AE2 B;  3N4M B;  3B1L X;  2I5Q A;  1L4Z B;  3RFZ B;  4JWM A;  1JOA A;  2ASQ A;  1MJD A;  3EA6 A;  4MEL A;  1SBB B;  4JLC A;  2IPI A;  3T3F A;  3VCB A;  2REX A;  5B5E U;  2J0K A;  1LPF A;  2Z8L A;  4DDI D;  1WX9 A;  2NQL A;  2OQH A;  3UMB A;  3T4W A;  2ZEQ A;  3M63 B;  5F3X B;  4UAU A;  2BCU A;  2H3F A;  3VAW A;  2QC8 A;  2C28 A;  3AQF A;  1IYF A;  1H8C A;  2LGY A;  1ZET A;  2W82 A;  9ICI A;  1C20 A;  3D9X A;  2V6O A;  1N2X A;  2GGG A;  5DLG A;  1YIW A;  4J9L A;  3S6J A;  5ALJ A;  3CXO A;  3H4B A;  3R0U A;  1I4R A;  1B1Z A;  3EAO A;  1FXA A;  4A3P A;  3KH0 A;  3I9V 1;  3JPO A;  1V80 A;  5KL8 B;  5BOM A;  3O65 B;  3H8M A;  2VA3 A;  1BML C;  1AHV A;  2N1W A;  2RDG A;  1NZP A;  1FFU C;  2MSN A;  3M8R A;  4B9V A;  2Q85 A;  3A0B U;  2WOV A;  2Y4G A;  1BPE A;  1SWV A;  2FE9 A;  1BKH A;  1WUE A;  1C1Y B;  3JPT A;  1TVA A;  1FCL A;  3TWB A;  1GRG A;  3UQA A;  1OFF A;  5ALX A;  1W1L A;  4EEL A;  4F4W A;  1X2G A;  3H70 A;  3AB5 A;  2XH4 A;  3H7V A;  1EO6 A;  2ZIX A;  2XGP A;  1QLB B;  9ICT A;  5CHV C;  1K5O A;  5AK5 A;  2CHR A;  1ZOL A;  3VFC A;  4IP5 A;  4RQM A;  2LXC A;  5E6O A;  3NVY B;  2TPR A;  3H8J A;  3NTU A;  4NJ8 A;  1BPX A;  3HWT A;  1ZQB A;  4IR1 A;  4KLF A;  2QSD A;  5DDM A;  4AYB C;  1P98 A;  8ICB A;  2I5H A;  8ICP A;  3BK2 A;  3SJN A;  3C2K A;  4HN8 A;  1WZ3 A;  3RO6 A;  4DSE A;  3RI7 C;  3PVX A;  1RYR A;  3A9K B;  2EEL A;  2WXR A;  3BWU D;  1LKY A;  5AM3 A;  3VR9 B;  4ED2 A;  3NVV B;  3DJG X;  2VFT A;  3VFK A;  5JRB A;  3IG8 A;  1E8W A;  3OHA A;  2KXJ A;  2YAU A;  2NRT A;  2L0F A;  2V3S A;  3Q3M C;  4JE3 B;  1UUP A;  4KGT A;  1L7N A;  5DPT A;  1J8C A;  4KKI A;  1MA7 A;  2MH7 A;  4NL9 A;  5L6G A;  3W1Y A;  5AM5 A;  3RNB C;  3KHH A;  1QSS A;  4B9N A;  1J7B A;  1QZE A;  1W1K A;  2HJ8 A;  3ZDA A;  3SR6 B;  1GPX A;  4DOC A;  1SIJ A;  5EE0 A;  3RR8 A;  2WF7 A;  2GH5 A;  5ALN A;  4EKU A;  1BNP A;  2YMM A;  2QAR A;  4O3P A;  4Q44 A;  4I27 A;  1C3T A;  3IFW B;  1DII A;  4BWM A;  3UIP B;  4YSX B;  1ZQZ A;  4CF4 A;  2JH7 A;  4O5E A;  2IOF K;  3APD A;  4FA6 A;  1UT5 A;  4B9S A;  4JQW C;  3D2Q A;  4MM3 A;  2VFR A;  4U6P A;  1KBU A;  3LWM A;  4QJF B;  4Y2U A;  8ICW A;  1FHV A;  2IO0 B;  1I4P A;  3NS1 B;  2W3R A;  1MNS A;  5IIN A;  2VH2 A;  4ANX A;  2MRP A;  2E8P A;  1XS9 D;  3ZJT A;  1ZDL A;  4GLS C;  3QWZ B;  2I1Q A;  1QQ6 A;  3ABV B;  2CRX A;  2K8B B;  2H89 B;  4RNO A;  4UB1 A;  1R6W A;  1MHH E;  1I19 A;  3MWC A;  1N61 C;  3C23 A;  4HPP A;  2QMT A;  1ECQ A;  2CR5 A;  2FAZ A;  1KW4 A;  1IG6 A;  3QHT A;  2WP6 A;  4ROP A;  1ZD5 A;  5I1V A;  2KX0 A;  4HWI B;  3A4S C;  4KZ0 A;  4KLG A;  1QQ7 A;  4IP4 A;  3RTV A;  3B0X A;  1KRH A;  4GFJ A;  1PZN A;  1ZDX A;  3V5F A;  3DG7 A;  2W55 A;  1ACC A;  1Z00 B;  1C76 A;  4JX1 C;  3N28 A;  1W6T A;  2R9Z A;  3KKA C;  3QU9 A;  3OLM D;  4KGS A;  1KL9 A;  4M6U A;  2P13 A;  1WXS A;  2BWE S;  2ZXI A;  2YVC A;  5KFZ A;  4IS7 A;  4TKN A;  4P0P A;  5CTR C;  3IT4 B;  4RQ6 A;  5KFD A;  1E7P B;  2J42 A;  3JW0 X;  4YFK A;  4CHK A;  1PDZ A;  3TAP A;  3RJG A;  1VRA B;  2FUG 1;  3I57 A;  1QH9 A;  1I4H A;  3IVF A;  3JPR A;  4TQ1 A;  2PVO D;  1NU5 A;  2XH2 A;  4H83 A;  2RDB C;  1ZQU A;  2UVV A;  2W8K A;  2XID A;  3Q3F A;  2OYY A;  1KJT A;  2C7M B;  4MDK E;  4FI4 A;  1L0Y B;  4DX3 A;  4WAF A;  2DZK A;  5D4B A;  4JDR A;  1P9D U;  3JVA A;  4WJ3 B;  2FLN A;  3SBF A;  3SQP A;  4QZD A;  1WRD B;  1EU3 A;  1TY2 A;  1L2N A;  2LXA A;  2OZ8 A;  1X9W A;  2G07 A;  1WJU A;  1XAN A;  2GR3 A;  4DLE A;  4ZYS A;  3V5C A;  2ZUD A;  1ZD2 P;  1U49 A;  3OZM A;  5KG6 A;  3V7J A;  4K3C A;  1NJX A;  2CXY A;  4J9R A;  3RT3 B;  1NK4 A;  5DLF A;  4EBC A;  3SHQ A;  2X38 A;  1AN8 A;  5AKH A;  2QJL A;  1GB1 A;  2XEW A;  3ZDE A;  3D47 A;  1NK6 A;  2WBA A;  3V3W A;  3GZN B;  1EBH A;  1M94 A;  3DVG X;  7ICT A;  5JCN A;  2WF8 A;  4M0X A;  4XWT A;  1I35 A;  1MDL A;  4W9G A;  3DG6 A;  2FPK A;  5D94 A;  2DAJ A;  1E0Z A;  1XWL A;  2WAQ C;  2LGD A;  3WK8 A;  4DFM A;  4UBB A;  4DF8 A;  3E9S A;  3ZNZ B;  3D2S A;  2BKR B;  1PFD A;  3RNF C;  2JYT A;  4PS7 A;  2KKP A;  1ZQT A;  5AM2 A;  4AP9 A;  4K7Z A;  5FK9 C;  2ZPY A;  2WXQ A;  3OSN A;  2BZF A;  3DDC B;  2BBC A;  4Z6E A;  3K4G A;  2DZM A;  3RB3 A;  2UVW A;  4KLH A;  3JZU A;  3ZRF A;  1T3Q A;  2XH0 A;  2ZTD A;  3TEX A;  3LVV A;  2FLP A;  3PRP B;  1ZQV A;  2G08 A;  2E8O A;  2J52 A;  2OH2 A;  3ZLG A;  3RJA A;  2OM6 A;  4Y2P A;  3CK5 A;  1NVI D;  4ENL A;  4KSL C;  3KOO A;  1QT9 A;  2FKP A;  2AH5 A;  3NVY A;  1ZQS A;  3CGD A;  4C8L A;  4KLM A;  5DBB A;  4UAR A;  8ICT A;  1KLV A;  1NHQ A;  4KEM A;  4I2B A;  4ECZ A;  2XSX A;  3O13 A;  4HYK A;  5KFV A;  1V85 A;  1X9S A;  3N1Z C;  3A9K A;  1BVS A;  4ED7 A;  1MG8 A;  4YXD B;  4YVZ A;  1L3V A;  3SEI A;  3NVV A;  1UF0 A;  4GB9 A;  5ALZ A;  3TX1 A;  4UB5 A;  2V4Q A;  3B0Y A;  2LGX A;  3C1Z A;  3B2F A;  2QQ6 A;  2DEN B;  5JCK A;  5KG0 A;  1GSN A;  1Z1V A;  4KDI C;  1L6V A;  2GBM A;  1L8P A;  4F1S A;  2KE7 A;  1YQ4 B;  2KVZ A;  2LWP A;  1WX7 A;  2LGS A;  2X8G A;  1NZB A;  2OCE A;  3SR6 A;  3SEB A;  3M7D A;  3WK6 A;  1EC8 A;  2I0K A;  3TW9 A;  3H0R B;  3H8S A;  5CP2 A;  3U26 A;  4P0Q B;  8ICK A;  4USA A;  1B0X A;  1HJP A;  3TCA A;  1U4A A;  2EQ8 A;  5ALF A;  1QSY A;  2G0A A;  2N9E B;  4UAW A;  2GOW A;  4YXM A;  1JPM A;  4EZ6 A;  3RGT A;  5KFI A;  5KG5 A;  3M8S A;  3PRM B;  4J3O D;  3CF6 E;  2Q0Z X;  3F5A A;  7ICL A;  3RNC C;  1L3U A;  2I38 A;  5BYQ A;  3TKA A;  3Q4D A;  4J3Z A;  2WXL A;  2WTF A;  5BMG A;  4ECY A;  2F1H A;  1C4C A;  4DQO C;  3C0P A;  4BCA A;  3M62 B;  1JAL A;  3NS1 A;  4WUR A;  4ED3 A;  2LUM A;  4HDQ A;  3HM6 X;  4KPR A;  1JWU D;  5L1K A;  5ALI A;  1Q3U A;  2X8C A;  3ZD8 A;  4PGY A;  1QLU A;  3KUM A;  2K8B A;  1SXE A;  4BBN C;  3VC5 A;  3GY1 A;  2PIA A;  3RB0 A;  1EUV B;  1KSP A;  3PZ7 A;  3S1F A;  4C0Z A;  1CI4 A;  3JW7 A;  1QOG A;  4YR0 A;  1UWM A;  1V1P B;  4LJO B;  4R64 A;  3BQ2 A;  8ICE A;  2KQ4 X;  3PV1 A;  3DFH A;  3U4F A;  5L1J A;  4P4M A;  2DBY A;  1Z00 A;  4M04 A;  1KFS A;  5ALU A;  1F5S A;  2LI5 A;  3R11 A;  4NJ7 A;  2LMC A;  9ICK A;  2C2E A;  1BXT A;  2RP5 A;  5KTQ A;  1NJW A;  3DDM A;  2BHN A;  3M6K A;  2MSE D;  1VZ7 A;  3APF A;  4HYR A;  3ZNG C;  2LYB A;  1ED1 A;  4PZO A;  3U8Z A;  4EQW A;  4C4T A;  1FEC A;  3POP A;  2LYH A;  3RNG C;  4UDU C;  4IC9 A;  1MG4 A;  4RZR A;  2RQ5 A;  1S0N A;  1LM8 B;  4BJQ A;  1M6Y A;  4DL7 A;  5KFO A;  1IXR A;  2AKZ A;  2MNR A;  3QFB A;  2KD0 A;  3UXK A;  1ZJN A;  3I6T A;  5FJP A;  2I9G A;  3N7S C;  3TWA A;  4F4Z A;  3P42 A;  1T4G A;  3QUQ A;  2RK5 A;  4W9I A;  4MSQ B;  4O3Q A;  4FDC B;  3PX6 A;  2D07 B;  3RN9 C;  3L8K A;  4YP3 A;  1HTO A;  2JSV X;  2LHE A;  3R7R A;  4ARC A;  3IXS A;  1J7C A;  4UAZ A;  4LNN A;  4KN4 A;  4NLC A;  4KLI A;  2WHI A;  4XZ4 A;  2PS2 A;  5HMM A;  3W8W A;  3QUC A;  1TKK A;  4A3R A;  5GXG B;  1TV9 A;  3ZXR A;  5GRT A;  4Z1Y A;  2D3G A;  1R4N B;  3MDC A;  2VIX A;  2KZM A;  1WXM A;  4GRT A;  3WK5 A;  2DF4 B;  3UXN A;  3OWE B;  4JV2 A;  3ZVH B;  3QQ8 B;  4IKG A;  3TJI A;  4UB2 A;  2BVF A;  5ALV A;  2XGQ A;  3Q2A C;  4DHJ B;  2WPF A;  3MKC A;  2HZG A;  1C4A A;  2MBE A;  1IV8 A;  1PGX A;  1VAO A;  5KFY A;  5AM0 A;  2HHX A;  1FPY A;  2B76 B;  4QZF A;  5KT4 A;  2L00 B;  3ZVI A;  1A6S A;  5CHG A;  3BYY B;  3OG5 A;  4X57 B;  1T0Y A;  2ZUB A;  1QQ5 A;  4QZG A;  1B43 A;  5J0P A;  3U52 E;  3CP8 A;  3LXD A;  3T6C A;  3C2M A;  5J18 A;  4P7I A;  3CGE A;  3FJ4 A;  1N63 A;  4JB3 A;  3WAP A;  3ZXV A;  3AN1 A;  2B3A A;  1X42 A;  1GC6 A;  4M9J A;  2H88 B;  5KAI U;  4O0I A;  5KFF A;  2LFI A;  3I63 C;  1JX4 A;  4YSY B;  3E0F A;  4LDT B;  4PH5 A;  1TYT A;  1ZQW A;  4FX9 A;  3AEV A;  4BGD A;  3UCD A;  3P4R B;  2BVC A;  1BQG A;  1C9F A;  2WXI A;  4H1Z A;  2K4H A;  5KG4 A;  2JEJ A;  4ZH4 A;  4WQM A;  4EOY A;  4OZB A;  1RM6 C;  4OAL A;  2AGQ A;  4DL5 A;  3DWG C;  4I6L B;  2O6K A;  3ENE A;  4WJP A;  2ZTC A;  3ZLZ A;  3DOW A;  2M0X A;  3W1S A;  2K8C B;  4P16 A;  3QEB Z;  4MJS B;  4CO7 A;  2GQT A;  1ZQC A;  3FWA A;  4DSI A;  4RPZ A;  4BBN F;  1HIW A;  2IO3 B;  2D3B A;  2VAN A;  1UGM A;  1F0Z A;  4XC2 A;  4HCD A;  2N7J A;  1HUZ A;  1N5X A;  1IGC A;  4A3O A;  3DEE A;  2G09 A;  2G45 B;  5E6J A;  3CMM B;  1TFR A;  2NBW B;  1P1A A;  4FS1 A;  2ATL A;  2FCN A;  2RD0 A;  2KN5 A;  1V9J A;  4FJV B;  3H12 A;  2MA1 A;  2ONQ A;  9ICW A;  3BJY A;  5DDY A;  5HP4 A;  3ZDB A;  3VH3 B;  4Y2Y A;  4APN A;  3ES7 A;  1YN3 A;  4DFK A;  2KDM A;  2PKO A;  4K7U A;  3VCN A;  5KAF U;  5ENL A;  4JGH B;  4RPX A;  4F91 B;  3VA8 A;  5FP0 A;  1ZQH A;  4RQ0 A;  1ZKH A;  3PW4 A;  2D10 A;  1XSL A;  2Q4T A;  1N60 A;  3GZF A;  2D6F C;  2JY6 A;  4KMU A;  5KT2 A;  5LXI B;  2PGW A;  5J0T A;  4QWD A;  1SF0 A;  4C56 C;  3R07 C;  2P88 A;  5G5H B;  2OZT A;  4RPY A;  1XS2 A;  1SE9 A;  9ICR A;  2YLM A;  1WGD A;  4J9S A;  2KC1 A;  4EEY A;  1V1P A;  3MR5 A;  2UYZ B;  2R8D A;  5BPC A;  3DWM A;  1FFV C;  3EJB B;  2CU1 A;  2NTT A;  2PMQ A;  4AQ7 A;  2QIE B;  3ETL A;  4A8E A;  3S1E A;  1JDF A;  2PPH A;  3MR3 A;  3C28 A;  1JMS A;  2C3C A;  3KLJ A;  4K8G A;  2RMM A;  2LRW A;  2FID A;  5CX3 A;  3WU2 U;  1XO0 A;  2BPS A;  3AEC B;  1K51 A;  2DYM A;  3NUH B;  3SU8 X;  4HVB A;  5T8I A;  4HPL B;  2JEG A;  4J1O A;  1F1H A;  2M1M A;  2X50 A;  3SI8 A;  1WX8 A;  2DW7 A;  4B6W A;  1TT5 B;  1FMA D;  4US9 A;  4PGX A;  2EAO A;  4KIK B;  5ADZ A;  4YG2 A;  3ENL A;  3WAL A;  8ICA A;  2Z59 B;  4KX3 A;  3FXG A;  3C21 A;  2PXI A;  3TFR A;  3T5J A;  2UVU A;  1T3N A;  1Q46 A;  4YD1 A;  2K22 A;  2QLT A;  1I4X A;  1DZN A;  2Z7J A;  4Y2S A;  2K8A A;  1KTK A;  5A0L A;  2XO7 A;  3DH9 A;  4A9A A;  1A77 A;  3JSV B;  4FHK A;  3GV5 B;  4XDC A;  1DXS A;  2GGE A;  4I2J A;  3U4E G;  3C8Y A;  1LO5 D;  7ICU A;  2F8K A;  5IP4 D;  2D5G A;  5BOL A;  4PVK A;  3DBH I;  1S1Q B;  3ZLF A;  2I2Y A;  1O08 A;  3D46 A;  3ZTC A;  1XQQ A;  3NJT A;  3R2I A;  3LB8 A;  1BZL A;  1S7M A;  3AXC A;  4DHJ D;  1PK1 B;  2A19 A;  2DUY A;  1D6E C;  4NNJ B;  1AHU A;  4UAS A;  2JRH A;  1T6B X;  3R7Q A;  1ZKQ A;  3ZVH A;  2EKI A;  4OVZ A;  3GO2 A;  4X5V A;  3PGE A;  3S2A A;  5ALH A;  3EPG A;  3KYC D;  1RLF A;  2QJJ A;  1GER A;  2JX5 A;  1GRH A;  4E5T A;  4M6W B;  4F2S A;  1UXY A;  3UJR A;  2PLI A;  2HDO A;  5J0U A;  5AK4 A;  2YVF A;  4Q8E A;  4K8D A;  1S97 A;  1F2R I;  2V3B A;  4FAD A;  2OWO A;  2KK8 A;  1QOB A;  2P6R A;  2DYO A;  2KOX A;  9ICG A;  1IBX B;  2BPG A;  3DQ0 A;  4B0M A;  3P1M A;  4A6G A;  3HKZ F;  3JPQ A;  4BKT A;  2W9M A;  2DLB A;  3TL5 A;  2JGA A;  1WR6 E;  5AZG A;  1PGB A;  3AE6 B;  2FUH B;  4LDT D;  1YNT E;  1UA0 A;  3AED B;  1SWW A;  5KFC A;  5J2K A;  1U45 A;  3DV9 A;  1ISN A;  2DKX A;  2HSZ A;  4E71 A;  3RRA A;  3GU3 A;  2V3P A;  2ONE A;  2KNB A;  1SV0 C;  1X6I A;  2DKZ A;  4RQN A;  2L7R A;  3H4K A;  1V81 A;  2GR2 A;  4DCC A;  3DBL B;  3E58 A;  4IW0 A;  3BVM A;  5KHO A;  2QB0 B;  2RSU A;  5DG9 A;  4YMO A;  1GXF A;  2YEP B;  3CYM A;  3DK9 A;  3ZDC A;  3NHE B;  2K8C A;  4WAA A;  1RYS A;  2NBU A;  4MJS A;  2ZNV B;  3QZ7 A;  3RH4 A;  4B9L A;  2C7N B;  4PL2 A;  4FBU A;  2HHS A;  4C7Z A;  1S9F A;  3VTW A;  4AUQ C;  4QNL A;  4GGQ A;  1V86 A;  2K89 A;  3QAR A;  2M17 A;  4LCD E;  2I1K A;  4EX7 A;  4NV0 A;  9ICX A;  2DNF A;  4O3R A;  2N7D A;  2WXG A;  3APC A;  4P6V F;  4PS8 A;  4GYP C;  4H4Y A;  3CGC A;  2VRR B;  5EWG A;  3Q14 C;  4REZ A;  4HK2 A;  3DJJ A;  2YN4 A;  3DDH A;  2NPT B;  3Q8Q B;  3V61 A;  2DAF A;  3LYY A;  4RGT A;  3FVD A;  5J0Q A;  5EDS A;  1WIA A;  2LPE A;  5AKL A;  1RG6 A;  4PL1 A;  5AI9 A;  3PS6 A;  1KTQ A;  2H3Q A;  2ASD A;  3VTU A;  1SXD A;  2BF8 B;  3UGB B;  2BB5 A;  3CT2 A;  3RB6 A;  2KV2 A;  1UZX B;  2BS3 B;  5AM4 A;  1NDA A;  1R4M B;  2V4R A;  1EM7 A;  2DX5 B;  2DPI A;  2C22 A;  1UGJ A;  1WXA A;  3L10 B;  2GQW A;  2L5Y A;  4E8G A;  4WQO B;  1UD7 A;  3WK7 A;  3DGH A;  8ICC A;  2ASL A;  2KFK B;  4E0D A;  5G5H A;  5H2F U;  3U30 A;  3EJE B;  2GBN A;  5ALM A;  5J2B A;  4IL2 A;  4CF3 A;  5DB8 A;  2O6V B;  2AQ2 B;  2WOW A;  2JXJ A;  1Y88 A;  4NLN A;  1JXE A;  2JXT A;  5K8E A;  1S5L U;  2ACZ B;  2LD9 A;  3NS8 A;  3H7I A;  4NPN A;  5KG1 A;  1A70 A;  4EFO A;  4H4Z A;  1SKW A;  7ICE A;  2PP3 A;  3I99 A;  3F53 A;  5KFS A;  1ZQP A;  4I2A A;  3AE4 B;  2W9A A;  3GD3 A;  3EEZ A;  3ETR B;  5AZF A;  1COK A;  4DQI A;  4F92 B;  3MGI A;  2QIL A;  4QZC A;  4Z6C A;  8ICJ A;  5C23 A;  5FS6 A;  1WVF A;  3FKY A;  1BNO A;  4XQ8 A;  2D3A A;  4G11 A;  5HNK A;  2M0N A;  3GE3 C;  4WIP A;  3FYY A;  3BS7 A;  5TR3 A;  5AEK B;  2J0M A;  3EF6 A;  8ICI A;  2MW5 A;  1SJD A;  5L1L A;  5CWR A;  5DB9 A;  4DOA A;  4WJQ A;  3HIZ A;  2KOB A;  2JEI A;  4KTQ A;  3R3M A;  1GV4 A;  1STZ A;  3BZC A;  1RPL A;  3H0M B;  1A76 A;  1NJZ A;  4G3I A;  8ICF A;  3U9I A;  3P4Q B;  1L3S A;  5J2E A;  3IJL A;  3D2N A;  3JSV A;  4IC7 B;  1F2R C;  1IM4 A;  9ICQ A;  4J9K A;  3PSI A;  4MGK E;  5CHF A;  4WWO A;  4GU2 A;  5D3I B;  4FJY A;  1W1R A;  2HBL A;  4DHG A;  4NZL B;  5KFN A;  1J0G A;  4QIW F;  1L5P A;  4JQ9 A;  1S0O A;  3ZYY X;  1N5W C;  2MJE A;  4J57 A;  2EH9 A;  4H4X A;  1NK0 A;  4DHZ B;  1CUK A;  4KGR A;  2FMS A;  3K1Z A;  2XY6 A;  2YQE A;  1ROE A;  2MHJ A;  2WDR B;  1V59 A;  4UB4 A;  1PK1 A;  1TY0 A;  2FMQ A;  3PY8 A;  2LJ5 A;  4IDI A;  4N9F 4;  5IKC M;  7ICI A;  2GRT A;  4ZCW A;  5CR0 A;  3M1Y A;  3PML A;  2GDQ A;  2NRZ A;  4DFJ A;  2PTW A;  4RQ4 A;  5EWE A;  1VR9 A;  2FBW B;  4NQL B;  3HRD C;  2IOF A;  3BS5 B;  3H0L B;  1TJE A;  2L32 A;  2CHZ A;  2XGZ A;  1JN3 A;  1I4G A;  5JHB A;  5AIC A;  2PMZ C;  4ELT A;  4KVG B;  1IBX A;  4M9N A;  1YMH E;  2AEH A;  5ALP A;  4II2 B;  1SKS A;  2PSN A;  1UH6 A;  4ELU A;  1RDF A;  1FXI A;  4QAY A;  1T7P A;  2EZZ A;  2OHF A;  4CNQ A;  2V3N A;  4ECV A;  3TJP A;  3WCQ A;  5LNK 1;  1WXV A;  5KFT A;  4HKQ A;  2JF5 A;  2DL0 A;  4FFD A;  4ECX A;  1T3Q C;  2ZVN A;  4NM1 A;  4PHE A;  2K3U A;  4KLT A;  3PNC A;  4H4R A;  1VZ8 A;  3PSF A;  4YWG G;  1SJC A;  4YWS A;  2IGH A;  2WXM A;  5JUM A;  2MU2 A;  4IM0 A;  1DRG A;  4DK5 A;  2VA8 A;  8ICZ A;  1AWD A;  3V05 A;  2HHT A;  2KMA A;  3Q8E A;  4G0N B;  3V62 A;  4AS1 A;  2QB0 A;  3R25 A;  3KUD B;  1QSL A;  2JHD A;  2W0H A;  3PZP A;  2BGF A;  4L23 A;  4YTM B;  4YXJ A;  2MUC A;  4ANW A;  1UQV A;  3JS8 A;  1E9I A;  3U7D A;  1NHR A;  2KWC A;  5AE2 A;  3GV8 B;  4PT5 A;  4FZL A;  4B9K A;  4UB3 A;  4WWM A;  1J7A A;  5DGB A;  7ICQ A;  1XSN A;  2MEK A;  4IL0 A;  1SL0 A;  2K8H A;  5IIO A;  1ZQ1 C;  2WXP A;  4IWP A;  2ICI A;  4OJL A;  2LUE A;  2NPT A;  4JB1 A;  1Q1R A;  2PTX A;  4HXD A;  2FLL A;  1X66 A;  1PUT A;  3N9Y C;  2P4P A;  2H5X A;  2W3S A;  1EU4 A;  3NVZ B;  2MP2 B;  3L17 A;  1SB3 C;  2E5A A;  5J2J A;  4NJ6 A;  2JZB B;  4F5O A;  5DQH A;  3PW2 A;  4KLS A;  2JQR B;  1X9X A;  2YVJ A;  5AKX A;  1NPX A;  4NEW A;  3R8B A;  2N9X A;  1Q1W A;  2HBK A;  2P6U A;  2R2O A;  2QVH A;  1DOQ A;  1KFD A;  2NRV A;  2O6V D;  3ALB A;  3ZJU A;  5KFL A;  3NZG A;  3N7R C;  2IO2 B;  5KNI A;  2KFK A;  1RZT A;  3AE1 B;  5JZE B;  2OOB B;  1UBQ A;  2O6V A;  2KC2 A;  1J2M A;  2EZX A;  1RYJ A;  2XK5 B;  5TSS A;  4XYC A;  5J17 A;  5EU9 A;  2WP9 B;  4OD0 A;  1SKR A;  4M47 A;  2HD5 B;  2HJ1 A;  3AEA B;  2G5H B;  2PTL A;  3DHH C;  3RUI B;  4JIO U;  5BMH A;  3DGB A;  1YOV B;  1XPY A;  4EYH B;  1IP9 A;  2KDE B;  3OW1 A;  2BDP A;  3J81 j;  4KT2 A;  1T5X D;  3ETR A;  3Q8C A;  5TR5 A;  3JPN A;  4XE0 A;  2Y0S C;  1QLT A;  1F8W A;  3BII D;  4TUR A;  2G3Q B;  1XC9 A;  1GET A;  4EBE A;  1XDI A;  2KAC A;  2LYA A;  4DEZ A;  4KPL A;  4S0R A;  2IND C;  5L6F A;  1WSP A;  2AWT A;  4MSM B;  2DW6 A;  4JK1 A;  1FNW A;  2DGZ A;  1RFA A;  4QZH A;  1GES A;  4H4Q A;  1U4B A;  4WWP A;  1WM2 A;  3CSF A;  4ECU A;  1QLN A;  2M0A A;  2HTM E;  3DBR I;  1L7Y A;  4HAI A;  1RQN A;  3MBY A;  3N20 C;  2H3V A;  5ALT A;  1WH3 A;  1ZRM A;  3A4R A;  1STE A;  3AU2 A;  3DER A;  2O3G A;  2Y3S A;  2GOL A;  5HHZ A;  9ICO A;  1CQV A;  1A5R A;  3U7Z A;  3C19 A;  1JIH A;  2CN1 A;  1S3S G;  2FJ6 A;  1YQB A;  2ASJ A;  4M0A A;  2K4P A;  3SMV A;  8ICL A;  2JU6 X;  3T8M A;  4H50 A;  4JHM A;  4GXI A;  3PW7 A;  3JPS A;  4K3B A;  3WK4 A;  4MGG A;  4DLG A;  3OSP A;  1L3T A;  3LDA A;  5C2T B;  2GMI C;  2JWU A;  3AUL A;  1MOK A;  3BW7 A;  2AXT U;  3E2E A;  5KG3 A;  4PYT A;  5ALO A;  3SN0 A;  3BS5 A;  4ACO A;  4ANV A;  3ZVV A;  1D3Z A;  2GO7 A;  3HM3 A;  3NRW A;  4R63 A;  2INC C;  4BVU C;  2DQN B;  5J0W A;  1ZQD A;  1SV4 A;  5KFM A;  1P7E A;  2KMC A;  2LAS A;  2R8J A;  1L8O A;  3TSS A;  2N1R A;  3H7P B;  2K1F A;  3TTE A;  4IQV A;  4TQR A;  3AU4 A;  1LQB A;  5BO4 B;  3FCP A;  1ZQO A;  2NYV A;  2KHQ A;  2J6S A;  4O5C A;  4GIS A;  2EQ9 A;  3B97 A;  3DEQ A;  3DVN V;  2AQ4 A;  9ICF A;  3P2B A;  5J0O A;  3SV3 A;  4RNM A;  3UQ2 A;  3PX4 A;  1I7H A;  3WK9 A;  3UQ0 A;  2BCP A;  3EKG A;  2OEH A;  4HG0 A;  2GL5 A;  2E8N A;  1E8Y A;  2QPM A;  4AYB F;  2MQJ A;  4WH4 A;  1EBG A;  1EF1 A;  3C1Y A;  1WGY A;  1R0M A;  1T0R C;  3UJ2 A;  4HEA 1;  4C8N A;  4DNS A;  1ZXI C;  2EKE C;  1WCL A;  2KJ5 A;  4QZ8 A;  2LEK A;  2E1E A;  2IHN A;  3PZD A;  2QB1 A;  2KX3 A;  1U48 A;  3QKE A;  2G06 A;  4MF2 A;  2E1F A;  2VFS A;  3GRT A;  4Y2Q A;  4CF5 A;  3K9O B;  4TUQ A;  3V4B A;  3OJU A;  3R66 C;  1TBE A;  3RIT A;  2WDV B;  1LVL A;  2R2Q A;  4OVU A;  1CRX A;  2FE8 A;  3HW2 A;  3OJ3 A;  3RJE A;  1TKY A;  2MAX A;  4C80 A;  2L8J A;  2ZJD A;  3Q8A A;  2BWF A;  3NVZ A;  2MP2 A;  3RZW C;  2KJH B;  3RCZ A;  1JWM D;  1XLN A;  3DG3 A;  2JZB A;  5JCL A;  2AYO B;  3MUC A;  4K4H A;  2C2R A;  2C2D A;  1HEZ E;  2CPR A;  3SN1 A;  1SJE D;  3KLS X;  2NS5 A;  4B0E A;  3NG0 A;  1F9C A;  1TZ1 A;  5FS7 A;  4AWJ A;  2YB4 A;  7ICO A;  5ALG A;  4LJX A;  1S77 D;  3EEC A;  1SJH D;  1NK5 A;  1ZQE A;  2JVC A;  3PW5 A;  4LVS A;  4KZC A;  2NMQ A;  4Q2J A;  3RNA C;  5JH5 C;  5F9L A;  2KJ8 A;  2W7O A;  5J2R A;  4IM3 A;  2JZP A;  3VQI A;  3MDA A;  1X9M A;  3B2G A;  2XK5 A;  3Q8B A;  3UXL A;  7ICP A;  3WAN A;  3WIM A;  1FEA A;  4IM2 A;  4XLO A;  2R61 A;  3VRA B;  2HBJ A;  1WWU A;  3SEN A;  1FFU A;  2XNA C;  5DPS A;  3TMP B;  3I3T B;  2WX1 A;  5ALR A;  5JTI A;  3SAG A;  3D2J A;  4N58 A;  4KLQ A;  4CYE A;  2BQQ A;  2GGH A;  4GXJ A;  4DXF A;  1GRE A;  1ZP0 B;  2W04 A;  1SJA A;  5J2C A;  3URH A;  1D7Y A;  3L4P A;  1RXV A;  7ICH A;  4QZI A;  1KDH A;  4FP1 A;  4JN7 A;  3SDL C;  4QZA A;  2WXJ A;  3TEZ A;  4LNO A;  4ECT A;  4M8N A;  4CQN A;  3RMK C;  2KTR B;  3WKC A;  3MFI A;  1PVP A;  3SFE B;  4PHP A;  3LAD A;  3QN3 A;  3PG6 A;  3SN4 A;  4YWO A;  3WKB A;  2M8S A;  1ZQR A;  1SIF A;  1WGR A;  2OJR A;  4WJO A;  3SSZ A;  2XY5 A;  5DBA A;  1C78 A;  4NAW B;  2KFN A;  1ET9 A;  5C5J A;  3VUY A;  4MHV A;  4GME A;  2KD1 A;  1WWT A;  4GIB A;  2UWQ A;  2QJM A;  1K8R B;  2XIC A;  4MH0 E;  1MDR A;  1Z5S B;  1HSK A;  1H4R A;  5J04 A;  4JWN A;  1SE3 A;  4XWW A;  4GGB A;  4FO6 A;  1FD6 A;  2XI9 A;  1TAM A;  1S76 D;  5I1W A;  5DG7 A;  1LVH A;  3FDS A;  2V4I B;  1D8L A;  1VLB A;  2EAP A;  1NEN B;  1F52 A;  2AL6 A;  1Z19 A;  2GH1 A;  2BQ3 A;  1E8X A;  1WJN A;  1D5Z C;  3QX7 A;  2J53 A;  4NJC A;  2XN9 C;  4C4R A;  2EDU A;  1PUZ A;  4M01 A;  4PVH A;  2P8B A;  3AEB B;  8ICR A;  4IR9 A;  2CU3 A;  4GSW A;  1P43 A;  1X2H A;  3DES A;  3NFU A;  1WRI A;  3GP7 A;  2C7H A;  4P4O A;  4MGZ E;  7ENL A;  5BOE A;  1ZUD 2;  1JCT A;  1YZ7 A;  1JRU A;  4E4U A;  2HDE A;  2BYT A;  4IRD A;  2ALZ A;  2WAQ F;  2OED A;  1NKC A;  4MT5 A;  1E8Z A;  3L3F X;  2QCZ A;  4KDL B;  3TCS A;  5JCI A;  2B21 A;  3V6E B;  3VCC A;  3VHT C;  2XH7 A;  4KIT B;  5E6N A;  2INP E;  4LTU A;  3RPF C;  4N59 A;  3Q8R B;  2KEY A;  1JWS D;  3AI5 A;  3RB4 A;  2IO1 B;  2CJN A;  3H7P A;  4F4K A;  3MP9 A;  3HPO A;  2R2Z A;  4DO9 A;  3PSP A;  3PLV A;  1NI3 A;  5FJO A;  5LXH A;  3FIL B;  2BYV E;  1N61 A;  4Y2J A;  5AKY A;  1E9M A;  4FN2 A;  3PFR A;  4DXK A;  1VDV A;  2CHW A;  1NHP A;  4UQG A;  5I4D A;  4O1N A;  2GR0 A;  4DHZ E;  3EC8 A;  4RGM A;  2K5P A;  3ZIM A;  1NK8 A;  7ICM A;  3DED A;  1HE8 A;  2ZIV B;  4K1W A;  3MY9 A;  1TZO A;  2AL3 A;  1D4B A;  3QE9 Y;  5B66 U;  2JRI B;  4BOZ B;  3TAD C;  2J4X A;  4P1C C;  3IBE A;  1VCB A;  2BT6 A;  1JRP A;  2E8M A;  3AQE A;  3OPX A;  2Y5P A;  9ICE A;  3ISB A;  3C0R B;  2NBV B;  3A33 B;  1WE7 A;  2L3Z A;  4R3D A;  2F76 X;  4JL9 A;  4HRS A;  5C3J B;  4B9M A;  4I29 A;  5KFR A;  4XRH A;  4J9M A;  3SQI A;  4W9K A;  2IZV B;  5DPW A;  1HEK A;  4DF4 A;  2ZXH A;  3UGV A;  2PP1 A;  1VZ6 A;  1MRA A;  2E3T A;  1E8H A;  4A8X C;  4IWQ A;  2AGO A;  3LWL A;  3V6K A;  4G9B A;  2KJ6 A;  1S0V A;  4W9L A;  1ET6 A;  4OZA A;  3W5U B;  1LB2 B;  2K60 A;  1OQR A;  1TIF A;  2VJ5 A;  1MVK A;  2O2V B;  3ZDD A;  2QEJ C;  3BOX A;  4K81 A;  1JCK B;  4ML8 A;  1MO9 A;  5III A;  2WXN A;  4F72 A;  3GIK A;  4JN8 A;  1V5T A;  1Z4O A;  1L6U A;  2HHV A;  1AHZ A;  4QZE A;  5ALY A;  1NNL A;  3C5G A;  2TSS A;  3PTF C;  4A20 A;  3UIO B;  2RR9 A;  2K6D B;  4I2C A;  1AOG A;  4HJG E;  1Q8K A;  3NZU A;  5LLI A;  5J2D A;  4H4W A;  1IGD A;  2K4I A;  4FZN A;  2NRX A;  2OFJ A;  1YX5 B;  5FJR A;  1O03 A;  4DFD A;  3UI3 A;  3H8W A;  4HCL A;  2KSO B;  1XT9 B;  3V7K A;  2IOH A;  4O5K A;  2KK0 A;  3QEA Z;  2QKQ A;  4O9M A;  1ZXH A;  4XA5 A;  5DKW A;  5EWF A;  5AKE A;  1L7M A;  5FR6 A;  4RF0 A;  4C8O A;  3NXL A;  1BT0 A;  2AHO B;  3DBS A;  3KHG A;  4Y2T A;  5J8Y C;  2IJ0 A;  2GWS A;  3VXW A;  2R8G A;  1EWY C;  1OEP A;  2W9C B;  5DG8 A;  1N62 C;  2WU5 B;  4H2H A;  5L95 C;  5ALL A;  3G6X A;  8ICH A;  3Q3O C;  5AI4 A;  3G6Y A;  5AE3 A;  4M8M A;  2MUT B;  2KTR A;  4NLG A;  3V6J A;  3RBE A;  2WNM A;  4MAC A;  2WF9 A;  5J0R A;  2AL2 B;  2LVP A;  3RNE C;  2HTH A;  4NAW A;  2IPK D;  3QTP A;  3W8Z A;  4ED6 A;  3HJE A;  2Y1I A;  2GQU A;  4FBJ B;  3Q8S B;  4KX6 B;  3Q8F A;  5C1Z A;  2B0C A;  4FE3 A;  5DGA A;  5KFP A;  5CHW A;  2YX8 A;  3AE3 B;  1RM6 B;  5KT6 A;  4UD8 A;  4F71 A;  3I4K A;  5AI5 A;  1YD8 U;  2BPC A;  2K4E A;  2MJ3 A;  3BSM A;  4IOI E;  4KWS A;  1OXJ A;  2E5S A;  2FPM A;  1RYU A;  1N48 A;  1ZQJ A;  1TS5 A;  3PRE A;  2BVG A;  5AIA A;  2VFV A;  1ONF A;  4UB6 U;  1MI0 A;  1WF9 A;  3AE8 B;  3M95 A;  3NZS A;  4L2Y A;  3RJH A;  1FXT B;  2LHD A;  4RF1 A;  2AGP A;  2OZ3 A;  2WOI A;  3Q8L A;  4DFP A;  1YJ1 A;  4W9E A;  4Z6F A;  3AEF B;  5KVH A;  3IHP C;  1WYW B;  3RF9 A;  1D9D A;  2JT4 B;  3D2D A;  2OG9 A;  4BV6 A;  9ICS A;  3IHQ B;  4MEM A;  2WXF A;  2PEA A;  1WCN A;  3LVW A;  4F4Y A;  1V8C A;  2HBM A;  1TK5 A;  4JPS A;  3HUI A;  4J6I A;  3WA0 A;  4XX5 A;  3MGH A;  3NUQ A;  3QU4 A;  3PO4 A;  2KZR A;  2LRU A;  2KKV A;  3KUZ A;  3A0H U;  2CHX A;  5HG2 A;  3P4S B;  3N4E A;  3G6V A;  5KG7 A;  3FIL A;  3ZDT A;  1ZQI A;  9ICM A;  1FNU A;  1NDD A;  1ZQK A;  6ENL A;  3UJS A;  2N9K A;  3NVW B;  2HVI A;  3QNM A;  1MPE A;  5FXE A;  1ZJM A;  3VH4 B;  3KUC B;  1HUO A;  3KZI U;  4GDK B;  4RGO S;  3NAS A;  3UXP A;  3GS2 A;  4M52 A;  2VKQ A;  1DYQ A;  5D3D A;  5TZV A;  2ZIV A;  3UXO A;  2KWU B;  1DK2 A;  1P0R A;  1XO1 A;  1FRD A;  3IC9 A;  8ICN A;  1P7D A;  2INN E;  3T3O A;  3PK7 A;  4RNN A;  4F50 A;  3ISC A;  3PLU A;  1NHS A;  5ALW A;  2PI5 A;  4LA1 A;  1ZMD A;  3ZGZ A;  2BS2 B;  5AHX A;  3ZD9 A;  2RDJ A;  1KOT A;  3LXF A;  3BYT B;  3H4D A;  1Q1O A;  2OO6 A;  1QOF A;  3D6J A;  4IG7 B;  1VD2 A;  3EYZ A;  1YZ6 A;  3AU6 A;  1NOM A;  3TAR A;  3S1C A;  3JPP A;  3DPD A;  1K50 A;  4K2S A;  3L54 A;  3GIJ A;  4P2H A;  1TTN A;  1B9R A;  3RJF A;  4GC6 A;  2IA6 A;  5CEH A;  4ED1 A;  2BKF A;  1XD3 B;  2MA9 B;  3DK8 A;  1OUQ A;  2IMW P;  3GB1 A;  2JWZ A;  2O2V A;  1F9J A;  5ER0 A;  4MGY E;  2Y9U A;  1VQZ A;  4DS5 A;  2L1A A;  2SEB D;  4K7S A;  5BYR A;  3I6E A;  2D3D A;  3ZLH A;  3HK0 A;  4H4S A;  1OEY A;  4TQ0 A;  4H19 A;  2OQY A;  1KLG D;  2EXR A;  3DCG A;  2N7E A;  3QU5 A;  2WGS A;  3BZD B;  2XCA A;  5J0S A;  3MC9 A;  3N1Y C;  3QIJ A;  3DFY A;  3KHR A;  2QJN A;  2JK6 A;  2VA2 A;  4O3S A;  1EBD A;  3KWL A;  5IIJ A;  3ML9 A;  3PR5 B;  3GIL A;  3N3K B;  3S1D A;  3EFC A;  3GE8 C;  3N32 A;  1PQS A;  1KEJ A;  3R0K A;  4RQ2 A;  3GDX A;  3EPI A;  4QWE A;  4TQS A;  7ICK A;  2IY0 B;  1FIQ B;  4FUL A;  1L7P A;  1URJ A;  2KSO A;  2YML A;  3X23 A;  3MZN A;  2D8C A;  3QYP A;  5KFE A;  4ZOH C;  5JU5 A;  4NWI A;  2KN7 A;  1KFY B;  1XLP A;  4RUA A;  1F3P A;  2K25 A;  5AK6 A;  1ESF A;  1T94 A;  2KHW B;  1J2N A;  1Q5W B;  2K6Q A;  1T0S C;  4EEN A;  5D46 A;  2PJH A;  2F8L A;  2GBJ A;  2R8K A;  2JV3 A;  1D8Y A;  2BS4 B;  4YSZ B;  3P3B A;  1GEU A;  2KO3 A;  3ZNI D;  4NL9 C;  2W9C A;  5EE9 A;  3OJ4 B;  4BWJ A;  3CRX A;  2C3D A;  1S8O A;  3HVZ A;  2I6X A;  2MUT A;  1J19 A;  2PLP A;  4I2D A;  4BKG A;  4HLE A;  3RNM A;  3V3X A;  1XO3 A;  3QU7 A;  1V2Y A;  2YY6 A;  2WB1 C;  1XSP A;  3ZW3 A;  2AL2 A;  2PP0 A;  1TZZ A;  2KFZ A;  2FIF A;  2XC9 A;  1BPB A;  1F77 A;  4C8M A;  1TS3 A;  4RM8 A;  1Y56 A;  2OX4 A;  2BR0 A;  3VVW B;  3AM9 A;  3PSE B;  2P0I A;  4AOF A;  3PM9 A;  3N4F A;  3ECI A;  3EUB 3;  2KMD A;  3ZRC A;  2RRD A;  5G55 A;  3AU5 A;  2PE9 A;  1PDY A;  2KLG A;  7ICJ A;  1IYX A;  2P66 A;  3U2S C;  4JWS C;  2DZI A;  4YMN A;  3ZJV A;  1X6J A;  1Q3V A;  2MLB A;  2JH1 A;  3GRS A;  3HW8 A;  3T5K A;  2HNE A;  3F2C A;  5DQI A;  1SJB A;  3OGU A;  3TQ1 A;  4FXC A;  5MPO A;  3C2L A;  1LFD A;  1PVR A;  2FNJ B;  5FR3 A;  2WDW A;  2MBH A;  4RT2 A;  2BCS A;  4MLA A;  4BC9 A;  2J6U A;  3L5K A;  1SE4 A;  1ZK7 A;  4PZN A;  4DDG D;  3JYU A;  1JPD X;  4MH8 A;  2PTY A;  2KZ3 A;  3Q8P B;  3KZX A;  1MQ3 A;  2YMQ A;  4KLU A;  2W54 A;  4KMO B;  4DSF A;  1GUA B;  3ZTD A;  3MR2 A;  2VZK B;  3QJZ A;  1CMX B;  1TE6 A;  2PTZ A;  2C5L C;  3R10 A;  2PE6 B;  2WYQ A;  3IAM 1;  3GII A;  2WXK A;  3T3N A;  2KIV A;  3SD7 A;  1YJI A;  3EAN A;  3TFS A;  3RAX A;  3TAQ A;  4KLJ A;  1NKB A;  2HHQ A;  3T5H A;  4KN7 A;  3PZ8 A;  3UIN B;  4EM4 A;  1ZQM A;  4F4R A;  3PQB A;  3HT3 A;  1TS2 A;  4NM2 A;  2Q5W D;  1DGJ A;  4DXA B;  2IY1 B;  3GQC A;  3Q6B A;  5KG2 A;  2H3I A;  1JWB D;  3FC4 A;  2DHZ A;  2GI9 A;  4URK A;  4ITK A;  3RJ8 A;  4KLD A;  1K1S A;  3OC4 A;  2A8X A;  1OW5 A;  8ICY A;  3NVW A;  4RH6 A;  1T0Q C;  5D79 A;  2IBI B;  4IRK A;  3ML8 A;  4GDK A;  3K1R B;  3BQ7 A;  1C79 A;  2ZPN A;  2JMG A;  1W1S A;  2F5Z A;  2C60 A;  1KLU D;  4CE6 A;  3GOE A;  3VTE A;  5ALS A;  1FFV A;  1KCZ A;  4C7Y A;  4DS4 A;  4H4U A;  3QX1 A;  3T9P A;  3N6H A;  2NCN A;  1V97 A;  1ZY8 A;  4MEX A;  5AKJ A;  2BYF A;  5IOI A;  9ICU A;  3PX0 A;  2K9X A;  4DN1 A;  4DL2 A;  2JRZ A;  5GTI U;  9ICV A;  2KG5 A;  3TAC B;  2QDF A;  2BGW A;  1V38 A;  4DSJ A;  2HMX A;  4M9L A;  4W9J A;  3T8Q A;  1WR1 A;  3PO0 A;  3URY A;  4W9C A;  3Q3J A;  4Y2X A;  4E3C A;  1C7Y A;  3DVN U;  4Y2V A;  1XCQ L;  3QC8 B;  2FDR A;  3VDZ A;  3DBH B;  2UUV A;  3CNH A;  3CYJ A;  5HHD G;  7ICS A;  3TEW A;  4S17 A;  3AE9 B;  3HHM A;  2JZ3 B;  2L05 A;  3ES8 A;  3ZNH B;  3OZY A;  1RWS A;  5CJ7 A;  1UPH A;  3V72 A;  4OJ5 A;  5EE3 A;  4IRC A;  2KT7 A;  1IIP A;  4PWC A;  3NO1 A;  5J0X A;  3FYH A;  4DWF A;  1NBF C;  5FXF A;  2G5I B;  4FJZ A;  3S47 A;  1V5O A;  2M56 B;  2BQU A;  1QIL A;  5K4L A;  3P63 A;  4RMA A;  4J56 A;  4KLO A;  1AQ6 A;  5C0Y A;  1HZ6 A;  4JV0 A;  3KYD D;  3OPS A;  1ZRN A;  2YQU A;  1EXN A;  1ZD3 A;  4RQ3 A;  3RR7 A;  3R9K A;  4JV1 A;  2LVO A;  2FCM A;  3EFU A;  2MCN B;  2KLC A;  3I28 A;  3GZN I;  3A1Q B;  5ALQ A;  5KL1 B;  3BQ1 A;  3BZK A;  3HX0 A;  2ESE A;  3PR4 A;  2M19 A;  2PFP A;  1KN0 A;  2WB1 F;  1N56 A;  2WQY B;  5AWV A;  1FIQ A;  4RM9 A;  4PHD A;  4HKZ E;  2O56 A;  4KKJ A;  5FS8 A;  4M9G A;  3K9P B;  5G5G B;  1LV5 A;  4EQR A;  2H3Z A;  1UBI A;  2KKC A;  1BWC A;  4E4F A;  1M4V A;  3SZ2 A;  2HOF A;  4RQ8 A;  4MFC A;  2KWV B;  5J0Y A;  2F77 X;  1ZW7 A;  2L76 A;  5KFK A;  1DOX A;  5AZH A;  5GTH U;  3TBL D;  4NLZ A;  2XY7 A;  2V1Y A;  4IQT A;  3BQ0 A;  4XDD A;  1EC7 A;  2W9N A;  3M9O B;  1PK3 A;  4ACF A;  1JUD A;  5KFG A;  3GSY A;  1XF5 L;  3QLD A;  4IZG A;  2WDT B;  4RT3 A;  1KKX A;  5D7G A;  4Z17 A;  3BVG A;  3ZDM C;  4I28 A;  4IQW A;  4I6P A;  4F7Z A;  2AU0 A;  5HML A;  1Z4N A;  2KP7 A;  4ZYN A;  2QDE A;  4DBG A;  3PRZ A;  2Z0E B;  3M6Z A;  4F5Q A;  4EEK A;  1SL1 A;  1QCK A;  2KVR A;  4HCN B;  2P3H A;  4GOC A;  1G6J A;  1SV0 A;  5IIL A;  2RHF A;  4BZA A;  3F2D A;  1RQL A;  4ECS A;  1WUF A;  2RAB A;  3JVZ X;  3PMN A;  2ZJ8 A;  5DCN A;  1WUD A;  3P93 A;  2W43 A;  9ICH A;  4XUS A;  4TMA B;  1YJJ A;  2KQS A;  3VUX A;  2VAO A;  1OJT A;  4HPN A;  1UCV A;  4E6M A;  1XXG A;  2AX5 A;  2KVC A;  1DOI A;  2D3C A;  3EGR A;  2W9B B;  3PO5 A;  5JHA A;  3V6H A;  1WWV A;  5AIB A;  3RYT A;  1H38 A;  2HHW A;  2IHM A;  2Y3A A;  1MBB A;  5D49 A;  4US8 A;  2VZK D;  1JW9 D;  3ZQ4 A;  4KX5 A;  2KAJ A;  4GYP A;  3PVL A;  4K7W A;  4RQ5 A;  5AKK A;  4M02 A;  3MC1 A;  2NO4 A;  2AQ0 A;  2F44 A;  4UBC A;  1L6N A;  3MHZ A;  9ICB A;  1DNC A;  2ZZB A;  2BCV A;  4DWI A;  4M9H A;  3MJ5 A;  4II3 B;  5L83 A;  4AJW A;  2IGG A;  4GIV A;  4BC7 A;  4TVY A;  3RRH A;  1SB3 B;  4CGZ A;  4A6Q A;  4HPM B;  3A9J B;  3F2B A;  2F1J A;  5KFQ A;  2LVQ A;  5KHQ A;  3FV9 A;  3PW0 A;  4F5P A;  1JEH A;  3NGD A;  1SZP A;  1GRT A;  5L1I A;  3BK1 A;  5JRT A;  3RCY A;  3QFA A;  2BB6 A;  2C9W B;  3KHL A;  3AUO A;  2G1E A;  3I5J C;  3TUO A;  2PMZ F;  3SQS A;  1BPY A;  2BKE A;  1P3Q U;  5D6J B;  3DK4 A;  1QTM A;  4RQ7 A;  4PYU A;  2PVG C;  3LAE A;  1GB4 A;  2KTQ A;  1H2I A;  1P7F A;  2PU0 A;  3L5O A;  2OJW A;  1XHC A;  3QUT A;  5HHH A;  2FCS A;  2V4L A;  4LNK A;  2GGI A;  1FNV A;  5F9N A;  1FRR A;  2VJ4 A;  1ZMC A;  3IP4 B;  3DHG C;  2Y9T A;  4H4T A;  4KLL A;  4DL3 A;  1F0X A;  1GRF A;  4MF8 A;  3I76 A;  3OAW A;  3RAQ A;  1TKD A;  2G4S A;  2HQM A;  3IRU A;  2HW3 A;  2J0J A;  2LI6 A;  2A4Z A;  2WX0 A;  5HMR A;  2CFY A;  8ICG A;  1W1Q A;  3A7A A;  2MBO A;  3M3J A;  3CW2 C;  4J03 A;  4EZK A;  4BBY A;  2HXT A;  4GIR A;  4MKS A;  2KJR A;  3IM1 A;  3NY5 A;  3C5F A;  1E10 A;  3RR1 A;  2KHV A;  1T8E A;  1KKR A;  3MSY A;  4BUR A;  2LM1 A;  5KFA A;  3D32 A;  4EQS A;  3R2T A;  3ZUN A;  4HNC A;  4EMI A;  3O0F A;  3KTQ A;  2ZZC A;  3RJJ A;  2PMV A;  2OVL A;  2G9H D;  2KMM A;  4ZA0 A;  5FJT A;  1TE2 A;  2ZCC A;  4XGA B;  4F3O A;  4I2G A;  1PYW D;  2ZTE A;  5L1M A;  5KFB A;  1WE6 A;  2MWS B;  4IQU A;  4B6J A;  4GR1 A;  1NKE A;  2W7P A;  1E8F A;  1L4D B;  1N5W A;  2LKY A;  3A1Q A;  4J9O A;  4MEY A;  2N1V A;  3DVG Y;  4LJP B;  4YT0 B;  5D2M B;  1RFK A;  4ZHO A;  1N63 C;  1W1M A;  2PLS A;  4BKS D;  2ES6 A;  5HI1 A;  3WKD A;  5AK3 A;  1DTN A;  1R4N I;  3TAN A;  2EQ6 A;  2HCF A;  3HRD D;  4C8K A;  1LGR A;  4NLB A;  4PVJ A;  5G5G A;  1IUE A;  2XCP A;  4BKS A;  2IDY A;  3MTN B;  4LII A;  4DWD A;  2LHT A;  3M9M B;  2D11 A;  4FLH A;  4C4S A;  4EYI B;  4YL8 A;  3X0W A;  1NJY A;  1EC9 A;  4NY0 A;  4BOS C;  1WGK A;  1FM0 D;  9ICL A;  1Q0W B;  4IT1 A;  5KVI A;  4MMW A;  2L52 A;  1ZQY A;  4YD2 A;  3W1S C;  3SFD B;  3PST A;  2BQR A;  5BYS A;  1S10 A;  1JQ4 A;  2PPG A;  3AE5 B;  1N6Z A;  1PVQ A;  2PI4 A;  3KD3 A;  2N9P C;  4YTN B;  4Y2R A;  2P8C A;  3Q8K A;  4O3N A;  1WY8 A;  4J9N A;  1XLO A;  4I2H A;  3UF8 A;  4OW0 A;  1SGH A;  1YQZ A;  2Y0S F;  3GFK B;  2KJ9 A;  2OXO A;  3ALR A;  1U9L A;  4QW8 A;  4QZ9 A;  1UA1 A;  2PFQ A;  1ZGU B;  2AQ3 B;  3CIR B;  4BAX A;  4TUU A;  2KWD A;  1GRA A;  2PA6 A;  1MFW A;  1GOZ A;  3CGB A;  1HXY D;  1V9P A;  4K1R B;  3FW7 A;  4GGH A;  1XU4 A;  1ZOY B;  2MX2 A;  2RPV A;  3MC8 A;  2JXX A;  2VFU A;  1ZE3 D;  3GV7 B;  5AKI A;  1WJ6 A;  5EOZ A;  1WI0 A;  2ISP A;  2LGI A;  2PW9 A;  2PGE A;  2I1J A;  4I2F A;  1KKO A;  3I1Y A;  3IJI A;  1QKZ A;  2CJO A;  3PWI A;  3EZ5 A;  2RDH A;  4A90 A;  2NRW A;  2W9B A;  4F5N A;  1N60 C;  1ONE A;  1MQ2 A;  4H4P A;  1GO3 F;  1WVE A;  2KN4 A;  5AKZ A;  3IK4 A;  1F44 A;  4DQS A;  5J2F A;  4EUT A;  3H6N A;  1GNU A;  4K4G A;  2KDI A;  3NOB A;  1MN8 A;  3THV A;  4C00 A;  4O3M A;  4DNA A;  1QQR A;  1UT8 A;  4DL6 A;  4J9Q A;  4HCP B;  1X1M A;  2R18 A;  1ELS A;  4UAV A;  2RPQ A;  2ZIU B;  1RRB A;  1I4Q A;  3IAS 1;  3MHS D;  8ICM A;  4YR2 A;  2RDI A;  4Q45 A;  2EZY A;  2QKN A;  4YN4 A;  9ICN A;  3BIN A;  4DL4 A;  2ZG6 A;  2NVK X;  3A9J A;  5T14 A;  2WPC A;  4FBT A;  3KBB A;  3RJK A;  5JXV A;  1P48 A;  3MGV A;  2EMS A;  4GFI A;  4GC7 A;  3QUB A;  3PHX B;  4PZF A;  1L0X B;  3QCA A;  3FW8 A;  5HQX A;  3SAF A;  2X99 A;  4DQR A;  2IGD A;  2RLT A;  3AH7 A;  3L08 A;  3N1X C;  1E90 A;  5H92 C;  4QWA A;  3F5E A;  4B95 A;  4R65 A;  5CRX A;  3W2D A;  4HJK A;  2PKE A;  3UJE A;  2F3N A;  1YEY A;  1KH0 A;  3DBR B;  2DZJ A;  2X8H A;  1NK7 A;  1FCC C;  8ICV A;  4PYZ A;  2LM4 A;  3KJM A;  4RGN A;  2KQ7 A;  1KD0 A;  1GG3 A;  3A7U A;  1XNS A;  1MUC A;  1TYG B;  4EX6 A;  1KN5 A;  2F2A B;  1WM3 A;  1BGX T;  2LZ6 A;  3PPA A;  4EMJ A;  2POD A;  2CKH B;  4H2A A;  1V6E A;  1ZR6 A;  1FHU A;  1Y8R C;  4Q8F A;  4BUG A;  4DQQ A;  1AW7 A;  1WXQ A;  4GLX A;  1XCT L;  1KF6 B;  2Y5C A;  3LB8 C;  2CDU A;  1TK0 A;  5IAA C;  1GJZ A;  1Z3E B;  4BXO B;  1A0P A;  1GAQ B;  2ZIW B;  3GD6 A;  3K1G A;  5AKG A;  2BTE A;  3N97 B;  2P35 A;  2L83 A;  4ECQ A;  5DQG A;  2ODG A;  4HNL A;  1MSW D;  2N0S B;  3MFG A;  4PS3 A;  1E6E B;  4PK1 A;  4O95 A;  2AQ1 B;  4JUZ A;  2R8H A; 
#chains in the Genus database with same CATH homology
 3IT4 B;  1E7P B;  2J42 A;  3GS2 A;  1TY0 A;  1DYQ A;  4IDI A;  5D3D A;  4D2K A;  2FUG 1;  1VRA B;  3I57 A;  4TQ1 A;  4TVW A;  1I4H A;  2PVO D;  1FRD A;  2INN E;  3T3O A;  1TKE A;  1VR9 A;  2FBW B;  3CWI A;  3HRD C;  1L0Y B;  3Q69 A;  4WAF A;  3ZGZ A;  2BS2 B;  1TJE A;  2L32 A;  3LXF A;  1I4G A;  3BYT B;  3TSJ A;  1EU3 A;  1PGA A;  1TY2 A;  4EC3 A;  1IBX A;  1QOF A;  4ZYS A;  4ARI A;  1YMH E;  3S1C A;  1FXI A;  1K50 A;  2OHF A;  2V3N A;  1MBT A;  3WCQ A;  2X38 A;  1AN8 A;  5LNK 1;  1B9R A;  2NTS A;  2QJL A;  1GB1 A;  4HKQ A;  3GB1 A;  1T3Q C;  2K3U A;  2WS3 B;  3P4P B;  1VQZ A;  2SEB D;  2L1A A;  4XWT A;  5BYR A;  1VZ8 A;  1E0Z A;  1DIQ A;  4YWG G;  4TQ0 A;  1K52 A;  1WYG A;  1KLG D;  3E9S A;  2EXR A;  1R7S A;  2IGH A;  2WXM A;  5FXD A;  1PFD A;  3BZD B;  3NRZ B;  2JYT A;  3FW9 A;  1AWD A;  2Y3R A;  1XEE A;  3V05 A;  3W8X A;  3KWL A;  5FK9 C;  3Q8E A;  4AS1 A;  2WXQ A;  3S1D A;  2BBC A;  4L23 A;  4YTM B;  1T3Q A;  4OZC A;  1ENF A;  1L0V B;  3TEX A;  3JS8 A;  2K0P A;  5AE2 A;  2J52 A;  1FIQ B;  3RJA A;  4PT5 A;  1NVI D;  4WWM A;  3NZ3 A;  1J7A A;  4ZOH C;  1QT9 A;  1KFY B;  1XLP A;  1ZDV A;  2MEK A;  2ON8 A;  3NVY A;  3KWV A;  3W9C B;  1ESF A;  2WXP A;  1ZXI A;  2ICI A;  4JB1 A;  2E6X A;  4PWB A;  2BS4 B;  4YSZ B;  3O13 A;  5BMI A;  1PUT A;  3N9Y C;  2MBR A;  2P4P A;  1W1O A;  2UUU A;  2W3S A;  1EU4 A;  1FO4 A;  1D5M C;  1NYR A;  5EE9 A;  3NVZ B;  1SB3 C;  2E5A A;  4YXD B;  3NVV A;  1SEB D;  3HVZ A;  3TX1 A;  2PLP A;  2JQR B;  3V3X A;  3B2F A;  3B9J B;  1XO3 A;  3R8B A;  4GDL B;  1L6V A;  1TS3 A;  1F77 A;  1Y56 A;  3ZJU A;  3AM9 A;  1YQ4 B;  3PM9 A;  2LJI A;  3AE1 B;  3AEE B;  3EUB 3;  3SR6 A;  3BVZ A;  3SEB A;  2I0K A;  1MHX A;  2WU2 B;  1RYJ A;  4USA A;  5TSS A;  2WP9 B;  3AEA B;  1K53 A;  2PTL A;  3U2S C;  4JWS C;  3EUB 2;  5BMH A;  3ZJV A;  4J3O D;  1JRO A;  1T5X D;  1CK1 A;  3ETR A;  2I38 A;  3Q8C A;  4RNA A;  5BYQ A;  2ZW0 A;  4FXC A;  2WXL A;  3J9C A;  4XE0 A;  5BMG A;  1C4C A;  3BII D;  4DQO C;  5MPO A;  1UWX A;  1QLT A;  3C0P A;  4BCA A;  1JAL A;  3NS1 A;  4WUR A;  5FR3 A;  2LUM A;  2WDW A;  2KAC A;  4MLA A;  4BC9 A;  1JWU D;  1SE4 A;  2DWQ A;  2ZW1 A;  4MH8 A;  1WSP A;  5L6F A;  2GRI A;  2YVS A;  2W54 A;  1FNW A;  1QLU A;  2VZK B;  4HRO A;  3A7R A;  2PIA A;  3IAM 1;  3PZ7 A;  3S1F A;  2WXK A;  3T3N A;  2M0A A;  1YJI A;  2HTM E;  1CZP A;  3PZ8 A;  1QOG A;  2Y3S A;  1UWM A;  1STE A;  1V1P B;  1C77 A;  2O3G A;  3PQB A;  1TS2 A;  5HHZ A;  1CQV A;  2KQ4 X;  2Q5W D;  2SAK A;  3U7Z A;  1DGJ A;  1JWB D;  1W1J A;  3FC4 A;  2DBY A;  2GI9 A;  4ITK A;  3RJ8 A;  1BUI C;  1D5X C;  3AE7 B;  1VJK A;  3NVW A;  4RH6 A;  2JU6 X;  5D79 A;  2LMC A;  2BVH A;  1BXT A;  1C79 A;  2V0G A;  1W1S A;  1TS4 A;  1KLU D;  1Q10 A;  3VTE A;  2WXH A;  5C2T B;  1VZ7 A;  1FFV A;  4C7Y A;  2JWU A;  1V97 A;  1NYQ A;  3BW7 A;  2K9X A;  3POP A;  1SSN A;  4PYT A;  4UDU C;  3URY A;  3PO0 A;  5EE1 A;  1AYF A;  4ZRP A;  1XCQ L;  5AE1 A;  2UUV A;  4JAY A;  1CJE A;  2WLB A;  3P42 A;  1EWC A;  1P7E A;  5HHD G;  2RK5 A;  3TEW A;  3TSS A;  3AE9 B;  4JWU C;  4ARC A;  2JSV X;  2LHE A;  1RWS A;  1JML A;  1J7C A;  3IXS A;  5EE3 A;  3LLB A;  4PWC A;  5FXF A;  3W8W A;  2BW2 A;  2M56 B;  5GXG B;  1QIL A;  3P63 A;  1HZ6 A;  4HG0 A;  1I7H A;  3NRZ A;  1HA5 A;  2QPM A;  4WH4 A;  3OWE B;  5FKA C;  4IKG A;  2BVF A;  4HEA 1;  4DNS A;  4RCO A;  1C4A A;  1PGX A;  2M19 A;  1VAO A;  1ZXI C;  2LEK A;  5AWV A;  2WQY B;  2B76 B;  1FIQ A;  4HKZ E;  2VFS A;  4KKJ A;  3BYY B;  5G5G B;  3VR8 B;  1HZ5 A;  1QOA A;  3U52 E;  1QF6 A;  1M4V A;  2WDV B;  4NAM A;  1XLQ A;  2FE8 A;  1N63 A;  1TKY A;  3AN1 A;  4C80 A;  3TSH A;  2H88 B;  3Q8A A;  1DOX A;  2PLS A;  2LFI A;  3HSU A;  3NVZ A;  1JWM D;  1XLN A;  4XDD A;  4YSY B;  4YTP B;  4TSS A;  1DOY A;  3GSY A;  3P4R B;  1SXT A;  1XF5 L;  1C9F A;  3B9J A;  2WXI A;  4A55 A;  1HEZ E;  5AUI A;  5D7G A;  1SJE D;  3KLS X;  4B0E A;  4DXG A;  4WQM A;  3BVG A;  3TEY A;  4OZB A;  1RM6 C;  2OAI A;  4OAL A;  1V1O A;  3DWG C;  2AXR A;  1YQ3 B;  1SJH D;  3W1S A;  1C4P A;  4Q2J A;  4P16 A;  2NMQ A;  1YN4 A;  2JZP A;  3VQI A;  2GQT A;  3FWA A;  3B2G A;  3Q8B A;  5H8Y E;  1F0Z A;  4XLO A;  2R61 A;  3VRA B;  2N7J A;  2XNA C;  5AUK A;  1FFU A;  1N5X A;  1IGC A;  1JWA D;  5E6J A;  4TMA B;  3D2J A;  1YJJ A;  2VAO A;  4RFB A;  1XXG A;  2AX5 A;  4N58 A;  1DOI A;  3EGR A;  4DXF A;  1HQR D;  1ZP0 B;  3L4P A;  2ONQ A;  1OQQ A;  1ZPS A;  4EE2 A;  3MC0 B;  1YN5 A;  2WXJ A;  1YN3 A;  2KDM A;  2Y3A A;  4US8 A;  2PKO A;  2VZK D;  3TEZ A;  1MBB A;  4ZOH B;  4PVE A;  1JW9 D;  3ZQ4 A;  2NQW A;  4CQN A;  2P3H A;  2KAJ A;  1UNS A;  1PDX A;  3KQ4 A;  3SFE B;  1N60 A;  3MHZ A;  3HVD A;  1C78 A;  4NAW B;  1SF0 A;  1ET9 A;  2WDQ B;  3MJ5 A;  4C56 C;  1N62 A;  4BC7 A;  2IGG A;  3R07 C;  4TVY A;  1WWT A;  1SB3 B;  5G5H B;  4A6Q A;  1HSK A;  1V1P A;  2JYE A;  4L1B A;  2R8D A;  3DWM A;  1SE3 A;  4XWW A;  1FFV C;  3BK1 A;  2NTT A;  4AQ7 A;  2QIE B;  1FD6 A;  2BB6 A;  3S1E A;  5I1W A;  3TUO A;  2G1E A;  3W5V B;  2V4I B;  1VLB A;  1NEN B;  2RMM A;  2PVG C;  3LAE A;  3AEC B;  1GB4 A;  4M0W A;  1K51 A;  2DYM A;  3NUH B;  1P7F A;  1D5Z C;  5T8I A;  2J53 A;  4MM3 B;  4NJC A;  2XN9 C;  3AV8 A;  1FNV A;  4OHJ A;  4PVH A;  3AEG B;  2YEP F;  3AEB B;  2Y08 A;  1FRR A;  1FMA D;  2CU3 A;  4US9 A;  3E56 A;  1X2H A;  5ADZ A;  1WRI A;  3GP7 A;  1E8G A;  1F0X A;  3FAH A;  1ZUD 2;  1E0Y A;  2HDE A;  2BYT A;  4N6E B;  5FXP A;  3AMZ A;  2OED A;  5HMR A;  4MT5 A;  2WXO A;  1W1Q A;  2K22 A;  3A7A A;  1I4X A;  1DZN A;  2INP E;  4LTU A;  1KTK A;  3RPF C;  2Q4W A;  4BBY A;  1TKG A;  4N59 A;  5HFY A;  1JWS D;  4A9A A;  3MP9 A;  2R2Z A;  2CJN A;  2N9L A;  4XDC A;  1E10 A;  1SE2 A;  4ZHP A;  1NI3 A;  3R2T A;  3H8H A;  3U4E G;  3FIL B;  3C8Y A;  1N61 A;  4LLG M;  1E9M A;  1LO5 D;  2PMV A;  1VDV A;  2D5G A;  2G9H D;  2KMM A;  4ZRQ A;  3VRB B;  4PVK A;  2GB1 A;  2I2Y A;  5I4D A;  4O1N A;  3D2H A;  1PYW D;  3R2I A;  4RGM A;  2K5P A;  1D6E C;  1AHU A;  3DED A;  1T6B X;  4LK0 M;  1TZO A;  1D4B A;  1NEK B;  2EKI A;  4OVZ A;  2J4X A;  1E8F A;  2BT6 A;  1N5W A;  1JRP A;  1FEH A;  1L4D B;  2Y5P A;  3IT6 B;  2JX5 A;  2MJD A;  1RFK A;  4YT0 B;  4ZHO A;  3AE2 B;  1N63 C;  1UXY A;  1W1M A;  1L4Z B;  4R3D A;  3RFZ B;  2PLI A;  4HRS A;  5HI1 A;  5C3J B;  3EA6 A;  2IPI A;  1SBB B;  1F2R I;  1IBX B;  3DQ0 A;  3HRD D;  1QOB A;  2DYO A;  4PVJ A;  5G5G A;  1IUE A;  4B0M A;  2Z8L A;  2IDY A;  3P1M A;  2DLB A;  1VZ6 A;  2E3T A;  1E8H A;  4A8X C;  1PGB A;  3AE6 B;  2W82 A;  1YNT E;  3AED B;  1WGK A;  1FM0 D;  1ET6 A;  4OZA A;  3W5U B;  1OQR A;  1MVK A;  2QEJ C;  2L52 A;  2V3P A;  3SFD B;  1JCK B;  4ML8 A;  1I4R A;  1B1Z A;  5BYS A;  1FXA A;  2WXN A;  1JQ4 A;  3AE5 B;  3I9V 1;  1L6U A;  1AHZ A;  4YTN B;  1BML C;  1AHV A;  2TSS A;  1XLO A;  3BVM A;  2RDG A;  1FFU C;  4OW0 A;  2Q85 A;  2Y4G A;  2AQ3 B;  2YEP B;  4HJG E;  3CIR B;  2KWD A;  1IGD A;  1FCL A;  1GOZ A;  1HXY D;  1OFF A;  3FW7 A;  4C7Z A;  1W1L A;  3UI3 A;  1ZOY B;  1X2G A;  2RPV A;  3AB5 A;  2VFU A;  1QLB B;  1ZE3 D;  2WXG A;  4P6V F;  1ZXH A;  3NVY B;  2PW9 A;  2LGI A;  4RF0 A;  4REZ A;  2QSD A;  1QKZ A;  2CJO A;  2RDH A;  3BK2 A;  4A90 A;  1N60 C;  2IJ0 A;  4RGT A;  1EWY C;  3LYY A;  1WVE A;  2KN4 A;  1N62 C;  2WU5 B;  3BWU D;  2EEL A;  2WXR A;  3VR9 B;  5AE3 A;  3NVV B;  2VFT A;  2BB5 A;  1QQR A;  2BS3 B;  2WNM A;  4MAC A;  4KGT A;  4JE3 B;  1UUP A;  1EM7 A;  1UGJ A;  4KKI A;  2MH7 A;  5L6G A;  2IPK D;  1I4Q A;  3IAS 1;  2QKN A;  1J7B A;  1W1K A;  3W8Z A;  2GQU A;  5G5H A;  4KX6 B;  3SR6 B;  3Q8F A;  1GPX A;  5JXV A;  2AQ2 B;  1SIJ A;  5EE0 A;  2JXT A;  5K8E A;  3AE3 B;  2ACZ B;  1RM6 B;  4PZF A;  1L0X B;  4UD8 A;  3FW8 A;  5HQX A;  1A70 A;  1DII A;  2IGD A;  4YSX B;  3I99 A;  2MJ3 A;  3AH7 A;  4IOI E;  3AE4 B;  5H92 C;  1TS5 A;  2BVG A;  2VFV A;  3ETR B;  3W2D A;  1MI0 A;  3AE8 B;  4L2Y A;  4RF1 A;  2VFR A;  2LHD A;  2QIL A;  1KH0 A;  1I4P A;  3NS1 B;  2W3R A;  1FCC C;  1WVF A;  3AEF B;  3KJM A;  4RGN A;  3ZJT A;  4WIP A;  4GLS C;  3A7U A;  3D2D A;  3ABV B;  1TYG B;  2H89 B;  1MHH E;  1I19 A;  1N61 C;  2WXF A;  4H2A A;  2QMT A;  1ZR6 A;  1V8C A;  4JPS A;  3HUI A;  1AW7 A;  1WXQ A;  3P4Q B;  1XCT L;  1KF6 B;  5I1V A;  2Y5C A;  3LB8 C;  1F2R C;  5HG2 A;  3P4S B;  1GAQ B;  1KRH A;  5D3I B;  1W1R A;  1ZDX A;  2BTE A;  4NZL B;  2W55 A;  1ACC A;  1L5P A;  1C76 A;  2L83 A;  1FNU A;  3FIL A;  4JX1 C;  3ZYY X;  1N5W C;  2MJE A;  2N9K A;  2N0S B;  3MFG A;  4KGS A;  3NVW B;  1MPE A;  5FXE A;  1E6E B;  2P13 A;  4KGR A;  4O95 A;  2AQ1 B;  1ROE A;  4GDK B;  2WDR B;  4RGO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...