1JROA

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 129
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jroA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jroA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1jroA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jroA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jroA04
4PVHA 3AM9A 1FO4A 4TVWA 4PVJA 5EE9A 3P4SB 4PYTA 1FRRA 1FXAA 1WXQA 3NS1B 3W9CB 3VTEA 3D2JA 4PZFA 3DQ0A 3L4PA 1ZUD2 1DIQA 3HUIA 2AX5A 4A9AA 1WVEA 2BVHA 5G5GB 3NVWA 1L6VA 3W5UB 3AV8A 3AB5A 4TVYA 1UWMA 2QJLA 3A7RA 2I0KA 2AXRA 1W1RA 1E10A 1YJIA 4XLOA 2VFTA 2OAIA 1DOIA 1FXIA 1V8CA 2E5AA 2OHFA 1CZPA 3CIRB 1NENB 5AE3A 3LB8C 4YTPB 4C7YA 1NYQA 2E3TA 3D2HA 3CWIA 1OQRA 1AHZA 3W8WA 1I7HA 3DWGC 1VJKA 1DIIA 2BT6A 3NVYB 2WU5B 2EKIA 1R7SA 1DOXA 4YSXB 3AN1A 4JWUC 1SIJA 4ITKA 5AE2A 2WDVB 1RM6B 3FWAA 1ZP0B 1F0ZA 4O95A 3FW7A 4YT0B 1E8GA 3DEDA 2NQWA 4YXDB 1WRIA 1QLBB 1FFVA 2R2ZA 5FXPA 2PLSA 2ACZB 2W55A 3AEGB 4ML8A 3S1FA 2YVSA 1WWTA 1YQ4B 3RPFC 1EWYC 4JB1A 2P13A 1TKYA 2P4PA 4PVKA 1E6EB 4ZOHB 3SR6B 1AHUA 2EXRA 1W1KA 4BC9A 3ETRA 1QOBA 4BC7A 4USAA 3W5VB 2HTME 1N62C 4KX6B 4WQMA 3NVZA 2LEKA 5AE1A 2Q85A 1OQQA 1N5WA 2FBWB 1T3QC 1UXYA 3TSHA 1FMAD 3BW7A 1PUTA 2DBYA 1NYRA 1RYJA 1QOFA 3AE3B 2Q5WD 3P4RB 1NI3A 2G1EA 2N0SB 1W1MA 1J7AA 1JROA 2K9XA 4HROA 1WVFA 3NVZB 3AMZA 2WDQB 1FFUA 2BS2B 1E8HA 3A7AA 4JWSC 1N60A 1JWBD 3JS8A 1F0XA 1JALA 2BVGA 5AUKA 2PVGC 4JX1C 1N61A 1B9RA 3LXFA 1XO3A 5FXDA 1CJEA 2MBRA 4LTUA 3SFEB 1N62A 1AYFA 1QLTA 1FM0D 1W1JA 2K22A 3NVVA 3ZYYX 4YTNB 1XLQA 3NVWB 4OALA 2K5PA 3B2GA 3ABVB 1W1SA 1VLBA 1FIQA 2MJ3A 3NVVB 4IDIA 3VRAB 2M56B 2Q4WA 5G5HA 5GXGB 3AEEB 2BS4B 1YQ3B 2GQUA 4DNSA 1FIQB 3W8XA 3AEFB 2KMMA 1GPXA 2MJEA 3P4QB 2GQTA 3NRZA 2VFRA 2JQRB 1E8FA 4JAYA 3AEBB 1OFFA 1W1QA 5MPOA 5C3JB 3AE5B 3GSYA 3B9JA 1QT9A 3LAEA 2WP9B 3HRDC 2CU3A 3AE4B 1TKEA 1AWDA 4BBYA 4YSYB 3TX1A 2KAJA 2H88B 3PO0A 1N63C 4ZHOA 3EUB2 2CJNA 1I19A 2L52A 2WLBA 3AE8B 4N6EB 4P6VF 2P3HA 2QKNA 3AE9B 3HRDD 3AEDB 2JX5A 1JW9D 1QOAA 2Y5CA 1ROEA 3AECB 2R8DA 3ETRB 1XLNA 1XLOA 1SB3B 1V97A 5HQXA 4PVEA 1PFDA 3VR8B 4US8A 1SF0A 3NS1A 5FXEA 1TKGA 4PWBA 1HSKA 1KF6B 2WQYB 4YTMB 3A7UA 5G5GA 1GAQB 1E0YA 2WU2B 2VFUA 1PDXA 1KRHA 5EE0A 1MBBA 2PIAA 1ZXIC 3C0PA 4WWMA 2WS3B 1DOYA 1RM6C 2BVFA 1JRPA 1T3QA 2O3GA 5HHZA 1QOGA 5EE3A 5C2TB 3KWLA 3BIID 3VRBB 1JQ4A 1N5XA 5ADZA 3DWMA 1NVID 1XLPA 3S1EA 3FW9A 4N59A 1X2HA 5HMRA 2B76B 3R07C 5D79A 1DGJA 3HVZA 2W3RA 1W1OA 2VFVA 5FXFA 2M19A 2W54A 2QIEB 3KJMA 1E7PB 3AH7A 4MLAA 1WYGA 3D2DA 3NVYA 1FFVC 4PWCA 3TSJA 1AHVA 2VFSA 4ZOHC 2MJDA 3AE6B 3S1CA 3I99A 4US9A 3VR9B 1ZXIA 4FXCA 2PKOA 1W1LA 5G5HB 3AEAB 3WCQA 4UD8A 2H89B 1IUEA 2W3SA 4HRSA 1YJJA 1DZNA 1VQZA 3NRZB 3AE2B 1VAOA 1SB3C 3FW8A 3EUB3 1J7BA 1N5WC 1QF6A 2WDRB 3P63A 1L0VB 2PLIA 2DWQA 3P4PB 1RWSA 3S1DA 3B9JB 2PVOD 2BS3B 1J7CA 5H92C 4YSZB 1NEKB 1E0ZA 3W8ZA 3PM9A 1E9MA 1JWAD 3SR6A 1L5PA 1FFUC 5AUIA 2CJOA 1FRDA 2RK5A 1ZR6A 3AE1B 4C7ZA 1N60C 1VDVA 5EE1A 2QPMA 2VAOA 3B2FA 1KFYB 3AE7B 1TJEA 4N58A 3SFDB 1QLUA 1A70A 1MBTA 1N61C 3P1MA 1RFKA 4EC3A 2L83A 4C80A 4ZHPA 4BCAA 2MH7A 1WGKA 3FAHA 1L6UA 4HG0A 3LLBA 1TYGB 1ZOYB 3FC4A 1X2GA 5H8YE 1N63A
chains in the Genus database with same CATH superfamily
4HEA1 1HJPA 1TK0A 1ZQLA 1S1QB 3IK4A 4PH5A 1LV5A 4O3SA 3WK4A 3Q8CA 2R8GA 2JMGA 4ACFA 2XO7A 4EKUA 5D4BA 4PYTA 1SJCA 1P7DA 4RQ5A 5EU9A 2RHFA 4I2AA 4HDQA 2O56A 2RRDA 2I1KA 1KLNA 4R66A 2CXYA 3D2JA 3SAHA 3H4DA 2MU2A 2B21A 4ECVA 4MH8A 1X66A 5T8IA 3C2MA 1ZUD2 2XH0A 3RF9A 2M8SA 4RH6A 5JXVA 5KFDA 1C4CA 3ZLHA 3PFRA 3PW4A 3CMMB 4WURA 2Z0DB 2IO0B 2E6XA 4UDUC 3EFCA 5B5EU 1ZX9A 3C2LA 2BYTA 5DGAA 2JEIA 4HPMB 2AXRA 1W1RA 3O13A 2KEYA 1ZQJA 1MN8A 3U7ZA 2HJ8A 4XLOA 2IZVB 1D9FA 1HTOA 4I27A 3QU4A 2YN4A 5KFLA 2HD5B 3QAQA 4FA6A 2YVJA 4M9NA 2KFKB 4YWOA 3N30A 3PV8A 2KX0A 2I6XA 3NY5A 3BZKA 4S17A 3N6JA 2G5HB 3FKYA 1FXIA 3L13A 1V59A 3KHRA 4F71A 3PSEB 5KFRA 3ZJTA 1KOTA 2WGSA 2WXGA 3Q8BA 2OHFA 2ASJA 2FE8A 1E8WA 2K4HA 3LB8C 2KFZA 2EZXA 4F5OA 2Z59B 4YTPB 2OQHA 4GXIA 5KFQA 1TFRA 2E3TA 2W9NA 1EM7A 2FNJB 2KK8A 3VTVA 3D2HA 3CYJA 2BQRA 5KFBA 1OQRA 4KN7A 2V3PA 2YY6A 4FO6A 4PGXA 2UVUA 1C9FA 2JYEA 4PS3A 3W8WA 1SL0A 4ZYNA 4YXMA 4H4VA 5AM5A 5J2CA 2L7RA 2DW6A 3BJSA 2R8HA 2V4LA 1FNWA 1ZDLA 1RYRA 1NHRA 1GO3F 2EH9A 1DOXA 2W0HA 2W82A 5JCKA 3SAFA 1LKYA 1COKA 1RRBA 4RUAA 2H3IA 1WXAA 2GBJA 2RD0A 3BVMA 3HHMA 1PDYA 4KX5A 2PI4A 1ZQPA 5AE2A 5ALEA 5IIMA 1Q10A 2WDVB 3ZDAA 3IJLA 5ALZA 1YD8U 2C7HA 4H4QA 1RM6B 3WK7A 2VA2A 1SSNA 2MBQA 3UPQA 2HI0A 2LFIA 3CGDA 2K8AA 1FNVA 1UF0A 5LXIB 2EQYA 3DH9A 3WKCA 4H4YA 3J9CA 3DEDA 1K1SA 1HA5A 1BNPA 7ICRA 4O5KA 3GO2A 2XK5A 5HMLA 2WF6A 1X2IA 4MM3A 2W43A 3QQ8B 4E3CA 4YXDB 5L6GA 2HBJA 4Q44A 2WXKA 4QZ9A 3VH4B 5FXPA 2JK6A 1MDLA 5DB6A 3PRZA 3U9IA 2KE7A 5J0SA 3H4BA 3V5CA 4F4KA 2F8KA 1TIFA 2LHEA 9ICCA 3DG6A 1BT0A 4LNOA 3MABA 4F91B 5D3IB 3ZXVA 4ANUA 2QQ6A 5U1OA 5JCMA 1AOGA 4GGQA 1YQ4B 3PO4A 4W9EA 3RPFC 3UXLA 3UINB 3QN3A 3PO5A 3CSFA 5ALLA 4R63A 1TKYA 3WK5A 1WMHA 3R11A 1K8RB 2OXOA 2ZIXA 4DWFA 4ZOHB 3SR6B 3RB0A 3ETRA 3MDAA 4KWSA 1D5MC 1S9FA 4BC7A 4CNQA 3Q8LA 4H2HA 3W5VB 4K1WA 5LLIA 3LYSA 3DK4A 2HTME 1I4QA 3WIMA 1UPHA 3UXNA 4MEXA 5AK4A 2DENB 3NVZA 4LZDA 4C4RA 2LEKA 2Q85A 5AE1A 3PVLA 3PVXA 3APDA 5E6PA 5IIKA 2JSVX 3L8KA 1H8CA 3X23A 3AXCA 1XSPA 1PUTA 1BWCA 1OJTA 1NYRA 3ES8A 1QOFA 2KKPA 4FBTA 4FBJB 4IQUA 4DNAA 2G1EA 3ZD8A 4J9RA 4NNJB 3UQBA 3IHQB 1PGBA 4PS8A 2P88A 4IR9A 1IPGA 1J7AA 1JROA 3TCSA 4HROA 3S6JA 2HMXA 3MSYA 1B0XA 4K7WA 4K4HA 5HR7A 3ZLZA 3EW9A 4QWCA 2EELA 2PPGA 4E4UA 2NRXA 4DFDA 3PLVA 3UXPA 1ZDVA 2IOFK 3MFGA 4EMWA 4NJ8A 3OLMD 4W9DA 4AJWA 3EGRA 4DHJD 1ZRNA 3WALA 3DGZA 2XCAA 1OTRB 4P0QA 3WKBA 2PE9A 2UU7A 4RMAA 3Q3FA 3DV9A 1WR1A 4BZAA 5C1ZA 5F3XB 5ALWA 1Q0WB 1AQ6A 1Y56A 2PVGC 3KWVA 4PS7A 2NPXA 1KEJA 3CXBA 4ENLA 4KLJA 3TCAA 1FCLA 1Z1VA 2L0TA 1N61A 5LNK1 3CYMA 5HMMA 2IYDB 8ICMA 2IBKA 2IY0B 3ZRFA 5DB7A 8ICHA 1KLUD 5DG8A 3N1ZC 1RVKA 2OO6A 1CJEA 2KXJA 2MBRA 1D7YA 4EBEA 1ZW7A 4HAIA 4WAAA 2WP5A 1FM0D 5AI0A 5BYQA 4AQ7A 3NVVA 1VJ5A 4YTNB 1Z19A 1XLQA 5KHOA 2W9AA 3F5EA 3ZYYX 2PU1A 4NLKA 2LGDA 2K5PA 3NTUA 1ZQYA 2MRLA 2OG9A 3U4EG 3DBLI 4IC9A 4LNKA 1IIPA 4XDCA 8ICKA 4NPNA 4TQ0A 1J2NA 4PHDA 3POPA 1KBUA 1FCCC 2A5UA 5ALMA 2K0PA 3ZXRA 3MY9A 1WWUA 3DHIC 3TANA 3H8WA 2YLMA 1Y8RC 2ZIWB 5AKIA 1YMHE 2MBBB 3W2DA 4PL1A 5KFKA 2NO5A 9ICWA 1I4XA 2MA9B 1LXDA 5BMHA 4A6GA 4KZ0A 2ZG6A 3QWZB 4YD2A 3R9KA 4J1OA 5KT5A 4E4FA 2CN1A 4M2YA 4UB2A 4KKJA 2YQUA 3ICXA 4JWMA 3T5KA 9ICAA 4IQTA 3PY8A 4RQ7A 3HX0A 3KKAA 4XZ4A 2NQLA 4Q8FA 4IL6U 1LFDA 4KPRA 9ICPA 3KQ4A 3UQAA 5KFNA 2RMMA 5J2BA 3P4QB 2R8JA 2VANA 4KZCA 3TADC 1Q1WA 2F3NA 3NRZA 4F8CB 1K52A 1TZ1A 2D3BA 2WBAA 1NHSA 2JQRB 2QB1A 5DG9A 1QZEA 3B08A 1FEHA 3JSVA 4JAYA 1NK7A 4ZRJA 1GSNA 1TKKA 2OZTA 2ZNVB 1Z00A 2DZKA 3GD3A 3LK9A 4EFOA 1OFFA 4DSJA 4M6WA 3M62B 4U7CA 3SEBA 3UJRA 1EF1A 2PW9A 1KCZA 4FS1A 2I5HA 4M8NA 3JW7A 1R4NB 1WE6A 2PODA 3RR7A 4IRDA 3MTNB 4KGTA 2LVOA 2KNJA 4XGAB 1GRGA 2ODGA 2PP3A 3ALRA 2P8CA 4W9GA 2CU3A 2C7NB 4RUCA 4TV3A 4IP4A 4EZLA 4JIOU 1ZQZA 4ED0A 4DFJA 4BBYA 1HXYD 3GOEA 2YB1A 3SDLC 3TX1A 3PW7A 3EANA 2KAJA 4LA1A 1MFWA 2BYFA 4TUSA 2WDTB 3Q69A 2BPSA 1WFYA 3ZD9A 1Z1BA 4ELVA 4F2RA 4ACOA 4TUUA 3T8QA 5ALIA 2XGPA 3ZVIA 2IOFA 2DFLA 4YXJA 1I19A 5DPWA 2OFJA 2L52A 3OHBA 9ICGA 4HCNB 1KD0A 1KRPA 2CPRA 2WLBA 3AE8B 2MUCA 4UAUA 4BXOB 3BYYB 4NEVA 4NQLB 3RCYA 4BWJA 3N7RC 5AHXA 1ZDXA 3HRDD 3IJQA 3ZLGA 4H83A 2WNMA 1L7NA 1JW9D 3R2IA 3UJSA 5ALXA 2MEKA 4BKSD 8ICAA 2IGGA 3WAMA 2BCPA 4LZGA 3DK8A 2E5SA 2EAMA 1PGAA 2EZYA 1XSNA 4LCDE 4RM9A 1UT5A 1X9MA 3Q8PB 4IWQA 2ZZ0A 2R8DA 4C0ZA 1D5ZC 2ALZA 4IM0A 4B6JA 2GDQA 3L10B 1XLOA 1F5SA 2AL1A 1ZXHA 3OW1A 1U4BA 1U9LA 2H3VA 8ICQA 2WXHA 4L2YA 5I4DA 3C8YA 5J0PA 2HHVA 2JXTA 2AEHA 5D7GA 4TQSA 1VZ7A 2ZTEA 2NTSA 1J0GA 3DGHA 3NS1A 1NKCA 2UVVA 3DVGX 2GL5A 4ECRA 1X1MA 3QNMA 4DL6A 5FS7A 5D46A 4ASWC 3N28A 4RQ4A 4QJFB 4YN4A 2Y1JA 4JK1A 1RLFA 4DFMA 1XD3B 4O5CA 3GV8B 2D6FC 1NNLA 5KG5A 4LJXA 4LVSA 3LDZE 4YTMB 1JI7A 4KLFA 2HDOA 4YD1A 2KJ8A 1MG8A 4CF3A 4QWEA 4W9JA 2W8KA 3VC5A 4BOSC 4ZRIA 1E0YA 2WU2B 4MEMA 2KSOB 1WM3A 4JPSA 4II2B 1V5OA 1KRHA 1ZQQA 1V81A 4GIVA 5IA7A 2OJRA 2ZCCA 1ZMCA 3NZSA 4HLEA 1SJHD 2C2RA 5AKLA 4WWMA 3Q3JA 3WANA 3VCBA 5ALVA 2OX4A 2PP1A 3U8ZA 3R0KA 2NRWA 2GWSA 1JWSD 4FE3A 4UARA 1TV9A 3OTQA 1SL2A 4I2FA 2HHQA 5EE3A 3M9OB 1QSYA 2VIXA 3PHWB 2J6SA 1I35A 1SEBD 3VRBB 1N5XA 2YMMA 3IN5A 5IDZA 9ICHA 3N1XC 2K4EA 3CGEA 3V6KA 3QEBZ 3FW9A 2Q0ZX 4WAFA 2AL2A 2QHOA 4F7ZA 2JYTA 2KC2A 4A20A 5AKHA 2QDDA 3Q14C 2BVCA 2N4FA 3R07C 1DGJA 4IT1A 4K2SA 1JOAA 2B3AA 3L16A 4M8MA 1IBXA 2W11A 2Y9TA 4MSMB 1W1OA 3AU4A 2JV3A 2P35A 5FXFA 3VA8A 2GQWA 2O6VB 4B9KA 2M19A 2JGAA 2HDEA 4EWJA 3C5GA 1EC8A 2W54A 4RF1A 3V5FA 4ZRKA 2LBOA 4G0NB 1XEEA 4EZJA 3H8SA 1COOA 1H2IA 4FJYA 4N9F4 2JXXA 1CEZA 3HWTA 3H70A 1GC6A 1WXSA 2VH2A 4NAWA 4NJ6A 4FZLA 3NVYA 1FFVC 2V3AA 3MUCA 2BPFA 4ZRQA 5J2JA 1JPDX 1TK8A 2LUMA 1Q3UA 1AHVA 2KDIA 1DK3A 3KHGA 3ZNHB 3KH0A 2LRWA 5JCLA 1VD2A 4R8UA 2ZPYA 1SV0C 2OLAA 2XGZA 2PKEA 1NKEA 4FXCA 4EQSA 2GH1A 5G5HB 5HNKA 2LGSA 1KTQA 3RN9C 3VXWA 4JUZA 4G3IA 3DHGC 4KDLB 3A9JA 3RTVA 3W1SA 3MR3A 2H89B 4DS5A 3URHA 3PWIA 2DKZA 1WSPA 4M9HA 5JU5A 3I9V1 2WOVA 4LIIA 3R3MA 2FIFA 5AEKB 4KV2A 4J9MA 5CHFA 4BAXA 5ER0A 4XUSA 2BYVE 4F4YA 7ICUA 1VAOA 5KAIU 3FW8A 4A90A 4EYIB 2PFNA 2PEAA 8ICBA 3EUB3 5KFIA 5FK9C 2D11A 3MBYA 2GGHA 1NK8A 1ZQSA 2BCSA 3MKCA 4DFPA 1L0VB 4JGHB 4K7ZA 3GIKA 4F4WA 3IAM1 5DBAA 1PGXA 4RQ1A 1SWVA 4KX3A 1S3SG 1DTNA 1E7UA 5FKAC 3CNHA 2GLEA 3S1DA 5FJRA 2ZVNA 4O3RA 4RNMA 1HIWA 5H92C 2EMTA 1WUEA 4CGZA 5HR6A 1T0SC 4FFDA 2G9HD 4I2JA 3PM9A 3H7IA 1E9MA 1FEAA 3T5JA 4WJPA 4JQ9A 4RQ6A 1X40A 4KIKB 1ZQ1C 5DLFA 2CJOA 1S77D 3QIJA 4F4RA 4DSIA 2IGDA 2KJ5A 2QARB 4PL2A 3KLSX 3RNGC 5JH5C 2HZGA 3CK5A 4TUPA 1XU4A 5I1VA 3Q8FA 5EE1A 5AKYA 1L0XB 3RMKC 3TMPB 1TJEA 4NY0A 2KTQA 2G4SA 3I6EA 3SFDB 1LO5D 3GZFA 4UQGA 3P1MA 1RFKA 1T0QC 3GE3C 1PVPA 4GXBA 1GRBA 3QKEA 4QZBA 3QZ8A 3P42A 4REZA 4IL0A 4OD0A 5AK5A 3GD4A 5BMIA 1XCQL 7ICTA 1S76D 1ZD4A 3Q8RB 1V49A 1WI0A 2QMTA 3T79A 2MH7A 2KP7A 2JZ3B 5J0RA 1H38A 3D46A 3A0HU 2CKHB 1U47A 3HM6X 1NELA 4F4ZA 2IHMA 7ICFA 4GOCA 1K50A 2K1FA 2ZJAA 4WJOA 1TYGB 5IINA 3RYTA 2ZW0A 4NV0A 3CP8A 4DLGA 2JU6X 4P1BC 3A1QB 1SJDA 4FHJA 1N63A 4M0AA 2MSNA 3AM9A 3TIXA 1ECWA 3H0RB 1FO4A 2WB1C 3QJZA 7ICMA 4ZH4A 5EE9A 2BPGA 2G4DB 3PPAA 4EQRA 4HCDA 1D3ZA 4C4VA 3GE8C 3VH3B 1XWLA 1A77A 3R0UA 2ZJ8A 1ZOLA 4FJVB 3VTEA 4MGGA 3DQ0A 5D94A 1AN8A 3MGVA 4BFRA 2FPMA 1X9XA 3I28A 4KLUA 4DF4A 4NLGA 1DIQA 2I9GA 2AX5A 4CCHA 4B0EA 2K60A 4EE2A 2HHUA 4RQ0A 2INPE 4KLSA 3MP9A 1ZMDA 3WKDA 3CSTA 3AB5A 3ENEA 1D8BA 2D3GA 4HJKA 2FYMA 2QJLA 3Q3MC 2R2QA 4RQ3A 3BS5B 1X9WA 2I0KA 2KN7A 1J8CA 2WDWA 2LGXA 3WA0A 5JCNA 2NTTA 4IC7B 3BQ1A 4RGMA 2NPTA 4KPLA 2KTRA 5TR5A 4A3OA 2V3NA 2VJ4A 2E8OA 2E1EA 4Z1YA 7ICPA 3WKAA 4URKA 1D8LA 8ICGA 2V4IB 2WYQA 1V8CA 4XC2A 3FG2P 4ADWA 2KKCA 1UCVA 4JMUA 1XS2A 2DHZA 2MLBA 2JF5A 2LHTA 1ZD2P 5ALPA 1ZQUA 5AI6A 4R64A 3CIRB 5G2NA 3PGEA 1DNCA 2LVQA 3EHVA 1NENB 3M7DA 1NYQA 2R8KA 3TEZA 5D2MB 4DHGA 1N48A 2KHQA 1C79A 3PZDA 1TAUA 2OVLA 1AHZA 7ICQA 1I7HA 2M1MA 3DWGC 5J2RA 1VJKA 2KN4A 4W9HA 3DESA 5JZEB 1VZ8A 4KLOA 3DBHI 5FMHA 3HKZC 2KIWA 2MWSB 2O2VA 4K3BA 1R7SA 1SBBB 4YSXB 2FMPA 3BJYA 3FV9A 3E58A 1FECA 3M3JA 5E6JA 4DO9A 4ANXA 1DXLA 2GR1A 5E6OA 2DAFA 1L7MA 4NWIA 2INNE 5J18A 5BOLA 4IRCA 3DHHC 3HJEA 3ZO5B 2V0GA 2ZUBA 2HHWA 3M1YA 1TS2A 4XWTA 1PK1A 5FS9A 3ML9A 1ZP0B 4GYPA 3JPQA 1F0ZA 3TJ4A 2LYBA 2GMIC 1HEKA 4DDID 4TUQA 1LKYB 1ZQNA 2C2DA 4NL9C 3BSMA 4FP1A 3BK1A 2RDIA 2V9WA 4PHEA 4EEYA 2Y0SC 1NJZA 4LNFA 4DQPA 2FUG1 2JVCA 5ALQA 2M17A 2R2ZA 1V1PA 4RT2A 9ICEA 2PLSA 4UASA 1MDRA 4RGTA 3LWLA 1E5WA 3Q6JA 5GMVA 2NO4A 3IRUA 4Y2RA 4RZRA 2KFNA 3PLUA 3UJ2A 4ELTA 1I4HA 3ZVVA 3KOOA 4K4IA 4ML8A 2YVSA 4W9LA 3NHEB 3QU2A 3BK2A 2J53A 1WWTA 3PR5B 5JHAA 5K4LA 1MA7A 2HHSA 5KFVA 2XK5B 2KDEB 3SQSA 2J6TA 2G5IB 5CP2A 2MUTB 4LJPB 2GBRA 4KLQA 1GRTA 3M6ZA 3ONNA 2BWES 4GMEA 1CRXA 1ONFA 2FLNA 1RG6A 1KLVA 4J56A 2P4PA 3OJ3A 3WK9A 1E6EB 4H4TA 3GV5B 2EXRA 2P3ZA 3ZVHA 1ZQOA 4M9JA 4I2DA 2C60A 3RJFA 4USAA 3EPGA 4BDPA 4MJSB 1N62C 1QQ6A 2BC1A 4Z6EA 3QA8A 1XQQA 4KX6B 3RB3A 1PZNA 4Y2JA 4GFJA 1ET6A 1N5WA 3QFBA 4UB1A 2AL6A 4DXGA 1T3QC 1UXYA 3SN0A 2KQSA 3BQTA 3BW7A 4IRKA 3IG5A 4I2EA 1LM8B 1WMHB 4G9BA 1RDFA 4EZ9A 4OW0A 4EBDA 2NBUA 2Q5WD 1RQNA 1V5TA 3P4RB 4MGIE 3Q45A 2N0SB 1W1MA 4EZ6A 2MBOA 2KACA 3URYA 2ZUCA 2JRIB 3F53A 5ENLA 3EJBB 3C1ZA 1OW5A 3NVZB 4AYBF 2DLBA 2KMDA 2OYYA 2QJJA 2ICIA 2OKTA 4EM3A 1FFUA 4F2SA 2M4NA 3A7AA 5ALGA 3IG8A 1XO1A 3RJIA 1N60A 2HOFA 1L3UA 2IJ0A 3DDMA 2P66A 3KYCD 3QARA 4IQVA 4GLXA 2OH2A 5A0LA 1C77A 1YZ6A 4ED2A 4I6NB 4HVBA 2BVGA 2V6OA 3V7LA 4DL7A 4JDRA 3VDGA 3B97A 2N7JA 3Q2AC 5CHWA 1J19A 5ALRA 2Z8LA 1B9RA 2KG5A 3PW2A 3LXFA 2AGQA 2RDJA 5ALOA 2PPHA 3SU8X 4DXKA 2ESEA 2Z7JA 4A35A 3EC8A 1NOMA 5AWVA 2JPHA 4XWWA 3SFEB 1N62A 4P0QB 2K6DB 4GLSC 4Y2PA 4UAYA 4I6PA 3AU6A 2L05A 4NZLB 5IN7A 4PYUA 4MGKE 3R7QA 2WF5A 1L7PA 3NRWA 5T14A 4K1RB 3NVWB 2WX0A 4ZRPA 1ET9A 4G8TA 4OALA 4QWAA 7ICHA 4O1NA 3RJJA 2A19A 1UGMA 2BQ3A 2XCPA 4P2HA 1SKWA 2B0CA 5KFPA 2F8LA 1WGYA 3V05A 2YVFA 4MFCA 3PRMB 1UHUA 2IGHA 1FIQA 5KT4A 1VZ6A 2IO1B 3RFAA 2MJ3A 4OJLA 2RQ5A 1F2RI 3CF6E 3APCA 3HVDA 3FM9A 3OP2A 3NVVB 4B9TA 4IDIA 3QZ7A 4II3B 2N9XA 2MA1A 1GRAA 2M56B 4J9QA 2N9KA 4PGQA 1S0NA 5JRBA 4EZKA 5L1JA 1ZPSA 2SEBD 2KJ6A 1YQ3B 4ARIA 2GQUA 3FILA 2K3UA 5ALNA 4Y2SA 1TAMA 8ICTA 3H0LB 4PHPA 4BJQA 3WKEA 3TKAA 1C4PA 2KMMA 3WK8A 3N7SC 4ZA0A 3SMVA 4GDKA 4W9KA 2YQEA 3I3TB 4RNAA 2P6RA 1PUZA 1SWWA 1PVQA 3IG3A 4GMVA 2N1WA 3VC8A 1T6BX 2X8GA 2K39A 1I4GA 1BGXT 1K4QA 1ZQAA 2ON8A 3F2BA 3PNCA 8ICYA 3EA6A 4S0RA 1PQSA 4YR2A 4IR1A 4RNNA 2DGZA 3JPRA 4AWJA 4YFKA 2NRVA 7ICNA 2N1RA 4YMOA 2C2EA 2PMQA 3BQ2A 4O3NA 4H4WA 3B9JA 5KG3A 4QZGA 3C1YA 4YMNA 3A9KA 3LB8A 2R8IA 3AEVA 3NJTA 1HUOA 4CF5A 1V6EA 3HRDC 5FS8A 3JSVB 4J57A 2W7OA 4AJYB 3AE4B 1E8ZA 3PW5A 5KFGA 2KZMA 3DIPA 2ZW1A 1XPYA 3GB1A 1TKEA 4M6WB 5FJPA 3ORYA 3L17A 2DYMA 3D32A 2Y4GA 4YSYB 3PZPA 4F50A 4LDTB 1EWCA 4I28A 3H9DA 3PV1A 1QLNA 4P4MA 4ZHOA 3RITA 4PPXA 4NLZA 2W8LA 5JCIA 3B0AA 2K8CB 3MJWA 2R2OA 3V60A 5IIIA 2PE6B 5CB1A 2F1JA 5J0OA 5BOMA 4N6EB 2DKXA 4QAYA 4R3DA 2EAPA 1WR6E 5ALDA 2BZFA 5BYRA 3OPSA 4UW9A 3V6HA 2ASLA 1JXEA 3OJUA 4MGYE 3TBLD 1ZRMA 3VAWA 4C8OA 2JX5A 4QWBA 2W9BA 2JEJA 1MJDA 2HSZA 2M0XA 4RQ8A 2W7PA 3SD5A 3ECIA 3KUCB 4B95A 1NHQA 4J3ZA 3EPIA 3GQCA 1WGRA 4X57B 3RNBC 5TSSA 4TSSA 3OPXA 2F77X 5HFYA 4TQ1A 3SV3A 4YG2A 4C8KA 3PMLA 4H4SA 2UWQA 5HQXA 1T94A 4A8EA 4OVUA 2N7EA 3RD2A 2QB0B 5KG7A 1PFDA 2LHDA 4AOFA 3DFYA 4BKSA 2QJMA 4Y2UA 3DVNU 3DG7A 2GO7A 1FEZA 1TY2A 1E9IA 1SXDA 1JN3A 1ZGUB 3I4KA 1JIHA 2HW3A 2ONQA 4EX7A 3R25A 1E8XA 3GD6A 2H5XA 3RR8A 1STZA 3CGCA 1AW7A 1TT5B 2WQYB 3MQTA 2I5QA 2AAQA 5DKWA 4EUTA 1ZKQA 3ZGZA 4MMWA 3TW9A 2PTWA 4A55A 4EX6A 4JWNA 1A0PA 1HEZE 1MBBA 3Q8AA 3PMNA 2WXLA 2PIAA 1ZXIC 1YN4A 4F1SA 1KQQA 2G3QB 1ZQCA 1RM6C 2BB5A 1B43A 1JPMA 4B9MA 4FS2A 2C22A 3QUBA 2NR2A 3H1UA 4K7SA 2O3GA 1QOGA 4IM3A 4DSLA 4MSQB 5C2TB 1JEHA 9ICJA 2VZKD 2PA6A 2H3ZA 3DWMA 3TJIA 3Q3NC 2N9PC 2VA3A 2ZADA 1P7EA 4N59A 1BQGA 4MKSA 5ALJA 1X2HA 4K81A 3SAGA 3PT2B 3GILA 1GRFA 5HMRA 2B76B 4RT3A 4IKGA 5J2KA 2Y5PA 4YCXA 5D79A 5CWRA 3IFWB 3CXOA 3RO6A 1JWUD 2W3RA 4M0WB 3U7DA 4RPZA 4YVZA 5HHDG 3VUYA 4F5PA 4NM2A 2KQ7A 5KG0A 1LQBA 1P7FA 2W9CB 4E5TA 4F8RA 1BPEA 2HOIA 1SE3A 3TWBA 3SZ2A 3LVWA 1P3QU 3KJMA 1OEYJ 2WXPA 4EMIA 5ALUA 4YP3A 4ECTA 1KDHA 3MR2A 2LMRA 3T5LA 3RZWC 1L3VA 4KLEA 1BKHA 4GC6A 5DPTA 1ZE3D 2A4ZA 4ZOHC 2MJDA 4H2AA 1EBDA 2ZIVB 3C19A 3AE6B 4WJNA 1SZHA 5DPSA 6ENLA 4DSFA 3I99A 4EOYA 1ZXIA 4RQMA 2XY6A 3RFZB 5L9XA 1J97A 4EBCA 7ICVA 4L1BA 4NAWB 3WCQA 1MHHE 2GH5A 5L95C 1NK6A 1HTQA 3VUXA 3V6JA 4HRSA 1QTMA 2C3DA 2GR0A 2CS4A 4NEWA 3BQ0A 3K9OB 2LASA 4JB3A 2EQ8A 1NPXA 8ICVA 2Y9UA 2KVRA 4G3XB 2Y3RA 2M0NA 3C5FA 1Z4OA 3M8SA 1TGZB 2EQ7A 1SGHA 3K75D 3C0RB 3DOWA 5TR3A 2L32A 3GC2A 4Z6FA 2AXTU 4PHAA 1UH6A 4O3PA 2I2YA 4YWSA 4HYKA 3P63A 5J2EA 4J9SA 2CHXA 2FCNA 1YX6B 1L8PA 4GDLA 3UJFA 1LVHA 5AKJA 3LXDA 5KL1B 3WAOA 4CF4A 1YNTE 1LVLA 8ICWA 3RNFC 3JVZX 3TI0A 4BKTA 4NLCA 4M52A 5FR3A 9ICIA 3UCDA 4YSZB 1NEKB 3EYZA 2F76X 1JUDA 1E7VA 2XVTA 1KSPA 1JWAD 3L5KA 3SR6A 1EBGA 2C5LC 1L5PA 2IPIA 3D2SA 3RZFA 2CRXA 1OUQA 3TADA 3RJKA 3PHXB 1FRDA 2RK5A 1ZR6A 3OWEB 2DUYA 4MDKE 3BINA 1S5LU 4KMOB 1ZQBA 5AM1A 1WE7A 1ELSA 8ICFA 1KFYB 2ZEQA 3B2FA 4OZCA 5AM0A 4N58A 3QU5A 3NZ3A 8ICSA 3K4GA 5IP4D 1A70A 1QLUA 1QILA 2J6UA 1L8LA 2DYBA 2ISOA 1MBTA 3RNEC 1K51A 1F9JA 3M9MB 1FHUA 5KFHA 1NJXA 3BVGA 2FIDA 4KEMA 3JZUA 4DFKA 4F92B 8ICJA 1MG4A 3HT3A 2N9EB 4BKGA 2BDPA 4W9CA 3I63C 5CHVC 1ZK7A 5CR0A 2DYOA 3KYDD 1IP9A 4HPLB 2YX8A 1NDDA 4IZGA 3L5OA 2DAJA 9ICXA 1Z2MA 1RPLA 4DYEA 4ECWA 2UUUA 7ICEA 3FC4A 3DVGY 3PZ7A 3RJGA 1LGRA 2A1JA 4WWNA 1X2GA 1TY0A 4PWCA 5KFYA 4PVHA 3JPNA 3D47A 4TVWA 3NXLA 1UNSA 3L3FX 5EWFA 2L76A 2ZC8A 4AP4C 3TWAA 5JRTA 3BYTB 3P4SB 3RUIB 3GRTA 4Z17A 2BKEA 2LPEA 1JDFA 1FRRA 1FXAA 1GOZA 2KX3A 3IAS1 2EKEC 4OHJA 2FCSA 2HXTA 2C3CA 3R7RA 1TYTA 3ED5A 3L4PA 2KZ3A 2DNFA 4MACA 5J0WA 4NAMA 2FKPA 1D8YA 2BHNA 3SSZA 1KFTA 2E1FA 3H8JA 3KVFB 4KKIA 1R6WA 3RRAA 2FCQA 3C23A 2RPVA 1V38A 4A9AA 1WVEA 3VC6A 5GTHU 4EEWA 5G5GB 4RCOA 1L6VA 2PMZC 2IA6A 2ZNVC 4QZAA 2XY7A 3R8BA 3AV8A 3K9PB 3MWCA 4MFAA 4C4VB 4TVYA 4APNA 2JY6A 2W04A 5KFFA 1ZQIA 8ICIA 9ICKA 3WU2U 3BQ7A 3TEXA 4H50A 1E10A 3AULA 5AKGA 5IIOA 1YJIA 9ICSA 4KVGB 2FLLA 1V80A 3S47A 1BPDA 4BBNF 2OAIA 4TKNA 2BQQA 2JWUA 1STEA 3QPEA 2BBCA 4WWPA 3PSTA 5LXHA 4Z6DA 1UUPA 4KDIC 2UVRA 2KTFA 1L7YA 4FJZA 4Y2TA 2XY5A 4KLGA 2PS2A 8ICOA 5CJ7A 3EZ5A 1XXGA 4NLBA 1CZPA 4C00A 1T8EA 5AE3A 7ICLA 2KYWA 1ZQRA 3N9YC 2RR9A 4X5VA 2FUHB 4M6UA 5ALKA 4P4PA 3KZIU 3DBLB 2KJRA 1MOKA 1WXVA 2H3FA 5AZFA 7ICOA 2AYOB 3TAQA 2CHZA 2NS5A 5TZVA 2JZBB 2CR5A 3ZIMA 2XI9A 9ICRA 2BT6A 1DIIA 3TUOA 2AHOB 5B66U 1DOQA 2EKIA 1Z5SB 4UAZA 3E2EA 2D8CA 4QZ8A 4F3OA 2H3QA 2WXFA 4J6IA 3SJNA 4LDTD 4IWPA 4XQ8A 5BPCA 4KMUA 2Y1IA 3RT3B 4FDCB 4UBBA 4JL9A 1GB1A 1GNUA 5AZHA 4IUMB 1UWXA 2JXJA 2WXIA 3QK0A 4AUQC 1N56A 1WJ4A 2WXOA 4KSLC 2VJ5A 1IGCA 2VKQA 2KDBA 3NO1A 1CI4A 2WF7A 3FWAA 1ZQMA 4GIBA 4IS7A 3GIIA 4DOAA 3RB4A 2KDFB 3BVZA 4IWOA 4GSWA 4HCHA 2XIDA 4WJQA 1E8GA 4CDGA 1D9DA 2NBWB 3S5SA 3RBDA 2KHWB 2AKMA 3DPDA 2XH7A 9ICQA 2XH2A 4W9FA 2XSXA 1DRGA 3B1LX 1WRIA 1QCKA 5KHQA 1FFVA 1L4DB 3AU5A 4DS4A 2BKFA 5DLGA 2XNAC 1TYPA 4J3OD 1SV0A 2G0AA 3IC9A 3S1FA 3RRGA 2WAQF 4UATA 1C7YA 3V7KA 5DDYA 1EF5A 5KFSA 4PGYA 4EM4A 2FDRA 3BS7A 3JPOA 3QC8B 1F8WA 3ISBA 5EBKA 1EWYC 4A8XC 5IOIA 4JB1A 2DX5B 1V1PB 2DF4B 3LJ3A 1OQYA 7ICGA 1AHUA 2JH1A 1W1KA 3TSSA 2LYAA 3P93A 2PCEA 2OEDA 2E8NA 3RRHA 4XE0A 1ZQEA 3PK7A 4J9OA 4DQRA 3F2CA 3RAQA 3VTWA 4QZIA 2AGPA 3BOXA 4IQWA 3PW0A 1ZQKA 3TL5A 4NXZA 2EANA 5F9NA 2ZXHA 3QYPA 2IHNA 1WCLA 1OQQA 1F0MA 3ZDCA 4KLIA 2KMCA 2RDHA 2BTEA 3TSHA 2NVUI 1NK4A 1GESA 1GRHA 4IL2A 4P7IA 3MZNA 2WF8A 3IV6A 3OJ4B 4MT5A 2YVGA 3ZVHB 5KFMA 5CX3A 3AE3B 5DCNA 1NI3A 1Z3EB 1KFSA 4LNNA 3T3OA 4NY8A 3EJDB 2HHTA 2HHXA 1D6EC 3IBEA 1ZQWA 1BPZA 2WXMA 2G07A 1WVFA 4YQWA 2ZCBA 2X99A 5J17A 2NBVB 3DERA 2WDQB 2BS2B 1E8HA 2AJQA 1F3PA 2INDC 1IYFA 3ZNGC 2REXA 1JWBD 3MFIA 4YR3A 2KVSA 3TFRA 1ZQTA 3JS8A 2F1HA 1JALA 5AUKA 3DDHA 3ZRCA 4HNLA 4JX1C 2RGFA 2AGOA 2WB1F 1A5RA 3ZDDA 1KLGD 3LDAA 2HVIA 3GDXA 9ICNA 3RJAA 2RP5A 4Z6CA 5CEHA 3TFSA 1XSLA 3RJHA 5FXDA 1EXNA 2E8MA 3TOYA 5KFJA 2YEPF 3JVAA 1L5UA 1TS4A 2YVCA 5U25A 3BWUD 4QIWF 7ICKA 2JRZA 1V2YA 2K22A 2MHJA 2QSDA 1PYWD 2K89A 2LM1A 5EOZA 3J81j 3G6YA 2ISPA 1SJED 1C78A 2MSED 1OEPA 1FXTB 2ZIUA 4J9NA 2BCRA 2PU0A 3B2GA 1WX7A 2K6QA 3AL0B 2P0IA 2K8BA 3SYZA 3P0WA 3ABVB 1MC8A 1W1SA 4JV0A 1MI0A 1T5XD 4M00A 4OVVA 2QCZA 1B1ZA 1VLBA 4NM1A 2YMLA 2KLCA 5J0XA 4Y2VA 4LLGM 3PQBA 5KNIA 4DQOC 1QKZA 5J2HA 2TSSA 1DXSA 1NK0A 2GGJA 1YQZA 5L6FA 3VRAB 2MAXA 2PFPA 3V61A 2WPCA 2Q4WA 1XANA 4F5NA 3N1YC 2LVPA 4CHKA 2HJ1A 4NJ7A 5G5HA 1MQ3A 1JWMD 5J8YC 3AU2A 1QQRA 1S7MA 2BS4B 4M01A 3U26A 3VDZA 3UQ2A 3ZNZB 4EELA 1UA0A 3I5JC 2XBBC 2PJHA 1FIQB 5FR6A 4E6MA 3D2QA 4K7UA 3DG3A 1JCKB 2XEWA 5DDMA 1WM2A 1OEYA 1SL1A 2DPJA 1GPXA 3GRSA 1UZXB 3ZI4A 5L83A 3EEZA 2MP2A 4F93B 3UCCA 2PLPA 3OG5A 1GUAB 2ZXIA 1ZQGA 2GB1A 4YL8A 4C4TA 2VFRA 2BR0A 2BYEA 2K8HA 8ICUA 3D9XA 3AI5A 2FPKA 2J7QB 1E8FA 5CHGA 5EWGA 1WJ6A 4UB3A 4MHVA 2IDYA 2KD0A 5KFTA 3VQIA 3PSPA 4UB8U 5DQIA 1ZYQA 4KLDA 1K53A 2V3SA 1KH0A 2WWZA 1L3SA 2PTLA 5BMGA 4C8LA 4HCLA 4NJCA 3A4SC 3UMCA 2EQ9A 1MVKA 1Q5WB 2RSUA 4GDKB 4DXFA 5C3JB 3RAXA 4ANVA 4CRXA 3AE5B 3GSYA 1XS9D 4OJPA 2C28A 1BZLA 8ICXA 2PTXA 1QT9A 3ETLA 3CAWA 2WXNA 3H8AA 3E0FA 2XICA 2OOBB 3LVVA 3PX4A 1JMLA 1SJAA 4OZBA 3CRXA 2WX1A 1AWDA 5AM2A 4KIKA 5KFZA 2ZVOA 3UQ0A 1TK5A 1SJBA 4OO1J 1DGSA 1L4ZB 2J0KA 3PO0A 4MM3B 3KUZA 4OZAA 1A6SA 1WGHA 5KFCA 4DL2A 5AM4A 4UBCA 2CJNA 4RF0A 1WCNA 3H40A 2LJIA 2DPIA 2IO2B 2BB6A 2P3HA 4RGOS 5EWEA 3Q8EA 1FPYA 9ICMA 3ZQ4A 3IP4B 2OZ3A 5L1LA 2ZTCA 3ALBA 4NQKE 2ZZPB 1QOAA 3UGVA 1T0RC 1E90A 4ICVA 4DBGA 1QSLA 1T4GA 1X42A 4QNLA 4TMAB 5KVIA 3VCNA 3KZXA 4P0PA 2Y5CA 3F2DA 1Q3VA 8ICNA 3O65B 3QHTA 2OQYA 7ICSA 4XRHA 4NL9A 2ZIXB 3AECB 1BPXA 1WX9A 2J4XA 1O03A 3ETRB 4DF8A 3A1QA 1GJZA 2LWPA 3DCGA 2R9ZA 3PX6A 1JX4A 1ECQA 2D10A 1KN5A 4AS1A 1GB4A 1V97A 2WPEA 4EYHB 3NZUA 4PVEA 1EU3A 3JPPA 3VR8B 2WP6A 4QZEA 3APFA 4Q2JA 4GFIA 2MW5A 1SF0A 1XT9B 3NUHB 5HI1A 3FYYA 5FXEA 2ZJ5A 3EECA 4KT2A 4PWBA 3G6XA 4I29A 1XF5L 2KC1A 1HSKA 3N4FA 1KL9A 4JE3B 1D4BA 7ENLA 1OGWA 3QUTA 1KF6B 2O6VD 3T3NA 3QU9A 5J2FA 2J0JA 1GAQB 2KWUB 4KGRA 4LK0M 3DBRI 3VVWB 2WOWA 3ISDA 5E6NA 2RDGA 3TQPA 3V6EB 3PREA 1NZBA 5KT2A 3BS5A 1CMXB 3Q6BA 4FADA 2PMVA 2WTFA 2JRHA 4F72A 2BW2A 3I57A 3MHSD 3HW8A 1KJTA 1UD7A 3PZ8A 5KG1A 1F9CA 2WS3B 1NK5A 1FD6A 3MC8A 3EF6A 1T3QA 3DK9A 3R66C 3KD3A 1WX8A 3SV4A 3WK6A 3BIID 5JUMA 2FE9A 5DB8A 1NVID 1YIWA 4KLLA 4HCPB 3SN4A 3GIJA 2ZZBA 4GGHA 3Q8KA 4OJOA 3MGHA 3U2SC 1IGDA 5C23A 4DEZA 4MH0E 3O0HA 4RPXA 2CHRA 4HN8A 5DGBA 2HQMA 3UXOA 2NYVA 2J52A 2ZJDA 3HVZA 4BV6A 3MHZA 4P16A 1EO6A 4OJ5A 5AZGA 2PI5A 2J3NA 4O3MA 3QUCA 3Q3OC 2QIEB 1QH9A 1J2MA 5KT6A 5KT3A 1A76A 4ECSA 2BGFA 4ECUA 4HPPA 1EC9A 4FX9A 3I6TA 1GV4A 3ZLFA 4BUGA 1JXLA 3B0YA 3IHPC 4M02A 3MR5A 5FP0A 2AQ4A 2K4PA 1HE8A 2KJHB 3RBEA 3DJGX 2Y08A 1ED1A 2FMQA 3TSJA 3TACB 4B9LA 2RDBC 3CW2C 1NZPA 4ECZA 1T3NA 1Y88A 2EAOA 3MC0B 1MPEA 1RZTA 3QX1A 2VRRB 2OM6A 5HKHA 4US9A 1KN0A 2WOIA 2PKOA 1W1LA 1ZQXA 4C8MA 2M9NA 2R18A 5L1MA 4I2GA 3JYUA 5FS6A 5I1WA 4GISA 2YB4A 2NVKX 4QZHA 1I4PA 1R4NI 2G45B 4GR1A 2D2QA 4JLCA 4FZNA 3R2TA 3HK0A 1WH3A 5BO4B 2KLGA 2KVZA 2FCMA 2F1IA 3GZNI 2OEHA 1CK1A 5IIJA 3OSPA 9ICBA 3ES7A 2MX2A 1DZNA 3DBHB 3TJPA 4M9LA 3NRZB 4HDOA 2XH4A 4ECYA 3U52E 4ZYSA 8ICRA 5AKEA 2JH7A 4QW8A 2KK0A 3M6KA 4KLTA 1EUVB 3PRPB 4JQWC 5KVHA 3A4RA 1Z00B 4QZCA 5KT7A 7ICIA 1J7BA 1S10A 4ANWA 4DXAB 3A33B 3L0WB 2PLIA 2X8HA 1NHPA 3H7SA 2GBNA 4A3PA 1RWSA 3CT2A 2JEFA 1ZKHA 2GSHA 3ISCA 1LPFA 2PXIA 3AUOA 3GS2A 1C20A 2BS3B 1J7CA 2V3BA 2MUTA 4PZNA 1FNUA 5AK3A 2HXUA 1U4AA 4IOIE 1N2XA 3F5AA 4GB9A 4I2CA 1BNOA 4UB4A 2OWOA 2JWZA 2G09A 3M8RA 1RYUA 1BPYA 3KHLA 3B0XA 1V85A 2F44A 9ICFA 4GGBA 9ICLA 4GDLB 4M04A 3AE1B 1KTKA 4UAVA 1P98A 4MJSA 1KKRA 1WGDA 3FYHA 2X38A 2HOQA 5F9LA 4O0IA 2QPMA 3STPA 2SAKA 3RH6A 5BOEA 1HZ5A 2AU0A 2G06A 1YN3A 8ICCA 3N6HA 1N61C 3Q4DA 4UB6U 3OHAA 5CRXA 1V1OA 2HTHA 4JN8A 5TISU 5D49A 3H7PA 2I1JA 4IHCA 1QQ5A 2EDUA 1LB2B 4BCAA 4ZHPA 1WRDB 1XC9A 1TVAA 3N7PD 1WGKA 3FAHA 1MQ2A 4M47A 1L6UA 4HG0A 3JPSA 4NLNA 1ZOYB 4DOCA 2ASQA 5AI5A 3QUQA 4RPYA 3V7JA 2KN5A 5AI9A 4F5RA 1IG6A 2LMCA 2R61A 4D2KA 1BXTA 2TPRA 5EE0A 2BWFA 3BZCA 2G08A 1HQRD 1NBFC 1ESFA 2K4IA 3UIOB 2PFQA 4ED1A 1DK2A 4GC7A 3EKGA 4PVJA 3OAWA 4YR0A 2LM4A 1L8OA 5AK6A 5C0YA 1WF9A 1WUDA 2KD1A 2GI9A 1NJYA 3OTRA 2KICA 4PJ0U 3I1YA 1YEYA 1ZQDA 1WXQA 2DZJA 3N20C 3NS1B 4GU2A 3W9CB 3DQVA 2KV2A 4PZFA 2CU1A 2IBIB 1NDAA 2Y5BB 1ISNA 1SXTA 1YOVB 2A1JB 4EENA 2KO3A 2FPLA 3UF8A 5IKCM 1T0YA 5CTRC 2QDEA 3PS6A 3BZDB 4MGZE 3HUIA 2V4RA 3QCAA 1O08A 2KFKA 2BVHA 3NVWA 4WQOB 3W5UB 3ZDBA 2AQ2B 3KKAC 5J0TA 4E0DA 2LUEA 5BYSA 3RJ8A 1XDIA 1GG3A 2YMQA 2GR2A 1UWMA 1ZQFA 3A7RA 3H8MA 1FEBA 4DSKA 3C29A 3H6NA 3AQEA 5ALSA 1SE9A 1P9DU 1WYWB 1P1AA 2C7MB 2VFTA 3NOBA 2B6GA 3DDCB 3DBRB 2BKRB 4ROPA 5KFXA 3OGUA 5HHIA 4HNCA 1I4RA 1YX5B 2D3CA 2VA8A 1DOIA 3HW2A 3QFAA 4E8GA 1SZPA 2HBMA 1TKDA 5D3DA 2X50A 3DFHA 1F1HA 1NU5A 2AL2B 2E5AA 3FDSA 3IDWA 5DPRA 4E74A 1MRAA 4PK1A 4F4XA 3IJIA 1RAXA 3ZTDA 4WWOA 3RCZA 1WIAA 1X9SA 4C7YA 2MBEA 4HJGE 4H4PA 2LI5A 1D5XC 2KWCA 3EFUA 1IBXB 1WJUA 2UVWA 2QJNA 2AKZA 2EZZA 2RDXA 2KZZA 3CWIA 4Q43A 2NCNA 2AQ1B 3SD7A 1YN5A 2EMSA 3N3KB 4IG7B 9ICUA 3C28A 4RQ2A 3LWMA 1YZ7A 5DBBA 1S8OA 4QZDA 5AI8A 4PYZA 1RXVA 1L0YB 4KSKC 3NVYB 2WU5B 3D6JA 4WH4A 2KKVA 2WHEA 4WIPA 3T9LA 5KG2A 4GXJA 5J2GA 2Y3SA 3AN1A 3OZYA 4UB5A 1UBIA 4JWUC 4R8UB 1SIJA 5AIAA 4ITKA 5J2DA 4MELA 1UGJA 5AI4A 1HUZA 4KTQA 2INCC 2V4QA 4OVZA 5J04A 3UXKA 4I6LB 3EJEB 2Y3AA 3GFKB 4P4OA 4KLHA 1FHVA 2CFYA 3A9JB 3NZGA 2BCUA 3NGDA 4YMMA 2MNRA 2L0FA 1KKXA 2IOHA 3FW7A 4O95A 3EAOA 3FJ4A 4K4GA 4YT0B 3ZDMC 3T9PA 3VFCA 5KL8B 1M94A 2J0MA 1KFDA 2FAZA 3TEWA 1SIFA 2KFJA 2NQWA 1ZD3A 1NJWA 1WXMA 5IAAC 4DHZB 2UYZB 3S2AA 1BPBA 3M9NB 4FBUA 3PTFC 3IT4B 1QLBB 1M4VA 3BY4B 1S0VA 2IMWP 3ZW3A 4MF2A 3GP7A 2K8CA 2XC9A 4ECQA 4IP5A 4MFFA 4DCCA 4FN2A 2ACZB 3GZNB 4BOZB 4KN4A 1L3TA 4K8GA 2W55A 1JRUA 3AEGB 3T4WA 2L5YA 3VHTC 2LI6A 3UM9A 1GC7A 4DL5A 3MC1A 4ED6A 2JUOA 4EQWA 4DQIA 1IYXA 2BQUA 2ASDA 3OC4A 3LYYA 1AROP 2LXCA 1E8YA 2M0AA 1Q1RA 1AARA 2P13A 5AKZA 4LNIA 4PVKA 3UGBB 1SE2A 1QSSA 3VFKA 4Y2YA 2OPJA 1U48A 4JV2A 1I42A 2DZMA 4BC9A 5BOFA 1QOBA 3ZDEA 5KFOA 8ICEA 1H4RA 2HE7A 3FCPA 3PSFA 1W6TA 3KLJA 4WQMA 3G6VA 4J9KA 4B9VA 3R1ZA 1RXWA 2QB0A 3HPOA 2RPQA 1R4MI 2FBWB 1F77A 4HK2A 2OZ8A 4GIRA 4DWDA 4CYEA 2KDMA 3A0BU 1FMAD 2WFAA 3MDCA 2GRTA 1F52A 5JTIA 2OCEA 2CHWA 4TQRA 2DBYA 2LJ5A 5KFWA 1RYJA 4GN1A 1ONEA 4FI4A 5DQHA 2YAUA 2POZA 1C4AA 2KHVA 4CO7A 1PVRA 5KFAA 3QE9Y 2FJ6A 3SBFA 3D2NA 3RB6A 4W9IA 2PFOA 4QW9A 2K9XA 5DQGA 1V86A 2N7DA 2HCFA 4PT5A 3AMZA 3JW0X 3HPFA 2O6KA 1GETA 3KFUF 2PP0A 1NI2A 4RFBA 4B0MA 5KFUA 4JWSC 4RU9A 2BCVA 2GBKA 3UMGA 9ICTA 4I2BA 2FMSA 4B9NA 1F0XA 1MO9A 4JHMA 5ALFA 1F2RC 3DEEA 2XN9C 5GRTA 3OZMA 3U4FA 1TE2A 2GGEA 4I2HA 7ICJA 3II4A 5HHHA 4XA5A 3SN1A 4ED7A 3IM1A 4H1ZA 4DQSA 4J03A 3UMBA 1XO3A 2VH1A 1UT8A 4PZOA 1PK3A 1Q46A 5KG4A 4ED3A 3THVA 3L54A 1XHCA 4H19A 4LTUA 5L1IA 3UI3A 1UBQA 4BBNC 2FI1A 1AYFA 1QLTA 5J2IA 2A1AA 1Q1OA 3N97B 1WY8A 3RH5A 1P0RA 2AH5A 1W1JA 3H8HA 1RYSA 3V3WA 2ZIWA 3Q8SB 4HKZE 3W1SC 3HSUA 4ZDVA 1S97A 4ICUA 4M0WA 3UJEA 3GY1A 2RABA 4A3RA 1ENFA 3SQIA 3N32A 1YJ1A 3SHQA 2PMZF 1XCTL 2ZUDA 2YTUA 2W9CA 4ELUA 2W03A 4JV1A 3E9SA 2F5ZA 2D5GA 2NPTB 2KT7A 1WG8A 2AQ0A 1TZOA 2KTRB 2LGIA 3X0WA 4BWMA 4EEKA 3Q8MA 1U45A 3SEIA 1VRAB 2JEGA 4GRTA 3ENLA 2ZTDA 3RJEA 2WXJA 4K8DA 1P48A 1ZJMA 4J9PA 2D3DA 1L2NA 4DOBA 2ZIVA 4OJ6A 2ZIUB 3T8MA 2WHIA 2QVHA 1XO0A 4IW0A 2K8BB 4J9LA 2ZPNA 5GXGB 4C8NA 2QAEA 3AEEB 1EU4A 1MNSA 1ZQVA 3RNMA 1IM4A 3SI8A 4DNSA 3TTEA 3GV7B 3W8XA 4ICAA 3VCCA 8ICZA 3DGBA 4ED8A 3AEFB 4O5EA 5KTQA 2YEPB 3RI7C 3T5HA 1Q8KA 3BDPA 5H2FU 2JT4B 2MJEA 4R65A 1UELA 4XX5A 3ZJVA 2A3VA 2ZZCA 3ML8A 2GQTA 3P3BA 2GBMA 3Q8QB 3DBSA 3IT6B 1URJA 1M6YA 2O2VB 3FXGA 1C76A 1V9PA 4H4RA 3AEBB 3OSNA 2IY1B 3RNAC 1P43A 1KKOA 1W1QA 3NG0A 5MPOA 3E56A 1N6ZA 2V1YA 3MC9A 3CGBA 5FJTA 5GTIU 4P1CC 1RFAA 3M95A 5DBCA 2MP2B 4FHKA 1YT3A 2BCQA 1H6VA 1QQ7A 4M0XA 3RULA 3LAEA 2WP9B 2WF9A 1PK1B 3SENA 1BMLC 2KWVB 1MUCA 1TS5A 5J0YA 1MHXA 4QWDA 4BXOA 4FZMA 1ZETA 2BGWA 1KW4A 1NK9A 2WAQC 4U6PA 1SXEA 4Q45A 3QEAZ 3NS8A 1HZ6A 1EC7A 1CUKA 1GERA 3V62A 3MFHA 4WJ3B 3WAPA 4CE6A 3DEQA 2H88B 2LZ6A 1N63C 1R0MA 3VUWA 3EUB2 2BPCA 4C4SA 2KVCA 2QC8A 2MCNB 1TE6A 3NUQA 2WXQA 3CB3A 2NV3A 1GXFA 1WZ0A 3H7VA 4P6VF 2QKNA 4DLEA 3AE9B 4LJOB 3FVDA 4RQNA 1L7OA 4B9SA 4KLMA 4B6WA 4H4XA 4DX3A 1UQVA 1X6IA 4DSEA 3AEDB 4E71A 2DQNB 4RGNA 5HP4A 3N4EA 2W9MA 4Y2XA 5AKKA 4O3QA 4ECXA 1T7PA 2MBHA 3KUDB 2PGEA 1GEUA 1MSWD 1WUFA 2LRUA 1ROEA 4JN7A 2JZPA 1WJNA 4M9GA 2A8XA 1K5OA 1BVSA 1XLNA 1Z4NA 3TQ1A 3TEYA 2QILA 3V6CB 1NKBA 1TS3A 2OJWA 1SB3B 3K1GA 3ZUNA 4KGSA 3QXGA 3P2BA 2DW7A 3V4BA 4US8A 1TBEA 2GRIA 3KW5B 4H4UA 1SGGA 2KSOA 2GOWA 4P0PB 1ZJNA 2JZZA 2BDUA 4DL4A 2LXAA 5ALHA 4BGDA 3ZJUA 1TKGA 2QGYA 9ICVA 3RNCC 3KHHA 2HNEA 4X2PA 3MGIA 3TARA 1DYQA 3K1RB 4DN1A 5K8EA 2QKQA 2IPKD 1WGGA 4XYCA 3LADA 1PDZA 1WZ3A 2KJ9A 2LYHA 5J0UA 1R4MB 4A6QA 5AIBA 3PX0A 2CDUA 3A7UA 5G5GA 5DB9A 3ZNID 2VFUA 2K25A 2LD9A 4MEYA 4AP9A 3PWGA 1PDXA 2NRZA 3W1YA 1GREA 3TAPA 1SE4A 4GXKA 2DL0A 3C0PA 3RR1A 2KOBA 5FJOA 2P8BA 4YWGG 4QIWC 1ACCA 1L6NA 1KM7A 4G11A 1DOYA 2BVFA 2KOXA 5J2AA 3HM3A 5KFEA 1SKSA 1JRPA 3AQFA 2QDFA 5HHZA 4CQNA 2D3AA 2O6VA 4HXDA 2I1QA 5IO9A 5ALYA 2UUVA 3KWLA 1CQVA 2J42A 1JQ4A 3THUA 5ADZA 2BC0A 2GOLA 2P6UA 1XLPA 1C1YB 3S1EA 2KMAA 2MRPA 2WPFA 2PTYA 5E79U 1C3TA 2NMQA 3O0FA 4DHZE 1EBHA 4FLHA 3RH4A 3ZDTA 2C9WB 4DHJB 1UA1A 3K1ZA 4QZFA 3M63B 1JCTA 3GU3A 1U49A 4I2IA 4RNOA 1SKRA 2VFVA 4DQQA 2RLTA 4RM8A 2BF8B 4GYPC 2PTZA 1M6IA 2N1VA 2LGYA 3HP6A 2HBLA 3MJ5A 2JR5A 3I76A 2EQ6A 1ZQHA 1XNSA 3ZKJC 2ES6A 2JZBA 1E7PB 3AH7A 2HBKA 2L8JA 4MLAA 3NASA 1WYGA 1ZY8A 4DK5A 1TAQA 1BUIC 4IM2A 1K1QA 3ZTCA 2F2AB 2HVHA 3D2DA 3T6CA 3GIMA 1ZD5A 2YMPA 4EMJA 3V3XA 3QLDA 2VFSA 3DJJA 2KZRA 4HWIB 3C2KA 3PR4A 3S1CA 3MR6A 3H0MB 4F5QA 2L3ZA 1G6JA 8ICLA 3VR9B 3ONSA 5KG6A 2FLPA 3PG6A 1S0MA 1B4FA 2E8PA 4G50A 2VZKB 5J29A 3QTPA 4MF8A 4BX9C 3FILB 4XDDA 5G55A 2IO3B 3AEAB 2L1AA 3VTUA 1WWVA 3HKZF 3JPTA 4UD8A 4EQXA 1VCBA 2X8XX 1IUEA 2W3SA 4DWIA 1RQLA 3QX7A 1YJJA 3UIPB 5ALTA 4G7FA 1YQBA 1VQZA 1SV4A 3L08A 3AE2B 4Y2QA 4ARCA 5J0QA 1SB3C 2NRTA 3RGTA 4FULA 4C56C 2PGWA 3KUMA 2D07B 5CA7A 3V72A 2XGQA 4B9UA 2GLSA 1IV8A 3HIZA 1N5WC 1QF6A 4HPNA 2WDRB 2GGGA 2DWQA 5C5JA 4UAWA 2QARA 3DVNV 3P4PB 4HKQA 2PSNA 5J8YA 1S0OA 2KNBA 3QU7A 3KTQA 5EDSA 5JHBA 2PVOD 3B9JB 2ONEA 2Y0SF 4DL3A 3A9KB 2Z0EB 2L00B 2KQ4X 4HYRA 4DDGD 2GGIA 2Q4TA 1E0ZA 3W8ZA 2GR3A 4Q8EA 2MQJA 5KAFU 2QEJC 3R10A 2N9LA 1FFUC 5AUIA 2ATLA 2QLTA 2JHDA 3T3FA 3HILA 2I38A 3KBBA 2KANA 3SQPA 5FJUA 4C7ZA 1N60C 4ZCWA 3OJSA 2AL3A 1B22A 3PSIA 3NFUA 4KITB 4K3CA 1VDVA 2KIVA 2VAOA 4BURA 3C21A 3AE7B 4OCZA 3H4KA 3IXSA 5AM3A 2X8CA 5IILA 3H12A 5DG7A 2DZIA 4EC3A 3U30A 3EWAA 5AKXA 1X6JA 1VR9A 5L1KA 2L83A 2W9BB 4C80A 1V9JA 5AICA 1JMSA 4BVUC 4AYBC 2WXRA 2LKYA 2V9HA 5HG2A 4L23A 4H4ZA 9ICOA 3LLBA 4O3OA 3N4MB 5D6JB 8ICPA 1TZZA 4TURA 2KWDA 3IVFA 2AWTA 1TTNA 1F44A 2AQ3B 1IXRA 5H8YE 4O9MA 1OXJA 3H7PB
chains in the Genus database with same CATH topology
4HEA1 1HQRD 4PVHA 1ESFA 3AM9A 1FO4A 4TVWA 1UNSA 4PVJA 3Q8CA 3BYTB 5EE9A 2GI9A 3P4SB 4PYTA 1FRRA 1FXAA 1GOZA 3IAS1 4OHJA 1WXQA 3NS1B 3W9CB 3VTEA 3D2JA 4PZFA 3DQ0A 3L4PA 4MH8A 1SXTA 1AN8A 4MACA 4NAMA 5T8IA 1ZUD2 3BZDB 4KKIA 4RH6A 5JXVA 1DIQA 3HUIA 2AX5A 2RPVA 4A9AA 1C4CA 4B0EA 4EE2A 2INPE 1WVEA 2BVHA 4WURA 5G5GB 4RCOA 3NVWA 1L6VA 3W5UB 2AQ2B 3MP9A 5BYSA 3R8BA 2E6XA 3AV8A 3AB5A 4UDUC 4TVYA 3RJ8A 1UWMA 2QJLA 2BYTA 3A7RA 2I0KA 3TEXA 2AXRA 2WDWA 1W1RA 1E10A 3O13A 2NTTA 1YJIA 3U7ZA 4RGMA 4XLOA 2VFTA 2OAIA 2V3NA 2JWUA 1I4RA 1STEA 2BBCA 1DOIA 1FXIA 1UUPA 2V4IB 5D3DA 1V8CA 3ZJTA 2WXGA 2E5AA 3Q8BA 2OHFA 1XXGA 1CZPA 2FE8A 3CIRB 1NENB 5AE3A 3LB8C 4YTPB 4C7YA 3N9YC 1NYQA 4HJGE 1D5XC 1IBXB 3TEZA 2E3TA 1EM7A 3D2HA 3CWIA 1OQRA 1C79A 2V3PA 2AQ1B 1YN5A 1C9FA 2JYEA 1AHZA 3W8WA 1I7HA 3DWGC 1VJKA 2KN4A 1VZ8A 1DIIA 1FNWA 2BT6A 1L0YB 3TUOA 3NVYB 2WU5B 4WH4A 2EKIA 1R7SA 1SBBB 1DOXA 4WIPA 2W82A 4YSXB 3BVMA 2WXFA 2Y3SA 3AN1A 5E6JA 4JWUC 1SIJA 4ITKA 5AE2A 1GB1A 1UGJA 1Q10A 2INNE 4OVZA 2WDVB 1UWXA 2WXIA 2Y3AA 2WXOA 2V0GA 1RM6B 1IGCA 1SSNA 1TS2A 4XWTA 3FWAA 1ZP0B 2LFIA 1F0ZA 4O95A 3FW7A 3BVZA 4YT0B 1FNVA 1E8GA 3J9CA 3DEDA 3BK1A 1HA5A 3TEWA 2NQWA 5L6GA 4YXDB 2FUG1 3IT4B 1WRIA 1QLBB 1M4VA 1FFVA 2R2ZA 1L4DB 1V1PA 2WXKA 5FXPA 3GP7A 2PLSA 4RGTA 2ACZB 2XNAC 4J3OD 2LHEA 1I4HA 2W55A 3AEGB 4ML8A 3S1FA 2YVSA 5D3IB 3BK2A 2J53A 1WWTA 1YQ4B 3RPFC 1EWYC 3LYYA 4A8XC 4JB1A 2M0AA 2P13A 1TKYA 1V1PB 2P4PA 4PVKA 1SE2A 1E6EB 4ZOHB 3SR6B 1AHUA 2EXRA 1W1KA 3TSSA 4BC9A 3ETRA 1QOBA 1D5MC 2OEDA 4XE0A 4USAA 4BC7A 3W5VB 2HTME 1I4QA 1N62C 1X2GA 4KX6B 4WQMA 3NVZA 2LEKA 5AE1A 2Q85A 1ET6A 1OQQA 1N5WA 1F77A 2FBWB 2RDHA 4DXGA 2BTEA 1T3QC 2KDMA 1UXYA 3TSHA 1FMAD 2JSVX 3BW7A 1PUTA 4MT5A 2DBYA 1NYRA 1RYJA 1QOFA 3AE3B 1C4AA 4OW0A 2Q5WD 3P4RB 1NI3A 2G1EA 2N0SB 1W1MA 1PGBA 2KACA 3URYA 3T3OA 1D6EC 1J7AA 1JROA 2K9XA 2WXMA 4HROA 1WVFA 3NVZB 2DLBA 4PT5A 3AMZA 2ICIA 2WDQB 2EELA 1FFUA 4RFBA 2BS2B 4B0MA 1E8HA 3A7AA 1ZDVA 3MFGA 4JWSC 1N60A 3EGRA 2IJ0A 1JWBD 3JS8A 1F0XA 3KWVA 1C77A 1JALA 1Y56A 1F2RC 2PVGC 5AUKA 2BVGA 2XN9C 4JX1C 1FCLA 2N7JA 1N61A 5LNK1 1KLGD 2Z8LA 1B9RA 3LXFA 1XO3A 3RJAA 1KLUD 5FXDA 1CJEA 5AWVA 2MBRA 2YEPF 4LTUA 3UI3A 4XWWA 1TS4A 1N62A 4GLSC 3SFEB 1AYFA 4NZLB 1FM0D 1QLTA 3BWUD 5BYQA 4AQ7A 1W1JA 2K22A 3NVVA 3H8HA 4YTNB 1XLQA 2QSDA 1PYWD 4HKZE 3ZYYX 1SJED 3NVWB 4ZRPA 3HSUA 1C78A 1ET9A 4M0WA 4OALA 2K5PA 4O1NA 1ENFA 3B2GA 3U4EG 1XCTL 3ABVB 4XDCA 3E9SA 1W1SA 3V05A 2D5GA 1MI0A 4TQ0A 2LGIA 1T5XD 3POPA 1TZOA 1B1ZA 1VLBA 1FCCC 2IGHA 1FIQA 1VZ6A 4LLGM 2K0PA 2MJ3A 3PQBA 1F2RI 3HVDA 4DQOC 1QKZA 1VRAB 2TSSA 3NVVB 1YMHE 4IDIA 2WXJA 3W2DA 1I4XA 5L6FA 3VRAB 5BMHA 2M56B 2Q4WA 2N9KA 5G5HA 1ZPSA 5GXGB 1JWMD 4KKJA 2SEBD 1QQRA 3AEEB 1EU4A 2BS4B 1YQ3B 4ARIA 2GQUA 3FILA 2K3UA 4DNSA 1FIQB 3W8XA 1JCKB 3AEFB 1C4PA 2KMMA 3KQ4A 1GPXA 2YEPB 2RMMA 2MJEA 3P4QB 3ZJVA 2PLPA 4RNAA 2GQTA 3NRZA 1K52A 2GB1A 2VFRA 3IT6B 1T6BX 2JQRB 1E8FA 1FEHA 4JAYA 1I4GA 2ON8A 2IDYA 3VQIA 1C76A 3EA6A 1K53A 3AEBB 5BMGA 1KH0A 1OFFA 2PTLA 1W1QA 5MPOA 3E56A 4NJCA 3SEBA 1MVKA 2PW9A 4GDKB 4DXFA 5C3JB 3AE5B 3GSYA 3B9JA 1QT9A 4KGTA 2WXNA 3LAEA 2WP9B 3HRDC 1BMLC 1JMLA 1TS5A 2CU3A 1MHXA 4OZBA 3AE4B 2ZW1A 3GB1A 1TKEA 1AWDA 1HZ6A 4BBYA 1HXYD 2DYMA 2Y4GA 4YSYB 3TX1A 1L4ZB 2KAJA 2H88B 3PO0A 4MM3B 4OZAA 1EWCA 1N63C 4ZHOA 3EUB2 3Q69A 2CJNA 2WXQA 4RF0A 1I19A 2L52A 2LJIA 2WLBA 3AE8B 4N6EB 4R3DA 2BB6A 3BYYB 4P6VF 4RGOS 2QKNA 3AE9B 2P3HA 3Q8EA 5BYRA 3ZQ4A 1ZDXA 3HRDD 3AEDB 2JX5A 2WNMA 1JW9D 3R2IA 1QOAA 2MEKA 5H8YE 4RGNA 2IGGA 4TMAB 2Y5CA 1PGAA 1ROEA 3AECB 5TSSA 2R8DA 2J4XA 2JZPA 4TSSA 3ETRB 1D5ZC 5HFYA 4TQ1A 1XLNA 3TEYA 1XLOA 2QILA 1ZXHA 1TS3A 1SB3B 1GB4A 4AS1A 2WXHA 1V97A 4L2YA 5I4DA 3C8YA 4KGSA 5HQXA 2JXTA 4PVEA 1EU3A 1PFDA 3VR8B 2LHDA 5D7GA 4US8A 2GRIA 1VZ7A 4Q2JA 2NTSA 1SF0A 3NS1A 3NUHB 5HI1A 3ZJUA 5FXEA 1TKGA 1TY2A 4PWBA 1XF5L 1HSKA 1DYQA 5K8EA 4JE3B 2IPKD 2ONQA 1D4BA 1KF6B 1AW7A 2WQYB 4YTMB 4A6QA 3A7UA 3T3NA 5G5GA 4KGRA 1GAQB 3ZGZA 1E0YA 4LK0M 2WU2B 2VFUA 2RDGA 4JPSA 4A55A 1PDXA 1KRHA 1HEZE 1SE4A 1MBBA 3Q8AA 2PMVA 2WXLA 2PIAA 1ZXIC 1YN4A 3C0PA 2BW2A 1SJHD 3I57A 4WWMA 3PZ8A 4YWGG 2WS3B 1ACCA 1DOYA 1RM6C 2BB5A 2BVFA 1FD6A 1JWSD 1JRPA 1T3QA 2O3GA 5HHZA 1QOGA 4CQNA 2UUVA 5EE3A 5C2TB 3KWLA 1CQVA 2J42A 1SEBD 3BIID 2VZKD 3VRBB 1N5XA 1JQ4A 3DWMA 1NVID 5ADZA 1XLPA 3S1EA 1P7EA 3FW9A 4N59A 4WAFA 1X2HA 2JYTA 2NMQA 5HMRA 2B76B 4IKGA 2Y5PA 3U2SC 1IGDA 3R07C 5D79A 1DGJA 1JWUD 2J52A 2W3RA 3HVZA 1IBXA 1W1OA 3MHZA 2VFVA 4P16A 5FXFA 5HHDG 2M19A 2HDEA 1P7FA 2W54A 4RF1A 2QIEB 3MJ5A 1XEEA 1SE3A 3KJMA 1E7PB 3AH7A 2WXPA 4MLAA 1WYGA 1BUIC 3D2DA 3NVYA 2Y08A 1FFVC 4PWCA 4ZRQA 3V3XA 3TSJA 2LUMA 1AHVA 2VFSA 1ZE3D 4ZOHC 2MJDA 4H2AA 3AE6B 3MC0B 3S1CA 1MPEA 3I99A 4US9A 3VR9B 1ZXIA 2PKOA 4FXCA 1W1LA 5G5HB 5I1WA 3RFZB 2VZKB 1I4PA 4L1BA 3FILB 4XDDA 3AEAB 2L1AA 4NAWB 3W1SA 3WCQA 1MHHE 4UD8A 2H89B 1IUEA 2W3SA 1WSPA 3I9V1 3R2TA 4HRSA 1YJJA 1CK1A 1DZNA 1VQZA 3NRZB 3AE2B 4ARCA 2Y3RA 1VAOA 3U52E 1SB3C 4ZYSA 3FW8A 4A90A 4C56C 3EUB3 2L32A 5FK9C 1J7BA 1N5WC 1QF6A 2I2YA 2WDRB 3P63A 1L0VB 2PLIA 2DWQA 3IAM1 1PGXA 3P4PB 4HKQA 1RWSA 5FKAC 3S1DA 1YNTE 2PVOD 3B9JB 3GS2A 2BS3B 1J7CA 1FNUA 5H92C 5FR3A 4IOIE 2KQ4X 4YSZB 1NEKB 2G9HD 1E0ZA 3W8ZA 3PM9A 1E9MA 1JWAD 2QEJC 3SR6A 2IPIA 1L5PA 2N9LA 1FFUC 5AUIA 2CJOA 2I38A 1FRDA 4GDLB 1ZR6A 2IGDA 2RK5A 3OWEB 3AE1B 4C7ZA 1KTKA 3KLSX 1N60C 5I1VA 1VDVA 2X38A 3Q8FA 5EE1A 2QPMA 2VAOA 3B2FA 1KFYB 2SAKA 1L0XB 3AE7B 4OZCA 1TJEA 4N58A 1HZ5A 3NZ3A 3SFDB 1YN3A 3IXSA 1LO5D 1QLUA 1A70A 1QILA 1MBTA 1N61C 3P1MA 1K51A 1RFKA 1V1OA 3BVGA 4EC3A 3P42A 4REZA 1VR9A 5BMIA 1XCQL 2L83A 4C80A 4ZHPA 4BCAA 2QMTA 2DYOA 2MH7A 2WXRA 1WGKA 3FAHA 5HG2A 1L6UA 4HG0A 3LLBA 1K50A 1TYGB 2UUUA 1ZOYB 3FC4A 3PZ7A 2ZW0A 2JU6X 2KWDA 2LMCA 4D2KA 1BXTA 2AQ3B 4L23A 1TY0A 5EE0A 2R61A 1N63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVH A;  3AM9 A;  1FO4 A;  4TVW A;  4PVJ A;  5EE9 A;  3P4S B;  4PYT A;  1FRR A;  1FXA A;  1WXQ A;  3NS1 B;  3W9C B;  3VTE A;  3D2J A;  4PZF A;  3DQ0 A;  3L4P A;  1ZUD 2;  1DIQ A;  3HUI A;  2AX5 A;  4A9A A;  1WVE A;  2BVH A;  5G5G B;  3NVW A;  1L6V A;  3W5U B;  3AV8 A;  3AB5 A;  4TVY A;  1UWM A;  2QJL A;  3A7R A;  2I0K A;  2AXR A;  1W1R A;  1E10 A;  1YJI A;  4XLO A;  2VFT A;  2OAI A;  1DOI A;  1FXI A;  1V8C A;  2E5A A;  2OHF A;  1CZP A;  3CIR B;  1NEN B;  5AE3 A;  3LB8 C;  4YTP B;  4C7Y A;  1NYQ A;  2E3T A;  3D2H A;  3CWI A;  1OQR A;  1AHZ A;  3W8W A;  1I7H A;  3DWG C;  1VJK A;  1DII A;  2BT6 A;  3NVY B;  2WU5 B;  2EKI A;  1R7S A;  1DOX A;  4YSX B;  3AN1 A;  4JWU C;  1SIJ A;  4ITK A;  5AE2 A;  2WDV B;  1RM6 B;  3FWA A;  1ZP0 B;  1F0Z A;  4O95 A;  3FW7 A;  4YT0 B;  1E8G A;  3DED A;  2NQW A;  4YXD B;  1WRI A;  1QLB B;  1FFV A;  2R2Z A;  5FXP A;  2PLS A;  2ACZ B;  2W55 A;  3AEG B;  4ML8 A;  3S1F A;  2YVS A;  1WWT A;  1YQ4 B;  3RPF C;  1EWY C;  4JB1 A;  2P13 A;  1TKY A;  2P4P A;  4PVK A;  1E6E B;  4ZOH B;  3SR6 B;  1AHU A;  2EXR A;  1W1K A;  4BC9 A;  3ETR A;  1QOB A;  4BC7 A;  4USA A;  3W5V B;  2HTM E;  1N62 C;  4KX6 B;  4WQM A;  3NVZ A;  2LEK A;  5AE1 A;  2Q85 A;  1OQQ A;  1N5W A;  2FBW B;  1T3Q C;  1UXY A;  3TSH A;  1FMA D;  3BW7 A;  1PUT A;  2DBY A;  1NYR A;  1RYJ A;  1QOF A;  3AE3 B;  2Q5W D;  3P4R B;  1NI3 A;  2G1E A;  2N0S B;  1W1M A;  1J7A A;  1JRO A;  2K9X A;  4HRO A;  1WVF A;  3NVZ B;  3AMZ A;  2WDQ B;  1FFU A;  2BS2 B;  1E8H A;  3A7A A;  4JWS C;  1N60 A;  1JWB D;  3JS8 A;  1F0X A;  1JAL A;  2BVG A;  5AUK A;  2PVG C;  4JX1 C;  1N61 A;  1B9R A;  3LXF A;  1XO3 A;  5FXD A;  1CJE A;  2MBR A;  4LTU A;  3SFE B;  1N62 A;  1AYF A;  1QLT A;  1FM0 D;  1W1J A;  2K22 A;  3NVV A;  3ZYY X;  4YTN B;  1XLQ A;  3NVW B;  4OAL A;  2K5P A;  3B2G A;  3ABV B;  1W1S A;  1VLB A;  1FIQ A;  2MJ3 A;  3NVV B;  4IDI A;  3VRA B;  2M56 B;  2Q4W A;  5G5H A;  5GXG B;  3AEE B;  2BS4 B;  1YQ3 B;  2GQU A;  4DNS A;  1FIQ B;  3W8X A;  3AEF B;  2KMM A;  1GPX A;  2MJE A;  3P4Q B;  2GQT A;  3NRZ A;  2VFR A;  2JQR B;  1E8F A;  4JAY A;  3AEB B;  1OFF A;  1W1Q A;  5MPO A;  5C3J B;  3AE5 B;  3GSY A;  3B9J A;  1QT9 A;  3LAE A;  2WP9 B;  3HRD C;  2CU3 A;  3AE4 B;  1TKE A;  1AWD A;  4BBY A;  4YSY B;  3TX1 A;  2KAJ A;  2H88 B;  3PO0 A;  1N63 C;  4ZHO A;  3EUB 2;  2CJN A;  1I19 A;  2L52 A;  2WLB A;  3AE8 B;  4N6E B;  4P6V F;  2P3H A;  2QKN A;  3AE9 B;  3HRD D;  3AED B;  2JX5 A;  1JW9 D;  1QOA A;  2Y5C A;  1ROE A;  3AEC B;  2R8D A;  3ETR B;  1XLN A;  1XLO A;  1SB3 B;  1V97 A;  5HQX A;  4PVE A;  1PFD A;  3VR8 B;  4US8 A;  1SF0 A;  3NS1 A;  5FXE A;  1TKG A;  4PWB A;  1HSK A;  1KF6 B;  2WQY B;  4YTM B;  3A7U A;  5G5G A;  1GAQ B;  1E0Y A;  2WU2 B;  2VFU A;  1PDX A;  1KRH A;  5EE0 A;  1MBB A;  2PIA A;  1ZXI C;  3C0P A;  4WWM A;  2WS3 B;  1DOY A;  1RM6 C;  2BVF A;  1JRP A;  1T3Q A;  2O3G A;  5HHZ A;  1QOG A;  5EE3 A;  5C2T B;  3KWL A;  3BII D;  3VRB B;  1JQ4 A;  1N5X A;  5ADZ A;  3DWM A;  1NVI D;  1XLP A;  3S1E A;  3FW9 A;  4N59 A;  1X2H A;  5HMR A;  2B76 B;  3R07 C;  5D79 A;  1DGJ A;  3HVZ A;  2W3R A;  1W1O A;  2VFV A;  5FXF A;  2M19 A;  2W54 A;  2QIE B;  3KJM A;  1E7P B;  3AH7 A;  4MLA A;  1WYG A;  3D2D A;  3NVY A;  1FFV C;  4PWC A;  3TSJ A;  1AHV A;  2VFS A;  4ZOH C;  2MJD A;  3AE6 B;  3S1C A;  3I99 A;  4US9 A;  3VR9 B;  1ZXI A;  4FXC A;  2PKO A;  1W1L A;  5G5H B;  3AEA B;  3WCQ A;  4UD8 A;  2H89 B;  1IUE A;  2W3S A;  4HRS A;  1YJJ A;  1DZN A;  1VQZ A;  3NRZ B;  3AE2 B;  1VAO A;  1SB3 C;  3FW8 A;  3EUB 3;  1J7B A;  1N5W C;  1QF6 A;  2WDR B;  3P63 A;  1L0V B;  2PLI A;  2DWQ A;  3P4P B;  1RWS A;  3S1D A;  3B9J B;  2PVO D;  2BS3 B;  1J7C A;  5H92 C;  4YSZ B;  1NEK B;  1E0Z A;  3W8Z A;  3PM9 A;  1E9M A;  1JWA D;  3SR6 A;  1L5P A;  1FFU C;  5AUI A;  2CJO A;  1FRD A;  2RK5 A;  1ZR6 A;  3AE1 B;  4C7Z A;  1N60 C;  1VDV A;  5EE1 A;  2QPM A;  2VAO A;  3B2F A;  1KFY B;  3AE7 B;  1TJE A;  4N58 A;  3SFD B;  1QLU A;  1A70 A;  1MBT A;  1N61 C;  3P1M A;  1RFK A;  4EC3 A;  2L83 A;  4C80 A;  4ZHP A;  4BCA A;  2MH7 A;  1WGK A;  3FAH A;  1L6U A;  4HG0 A;  3LLB A;  1TYG B;  1ZOY B;  3FC4 A;  1X2G A;  5H8Y E;  1N63 A; 
#chains in the Genus database with same CATH topology
 4HEA 1;  1HJP A;  1TK0 A;  1ZQL A;  1S1Q B;  3IK4 A;  4PH5 A;  1LV5 A;  4O3S A;  3WK4 A;  3Q8C A;  2R8G A;  2JMG A;  4ACF A;  2XO7 A;  4EKU A;  5D4B A;  4PYT A;  1SJC A;  1P7D A;  4RQ5 A;  5EU9 A;  2RHF A;  4I2A A;  4HDQ A;  2O56 A;  2RRD A;  2I1K A;  1KLN A;  4R66 A;  2CXY A;  3D2J A;  3SAH A;  3H4D A;  2MU2 A;  2B21 A;  4ECV A;  4MH8 A;  1X66 A;  5T8I A;  3C2M A;  1ZUD 2;  2XH0 A;  3RF9 A;  2M8S A;  4RH6 A;  5JXV A;  5KFD A;  1C4C A;  3ZLH A;  3PFR A;  3PW4 A;  3CMM B;  4WUR A;  2Z0D B;  2IO0 B;  2E6X A;  4UDU C;  3EFC A;  5B5E U;  1ZX9 A;  3C2L A;  2BYT A;  5DGA A;  2JEI A;  4HPM B;  2AXR A;  1W1R A;  3O13 A;  2KEY A;  1ZQJ A;  1MN8 A;  3U7Z A;  2HJ8 A;  4XLO A;  2IZV B;  1D9F A;  1HTO A;  4I27 A;  3QU4 A;  2YN4 A;  5KFL A;  2HD5 B;  3QAQ A;  4FA6 A;  2YVJ A;  4M9N A;  2KFK B;  4YWO A;  3N30 A;  3PV8 A;  2KX0 A;  2I6X A;  3NY5 A;  3BZK A;  4S17 A;  3N6J A;  2G5H B;  3FKY A;  1FXI A;  3L13 A;  1V59 A;  3KHR A;  4F71 A;  3PSE B;  5KFR A;  3ZJT A;  1KOT A;  2WGS A;  2WXG A;  3Q8B A;  2OHF A;  2ASJ A;  2FE8 A;  1E8W A;  2K4H A;  3LB8 C;  2KFZ A;  2EZX A;  4F5O A;  2Z59 B;  4YTP B;  2OQH A;  4GXI A;  5KFQ A;  1TFR A;  2E3T A;  2W9N A;  1EM7 A;  2FNJ B;  2KK8 A;  3VTV A;  3D2H A;  3CYJ A;  2BQR A;  5KFB A;  1OQR A;  4KN7 A;  2V3P A;  2YY6 A;  4FO6 A;  4PGX A;  2UVU A;  1C9F A;  2JYE A;  4PS3 A;  3W8W A;  1SL0 A;  4ZYN A;  4YXM A;  4H4V A;  5AM5 A;  5J2C A;  2L7R A;  2DW6 A;  3BJS A;  2R8H A;  2V4L A;  1FNW A;  1ZDL A;  1RYR A;  1NHR A;  1GO3 F;  2EH9 A;  1DOX A;  2W0H A;  2W82 A;  5JCK A;  3SAF A;  1LKY A;  1COK A;  1RRB A;  4RUA A;  2H3I A;  1WXA A;  2GBJ A;  2RD0 A;  3BVM A;  3HHM A;  1PDY A;  4KX5 A;  2PI4 A;  1ZQP A;  5AE2 A;  5ALE A;  5IIM A;  1Q10 A;  2WDV B;  3ZDA A;  3IJL A;  5ALZ A;  1YD8 U;  2C7H A;  4H4Q A;  1RM6 B;  3WK7 A;  2VA2 A;  1SSN A;  2MBQ A;  3UPQ A;  2HI0 A;  2LFI A;  3CGD A;  2K8A A;  1FNV A;  1UF0 A;  5LXI B;  2EQY A;  3DH9 A;  3WKC A;  4H4Y A;  3J9C A;  3DED A;  1K1S A;  1HA5 A;  1BNP A;  7ICR A;  4O5K A;  3GO2 A;  2XK5 A;  5HML A;  2WF6 A;  1X2I A;  4MM3 A;  2W43 A;  3QQ8 B;  4E3C A;  4YXD B;  5L6G A;  2HBJ A;  4Q44 A;  2WXK A;  4QZ9 A;  3VH4 B;  5FXP A;  2JK6 A;  1MDL A;  5DB6 A;  3PRZ A;  3U9I A;  2KE7 A;  5J0S A;  3H4B A;  3V5C A;  4F4K A;  2F8K A;  1TIF A;  2LHE A;  9ICC A;  3DG6 A;  1BT0 A;  4LNO A;  3MAB A;  4F91 B;  5D3I B;  3ZXV A;  4ANU A;  2QQ6 A;  5U1O A;  5JCM A;  1AOG A;  4GGQ A;  1YQ4 B;  3PO4 A;  4W9E A;  3RPF C;  3UXL A;  3UIN B;  3QN3 A;  3PO5 A;  3CSF A;  5ALL A;  4R63 A;  1TKY A;  3WK5 A;  1WMH A;  3R11 A;  1K8R B;  2OXO A;  2ZIX A;  4DWF A;  4ZOH B;  3SR6 B;  3RB0 A;  3ETR A;  3MDA A;  4KWS A;  1D5M C;  1S9F A;  4BC7 A;  4CNQ A;  3Q8L A;  4H2H A;  3W5V B;  4K1W A;  5LLI A;  3LYS A;  3DK4 A;  2HTM E;  1I4Q A;  3WIM A;  1UPH A;  3UXN A;  4MEX A;  5AK4 A;  2DEN B;  3NVZ A;  4LZD A;  4C4R A;  2LEK A;  2Q85 A;  5AE1 A;  3PVL A;  3PVX A;  3APD A;  5E6P A;  5IIK A;  2JSV X;  3L8K A;  1H8C A;  3X23 A;  3AXC A;  1XSP A;  1PUT A;  1BWC A;  1OJT A;  1NYR A;  3ES8 A;  1QOF A;  2KKP A;  4FBT A;  4FBJ B;  4IQU A;  4DNA A;  2G1E A;  3ZD8 A;  4J9R A;  4NNJ B;  3UQB A;  3IHQ B;  1PGB A;  4PS8 A;  2P88 A;  4IR9 A;  1IPG A;  1J7A A;  1JRO A;  3TCS A;  4HRO A;  3S6J A;  2HMX A;  3MSY A;  1B0X A;  4K7W A;  4K4H A;  5HR7 A;  3ZLZ A;  3EW9 A;  4QWC A;  2EEL A;  2PPG A;  4E4U A;  2NRX A;  4DFD A;  3PLV A;  3UXP A;  1ZDV A;  2IOF K;  3MFG A;  4EMW A;  4NJ8 A;  3OLM D;  4W9D A;  4AJW A;  3EGR A;  4DHJ D;  1ZRN A;  3WAL A;  3DGZ A;  2XCA A;  1OTR B;  4P0Q A;  3WKB A;  2PE9 A;  2UU7 A;  4RMA A;  3Q3F A;  3DV9 A;  1WR1 A;  4BZA A;  5C1Z A;  5F3X B;  5ALW A;  1Q0W B;  1AQ6 A;  1Y56 A;  2PVG C;  3KWV A;  4PS7 A;  2NPX A;  1KEJ A;  3CXB A;  4ENL A;  4KLJ A;  3TCA A;  1FCL A;  1Z1V A;  2L0T A;  1N61 A;  5LNK 1;  3CYM A;  5HMM A;  2IYD B;  8ICM A;  2IBK A;  2IY0 B;  3ZRF A;  5DB7 A;  8ICH A;  1KLU D;  5DG8 A;  3N1Z C;  1RVK A;  2OO6 A;  1CJE A;  2KXJ A;  2MBR A;  1D7Y A;  4EBE A;  1ZW7 A;  4HAI A;  4WAA A;  2WP5 A;  1FM0 D;  5AI0 A;  5BYQ A;  4AQ7 A;  3NVV A;  1VJ5 A;  4YTN B;  1Z19 A;  1XLQ A;  5KHO A;  2W9A A;  3F5E A;  3ZYY X;  2PU1 A;  4NLK A;  2LGD A;  2K5P A;  3NTU A;  1ZQY A;  2MRL A;  2OG9 A;  3U4E G;  3DBL I;  4IC9 A;  4LNK A;  1IIP A;  4XDC A;  8ICK A;  4NPN A;  4TQ0 A;  1J2N A;  4PHD A;  3POP A;  1KBU A;  1FCC C;  2A5U A;  5ALM A;  2K0P A;  3ZXR A;  3MY9 A;  1WWU A;  3DHI C;  3TAN A;  3H8W A;  2YLM A;  1Y8R C;  2ZIW B;  5AKI A;  1YMH E;  2MBB B;  3W2D A;  4PL1 A;  5KFK A;  2NO5 A;  9ICW A;  1I4X A;  2MA9 B;  1LXD A;  5BMH A;  4A6G A;  4KZ0 A;  2ZG6 A;  3QWZ B;  4YD2 A;  3R9K A;  4J1O A;  5KT5 A;  4E4F A;  2CN1 A;  4M2Y A;  4UB2 A;  4KKJ A;  2YQU A;  3ICX A;  4JWM A;  3T5K A;  9ICA A;  4IQT A;  3PY8 A;  4RQ7 A;  3HX0 A;  3KKA A;  4XZ4 A;  2NQL A;  4Q8F A;  4IL6 U;  1LFD A;  4KPR A;  9ICP A;  3KQ4 A;  3UQA A;  5KFN A;  2RMM A;  5J2B A;  3P4Q B;  2R8J A;  2VAN A;  4KZC A;  3TAD C;  1Q1W A;  2F3N A;  3NRZ A;  4F8C B;  1K52 A;  1TZ1 A;  2D3B A;  2WBA A;  1NHS A;  2JQR B;  2QB1 A;  5DG9 A;  1QZE A;  3B08 A;  1FEH A;  3JSV A;  4JAY A;  1NK7 A;  4ZRJ A;  1GSN A;  1TKK A;  2OZT A;  2ZNV B;  1Z00 A;  2DZK A;  3GD3 A;  3LK9 A;  4EFO A;  1OFF A;  4DSJ A;  4M6W A;  3M62 B;  4U7C A;  3SEB A;  3UJR A;  1EF1 A;  2PW9 A;  1KCZ A;  4FS1 A;  2I5H A;  4M8N A;  3JW7 A;  1R4N B;  1WE6 A;  2POD A;  3RR7 A;  4IRD A;  3MTN B;  4KGT A;  2LVO A;  2KNJ A;  4XGA B;  1GRG A;  2ODG A;  2PP3 A;  3ALR A;  2P8C A;  4W9G A;  2CU3 A;  2C7N B;  4RUC A;  4TV3 A;  4IP4 A;  4EZL A;  4JIO U;  1ZQZ A;  4ED0 A;  4DFJ A;  4BBY A;  1HXY D;  3GOE A;  2YB1 A;  3SDL C;  3TX1 A;  3PW7 A;  3EAN A;  2KAJ A;  4LA1 A;  1MFW A;  2BYF A;  4TUS A;  2WDT B;  3Q69 A;  2BPS A;  1WFY A;  3ZD9 A;  1Z1B A;  4ELV A;  4F2R A;  4ACO A;  4TUU A;  3T8Q A;  5ALI A;  2XGP A;  3ZVI A;  2IOF A;  2DFL A;  4YXJ A;  1I19 A;  5DPW A;  2OFJ A;  2L52 A;  3OHB A;  9ICG A;  4HCN B;  1KD0 A;  1KRP A;  2CPR A;  2WLB A;  3AE8 B;  2MUC A;  4UAU A;  4BXO B;  3BYY B;  4NEV A;  4NQL B;  3RCY A;  4BWJ A;  3N7R C;  5AHX A;  1ZDX A;  3HRD D;  3IJQ A;  3ZLG A;  4H83 A;  2WNM A;  1L7N A;  1JW9 D;  3R2I A;  3UJS A;  5ALX A;  2MEK A;  4BKS D;  8ICA A;  2IGG A;  3WAM A;  2BCP A;  4LZG A;  3DK8 A;  2E5S A;  2EAM A;  1PGA A;  2EZY A;  1XSN A;  4LCD E;  4RM9 A;  1UT5 A;  1X9M A;  3Q8P B;  4IWQ A;  2ZZ0 A;  2R8D A;  4C0Z A;  1D5Z C;  2ALZ A;  4IM0 A;  4B6J A;  2GDQ A;  3L10 B;  1XLO A;  1F5S A;  2AL1 A;  1ZXH A;  3OW1 A;  1U4B A;  1U9L A;  2H3V A;  8ICQ A;  2WXH A;  4L2Y A;  5I4D A;  3C8Y A;  5J0P A;  2HHV A;  2JXT A;  2AEH A;  5D7G A;  4TQS A;  1VZ7 A;  2ZTE A;  2NTS A;  1J0G A;  3DGH A;  3NS1 A;  1NKC A;  2UVV A;  3DVG X;  2GL5 A;  4ECR A;  1X1M A;  3QNM A;  4DL6 A;  5FS7 A;  5D46 A;  4ASW C;  3N28 A;  4RQ4 A;  4QJF B;  4YN4 A;  2Y1J A;  4JK1 A;  1RLF A;  4DFM A;  1XD3 B;  4O5C A;  3GV8 B;  2D6F C;  1NNL A;  5KG5 A;  4LJX A;  4LVS A;  3LDZ E;  4YTM B;  1JI7 A;  4KLF A;  2HDO A;  4YD1 A;  2KJ8 A;  1MG8 A;  4CF3 A;  4QWE A;  4W9J A;  2W8K A;  3VC5 A;  4BOS C;  4ZRI A;  1E0Y A;  2WU2 B;  4MEM A;  2KSO B;  1WM3 A;  4JPS A;  4II2 B;  1V5O A;  1KRH A;  1ZQQ A;  1V81 A;  4GIV A;  5IA7 A;  2OJR A;  2ZCC A;  1ZMC A;  3NZS A;  4HLE A;  1SJH D;  2C2R A;  5AKL A;  4WWM A;  3Q3J A;  3WAN A;  3VCB A;  5ALV A;  2OX4 A;  2PP1 A;  3U8Z A;  3R0K A;  2NRW A;  2GWS A;  1JWS D;  4FE3 A;  4UAR A;  1TV9 A;  3OTQ A;  1SL2 A;  4I2F A;  2HHQ A;  5EE3 A;  3M9O B;  1QSY A;  2VIX A;  3PHW B;  2J6S A;  1I35 A;  1SEB D;  3VRB B;  1N5X A;  2YMM A;  3IN5 A;  5IDZ A;  9ICH A;  3N1X C;  2K4E A;  3CGE A;  3V6K A;  3QEB Z;  3FW9 A;  2Q0Z X;  4WAF A;  2AL2 A;  2QHO A;  4F7Z A;  2JYT A;  2KC2 A;  4A20 A;  5AKH A;  2QDD A;  3Q14 C;  2BVC A;  2N4F A;  3R07 C;  1DGJ A;  4IT1 A;  4K2S A;  1JOA A;  2B3A A;  3L16 A;  4M8M A;  1IBX A;  2W11 A;  2Y9T A;  4MSM B;  1W1O A;  3AU4 A;  2JV3 A;  2P35 A;  5FXF A;  3VA8 A;  2GQW A;  2O6V B;  4B9K A;  2M19 A;  2JGA A;  2HDE A;  4EWJ A;  3C5G A;  1EC8 A;  2W54 A;  4RF1 A;  3V5F A;  4ZRK A;  2LBO A;  4G0N B;  1XEE A;  4EZJ A;  3H8S A;  1COO A;  1H2I A;  4FJY A;  4N9F 4;  2JXX A;  1CEZ A;  3HWT A;  3H70 A;  1GC6 A;  1WXS A;  2VH2 A;  4NAW A;  4NJ6 A;  4FZL A;  3NVY A;  1FFV C;  2V3A A;  3MUC A;  2BPF A;  4ZRQ A;  5J2J A;  1JPD X;  1TK8 A;  2LUM A;  1Q3U A;  1AHV A;  2KDI A;  1DK3 A;  3KHG A;  3ZNH B;  3KH0 A;  2LRW A;  5JCL A;  1VD2 A;  4R8U A;  2ZPY A;  1SV0 C;  2OLA A;  2XGZ A;  2PKE A;  1NKE A;  4FXC A;  4EQS A;  2GH1 A;  5G5H B;  5HNK A;  2LGS A;  1KTQ A;  3RN9 C;  3VXW A;  4JUZ A;  4G3I A;  3DHG C;  4KDL B;  3A9J A;  3RTV A;  3W1S A;  3MR3 A;  2H89 B;  4DS5 A;  3URH A;  3PWI A;  2DKZ A;  1WSP A;  4M9H A;  5JU5 A;  3I9V 1;  2WOV A;  4LII A;  3R3M A;  2FIF A;  5AEK B;  4KV2 A;  4J9M A;  5CHF A;  4BAX A;  5ER0 A;  4XUS A;  2BYV E;  4F4Y A;  7ICU A;  1VAO A;  5KAI U;  3FW8 A;  4A90 A;  4EYI B;  2PFN A;  2PEA A;  8ICB A;  3EUB 3;  5KFI A;  5FK9 C;  2D11 A;  3MBY A;  2GGH A;  1NK8 A;  1ZQS A;  2BCS A;  3MKC A;  4DFP A;  1L0V B;  4JGH B;  4K7Z A;  3GIK A;  4F4W A;  3IAM 1;  5DBA A;  1PGX A;  4RQ1 A;  1SWV A;  4KX3 A;  1S3S G;  1DTN A;  1E7U A;  5FKA C;  3CNH A;  2GLE A;  3S1D A;  5FJR A;  2ZVN A;  4O3R A;  4RNM A;  1HIW A;  5H92 C;  2EMT A;  1WUE A;  4CGZ A;  5HR6 A;  1T0S C;  4FFD A;  2G9H D;  4I2J A;  3PM9 A;  3H7I A;  1E9M A;  1FEA A;  3T5J A;  4WJP A;  4JQ9 A;  4RQ6 A;  1X40 A;  4KIK B;  1ZQ1 C;  5DLF A;  2CJO A;  1S77 D;  3QIJ A;  4F4R A;  4DSI A;  2IGD A;  2KJ5 A;  2QAR B;  4PL2 A;  3KLS X;  3RNG C;  5JH5 C;  2HZG A;  3CK5 A;  4TUP A;  1XU4 A;  5I1V A;  3Q8F A;  5EE1 A;  5AKY A;  1L0X B;  3RMK C;  3TMP B;  1TJE A;  4NY0 A;  2KTQ A;  2G4S A;  3I6E A;  3SFD B;  1LO5 D;  3GZF A;  4UQG A;  3P1M A;  1RFK A;  1T0Q C;  3GE3 C;  1PVP A;  4GXB A;  1GRB A;  3QKE A;  4QZB A;  3QZ8 A;  3P42 A;  4REZ A;  4IL0 A;  4OD0 A;  5AK5 A;  3GD4 A;  5BMI A;  1XCQ L;  7ICT A;  1S76 D;  1ZD4 A;  3Q8R B;  1V49 A;  1WI0 A;  2QMT A;  3T79 A;  2MH7 A;  2KP7 A;  2JZ3 B;  5J0R A;  1H38 A;  3D46 A;  3A0H U;  2CKH B;  1U47 A;  3HM6 X;  1NEL A;  4F4Z A;  2IHM A;  7ICF A;  4GOC A;  1K50 A;  2K1F A;  2ZJA A;  4WJO A;  1TYG B;  5IIN A;  3RYT A;  2ZW0 A;  4NV0 A;  3CP8 A;  4DLG A;  2JU6 X;  4P1B C;  3A1Q B;  1SJD A;  4FHJ A;  1N63 A;  4M0A A;  2MSN A;  3AM9 A;  3TIX A;  1ECW A;  3H0R B;  1FO4 A;  2WB1 C;  3QJZ A;  7ICM A;  4ZH4 A;  5EE9 A;  2BPG A;  2G4D B;  3PPA A;  4EQR A;  4HCD A;  1D3Z A;  4C4V A;  3GE8 C;  3VH3 B;  1XWL A;  1A77 A;  3R0U A;  2ZJ8 A;  1ZOL A;  4FJV B;  3VTE A;  4MGG A;  3DQ0 A;  5D94 A;  1AN8 A;  3MGV A;  4BFR A;  2FPM A;  1X9X A;  3I28 A;  4KLU A;  4DF4 A;  4NLG A;  1DIQ A;  2I9G A;  2AX5 A;  4CCH A;  4B0E A;  2K60 A;  4EE2 A;  2HHU A;  4RQ0 A;  2INP E;  4KLS A;  3MP9 A;  1ZMD A;  3WKD A;  3CST A;  3AB5 A;  3ENE A;  1D8B A;  2D3G A;  4HJK A;  2FYM A;  2QJL A;  3Q3M C;  2R2Q A;  4RQ3 A;  3BS5 B;  1X9W A;  2I0K A;  2KN7 A;  1J8C A;  2WDW A;  2LGX A;  3WA0 A;  5JCN A;  2NTT A;  4IC7 B;  3BQ1 A;  4RGM A;  2NPT A;  4KPL A;  2KTR A;  5TR5 A;  4A3O A;  2V3N A;  2VJ4 A;  2E8O A;  2E1E A;  4Z1Y A;  7ICP A;  3WKA A;  4URK A;  1D8L A;  8ICG A;  2V4I B;  2WYQ A;  1V8C A;  4XC2 A;  3FG2 P;  4ADW A;  2KKC A;  1UCV A;  4JMU A;  1XS2 A;  2DHZ A;  2MLB A;  2JF5 A;  2LHT A;  1ZD2 P;  5ALP A;  1ZQU A;  5AI6 A;  4R64 A;  3CIR B;  5G2N A;  3PGE A;  1DNC A;  2LVQ A;  3EHV A;  1NEN B;  3M7D A;  1NYQ A;  2R8K A;  3TEZ A;  5D2M B;  4DHG A;  1N48 A;  2KHQ A;  1C79 A;  3PZD A;  1TAU A;  2OVL A;  1AHZ A;  7ICQ A;  1I7H A;  2M1M A;  3DWG C;  5J2R A;  1VJK A;  2KN4 A;  4W9H A;  3DES A;  5JZE B;  1VZ8 A;  4KLO A;  3DBH I;  5FMH A;  3HKZ C;  2KIW A;  2MWS B;  2O2V A;  4K3B A;  1R7S A;  1SBB B;  4YSX B;  2FMP A;  3BJY A;  3FV9 A;  3E58 A;  1FEC A;  3M3J A;  5E6J A;  4DO9 A;  4ANX A;  1DXL A;  2GR1 A;  5E6O A;  2DAF A;  1L7M A;  4NWI A;  2INN E;  5J18 A;  5BOL A;  4IRC A;  3DHH C;  3HJE A;  3ZO5 B;  2V0G A;  2ZUB A;  2HHW A;  3M1Y A;  1TS2 A;  4XWT A;  1PK1 A;  5FS9 A;  3ML9 A;  1ZP0 B;  4GYP A;  3JPQ A;  1F0Z A;  3TJ4 A;  2LYB A;  2GMI C;  1HEK A;  4DDI D;  4TUQ A;  1LKY B;  1ZQN A;  2C2D A;  4NL9 C;  3BSM A;  4FP1 A;  3BK1 A;  2RDI A;  2V9W A;  4PHE A;  4EEY A;  2Y0S C;  1NJZ A;  4LNF A;  4DQP A;  2FUG 1;  2JVC A;  5ALQ A;  2M17 A;  2R2Z A;  1V1P A;  4RT2 A;  9ICE A;  2PLS A;  4UAS A;  1MDR A;  4RGT A;  3LWL A;  1E5W A;  3Q6J A;  5GMV A;  2NO4 A;  3IRU A;  4Y2R A;  4RZR A;  2KFN A;  3PLU A;  3UJ2 A;  4ELT A;  1I4H A;  3ZVV A;  3KOO A;  4K4I A;  4ML8 A;  2YVS A;  4W9L A;  3NHE B;  3QU2 A;  3BK2 A;  2J53 A;  1WWT A;  3PR5 B;  5JHA A;  5K4L A;  1MA7 A;  2HHS A;  5KFV A;  2XK5 B;  2KDE B;  3SQS A;  2J6T A;  2G5I B;  5CP2 A;  2MUT B;  4LJP B;  2GBR A;  4KLQ A;  1GRT A;  3M6Z A;  3ONN A;  2BWE S;  4GME A;  1CRX A;  1ONF A;  2FLN A;  1RG6 A;  1KLV A;  4J56 A;  2P4P A;  3OJ3 A;  3WK9 A;  1E6E B;  4H4T A;  3GV5 B;  2EXR A;  2P3Z A;  3ZVH A;  1ZQO A;  4M9J A;  4I2D A;  2C60 A;  3RJF A;  4USA A;  3EPG A;  4BDP A;  4MJS B;  1N62 C;  1QQ6 A;  2BC1 A;  4Z6E A;  3QA8 A;  1XQQ A;  4KX6 B;  3RB3 A;  1PZN A;  4Y2J A;  4GFJ A;  1ET6 A;  1N5W A;  3QFB A;  4UB1 A;  2AL6 A;  4DXG A;  1T3Q C;  1UXY A;  3SN0 A;  2KQS A;  3BQT A;  3BW7 A;  4IRK A;  3IG5 A;  4I2E A;  1LM8 B;  1WMH B;  4G9B A;  1RDF A;  4EZ9 A;  4OW0 A;  4EBD A;  2NBU A;  2Q5W D;  1RQN A;  1V5T A;  3P4R B;  4MGI E;  3Q45 A;  2N0S B;  1W1M A;  4EZ6 A;  2MBO A;  2KAC A;  3URY A;  2ZUC A;  2JRI B;  3F53 A;  5ENL A;  3EJB B;  3C1Z A;  1OW5 A;  3NVZ B;  4AYB F;  2DLB A;  2KMD A;  2OYY A;  2QJJ A;  2ICI A;  2OKT A;  4EM3 A;  1FFU A;  4F2S A;  2M4N A;  3A7A A;  5ALG A;  3IG8 A;  1XO1 A;  3RJI A;  1N60 A;  2HOF A;  1L3U A;  2IJ0 A;  3DDM A;  2P66 A;  3KYC D;  3QAR A;  4IQV A;  4GLX A;  2OH2 A;  5A0L A;  1C77 A;  1YZ6 A;  4ED2 A;  4I6N B;  4HVB A;  2BVG A;  2V6O A;  3V7L A;  4DL7 A;  4JDR A;  3VDG A;  3B97 A;  2N7J A;  3Q2A C;  5CHW A;  1J19 A;  5ALR A;  2Z8L A;  1B9R A;  2KG5 A;  3PW2 A;  3LXF A;  2AGQ A;  2RDJ A;  5ALO A;  2PPH A;  3SU8 X;  4DXK A;  2ESE A;  2Z7J A;  4A35 A;  3EC8 A;  1NOM A;  5AWV A;  2JPH A;  4XWW A;  3SFE B;  1N62 A;  4P0Q B;  2K6D B;  4GLS C;  4Y2P A;  4UAY A;  4I6P A;  3AU6 A;  2L05 A;  4NZL B;  5IN7 A;  4PYU A;  4MGK E;  3R7Q A;  2WF5 A;  1L7P A;  3NRW A;  5T14 A;  4K1R B;  3NVW B;  2WX0 A;  4ZRP A;  1ET9 A;  4G8T A;  4OAL A;  4QWA A;  7ICH A;  4O1N A;  3RJJ A;  2A19 A;  1UGM A;  2BQ3 A;  2XCP A;  4P2H A;  1SKW A;  2B0C A;  5KFP A;  2F8L A;  1WGY A;  3V05 A;  2YVF A;  4MFC A;  3PRM B;  1UHU A;  2IGH A;  1FIQ A;  5KT4 A;  1VZ6 A;  2IO1 B;  3RFA A;  2MJ3 A;  4OJL A;  2RQ5 A;  1F2R I;  3CF6 E;  3APC A;  3HVD A;  3FM9 A;  3OP2 A;  3NVV B;  4B9T A;  4IDI A;  3QZ7 A;  4II3 B;  2N9X A;  2MA1 A;  1GRA A;  2M56 B;  4J9Q A;  2N9K A;  4PGQ A;  1S0N A;  5JRB A;  4EZK A;  5L1J A;  1ZPS A;  2SEB D;  2KJ6 A;  1YQ3 B;  4ARI A;  2GQU A;  3FIL A;  2K3U A;  5ALN A;  4Y2S A;  1TAM A;  8ICT A;  3H0L B;  4PHP A;  4BJQ A;  3WKE A;  3TKA A;  1C4P A;  2KMM A;  3WK8 A;  3N7S C;  4ZA0 A;  3SMV A;  4GDK A;  4W9K A;  2YQE A;  3I3T B;  4RNA A;  2P6R A;  1PUZ A;  1SWW A;  1PVQ A;  3IG3 A;  4GMV A;  2N1W A;  3VC8 A;  1T6B X;  2X8G A;  2K39 A;  1I4G A;  1BGX T;  1K4Q A;  1ZQA A;  2ON8 A;  3F2B A;  3PNC A;  8ICY A;  3EA6 A;  4S0R A;  1PQS A;  4YR2 A;  4IR1 A;  4RNN A;  2DGZ A;  3JPR A;  4AWJ A;  4YFK A;  2NRV A;  7ICN A;  2N1R A;  4YMO A;  2C2E A;  2PMQ A;  3BQ2 A;  4O3N A;  4H4W A;  3B9J A;  5KG3 A;  4QZG A;  3C1Y A;  4YMN A;  3A9K A;  3LB8 A;  2R8I A;  3AEV A;  3NJT A;  1HUO A;  4CF5 A;  1V6E A;  3HRD C;  5FS8 A;  3JSV B;  4J57 A;  2W7O A;  4AJY B;  3AE4 B;  1E8Z A;  3PW5 A;  5KFG A;  2KZM A;  3DIP A;  2ZW1 A;  1XPY A;  3GB1 A;  1TKE A;  4M6W B;  5FJP A;  3ORY A;  3L17 A;  2DYM A;  3D32 A;  2Y4G A;  4YSY B;  3PZP A;  4F50 A;  4LDT B;  1EWC A;  4I28 A;  3H9D A;  3PV1 A;  1QLN A;  4P4M A;  4ZHO A;  3RIT A;  4PPX A;  4NLZ A;  2W8L A;  5JCI A;  3B0A A;  2K8C B;  3MJW A;  2R2O A;  3V60 A;  5III A;  2PE6 B;  5CB1 A;  2F1J A;  5J0O A;  5BOM A;  4N6E B;  2DKX A;  4QAY A;  4R3D A;  2EAP A;  1WR6 E;  5ALD A;  2BZF A;  5BYR A;  3OPS A;  4UW9 A;  3V6H A;  2ASL A;  1JXE A;  3OJU A;  4MGY E;  3TBL D;  1ZRM A;  3VAW A;  4C8O A;  2JX5 A;  4QWB A;  2W9B A;  2JEJ A;  1MJD A;  2HSZ A;  2M0X A;  4RQ8 A;  2W7P A;  3SD5 A;  3ECI A;  3KUC B;  4B95 A;  1NHQ A;  4J3Z A;  3EPI A;  3GQC A;  1WGR A;  4X57 B;  3RNB C;  5TSS A;  4TSS A;  3OPX A;  2F77 X;  5HFY A;  4TQ1 A;  3SV3 A;  4YG2 A;  4C8K A;  3PML A;  4H4S A;  2UWQ A;  5HQX A;  1T94 A;  4A8E A;  4OVU A;  2N7E A;  3RD2 A;  2QB0 B;  5KG7 A;  1PFD A;  2LHD A;  4AOF A;  3DFY A;  4BKS A;  2QJM A;  4Y2U A;  3DVN U;  3DG7 A;  2GO7 A;  1FEZ A;  1TY2 A;  1E9I A;  1SXD A;  1JN3 A;  1ZGU B;  3I4K A;  1JIH A;  2HW3 A;  2ONQ A;  4EX7 A;  3R25 A;  1E8X A;  3GD6 A;  2H5X A;  3RR8 A;  1STZ A;  3CGC A;  1AW7 A;  1TT5 B;  2WQY B;  3MQT A;  2I5Q A;  2AAQ A;  5DKW A;  4EUT A;  1ZKQ A;  3ZGZ A;  4MMW A;  3TW9 A;  2PTW A;  4A55 A;  4EX6 A;  4JWN A;  1A0P A;  1HEZ E;  1MBB A;  3Q8A A;  3PMN A;  2WXL A;  2PIA A;  1ZXI C;  1YN4 A;  4F1S A;  1KQQ A;  2G3Q B;  1ZQC A;  1RM6 C;  2BB5 A;  1B43 A;  1JPM A;  4B9M A;  4FS2 A;  2C22 A;  3QUB A;  2NR2 A;  3H1U A;  4K7S A;  2O3G A;  1QOG A;  4IM3 A;  4DSL A;  4MSQ B;  5C2T B;  1JEH A;  9ICJ A;  2VZK D;  2PA6 A;  2H3Z A;  3DWM A;  3TJI A;  3Q3N C;  2N9P C;  2VA3 A;  2ZAD A;  1P7E A;  4N59 A;  1BQG A;  4MKS A;  5ALJ A;  1X2H A;  4K81 A;  3SAG A;  3PT2 B;  3GIL A;  1GRF A;  5HMR A;  2B76 B;  4RT3 A;  4IKG A;  5J2K A;  2Y5P A;  4YCX A;  5D79 A;  5CWR A;  3IFW B;  3CXO A;  3RO6 A;  1JWU D;  2W3R A;  4M0W B;  3U7D A;  4RPZ A;  4YVZ A;  5HHD G;  3VUY A;  4F5P A;  4NM2 A;  2KQ7 A;  5KG0 A;  1LQB A;  1P7F A;  2W9C B;  4E5T A;  4F8R A;  1BPE A;  2HOI A;  1SE3 A;  3TWB A;  3SZ2 A;  3LVW A;  1P3Q U;  3KJM A;  1OEY J;  2WXP A;  4EMI A;  5ALU A;  4YP3 A;  4ECT A;  1KDH A;  3MR2 A;  2LMR A;  3T5L A;  3RZW C;  1L3V A;  4KLE A;  1BKH A;  4GC6 A;  5DPT A;  1ZE3 D;  2A4Z A;  4ZOH C;  2MJD A;  4H2A A;  1EBD A;  2ZIV B;  3C19 A;  3AE6 B;  4WJN A;  1SZH A;  5DPS A;  6ENL A;  4DSF A;  3I99 A;  4EOY A;  1ZXI A;  4RQM A;  2XY6 A;  3RFZ B;  5L9X A;  1J97 A;  4EBC A;  7ICV A;  4L1B A;  4NAW B;  3WCQ A;  1MHH E;  2GH5 A;  5L95 C;  1NK6 A;  1HTQ A;  3VUX A;  3V6J A;  4HRS A;  1QTM A;  2C3D A;  2GR0 A;  2CS4 A;  4NEW A;  3BQ0 A;  3K9O B;  2LAS A;  4JB3 A;  2EQ8 A;  1NPX A;  8ICV A;  2Y9U A;  2KVR A;  4G3X B;  2Y3R A;  2M0N A;  3C5F A;  1Z4O A;  3M8S A;  1TGZ B;  2EQ7 A;  1SGH A;  3K75 D;  3C0R B;  3DOW A;  5TR3 A;  2L32 A;  3GC2 A;  4Z6F A;  2AXT U;  4PHA A;  1UH6 A;  4O3P A;  2I2Y A;  4YWS A;  4HYK A;  3P63 A;  5J2E A;  4J9S A;  2CHX A;  2FCN A;  1YX6 B;  1L8P A;  4GDL A;  3UJF A;  1LVH A;  5AKJ A;  3LXD A;  5KL1 B;  3WAO A;  4CF4 A;  1YNT E;  1LVL A;  8ICW A;  3RNF C;  3JVZ X;  3TI0 A;  4BKT A;  4NLC A;  4M52 A;  5FR3 A;  9ICI A;  3UCD A;  4YSZ B;  1NEK B;  3EYZ A;  2F76 X;  1JUD A;  1E7V A;  2XVT A;  1KSP A;  1JWA D;  3L5K A;  3SR6 A;  1EBG A;  2C5L C;  1L5P A;  2IPI A;  3D2S A;  3RZF A;  2CRX A;  1OUQ A;  3TAD A;  3RJK A;  3PHX B;  1FRD A;  2RK5 A;  1ZR6 A;  3OWE B;  2DUY A;  4MDK E;  3BIN A;  1S5L U;  4KMO B;  1ZQB A;  5AM1 A;  1WE7 A;  1ELS A;  8ICF A;  1KFY B;  2ZEQ A;  3B2F A;  4OZC A;  5AM0 A;  4N58 A;  3QU5 A;  3NZ3 A;  8ICS A;  3K4G A;  5IP4 D;  1A70 A;  1QLU A;  1QIL A;  2J6U A;  1L8L A;  2DYB A;  2ISO A;  1MBT A;  3RNE C;  1K51 A;  1F9J A;  3M9M B;  1FHU A;  5KFH A;  1NJX A;  3BVG A;  2FID A;  4KEM A;  3JZU A;  4DFK A;  4F92 B;  8ICJ A;  1MG4 A;  3HT3 A;  2N9E B;  4BKG A;  2BDP A;  4W9C A;  3I63 C;  5CHV C;  1ZK7 A;  5CR0 A;  2DYO A;  3KYD D;  1IP9 A;  4HPL B;  2YX8 A;  1NDD A;  4IZG A;  3L5O A;  2DAJ A;  9ICX A;  1Z2M A;  1RPL A;  4DYE A;  4ECW A;  2UUU A;  7ICE A;  3FC4 A;  3DVG Y;  3PZ7 A;  3RJG A;  1LGR A;  2A1J A;  4WWN A;  1X2G A;  1TY0 A;  4PWC A;  5KFY A;  4PVH A;  3JPN A;  3D47 A;  4TVW A;  3NXL A;  1UNS A;  3L3F X;  5EWF A;  2L76 A;  2ZC8 A;  4AP4 C;  3TWA A;  5JRT A;  3BYT B;  3P4S B;  3RUI B;  3GRT A;  4Z17 A;  2BKE A;  2LPE A;  1JDF A;  1FRR A;  1FXA A;  1GOZ A;  2KX3 A;  3IAS 1;  2EKE C;  4OHJ A;  2FCS A;  2HXT A;  2C3C A;  3R7R A;  1TYT A;  3ED5 A;  3L4P A;  2KZ3 A;  2DNF A;  4MAC A;  5J0W A;  4NAM A;  2FKP A;  1D8Y A;  2BHN A;  3SSZ A;  1KFT A;  2E1F A;  3H8J A;  3KVF B;  4KKI A;  1R6W A;  3RRA A;  2FCQ A;  3C23 A;  2RPV A;  1V38 A;  4A9A A;  1WVE A;  3VC6 A;  5GTH U;  4EEW A;  5G5G B;  4RCO A;  1L6V A;  2PMZ C;  2IA6 A;  2ZNV C;  4QZA A;  2XY7 A;  3R8B A;  3AV8 A;  3K9P B;  3MWC A;  4MFA A;  4C4V B;  4TVY A;  4APN A;  2JY6 A;  2W04 A;  5KFF A;  1ZQI A;  8ICI A;  9ICK A;  3WU2 U;  3BQ7 A;  3TEX A;  4H50 A;  1E10 A;  3AUL A;  5AKG A;  5IIO A;  1YJI A;  9ICS A;  4KVG B;  2FLL A;  1V80 A;  3S47 A;  1BPD A;  4BBN F;  2OAI A;  4TKN A;  2BQQ A;  2JWU A;  1STE A;  3QPE A;  2BBC A;  4WWP A;  3PST A;  5LXH A;  4Z6D A;  1UUP A;  4KDI C;  2UVR A;  2KTF A;  1L7Y A;  4FJZ A;  4Y2T A;  2XY5 A;  4KLG A;  2PS2 A;  8ICO A;  5CJ7 A;  3EZ5 A;  1XXG A;  4NLB A;  1CZP A;  4C00 A;  1T8E A;  5AE3 A;  7ICL A;  2KYW A;  1ZQR A;  3N9Y C;  2RR9 A;  4X5V A;  2FUH B;  4M6U A;  5ALK A;  4P4P A;  3KZI U;  3DBL B;  2KJR A;  1MOK A;  1WXV A;  2H3F A;  5AZF A;  7ICO A;  2AYO B;  3TAQ A;  2CHZ A;  2NS5 A;  5TZV A;  2JZB B;  2CR5 A;  3ZIM A;  2XI9 A;  9ICR A;  2BT6 A;  1DII A;  3TUO A;  2AHO B;  5B66 U;  1DOQ A;  2EKI A;  1Z5S B;  4UAZ A;  3E2E A;  2D8C A;  4QZ8 A;  4F3O A;  2H3Q A;  2WXF A;  4J6I A;  3SJN A;  4LDT D;  4IWP A;  4XQ8 A;  5BPC A;  4KMU A;  2Y1I A;  3RT3 B;  4FDC B;  4UBB A;  4JL9 A;  1GB1 A;  1GNU A;  5AZH A;  4IUM B;  1UWX A;  2JXJ A;  2WXI A;  3QK0 A;  4AUQ C;  1N56 A;  1WJ4 A;  2WXO A;  4KSL C;  2VJ5 A;  1IGC A;  2VKQ A;  2KDB A;  3NO1 A;  1CI4 A;  2WF7 A;  3FWA A;  1ZQM A;  4GIB A;  4IS7 A;  3GII A;  4DOA A;  3RB4 A;  2KDF B;  3BVZ A;  4IWO A;  4GSW A;  4HCH A;  2XID A;  4WJQ A;  1E8G A;  4CDG A;  1D9D A;  2NBW B;  3S5S A;  3RBD A;  2KHW B;  2AKM A;  3DPD A;  2XH7 A;  9ICQ A;  2XH2 A;  4W9F A;  2XSX A;  1DRG A;  3B1L X;  1WRI A;  1QCK A;  5KHQ A;  1FFV A;  1L4D B;  3AU5 A;  4DS4 A;  2BKF A;  5DLG A;  2XNA C;  1TYP A;  4J3O D;  1SV0 A;  2G0A A;  3IC9 A;  3S1F A;  3RRG A;  2WAQ F;  4UAT A;  1C7Y A;  3V7K A;  5DDY A;  1EF5 A;  5KFS A;  4PGY A;  4EM4 A;  2FDR A;  3BS7 A;  3JPO A;  3QC8 B;  1F8W A;  3ISB A;  5EBK A;  1EWY C;  4A8X C;  5IOI A;  4JB1 A;  2DX5 B;  1V1P B;  2DF4 B;  3LJ3 A;  1OQY A;  7ICG A;  1AHU A;  2JH1 A;  1W1K A;  3TSS A;  2LYA A;  3P93 A;  2PCE A;  2OED A;  2E8N A;  3RRH A;  4XE0 A;  1ZQE A;  3PK7 A;  4J9O A;  4DQR A;  3F2C A;  3RAQ A;  3VTW A;  4QZI A;  2AGP A;  3BOX A;  4IQW A;  3PW0 A;  1ZQK A;  3TL5 A;  4NXZ A;  2EAN A;  5F9N A;  2ZXH A;  3QYP A;  2IHN A;  1WCL A;  1OQQ A;  1F0M A;  3ZDC A;  4KLI A;  2KMC A;  2RDH A;  2BTE A;  3TSH A;  2NVU I;  1NK4 A;  1GES A;  1GRH A;  4IL2 A;  4P7I A;  3MZN A;  2WF8 A;  3IV6 A;  3OJ4 B;  4MT5 A;  2YVG A;  3ZVH B;  5KFM A;  5CX3 A;  3AE3 B;  5DCN A;  1NI3 A;  1Z3E B;  1KFS A;  4LNN A;  3T3O A;  4NY8 A;  3EJD B;  2HHT A;  2HHX A;  1D6E C;  3IBE A;  1ZQW A;  1BPZ A;  2WXM A;  2G07 A;  1WVF A;  4YQW A;  2ZCB A;  2X99 A;  5J17 A;  2NBV B;  3DER A;  2WDQ B;  2BS2 B;  1E8H A;  2AJQ A;  1F3P A;  2IND C;  1IYF A;  3ZNG C;  2REX A;  1JWB D;  3MFI A;  4YR3 A;  2KVS A;  3TFR A;  1ZQT A;  3JS8 A;  2F1H A;  1JAL A;  5AUK A;  3DDH A;  3ZRC A;  4HNL A;  4JX1 C;  2RGF A;  2AGO A;  2WB1 F;  1A5R A;  3ZDD A;  1KLG D;  3LDA A;  2HVI A;  3GDX A;  9ICN A;  3RJA A;  2RP5 A;  4Z6C A;  5CEH A;  3TFS A;  1XSL A;  3RJH A;  5FXD A;  1EXN A;  2E8M A;  3TOY A;  5KFJ A;  2YEP F;  3JVA A;  1L5U A;  1TS4 A;  2YVC A;  5U25 A;  3BWU D;  4QIW F;  7ICK A;  2JRZ A;  1V2Y A;  2K22 A;  2MHJ A;  2QSD A;  1PYW D;  2K89 A;  2LM1 A;  5EOZ A;  3J81 j;  3G6Y A;  2ISP A;  1SJE D;  1C78 A;  2MSE D;  1OEP A;  1FXT B;  2ZIU A;  4J9N A;  2BCR A;  2PU0 A;  3B2G A;  1WX7 A;  2K6Q A;  3AL0 B;  2P0I A;  2K8B A;  3SYZ A;  3P0W A;  3ABV B;  1MC8 A;  1W1S A;  4JV0 A;  1MI0 A;  1T5X D;  4M00 A;  4OVV A;  2QCZ A;  1B1Z A;  1VLB A;  4NM1 A;  2YML A;  2KLC A;  5J0X A;  4Y2V A;  4LLG M;  3PQB A;  5KNI A;  4DQO C;  1QKZ A;  5J2H A;  2TSS A;  1DXS A;  1NK0 A;  2GGJ A;  1YQZ A;  5L6F A;  3VRA B;  2MAX A;  2PFP A;  3V61 A;  2WPC A;  2Q4W A;  1XAN A;  4F5N A;  3N1Y C;  2LVP A;  4CHK A;  2HJ1 A;  4NJ7 A;  5G5H A;  1MQ3 A;  1JWM D;  5J8Y C;  3AU2 A;  1QQR A;  1S7M A;  2BS4 B;  4M01 A;  3U26 A;  3VDZ A;  3UQ2 A;  3ZNZ B;  4EEL A;  1UA0 A;  3I5J C;  2XBB C;  2PJH A;  1FIQ B;  5FR6 A;  4E6M A;  3D2Q A;  4K7U A;  3DG3 A;  1JCK B;  2XEW A;  5DDM A;  1WM2 A;  1OEY A;  1SL1 A;  2DPJ A;  1GPX A;  3GRS A;  1UZX B;  3ZI4 A;  5L83 A;  3EEZ A;  2MP2 A;  4F93 B;  3UCC A;  2PLP A;  3OG5 A;  1GUA B;  2ZXI A;  1ZQG A;  2GB1 A;  4YL8 A;  4C4T A;  2VFR A;  2BR0 A;  2BYE A;  2K8H A;  8ICU A;  3D9X A;  3AI5 A;  2FPK A;  2J7Q B;  1E8F A;  5CHG A;  5EWG A;  1WJ6 A;  4UB3 A;  4MHV A;  2IDY A;  2KD0 A;  5KFT A;  3VQI A;  3PSP A;  4UB8 U;  5DQI A;  1ZYQ A;  4KLD A;  1K53 A;  2V3S A;  1KH0 A;  2WWZ A;  1L3S A;  2PTL A;  5BMG A;  4C8L A;  4HCL A;  4NJC A;  3A4S C;  3UMC A;  2EQ9 A;  1MVK A;  1Q5W B;  2RSU A;  4GDK B;  4DXF A;  5C3J B;  3RAX A;  4ANV A;  4CRX A;  3AE5 B;  3GSY A;  1XS9 D;  4OJP A;  2C28 A;  1BZL A;  8ICX A;  2PTX A;  1QT9 A;  3ETL A;  3CAW A;  2WXN A;  3H8A A;  3E0F A;  2XIC A;  2OOB B;  3LVV A;  3PX4 A;  1JML A;  1SJA A;  4OZB A;  3CRX A;  2WX1 A;  1AWD A;  5AM2 A;  4KIK A;  5KFZ A;  2ZVO A;  3UQ0 A;  1TK5 A;  1SJB A;  4OO1 J;  1DGS A;  1L4Z B;  2J0K A;  3PO0 A;  4MM3 B;  3KUZ A;  4OZA A;  1A6S A;  1WGH A;  5KFC A;  4DL2 A;  5AM4 A;  4UBC A;  2CJN A;  4RF0 A;  1WCN A;  3H40 A;  2LJI A;  2DPI A;  2IO2 B;  2BB6 A;  2P3H A;  4RGO S;  5EWE A;  3Q8E A;  1FPY A;  9ICM A;  3ZQ4 A;  3IP4 B;  2OZ3 A;  5L1L A;  2ZTC A;  3ALB A;  4NQK E;  2ZZP B;  1QOA A;  3UGV A;  1T0R C;  1E90 A;  4ICV A;  4DBG A;  1QSL A;  1T4G A;  1X42 A;  4QNL A;  4TMA B;  5KVI A;  3VCN A;  3KZX A;  4P0P A;  2Y5C A;  3F2D A;  1Q3V A;  8ICN A;  3O65 B;  3QHT A;  2OQY A;  7ICS A;  4XRH A;  4NL9 A;  2ZIX B;  3AEC B;  1BPX A;  1WX9 A;  2J4X A;  1O03 A;  3ETR B;  4DF8 A;  3A1Q A;  1GJZ A;  2LWP A;  3DCG A;  2R9Z A;  3PX6 A;  1JX4 A;  1ECQ A;  2D10 A;  1KN5 A;  4AS1 A;  1GB4 A;  1V97 A;  2WPE A;  4EYH B;  3NZU A;  4PVE A;  1EU3 A;  3JPP A;  3VR8 B;  2WP6 A;  4QZE A;  3APF A;  4Q2J A;  4GFI A;  2MW5 A;  1SF0 A;  1XT9 B;  3NUH B;  5HI1 A;  3FYY A;  5FXE A;  2ZJ5 A;  3EEC A;  4KT2 A;  4PWB A;  3G6X A;  4I29 A;  1XF5 L;  2KC1 A;  1HSK A;  3N4F A;  1KL9 A;  4JE3 B;  1D4B A;  7ENL A;  1OGW A;  3QUT A;  1KF6 B;  2O6V D;  3T3N A;  3QU9 A;  5J2F A;  2J0J A;  1GAQ B;  2KWU B;  4KGR A;  4LK0 M;  3DBR I;  3VVW B;  2WOW A;  3ISD A;  5E6N A;  2RDG A;  3TQP A;  3V6E B;  3PRE A;  1NZB A;  5KT2 A;  3BS5 A;  1CMX B;  3Q6B A;  4FAD A;  2PMV A;  2WTF A;  2JRH A;  4F72 A;  2BW2 A;  3I57 A;  3MHS D;  3HW8 A;  1KJT A;  1UD7 A;  3PZ8 A;  5KG1 A;  1F9C A;  2WS3 B;  1NK5 A;  1FD6 A;  3MC8 A;  3EF6 A;  1T3Q A;  3DK9 A;  3R66 C;  3KD3 A;  1WX8 A;  3SV4 A;  3WK6 A;  3BII D;  5JUM A;  2FE9 A;  5DB8 A;  1NVI D;  1YIW A;  4KLL A;  4HCP B;  3SN4 A;  3GIJ A;  2ZZB A;  4GGH A;  3Q8K A;  4OJO A;  3MGH A;  3U2S C;  1IGD A;  5C23 A;  4DEZ A;  4MH0 E;  3O0H A;  4RPX A;  2CHR A;  4HN8 A;  5DGB A;  2HQM A;  3UXO A;  2NYV A;  2J52 A;  2ZJD A;  3HVZ A;  4BV6 A;  3MHZ A;  4P16 A;  1EO6 A;  4OJ5 A;  5AZG A;  2PI5 A;  2J3N A;  4O3M A;  3QUC A;  3Q3O C;  2QIE B;  1QH9 A;  1J2M A;  5KT6 A;  5KT3 A;  1A76 A;  4ECS A;  2BGF A;  4ECU A;  4HPP A;  1EC9 A;  4FX9 A;  3I6T A;  1GV4 A;  3ZLF A;  4BUG A;  1JXL A;  3B0Y A;  3IHP C;  4M02 A;  3MR5 A;  5FP0 A;  2AQ4 A;  2K4P A;  1HE8 A;  2KJH B;  3RBE A;  3DJG X;  2Y08 A;  1ED1 A;  2FMQ A;  3TSJ A;  3TAC B;  4B9L A;  2RDB C;  3CW2 C;  1NZP A;  4ECZ A;  1T3N A;  1Y88 A;  2EAO A;  3MC0 B;  1MPE A;  1RZT A;  3QX1 A;  2VRR B;  2OM6 A;  5HKH A;  4US9 A;  1KN0 A;  2WOI A;  2PKO A;  1W1L A;  1ZQX A;  4C8M A;  2M9N A;  2R18 A;  5L1M A;  4I2G A;  3JYU A;  5FS6 A;  5I1W A;  4GIS A;  2YB4 A;  2NVK X;  4QZH A;  1I4P A;  1R4N I;  2G45 B;  4GR1 A;  2D2Q A;  4JLC A;  4FZN A;  3R2T A;  3HK0 A;  1WH3 A;  5BO4 B;  2KLG A;  2KVZ A;  2FCM A;  2F1I A;  3GZN I;  2OEH A;  1CK1 A;  5IIJ A;  3OSP A;  9ICB A;  3ES7 A;  2MX2 A;  1DZN A;  3DBH B;  3TJP A;  4M9L A;  3NRZ B;  4HDO A;  2XH4 A;  4ECY A;  3U52 E;  4ZYS A;  8ICR A;  5AKE A;  2JH7 A;  4QW8 A;  2KK0 A;  3M6K A;  4KLT A;  1EUV B;  3PRP B;  4JQW C;  5KVH A;  3A4R A;  1Z00 B;  4QZC A;  5KT7 A;  7ICI A;  1J7B A;  1S10 A;  4ANW A;  4DXA B;  3A33 B;  3L0W B;  2PLI A;  2X8H A;  1NHP A;  3H7S A;  2GBN A;  4A3P A;  1RWS A;  3CT2 A;  2JEF A;  1ZKH A;  2GSH A;  3ISC A;  1LPF A;  2PXI A;  3AUO A;  3GS2 A;  1C20 A;  2BS3 B;  1J7C A;  2V3B A;  2MUT A;  4PZN A;  1FNU A;  5AK3 A;  2HXU A;  1U4A A;  4IOI E;  1N2X A;  3F5A A;  4GB9 A;  4I2C A;  1BNO A;  4UB4 A;  2OWO A;  2JWZ A;  2G09 A;  3M8R A;  1RYU A;  1BPY A;  3KHL A;  3B0X A;  1V85 A;  2F44 A;  9ICF A;  4GGB A;  9ICL A;  4GDL B;  4M04 A;  3AE1 B;  1KTK A;  4UAV A;  1P98 A;  4MJS A;  1KKR A;  1WGD A;  3FYH A;  2X38 A;  2HOQ A;  5F9L A;  4O0I A;  2QPM A;  3STP A;  2SAK A;  3RH6 A;  5BOE A;  1HZ5 A;  2AU0 A;  2G06 A;  1YN3 A;  8ICC A;  3N6H A;  1N61 C;  3Q4D A;  4UB6 U;  3OHA A;  5CRX A;  1V1O A;  2HTH A;  4JN8 A;  5TIS U;  5D49 A;  3H7P A;  2I1J A;  4IHC A;  1QQ5 A;  2EDU A;  1LB2 B;  4BCA A;  4ZHP A;  1WRD B;  1XC9 A;  1TVA A;  3N7P D;  1WGK A;  3FAH A;  1MQ2 A;  4M47 A;  1L6U A;  4HG0 A;  3JPS A;  4NLN A;  1ZOY B;  4DOC A;  2ASQ A;  5AI5 A;  3QUQ A;  4RPY A;  3V7J A;  2KN5 A;  5AI9 A;  4F5R A;  1IG6 A;  2LMC A;  2R61 A;  4D2K A;  1BXT A;  2TPR A;  5EE0 A;  2BWF A;  3BZC A;  2G08 A;  1HQR D;  1NBF C;  1ESF A;  2K4I A;  3UIO B;  2PFQ A;  4ED1 A;  1DK2 A;  4GC7 A;  3EKG A;  4PVJ A;  3OAW A;  4YR0 A;  2LM4 A;  1L8O A;  5AK6 A;  5C0Y A;  1WF9 A;  1WUD A;  2KD1 A;  2GI9 A;  1NJY A;  3OTR A;  2KIC A;  4PJ0 U;  3I1Y A;  1YEY A;  1ZQD A;  1WXQ A;  2DZJ A;  3N20 C;  3NS1 B;  4GU2 A;  3W9C B;  3DQV A;  2KV2 A;  4PZF A;  2CU1 A;  2IBI B;  1NDA A;  2Y5B B;  1ISN A;  1SXT A;  1YOV B;  2A1J B;  4EEN A;  2KO3 A;  2FPL A;  3UF8 A;  5IKC M;  1T0Y A;  5CTR C;  2QDE A;  3PS6 A;  3BZD B;  4MGZ E;  3HUI A;  2V4R A;  3QCA A;  1O08 A;  2KFK A;  2BVH A;  3NVW A;  4WQO B;  3W5U B;  3ZDB A;  2AQ2 B;  3KKA C;  5J0T A;  4E0D A;  2LUE A;  5BYS A;  3RJ8 A;  1XDI A;  1GG3 A;  2YMQ A;  2GR2 A;  1UWM A;  1ZQF A;  3A7R A;  3H8M A;  1FEB A;  4DSK A;  3C29 A;  3H6N A;  3AQE A;  5ALS A;  1SE9 A;  1P9D U;  1WYW B;  1P1A A;  2C7M B;  2VFT A;  3NOB A;  2B6G A;  3DDC B;  3DBR B;  2BKR B;  4ROP A;  5KFX A;  3OGU A;  5HHI A;  4HNC A;  1I4R A;  1YX5 B;  2D3C A;  2VA8 A;  1DOI A;  3HW2 A;  3QFA A;  4E8G A;  1SZP A;  2HBM A;  1TKD A;  5D3D A;  2X50 A;  3DFH A;  1F1H A;  1NU5 A;  2AL2 B;  2E5A A;  3FDS A;  3IDW A;  5DPR A;  4E74 A;  1MRA A;  4PK1 A;  4F4X A;  3IJI A;  1RAX A;  3ZTD A;  4WWO A;  3RCZ A;  1WIA A;  1X9S A;  4C7Y A;  2MBE A;  4HJG E;  4H4P A;  2LI5 A;  1D5X C;  2KWC A;  3EFU A;  1IBX B;  1WJU A;  2UVW A;  2QJN A;  2AKZ A;  2EZZ A;  2RDX A;  2KZZ A;  3CWI A;  4Q43 A;  2NCN A;  2AQ1 B;  3SD7 A;  1YN5 A;  2EMS A;  3N3K B;  4IG7 B;  9ICU A;  3C28 A;  4RQ2 A;  3LWM A;  1YZ7 A;  5DBB A;  1S8O A;  4QZD A;  5AI8 A;  4PYZ A;  1RXV A;  1L0Y B;  4KSK C;  3NVY B;  2WU5 B;  3D6J A;  4WH4 A;  2KKV A;  2WHE A;  4WIP A;  3T9L A;  5KG2 A;  4GXJ A;  5J2G A;  2Y3S A;  3AN1 A;  3OZY A;  4UB5 A;  1UBI A;  4JWU C;  4R8U B;  1SIJ A;  5AIA A;  4ITK A;  5J2D A;  4MEL A;  1UGJ A;  5AI4 A;  1HUZ A;  4KTQ A;  2INC C;  2V4Q A;  4OVZ A;  5J04 A;  3UXK A;  4I6L B;  3EJE B;  2Y3A A;  3GFK B;  4P4O A;  4KLH A;  1FHV A;  2CFY A;  3A9J B;  3NZG A;  2BCU A;  3NGD A;  4YMM A;  2MNR A;  2L0F A;  1KKX A;  2IOH A;  3FW7 A;  4O95 A;  3EAO A;  3FJ4 A;  4K4G A;  4YT0 B;  3ZDM C;  3T9P A;  3VFC A;  5KL8 B;  1M94 A;  2J0M A;  1KFD A;  2FAZ A;  3TEW A;  1SIF A;  2KFJ A;  2NQW A;  1ZD3 A;  1NJW A;  1WXM A;  5IAA C;  4DHZ B;  2UYZ B;  3S2A A;  1BPB A;  3M9N B;  4FBU A;  3PTF C;  3IT4 B;  1QLB B;  1M4V A;  3BY4 B;  1S0V A;  2IMW P;  3ZW3 A;  4MF2 A;  3GP7 A;  2K8C A;  2XC9 A;  4ECQ A;  4IP5 A;  4MFF A;  4DCC A;  4FN2 A;  2ACZ B;  3GZN B;  4BOZ B;  4KN4 A;  1L3T A;  4K8G A;  2W55 A;  1JRU A;  3AEG B;  3T4W A;  2L5Y A;  3VHT C;  2LI6 A;  3UM9 A;  1GC7 A;  4DL5 A;  3MC1 A;  4ED6 A;  2JUO A;  4EQW A;  4DQI A;  1IYX A;  2BQU A;  2ASD A;  3OC4 A;  3LYY A;  1ARO P;  2LXC A;  1E8Y A;  2M0A A;  1Q1R A;  1AAR A;  2P13 A;  5AKZ A;  4LNI A;  4PVK A;  3UGB B;  1SE2 A;  1QSS A;  3VFK A;  4Y2Y A;  2OPJ A;  1U48 A;  4JV2 A;  1I42 A;  2DZM A;  4BC9 A;  5BOF A;  1QOB A;  3ZDE A;  5KFO A;  8ICE A;  1H4R A;  2HE7 A;  3FCP A;  3PSF A;  1W6T A;  3KLJ A;  4WQM A;  3G6V A;  4J9K A;  4B9V A;  3R1Z A;  1RXW A;  2QB0 A;  3HPO A;  2RPQ A;  1R4M I;  2FBW B;  1F77 A;  4HK2 A;  2OZ8 A;  4GIR A;  4DWD A;  4CYE A;  2KDM A;  3A0B U;  1FMA D;  2WFA A;  3MDC A;  2GRT A;  1F52 A;  5JTI A;  2OCE A;  2CHW A;  4TQR A;  2DBY A;  2LJ5 A;  5KFW A;  1RYJ A;  4GN1 A;  1ONE A;  4FI4 A;  5DQH A;  2YAU A;  2POZ A;  1C4A A;  2KHV A;  4CO7 A;  1PVR A;  5KFA A;  3QE9 Y;  2FJ6 A;  3SBF A;  3D2N A;  3RB6 A;  4W9I A;  2PFO A;  4QW9 A;  2K9X A;  5DQG A;  1V86 A;  2N7D A;  2HCF A;  4PT5 A;  3AMZ A;  3JW0 X;  3HPF A;  2O6K A;  1GET A;  3KFU F;  2PP0 A;  1NI2 A;  4RFB A;  4B0M A;  5KFU A;  4JWS C;  4RU9 A;  2BCV A;  2GBK A;  3UMG A;  9ICT A;  4I2B A;  2FMS A;  4B9N A;  1F0X A;  1MO9 A;  4JHM A;  5ALF A;  1F2R C;  3DEE A;  2XN9 C;  5GRT A;  3OZM A;  3U4F A;  1TE2 A;  2GGE A;  4I2H A;  7ICJ A;  3II4 A;  5HHH A;  4XA5 A;  3SN1 A;  4ED7 A;  3IM1 A;  4H1Z A;  4DQS A;  4J03 A;  3UMB A;  1XO3 A;  2VH1 A;  1UT8 A;  4PZO A;  1PK3 A;  1Q46 A;  5KG4 A;  4ED3 A;  3THV A;  3L54 A;  1XHC A;  4H19 A;  4LTU A;  5L1I A;  3UI3 A;  1UBQ A;  4BBN C;  2FI1 A;  1AYF A;  1QLT A;  5J2I A;  2A1A A;  1Q1O A;  3N97 B;  1WY8 A;  3RH5 A;  1P0R A;  2AH5 A;  1W1J A;  3H8H A;  1RYS A;  3V3W A;  2ZIW A;  3Q8S B;  4HKZ E;  3W1S C;  3HSU A;  4ZDV A;  1S97 A;  4ICU A;  4M0W A;  3UJE A;  3GY1 A;  2RAB A;  4A3R A;  1ENF A;  3SQI A;  3N32 A;  1YJ1 A;  3SHQ A;  2PMZ F;  1XCT L;  2ZUD A;  2YTU A;  2W9C A;  4ELU A;  2W03 A;  4JV1 A;  3E9S A;  2F5Z A;  2D5G A;  2NPT B;  2KT7 A;  1WG8 A;  2AQ0 A;  1TZO A;  2KTR B;  2LGI A;  3X0W A;  4BWM A;  4EEK A;  3Q8M A;  1U45 A;  3SEI A;  1VRA B;  2JEG A;  4GRT A;  3ENL A;  2ZTD A;  3RJE A;  2WXJ A;  4K8D A;  1P48 A;  1ZJM A;  4J9P A;  2D3D A;  1L2N A;  4DOB A;  2ZIV A;  4OJ6 A;  2ZIU B;  3T8M A;  2WHI A;  2QVH A;  1XO0 A;  4IW0 A;  2K8B B;  4J9L A;  2ZPN A;  5GXG B;  4C8N A;  2QAE A;  3AEE B;  1EU4 A;  1MNS A;  1ZQV A;  3RNM A;  1IM4 A;  3SI8 A;  4DNS A;  3TTE A;  3GV7 B;  3W8X A;  4ICA A;  3VCC A;  8ICZ A;  3DGB A;  4ED8 A;  3AEF B;  4O5E A;  5KTQ A;  2YEP B;  3RI7 C;  3T5H A;  1Q8K A;  3BDP A;  5H2F U;  2JT4 B;  2MJE A;  4R65 A;  1UEL A;  4XX5 A;  3ZJV A;  2A3V A;  2ZZC A;  3ML8 A;  2GQT A;  3P3B A;  2GBM A;  3Q8Q B;  3DBS A;  3IT6 B;  1URJ A;  1M6Y A;  2O2V B;  3FXG A;  1C76 A;  1V9P A;  4H4R A;  3AEB B;  3OSN A;  2IY1 B;  3RNA C;  1P43 A;  1KKO A;  1W1Q A;  3NG0 A;  5MPO A;  3E56 A;  1N6Z A;  2V1Y A;  3MC9 A;  3CGB A;  5FJT A;  5GTI U;  4P1C C;  1RFA A;  3M95 A;  5DBC A;  2MP2 B;  4FHK A;  1YT3 A;  2BCQ A;  1H6V A;  1QQ7 A;  4M0X A;  3RUL A;  3LAE A;  2WP9 B;  2WF9 A;  1PK1 B;  3SEN A;  1BML C;  2KWV B;  1MUC A;  1TS5 A;  5J0Y A;  1MHX A;  4QWD A;  4BXO A;  4FZM A;  1ZET A;  2BGW A;  1KW4 A;  1NK9 A;  2WAQ C;  4U6P A;  1SXE A;  4Q45 A;  3QEA Z;  3NS8 A;  1HZ6 A;  1EC7 A;  1CUK A;  1GER A;  3V62 A;  3MFH A;  4WJ3 B;  3WAP A;  4CE6 A;  3DEQ A;  2H88 B;  2LZ6 A;  1N63 C;  1R0M A;  3VUW A;  3EUB 2;  2BPC A;  4C4S A;  2KVC A;  2QC8 A;  2MCN B;  1TE6 A;  3NUQ A;  2WXQ A;  3CB3 A;  2NV3 A;  1GXF A;  1WZ0 A;  3H7V A;  4P6V F;  2QKN A;  4DLE A;  3AE9 B;  4LJO B;  3FVD A;  4RQN A;  1L7O A;  4B9S A;  4KLM A;  4B6W A;  4H4X A;  4DX3 A;  1UQV A;  1X6I A;  4DSE A;  3AED B;  4E71 A;  2DQN B;  4RGN A;  5HP4 A;  3N4E A;  2W9M A;  4Y2X A;  5AKK A;  4O3Q A;  4ECX A;  1T7P A;  2MBH A;  3KUD B;  2PGE A;  1GEU A;  1MSW D;  1WUF A;  2LRU A;  1ROE A;  4JN7 A;  2JZP A;  1WJN A;  4M9G A;  2A8X A;  1K5O A;  1BVS A;  1XLN A;  1Z4N A;  3TQ1 A;  3TEY A;  2QIL A;  3V6C B;  1NKB A;  1TS3 A;  2OJW A;  1SB3 B;  3K1G A;  3ZUN A;  4KGS A;  3QXG A;  3P2B A;  2DW7 A;  3V4B A;  4US8 A;  1TBE A;  2GRI A;  3KW5 B;  4H4U A;  1SGG A;  2KSO A;  2GOW A;  4P0P B;  1ZJN A;  2JZZ A;  2BDU A;  4DL4 A;  2LXA A;  5ALH A;  4BGD A;  3ZJU A;  1TKG A;  2QGY A;  9ICV A;  3RNC C;  3KHH A;  2HNE A;  4X2P A;  3MGI A;  3TAR A;  1DYQ A;  3K1R B;  4DN1 A;  5K8E A;  2QKQ A;  2IPK D;  1WGG A;  4XYC A;  3LAD A;  1PDZ A;  1WZ3 A;  2KJ9 A;  2LYH A;  5J0U A;  1R4M B;  4A6Q A;  5AIB A;  3PX0 A;  2CDU A;  3A7U A;  5G5G A;  5DB9 A;  3ZNI D;  2VFU A;  2K25 A;  2LD9 A;  4MEY A;  4AP9 A;  3PWG A;  1PDX A;  2NRZ A;  3W1Y A;  1GRE A;  3TAP A;  1SE4 A;  4GXK A;  2DL0 A;  3C0P A;  3RR1 A;  2KOB A;  5FJO A;  2P8B A;  4YWG G;  4QIW C;  1ACC A;  1L6N A;  1KM7 A;  4G11 A;  1DOY A;  2BVF A;  2KOX A;  5J2A A;  3HM3 A;  5KFE A;  1SKS A;  1JRP A;  3AQF A;  2QDF A;  5HHZ A;  4CQN A;  2D3A A;  2O6V A;  4HXD A;  2I1Q A;  5IO9 A;  5ALY A;  2UUV A;  3KWL A;  1CQV A;  2J42 A;  1JQ4 A;  3THU A;  5ADZ A;  2BC0 A;  2GOL A;  2P6U A;  1XLP A;  1C1Y B;  3S1E A;  2KMA A;  2MRP A;  2WPF A;  2PTY A;  5E79 U;  1C3T A;  2NMQ A;  3O0F A;  4DHZ E;  1EBH A;  4FLH A;  3RH4 A;  3ZDT A;  2C9W B;  4DHJ B;  1UA1 A;  3K1Z A;  4QZF A;  3M63 B;  1JCT A;  3GU3 A;  1U49 A;  4I2I A;  4RNO A;  1SKR A;  2VFV A;  4DQQ A;  2RLT A;  4RM8 A;  2BF8 B;  4GYP C;  2PTZ A;  1M6I A;  2N1V A;  2LGY A;  3HP6 A;  2HBL A;  3MJ5 A;  2JR5 A;  3I76 A;  2EQ6 A;  1ZQH A;  1XNS A;  3ZKJ C;  2ES6 A;  2JZB A;  1E7P B;  3AH7 A;  2HBK A;  2L8J A;  4MLA A;  3NAS A;  1WYG A;  1ZY8 A;  4DK5 A;  1TAQ A;  1BUI C;  4IM2 A;  1K1Q A;  3ZTC A;  2F2A B;  2HVH A;  3D2D A;  3T6C A;  3GIM A;  1ZD5 A;  2YMP A;  4EMJ A;  3V3X A;  3QLD A;  2VFS A;  3DJJ A;  2KZR A;  4HWI B;  3C2K A;  3PR4 A;  3S1C A;  3MR6 A;  3H0M B;  4F5Q A;  2L3Z A;  1G6J A;  8ICL A;  3VR9 B;  3ONS A;  5KG6 A;  2FLP A;  3PG6 A;  1S0M A;  1B4F A;  2E8P A;  4G50 A;  2VZK B;  5J29 A;  3QTP A;  4MF8 A;  4BX9 C;  3FIL B;  4XDD A;  5G55 A;  2IO3 B;  3AEA B;  2L1A A;  3VTU A;  1WWV A;  3HKZ F;  3JPT A;  4UD8 A;  4EQX A;  1VCB A;  2X8X X;  1IUE A;  2W3S A;  4DWI A;  1RQL A;  3QX7 A;  1YJJ A;  3UIP B;  5ALT A;  4G7F A;  1YQB A;  1VQZ A;  1SV4 A;  3L08 A;  3AE2 B;  4Y2Q A;  4ARC A;  5J0Q A;  1SB3 C;  2NRT A;  3RGT A;  4FUL A;  4C56 C;  2PGW A;  3KUM A;  2D07 B;  5CA7 A;  3V72 A;  2XGQ A;  4B9U A;  2GLS A;  1IV8 A;  3HIZ A;  1N5W C;  1QF6 A;  4HPN A;  2WDR B;  2GGG A;  2DWQ A;  5C5J A;  4UAW A;  2QAR A;  3DVN V;  3P4P B;  4HKQ A;  2PSN A;  5J8Y A;  1S0O A;  2KNB A;  3QU7 A;  3KTQ A;  5EDS A;  5JHB A;  2PVO D;  3B9J B;  2ONE A;  2Y0S F;  4DL3 A;  3A9K B;  2Z0E B;  2L00 B;  2KQ4 X;  4HYR A;  4DDG D;  2GGI A;  2Q4T A;  1E0Z A;  3W8Z A;  2GR3 A;  4Q8E A;  2MQJ A;  5KAF U;  2QEJ C;  3R10 A;  2N9L A;  1FFU C;  5AUI A;  2ATL A;  2QLT A;  2JHD A;  3T3F A;  3HIL A;  2I38 A;  3KBB A;  2KAN A;  3SQP A;  5FJU A;  4C7Z A;  1N60 C;  4ZCW A;  3OJS A;  2AL3 A;  1B22 A;  3PSI A;  3NFU A;  4KIT B;  4K3C A;  1VDV A;  2KIV A;  2VAO A;  4BUR A;  3C21 A;  3AE7 B;  4OCZ A;  3H4K A;  3IXS A;  5AM3 A;  2X8C A;  5IIL A;  3H12 A;  5DG7 A;  2DZI A;  4EC3 A;  3U30 A;  3EWA A;  5AKX A;  1X6J A;  1VR9 A;  5L1K A;  2L83 A;  2W9B B;  4C80 A;  1V9J A;  5AIC A;  1JMS A;  4BVU C;  4AYB C;  2WXR A;  2LKY A;  2V9H A;  5HG2 A;  4L23 A;  4H4Z A;  9ICO A;  3LLB A;  4O3O A;  3N4M B;  5D6J B;  8ICP A;  1TZZ A;  4TUR A;  2KWD A;  3IVF A;  2AWT A;  1TTN A;  1F44 A;  2AQ3 B;  1IXR A;  5H8Y E;  4O9M A;  1OXJ A;  3H7P B; 
#chains in the Genus database with same CATH homology
 4HEA 1;  1HQR D;  4PVH A;  1ESF A;  3AM9 A;  1FO4 A;  4TVW A;  1UNS A;  4PVJ A;  3Q8C A;  3BYT B;  5EE9 A;  2GI9 A;  3P4S B;  4PYT A;  1FRR A;  1FXA A;  1GOZ A;  3IAS 1;  4OHJ A;  1WXQ A;  3NS1 B;  3W9C B;  3VTE A;  3D2J A;  4PZF A;  3DQ0 A;  3L4P A;  4MH8 A;  1SXT A;  1AN8 A;  4MAC A;  4NAM A;  5T8I A;  1ZUD 2;  3BZD B;  4KKI A;  4RH6 A;  5JXV A;  1DIQ A;  3HUI A;  2AX5 A;  2RPV A;  4A9A A;  1C4C A;  4B0E A;  4EE2 A;  2INP E;  1WVE A;  2BVH A;  4WUR A;  5G5G B;  4RCO A;  3NVW A;  1L6V A;  3W5U B;  2AQ2 B;  3MP9 A;  5BYS A;  3R8B A;  2E6X A;  3AV8 A;  3AB5 A;  4UDU C;  4TVY A;  3RJ8 A;  1UWM A;  2QJL A;  2BYT A;  3A7R A;  2I0K A;  3TEX A;  2AXR A;  2WDW A;  1W1R A;  1E10 A;  3O13 A;  2NTT A;  1YJI A;  3U7Z A;  4RGM A;  4XLO A;  2VFT A;  2OAI A;  2V3N A;  2JWU A;  1I4R A;  1STE A;  2BBC A;  1DOI A;  1FXI A;  1UUP A;  2V4I B;  5D3D A;  1V8C A;  3ZJT A;  2WXG A;  2E5A A;  3Q8B A;  2OHF A;  1XXG A;  1CZP A;  2FE8 A;  3CIR B;  1NEN B;  5AE3 A;  3LB8 C;  4YTP B;  4C7Y A;  3N9Y C;  1NYQ A;  4HJG E;  1D5X C;  1IBX B;  3TEZ A;  2E3T A;  1EM7 A;  3D2H A;  3CWI A;  1OQR A;  1C79 A;  2V3P A;  2AQ1 B;  1YN5 A;  1C9F A;  2JYE A;  1AHZ A;  3W8W A;  1I7H A;  3DWG C;  1VJK A;  2KN4 A;  1VZ8 A;  1DII A;  1FNW A;  2BT6 A;  1L0Y B;  3TUO A;  3NVY B;  2WU5 B;  4WH4 A;  2EKI A;  1R7S A;  1SBB B;  1DOX A;  4WIP A;  2W82 A;  4YSX B;  3BVM A;  2WXF A;  2Y3S A;  3AN1 A;  5E6J A;  4JWU C;  1SIJ A;  4ITK A;  5AE2 A;  1GB1 A;  1UGJ A;  1Q10 A;  2INN E;  4OVZ A;  2WDV B;  1UWX A;  2WXI A;  2Y3A A;  2WXO A;  2V0G A;  1RM6 B;  1IGC A;  1SSN A;  1TS2 A;  4XWT A;  3FWA A;  1ZP0 B;  2LFI A;  1F0Z A;  4O95 A;  3FW7 A;  3BVZ A;  4YT0 B;  1FNV A;  1E8G A;  3J9C A;  3DED A;  3BK1 A;  1HA5 A;  3TEW A;  2NQW A;  5L6G A;  4YXD B;  2FUG 1;  3IT4 B;  1WRI A;  1QLB B;  1M4V A;  1FFV A;  2R2Z A;  1L4D B;  1V1P A;  2WXK A;  5FXP A;  3GP7 A;  2PLS A;  4RGT A;  2ACZ B;  2XNA C;  4J3O D;  2LHE A;  1I4H A;  2W55 A;  3AEG B;  4ML8 A;  3S1F A;  2YVS A;  5D3I B;  3BK2 A;  2J53 A;  1WWT A;  1YQ4 B;  3RPF C;  1EWY C;  3LYY A;  4A8X C;  4JB1 A;  2M0A A;  2P13 A;  1TKY A;  1V1P B;  2P4P A;  4PVK A;  1SE2 A;  1E6E B;  4ZOH B;  3SR6 B;  1AHU A;  2EXR A;  1W1K A;  3TSS A;  4BC9 A;  3ETR A;  1QOB A;  1D5M C;  2OED A;  4XE0 A;  4USA A;  4BC7 A;  3W5V B;  2HTM E;  1I4Q A;  1N62 C;  1X2G A;  4KX6 B;  4WQM A;  3NVZ A;  2LEK A;  5AE1 A;  2Q85 A;  1ET6 A;  1OQQ A;  1N5W A;  1F77 A;  2FBW B;  2RDH A;  4DXG A;  2BTE A;  1T3Q C;  2KDM A;  1UXY A;  3TSH A;  1FMA D;  2JSV X;  3BW7 A;  1PUT A;  4MT5 A;  2DBY A;  1NYR A;  1RYJ A;  1QOF A;  3AE3 B;  1C4A A;  4OW0 A;  2Q5W D;  3P4R B;  1NI3 A;  2G1E A;  2N0S B;  1W1M A;  1PGB A;  2KAC A;  3URY A;  3T3O A;  1D6E C;  1J7A A;  1JRO A;  2K9X A;  2WXM A;  4HRO A;  1WVF A;  3NVZ B;  2DLB A;  4PT5 A;  3AMZ A;  2ICI A;  2WDQ B;  2EEL A;  1FFU A;  4RFB A;  2BS2 B;  4B0M A;  1E8H A;  3A7A A;  1ZDV A;  3MFG A;  4JWS C;  1N60 A;  3EGR A;  2IJ0 A;  1JWB D;  3JS8 A;  1F0X A;  3KWV A;  1C77 A;  1JAL A;  1Y56 A;  1F2R C;  2PVG C;  5AUK A;  2BVG A;  2XN9 C;  4JX1 C;  1FCL A;  2N7J A;  1N61 A;  5LNK 1;  1KLG D;  2Z8L A;  1B9R A;  3LXF A;  1XO3 A;  3RJA A;  1KLU D;  5FXD A;  1CJE A;  5AWV A;  2MBR A;  2YEP F;  4LTU A;  3UI3 A;  4XWW A;  1TS4 A;  1N62 A;  4GLS C;  3SFE B;  1AYF A;  4NZL B;  1FM0 D;  1QLT A;  3BWU D;  5BYQ A;  4AQ7 A;  1W1J A;  2K22 A;  3NVV A;  3H8H A;  4YTN B;  1XLQ A;  2QSD A;  1PYW D;  4HKZ E;  3ZYY X;  1SJE D;  3NVW B;  4ZRP A;  3HSU A;  1C78 A;  1ET9 A;  4M0W A;  4OAL A;  2K5P A;  4O1N A;  1ENF A;  3B2G A;  3U4E G;  1XCT L;  3ABV B;  4XDC A;  3E9S A;  1W1S A;  3V05 A;  2D5G A;  1MI0 A;  4TQ0 A;  2LGI A;  1T5X D;  3POP A;  1TZO A;  1B1Z A;  1VLB A;  1FCC C;  2IGH A;  1FIQ A;  1VZ6 A;  4LLG M;  2K0P A;  2MJ3 A;  3PQB A;  1F2R I;  3HVD A;  4DQO C;  1QKZ A;  1VRA B;  2TSS A;  3NVV B;  1YMH E;  4IDI A;  2WXJ A;  3W2D A;  1I4X A;  5L6F A;  3VRA B;  5BMH A;  2M56 B;  2Q4W A;  2N9K A;  5G5H A;  1ZPS A;  5GXG B;  1JWM D;  4KKJ A;  2SEB D;  1QQR A;  3AEE B;  1EU4 A;  2BS4 B;  1YQ3 B;  4ARI A;  2GQU A;  3FIL A;  2K3U A;  4DNS A;  1FIQ B;  3W8X A;  1JCK B;  3AEF B;  1C4P A;  2KMM A;  3KQ4 A;  1GPX A;  2YEP B;  2RMM A;  2MJE A;  3P4Q B;  3ZJV A;  2PLP A;  4RNA A;  2GQT A;  3NRZ A;  1K52 A;  2GB1 A;  2VFR A;  3IT6 B;  1T6B X;  2JQR B;  1E8F A;  1FEH A;  4JAY A;  1I4G A;  2ON8 A;  2IDY A;  3VQI A;  1C76 A;  3EA6 A;  1K53 A;  3AEB B;  5BMG A;  1KH0 A;  1OFF A;  2PTL A;  1W1Q A;  5MPO A;  3E56 A;  4NJC A;  3SEB A;  1MVK A;  2PW9 A;  4GDK B;  4DXF A;  5C3J B;  3AE5 B;  3GSY A;  3B9J A;  1QT9 A;  4KGT A;  2WXN A;  3LAE A;  2WP9 B;  3HRD C;  1BML C;  1JML A;  1TS5 A;  2CU3 A;  1MHX A;  4OZB A;  3AE4 B;  2ZW1 A;  3GB1 A;  1TKE A;  1AWD A;  1HZ6 A;  4BBY A;  1HXY D;  2DYM A;  2Y4G A;  4YSY B;  3TX1 A;  1L4Z B;  2KAJ A;  2H88 B;  3PO0 A;  4MM3 B;  4OZA A;  1EWC A;  1N63 C;  4ZHO A;  3EUB 2;  3Q69 A;  2CJN A;  2WXQ A;  4RF0 A;  1I19 A;  2L52 A;  2LJI A;  2WLB A;  3AE8 B;  4N6E B;  4R3D A;  2BB6 A;  3BYY B;  4P6V F;  4RGO S;  2QKN A;  3AE9 B;  2P3H A;  3Q8E A;  5BYR A;  3ZQ4 A;  1ZDX A;  3HRD D;  3AED B;  2JX5 A;  2WNM A;  1JW9 D;  3R2I A;  1QOA A;  2MEK A;  5H8Y E;  4RGN A;  2IGG A;  4TMA B;  2Y5C A;  1PGA A;  1ROE A;  3AEC B;  5TSS A;  2R8D A;  2J4X A;  2JZP A;  4TSS A;  3ETR B;  1D5Z C;  5HFY A;  4TQ1 A;  1XLN A;  3TEY A;  1XLO A;  2QIL A;  1ZXH A;  1TS3 A;  1SB3 B;  1GB4 A;  4AS1 A;  2WXH A;  1V97 A;  4L2Y A;  5I4D A;  3C8Y A;  4KGS A;  5HQX A;  2JXT A;  4PVE A;  1EU3 A;  1PFD A;  3VR8 B;  2LHD A;  5D7G A;  4US8 A;  2GRI A;  1VZ7 A;  4Q2J A;  2NTS A;  1SF0 A;  3NS1 A;  3NUH B;  5HI1 A;  3ZJU A;  5FXE A;  1TKG A;  1TY2 A;  4PWB A;  1XF5 L;  1HSK A;  1DYQ A;  5K8E A;  4JE3 B;  2IPK D;  2ONQ A;  1D4B A;  1KF6 B;  1AW7 A;  2WQY B;  4YTM B;  4A6Q A;  3A7U A;  3T3N A;  5G5G A;  4KGR A;  1GAQ B;  3ZGZ A;  1E0Y A;  4LK0 M;  2WU2 B;  2VFU A;  2RDG A;  4JPS A;  4A55 A;  1PDX A;  1KRH A;  1HEZ E;  1SE4 A;  1MBB A;  3Q8A A;  2PMV A;  2WXL A;  2PIA A;  1ZXI C;  1YN4 A;  3C0P A;  2BW2 A;  1SJH D;  3I57 A;  4WWM A;  3PZ8 A;  4YWG G;  2WS3 B;  1ACC A;  1DOY A;  1RM6 C;  2BB5 A;  2BVF A;  1FD6 A;  1JWS D;  1JRP A;  1T3Q A;  2O3G A;  5HHZ A;  1QOG A;  4CQN A;  2UUV A;  5EE3 A;  5C2T B;  3KWL A;  1CQV A;  2J42 A;  1SEB D;  3BII D;  2VZK D;  3VRB B;  1N5X A;  1JQ4 A;  3DWM A;  1NVI D;  5ADZ A;  1XLP A;  3S1E A;  1P7E A;  3FW9 A;  4N59 A;  4WAF A;  1X2H A;  2JYT A;  2NMQ A;  5HMR A;  2B76 B;  4IKG A;  2Y5P A;  3U2S C;  1IGD A;  3R07 C;  5D79 A;  1DGJ A;  1JWU D;  2J52 A;  2W3R A;  3HVZ A;  1IBX A;  1W1O A;  3MHZ A;  2VFV A;  4P16 A;  5FXF A;  5HHD G;  2M19 A;  2HDE A;  1P7F A;  2W54 A;  4RF1 A;  2QIE B;  3MJ5 A;  1XEE A;  1SE3 A;  3KJM A;  1E7P B;  3AH7 A;  2WXP A;  4MLA A;  1WYG A;  1BUI C;  3D2D A;  3NVY A;  2Y08 A;  1FFV C;  4PWC A;  4ZRQ A;  3V3X A;  3TSJ A;  2LUM A;  1AHV A;  2VFS A;  1ZE3 D;  4ZOH C;  2MJD A;  4H2A A;  3AE6 B;  3MC0 B;  3S1C A;  1MPE A;  3I99 A;  4US9 A;  3VR9 B;  1ZXI A;  2PKO A;  4FXC A;  1W1L A;  5G5H B;  5I1W A;  3RFZ B;  2VZK B;  1I4P A;  4L1B A;  3FIL B;  4XDD A;  3AEA B;  2L1A A;  4NAW B;  3W1S A;  3WCQ A;  1MHH E;  4UD8 A;  2H89 B;  1IUE A;  2W3S A;  1WSP A;  3I9V 1;  3R2T A;  4HRS A;  1YJJ A;  1CK1 A;  1DZN A;  1VQZ A;  3NRZ B;  3AE2 B;  4ARC A;  2Y3R A;  1VAO A;  3U52 E;  1SB3 C;  4ZYS A;  3FW8 A;  4A90 A;  4C56 C;  3EUB 3;  2L32 A;  5FK9 C;  1J7B A;  1N5W C;  1QF6 A;  2I2Y A;  2WDR B;  3P63 A;  1L0V B;  2PLI A;  2DWQ A;  3IAM 1;  1PGX A;  3P4P B;  4HKQ A;  1RWS A;  5FKA C;  3S1D A;  1YNT E;  2PVO D;  3B9J B;  3GS2 A;  2BS3 B;  1J7C A;  1FNU A;  5H92 C;  5FR3 A;  4IOI E;  2KQ4 X;  4YSZ B;  1NEK B;  2G9H D;  1E0Z A;  3W8Z A;  3PM9 A;  1E9M A;  1JWA D;  2QEJ C;  3SR6 A;  2IPI A;  1L5P A;  2N9L A;  1FFU C;  5AUI A;  2CJO A;  2I38 A;  1FRD A;  4GDL B;  1ZR6 A;  2IGD A;  2RK5 A;  3OWE B;  3AE1 B;  4C7Z A;  1KTK A;  3KLS X;  1N60 C;  5I1V A;  1VDV A;  2X38 A;  3Q8F A;  5EE1 A;  2QPM A;  2VAO A;  3B2F A;  1KFY B;  2SAK A;  1L0X B;  3AE7 B;  4OZC A;  1TJE A;  4N58 A;  1HZ5 A;  3NZ3 A;  3SFD B;  1YN3 A;  3IXS A;  1LO5 D;  1QLU A;  1A70 A;  1QIL A;  1MBT A;  1N61 C;  3P1M A;  1K51 A;  1RFK A;  1V1O A;  3BVG A;  4EC3 A;  3P42 A;  4REZ A;  1VR9 A;  5BMI A;  1XCQ L;  2L83 A;  4C80 A;  4ZHP A;  4BCA A;  2QMT A;  2DYO A;  2MH7 A;  2WXR A;  1WGK A;  3FAH A;  5HG2 A;  1L6U A;  4HG0 A;  3LLB A;  1K50 A;  1TYG B;  2UUU A;  1ZOY B;  3FC4 A;  3PZ7 A;  2ZW0 A;  2JU6 X;  2KWD A;  2LMC A;  4D2K A;  1BXT A;  2AQ3 B;  4L23 A;  1TY0 A;  5EE0 A;  2R61 A;  1N63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...