1JROA

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 129
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jroA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jroA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1jroA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jroA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jroA04
3W8XA 1W1KA 4EC3A 2W54A 3NVZB 5MPOA 1VDVA 1W1LA 3AH7A 1JRPA 1DOYA 3ETRB 4YTMB 5EE3A 5C3JB 3CWIA 3AEDB 1NVID 1ZXIA 2PLIA 1VQZA 1DOXA 1N5WA 2R8DA 1RM6B 2OAIA 3RPFC 1E8FA 1VLBA 2I0KA 2QIEB 2WU2B 2MJ3A 1YQ3B 1ZUD2 1CJEA 3BIID 1TKGA 2FBWB 3B2GA 3VRBB 2VFUA 3FW9A 3AV8A 4JAYA 5D79A 4XLOA 1AHVA 3AEFB 3AEEB 1SF0A 2AXRA 2BS4B 1PDXA 3P63A 1FRDA 2GQUA 3SFDB 1DGJA 3D2HA 1RM6C 1W1SA 4N58A 3NVYA 3HVZA 2CJOA 2WQYB 2AX5A 1X2GA 2B76B 3W8WA 2QPMA 2Y5CA 3TSJA 2WLBA 3HRDD 3AE1B 5AUKA 3GSYA 1SB3B 5EE1A 3NVZA 3AECB 3PO0A 4JB1A 3PM9A 3AE8B 2RK5A 3ETRA 2N0SB 1N61C 3AE6B 1E10A 1DOIA 3AN1A 1FFVC 2CJNA 1L5PA 4ZOHC 1YJJA 1KF6B 2QJLA 4USAA 1JROA 2P3HA 3NRZB 4PVEA 5FXPA 1FIQB 3AEBB 1FRRA 1SB3C 1NYQA 3EUB2 3W5UB 4HG0A 2MJEA 5FXEA 4ZHOA 1R7SA 5HMRA 3LAEA 4HRSA 3FAHA 2EXRA 2H89B 4WWMA 1N61A 3EUB3 1W1MA 1W1JA 5EE0A 1FFVA 5C2TB 3B9JB 4BBYA 3AMZA 3DWGC 1JALA 4O95A 1JWAD 1FFUC 1WXQA 2O3GA 3AE5B 4C7YA 1QF6A 3S1DA 5FXDA 1GPXA 1X2HA 1L0VB 1V97A 1L6UA 2VFSA 1MBTA 1WVEA 1UXYA 1KFYB 1QOBA 4PVJA 2Q4WA 4N59A 3C0PA 4PWBA 4UD8A 3NVWA 1ZR6A 1E0ZA 3TSHA 1KRHA 1WYGA 3AM9A 3P1MA 2YVSA 3L4PA 1TJEA 3SR6B 3NRZA 2G1EA 4YSYB 3BW7A 4JWUC 4PZFA 1FFUA 2GQTA 4US8A 4DNSA 4BCAA 1XO3A 5FXFA 4P6VF 1YQ4B 3LXFA 3W5VB 1NI3A 5AE2A 1QOFA 2BT6A 2HTME 1FXIA 4LTUA 3JS8A 3AE4B 2DBYA 3FW8A 1I7HA 5AE1A 1E8GA 3ZYYX 2WDRB 1IUEA 2E3TA 2K5PA 1QT9A 2W3RA 2WDVB 1W1QA 5G5GB 1PFDA 4YXDB 1XLQA 1WGKA 2Q5WD 1OQQA 4JWSC 4A9AA 5ADZA 2M19A 3CIRB 3AEAB 1DZNA 3D2JA 3VRAB 4PVHA 3D2DA 3LLBA 3AE2B 1VAOA 2MJDA 2W3SA 4HROA 4YTPB 2BVGA 3W9CB 4ITKA 2WU5B 1W1RA 4FXCA 1TKEA 2PVGC 1YJIA 2P13A 4US9A 3NS1B 1F0ZA 3P4RB 3A7RA 3S1CA 1AWDA 2MH7A 2VFVA 5AUIA 1J7CA 5HQXA 4JX1C 3VTEA 1JQ4A 1NEKB 2BVHA 4ML8A 1N60C 5G5HB 1B9RA 1CZPA 1SIJA 4YT0B 5AE3A 1WWTA 2BS3B 1E0YA 3I99A 5H92C 1NENB 2VFRA 3FC4A 2JQRB 3NVVB 1E7PB 5G5GA 1PUTA 3FWAA 1N5XA 1I19A 3FW7A 4IDIA 1AHZA 2WP9B 1T3QC 4YSXB 2ACZB 3HUIA 1E9MA 4YTNB 1AYFA 1N60A 4PVKA 1MBBA 2VFTA 3AE9B 1ZP0B 3HRDC 3P4PB 1JWBD 2MBRA 3R07C 1WVFA 4BC9A 1GAQB 4N6EB 1OQRA 4PWCA 4PYTA 1W1OA 1OFFA 1QOGA 1FIQA 5HHZA 3DEDA 3NS1A 1ROEA 3SFEB 2JX5A 1J7AA 3DQ0A 3B2FA 1TKYA 2E5AA 1FO4A 2KMMA 2WDQB 4MLAA 3P4QB 3KJMA 2CU3A 3VR8B 1QOAA 2KAJA 3WCQA 3P4SB 1L6VA 5G5HA 1T3QA 2PVOD 2Q85A 1E8HA 1JW9D 3B9JA 1XLNA 4OALA 5H8YE 4ZHPA 3A7AA 1FXAA 1V8CA 4TVWA 2LEKA 3ABVB 2K22A 3AEGB 4ZOHB 1AHUA 3NVVA 1FMAD 3AE3B 2L52A 2BS2B 1E6EB 5GXGB 2WS3B 1WRIA 1HSKA 2NQWA 2PLSA 4WQMA 1RFKA 3AE7B 2L83A 1N62C 2R2ZA 1QLTA 3SR6A 1EWYC 1N63C 2M56B 2P4PA 3KWLA 3NVWB 3TX1A 2EKIA 1DIIA 1FM0D 2K9XA 3DWMA 3S1FA 4C80A 1NYRA 1TYGB 4BC7A 1QLUA 1UWMA 4KX6B 1DIQA 2QKNA 1XLPA 2PIAA 2OHFA 1ZXIC 1A70A 3VR9B 2W55A 1XLOA 3LB8C 1N5WC 3AB5A 1J7BA 1ZOYB 1RWSA 4TVYA 3S1EA 3W8ZA 3NVYB 1F0XA 1QLBB 1VJKA 1N62A 2BVFA 3A7UA 1RYJA 2VAOA 2DWQA 1N63A 4C7ZA 2PKOA 4YSZB 2H88B 5EE9A
chains in the Genus database with same CATH superfamily
1D5MC 2NBVB 1W1KA 4EEYA 4EC3A 4GXBA 2XH4A 1J19A 1GG3A 4ADWA 2KJ8A 2ZEQA 1VRAB 4M0AA 4QZDA 3N4MB 1Q3UA 1WZ0A 4C4VA 2UVRA 2WOIA 3PO4A 2PEAA 2WGSA 3C2LA 3PSIA 1S1QB 2KFJA 8ICOA 5KFHA 4BX9C 3CYJA 4GFIA 1ZXIA 2L3ZA 4KWSA 5CHFA 4GMEA 3LB8A 3AL0B 1E9IA 4F5PA 3N3KB 3TJ4A 1OXJA 4I2DA 7ICKA 1VLBA 1ET6A 1S9FA 5KFSA 5L1MA 2QIEB 2MJ3A 4A90A 5CWRA 5GTHU 5FS7A 3H9DA 3LYSA 1GC7A 3WKAA 4KV2A 4OZAA 1CJEA 1KH0A 3ZLFA 4W9IA 3C2MA 5AZHA 4EZJA 1KKRA 2BCPA 3L5KA 3NASA 4KN7A 4TUQA 1E5WA 1ENFA 4RFBA 4CO7A 4DDID 1C20A 4WJQA 3RAXA 2KJ5A 2W03A 4DS4A 1BKHA 4EX7A 2D3DA 2NTSA 3M95A 2IGGA 3SQPA 2AXRA 4DFJA 2L0FA 2BS4B 2W9CB 2ODGA 2GQUA 1JMLA 4ASWC 4F1SA 4C00A 1JOAA 4LJXA 3UIOB 3S2AA 4P7IA 4QW8A 5HHDG 2R9ZA 4MJSA 1ZQWA 2DKXA 3ES8A 3TTEA 2MCNB 2RDIA 4ICAA 3HVZA 3D2NA 4IC7B 2X8CA 2UU7A 2WQYB 3KOOA 5DG9A 2XH2A 4P0PB 2PW9A 3U30A 2VANA 1ZJMA 1BMLC 3DEQA 2A8XA 4A55A 1OEYA 1EO6A 1JUDA 4ED7A 2NS5A 3UCCA 2H3QA 4IW0A 3N1ZC 3TSJA 2PP3A 2KN5A 3HRDD 4Y2YA 4RNOA 3L54A 3F2DA 3WK8A 3QFAA 3AE1B 3GSYA 1PVQA 7ICTA 2IHNA 3H8SA 1EF5A 1R0MA 2NPTA 3TWBA 4BAXA 3AECB 3DVNU 3RR8A 1L7PA 2SEBD 1TK0A 3R8BA 3AE8B 3ZDTA 4I2JA 3MJ5A 5E79U 4MGZE 5ENLA 3HWTA 2KKPA 4UB5A 2W7OA 3FYHA 3AE6B 1FHUA 3KFUF 3T6CA 4OW0A 2PSNA 1ZQZA 2MRLA 2ZUDA 4CF3A 2ZW0A 5AI0A 2BF8B 2HJ1A 2L32A 4MFCA 2G45B 5HMLA 8ICZA 2KD0A 3Q8FA 5IDZA 8ICUA 2YVCA 3U8ZA 2QSDA 2QJLA 4F4KA 2QMTA 3NFUA 1KCZA 3V7KA 2ESEA 2P8CA 3ZIMA 1Q1RA 4EZKA 3IM1A 3IN5A 5FXPA 1JXEA 3U7ZA 8ICRA 4YQWA 1FIQB 4F2RA 4HWIB 3MHZA 4GRTA 3ZI4A 1SB3C 5HKHA 3GB1A 2C22A 1R4NB 3NZUA 4I29A 3JPTA 3GP7A 1UNSA 5DDYA 3EUB2 2N1RA 1WI0A 3SQSA 9ICSA 5KFDA 3NTUA 4XA5A 5KT5A 1PVPA 1P98A 1C4CA 3EC8A 4K4HA 4GDLB 9ICQA 3IK4A 4W9GA 4ZHOA 3PT2B 3IDWA 3BZCA 5AM3A 3PNCA 2V3BA 1Q1OA 1WWUA 4EZ9A 3QKEA 2W8KA 3Q6JA 2X38A 1GESA 4RNNA 1N61A 2LMCA 3L10B 3OAWA 1ZQPA 1XWLA 2IO0B 4TMAB 2GQWA 1XHCA 3LADA 2N4FA 1TAMA 5EE0A 2AGPA 3RJFA 3RMKC 3CSTA 1FFVA 1H8CA 3MFIA 1V2YA 5C2TB 4BBYA 4P0PA 2Y9TA 1ZDXA 3V4BA 2G06A 2YB1A 3GIJA 4RQ1A 5GRTA 2K0PA 2R61A 4O95A 7ICOA 4D2KA 5AI8A 1WXQA 1SSNA 4REZA 3AE5B 2W9BB 1FXTB 4NJCA 1MNSA 4MHVA 3OW1A 4JPSA 3Q8CA 2HNEA 3M9MB 1RZTA 3A9KA 5J0OA 4QIWF 4GIBA 5FXDA 4CNQA 3AQEA 5HMMA 4PHAA 4RT2A 3CP8A 3LDAA 5ALQA 3BJYA 2K8BB 7ICGA 1V97A 3DHHC 2VFSA 1PDYA 3FV9A 4DHJD 3BQ1A 2GH5A 5FS8A 4EOYA 2MUCA 4NEVA 3ZVVA 1UXYA 2XC9A 5FKAC 3JPRA 5BYQA 4ANUA 4KIKA 3SN4A 2P6UA 4K81A 4E6MA 3SN0A 2V3PA 4O5EA 3N20C 3NVWA 3EAOA 3KLJA 1SV0A 1WE7A 4IL0A 4Y2JA 3TSHA 1MHXA 4GN1A 3P1MA 4IR9A 3VC5A 2REXA 4B9VA 2KIWA 2ON8A 4RH6A 1K1SA 2G1EA 3SHQA 4FN2A 5DQHA 4QJFB 5AI6A 3HJEA 5TZVA 3OGUA 4GXKA 2GQTA 2RDBC 4A3PA 3I9V1 4ICVA 2BTEA 1TFRA 1X9SA 4MSMB 4P6VF 3OZYA 3B0AA 1RPLA 5J04A 1I35A 4H4VA 3W5VB 1TK8A 1NI3A 2BYFA 5J29A 4E4UA 5AE2A 4RUCA 1DXSA 1QOFA 4GDLA 1ZQGA 3V72A 4I6NB 3W1SC 1BGXT 2ASDA 2WXHA 3Q14C 2K6QA 2WXGA 4GOCA 5AI5A 3LVWA 3Q69A 3QZ7A 4LTUA 2CHWA 3SV4A 5BPCA 3OLMD 2PJHA 3B1LX 2KV2A 3PV1A 2LXCA 5IOIA 1LVLA 4FS2A 3AE4B 3PLUA 3IBEA 2DBYA 3H40A 8ICTA 2AWTA 1C79A 7ICQA 1L4DB 9ICUA 4JB3A 5EDSA 1HZ6A 1TS3A 5D2MB 3GZNI 4EZLA 1DRGA 2BPSA 1E8GA 3RBDA 1ZQYA 1S0OA 3ZYYX 1E90A 2F77X 2KLGA 1Z4NA 5CX3A 3U4FA 4E0DA 1KEJA 1L7OA 1YX5B 2IPKD 5KFXA 2JYTA 4FJZA 3OC4A 5G5GB 3CK5A 3PZ8A 5L6FA 1HA5A 2W9BA 4FX9A 4DFDA 1JIHA 2D3BA 1XLQA 1FECA 4H1ZA 1L3VA 1T0SC 1WGKA 4RNAA 4AQ7A 5K8EA 2XVTA 1KJTA 1OQQA 5DPRA 3LWMA 4J03A 4E71A 2WDWA 2BPFA 4ICUA 3CIRB 2LGDA 3EGRA 2KJ6A 3JYUA 5EWGA 2PE9A 3C8YA 2LWPA 4JN8A 7ICIA 2INDC 2BKFA 2Z59B 5G2NA 4ZCWA 4DSFA 3Q8KA 4JQWC 3FILB 4PYUA 4PGQA 5KHOA 1EC8A 3C1ZA 3JSVB 1NK9A 5L9XA 2WXJA 1PK3A 3T5JA 4G0NB 5CTRC 4YN4A 4IWOA 1NKEA 4YTPB 3W9CB 2H3VA 1XU4A 4G3IA 4TUUA 1MPEA 1RQNA 1UZXB 3A4SC 1EC9A 2PVGC 3CXOA 3MDCA 2CKHB 1S3SG 4NLKA 4ZRJA 5JRTA 7ICJA 1Q10A 1M6YA 2QJNA 4W9DA 1KOTA 4MDKE 6ENLA 2JVCA 4XDDA 2LBOA 4IG7B 3RFZB 2KEYA 3BZKA 3M9OB 2WXMA 5JCIA 3CRXA 3CYMA 3NXLA 2PTZA 2DZMA 5FS6A 2RQ5A 1NEKB 4KVGB 4WJOA 5FP0A 2KMDA 3A33B 9ICJA 2PE6B 4GR1A 5BOEA 3MQTA 3DBHI 5E6JA 4XE0A 2JUOA 1UT5A 1KFSA 3P42A 2WX0A 1B9RA 3DH9A 2Y9UA 2MW5A 4KT2A 4WAAA 1SIJA 4O3MA 2VA8A 5AE3A 2MSED 3HM6X 3VDGA 5L1KA 9ICPA 3TQPA 8ICMA 1XO0A 4F3OA 1WWTA 2KNBA 2YMPA 2HHTA 2NR2A 4K7UA 1WM3A 2BS3B 3TCSA 1TS4A 1O03A 2E1FA 5H92C 3R2IA 1M94A 1NENB 1ZQXA 1EF1A 4MH8A 1BVSA 2EH9A 3RYTA 3VC8A 1NK4A 2RDJA 5BYSA 1RYUA 9ICAA 4DSEA 4ANVA 2PU1A 3NRWA 2LGIA 4EENA 4U6PA 3ONSA 2QKQA 2V3SA 3RNEC 3F5AA 4JV1A 1UCVA 1E7PB 2DNFA 4H4YA 4PZOA 4NLCA 5G5GA 3SENA 3X23A 2KVZA 2QDFA 4EYIB 3BSMA 3MFHA 3UXOA 2H3ZA 1L2NA 2VH1A 3GS2A 2ZIVB 4IDIA 2H3IA 5KL1B 5D94A 2P0IA 4YSXB 5H2FU 4TUPA 2C3DA 1Z4OA 1SL2A 2D07B 2GLSA 2J52A 2PFNA 2K3UA 2YVFA 2EAPA 2LYHA 1E8WA 4LJOB 1ZQSA 1MRAA 2DF4B 4BFRA 4ED3A 1NJWA 2B0CA 4KMUA 3FILA 3BQTA 3MY9A 1C4AA 2J6UA 1B0XA 4F5OA 2P8BA 4M9HA 1PGXA 3JSVA 2FCQA 3IHPC 2A5UA 3VCBA 1S0VA 4B9UA 3BVZA 4KSKC 3IJIA 4M52A 4WJNA 3IRUA 2WX1A 3ZVIA 4HXDA 3DEDA 4R8UB 4HCLA 8ICNA 3EA6A 1ROEA 4J3ZA 2P6RA 2GDQA 4HNCA 3RRHA 1ZMCA 3D6JA 2E5AA 2KIVA 2KMMA 3IG5A 4EYHB 2O2VA 2L05A 3ZGZA 4UB3A 1KQQA 1XS2A 4QZ9A 2PFOA 4W9EA 3TADA 1QQRA 1VR9A 2LJ5A 5AEKB 4UBBA 3PW4A 2KAJA 2L5YA 1MSWD 2XBBC 2EDUA 3WCQA 3VC6A 1DK2A 3ZDEA 1ZD4A 4EMIA 3KZXA 3RJGA 4ELVA 2HQMA 2RMMA 4DXGA 1SZPA 4IL2A 8ICPA 3WK9A 5C0YA 2DAJA 1JW9D 4DSLA 1E8HA 4MGIE 2MAXA 3RITA 5H8YE 2FPKA 1UUPA 1Y8RC 1P1AA 1MQ2A 2QB0B 1GEUA 3SU8X 4ZHPA 2AQ0A 3RNCC 3BQ0A 4TVWA 1XCQL 4QWBA 1KM7A 1V9JA 4F4XA 1VCBA 1YD8U 4YL8A 3DK4A 3TIXA 2K4PA 1NHRA 2AL6A 2LZ6A 2RP5A 3CW2C 2L00B 1ZPSA 4EM4A 3GIIA 2I1JA 4PS3A 3D2SA 2DFLA 2KACA 1AHUA 2LFIA 4DQOC 3M8RA 2JT4B 1TS5A 1WXVA 4MEMA 1SJCA 4G7FA 3LWLA 1ZD5A 3RJHA 3M1YA 1BNOA 5J2AA 3VCNA 2ZIXB 3QEAZ 4OO1J 2F8KA 5HI1A 4AP9A 3Q8MA 4KSLC 1NU5A 5DPWA 2XICA 1WRIA 3PRMB 4OVZA 2R2OA 1I42A 2RDXA 1WR1A 5IIKA 2WFAA 4ELUA 2C7HA 3MC8A 1NKCA 2O6VA 5AKEA 3RAQA 4R63A 4IQVA 4MT5A 2KXJA 5E6PA 1D7YA 1X6JA 4PPXA 3URHA 1QLTA 2YQEA 3R0KA 4KLLA 2EZZA 3SR6A 2C3CA 2K1FA 4HVBA 1YMHE 2YQUA 2P4PA 4MF8A 1I4XA 2KWDA 4UDUC 3PW7A 4ZDVA 4EBDA 1ECWA 1QSLA 1HUZA 3OPXA 3SI8A 2C7MB 8ICFA 1MDLA 2LYAA 2K9XA 3ZO5B 3GIMA 3F2BA 2E1EA 1TYGB 4GYPA 4YCXA 3NUHB 1QLUA 2BHNA 4NLZA 1ED1A 1MHHE 1JMSA 3SJNA 3CF6E 3UXPA 4DWDA 3SYZA 3RH5A 1RFAA 4X57B 4ZRQA 2ZADA 5T8IA 2P3ZA 2WTFA 8ICQA 5IN7A 3DBLB 2NRZA 3BK1A 1ZXIC 3UXKA 5FJTA 3VR9B 2W11A 3LB8C 3N30A 2R8KA 3PX4A 3EHVA 4ZRIA 4IT1A 3M8SA 5FJRA 5KFZA 1ZQRA 3QQ8B 4KZCA 4RQ0A 1BZLA 4NM2A 4QAYA 2BWES 1VJKA 3T3FA 2ONEA 5CHGA 4DSIA 2PI4A 2KZZA 2BVFA 2MA1A 1M6IA 1WX8A 3A7UA 4KPRA 2XCPA 2FMPA 3RD2A 1OJTA 1X66A 2I9GA 4YSZB 2H88B 4ZYSA 4RT3A 2PXIA 1JRUA 2J0KA 4F5QA 4XDCA 1WCNA 3F2CA 4RQMA 3FG2P 3PFRA 3W8XA 1NNLA 5JRBA 1HJPA 5KFIA 1DGSA 4ED6A 5MPOA 3NVZB 1W1LA 4ECQA 4EM3A 3KQ4A 3Q8SB 2LVQA 1JRPA 1ZKQA 2FDRA 2ZIXA 1I4PA 1J2MA 4YTMB 5J2KA 4Q45A 5C3JB 4YP3A 4YR2A 3AEDB 2GRIA 1P7FA 3MABA 3NZ3A 3MHSD 4I2CA 4KGSA 4NWIA 2WF9A 5BYRA 3H70A 2ATLA 2PLIA 4Y2XA 1HXYD 2LGSA 2D6FC 2N1VA 3GQCA 4YVZA 2OAIA 2POZA 3JPPA 3L8KA 2KQ7A 1E8FA 3K1RB 2KZMA 2KWCA 3DBRI 2I0KA 3D47A 2B21A 2K89A 4Y2TA 3GO2A 1NOMA 3KYDD 1YQ3B 4PYZA 2WHIA 1V9PA 3GOEA 4MM3B 1NK5A 5AI4A 2YMMA 2OM6A 2AU0A 1TKGA 3UJFA 3LDZE 9ICMA 2BKRB 1IYXA 2VFUA 4Z6EA 3BINA 4JWNA 4IM2A 1QZEA 2O56A 5L1IA 2MUTA 2ONQA 4GDKB 2JXXA 3AEEB 5J0PA 4DFMA 3V5CA 1R4MI 4H4ZA 4J57A 3P63A 3OTQA 2JMGA 3PSEB 4KLIA 3D2HA 5ALDA 2JRZA 3KHGA 3D32A 2CRXA 2KWVB 3V3WA 4GGQA 1B4FA 1W1SA 3ES7A 2ZVNA 2A19A 3OJUA 3QLDA 2OJWA 4GC7A 2B6GA 3ISDA 3HPOA 3AEVA 2FLLA 4BVUC 3RB4A 2AX5A 1HZ5A 2RABA 2J7QB 1F77A 3IP4B 1KLNA 1H38A 1ELSA 2BPGA 1X2GA 2WXLA 5DBBA 3W8WA 5KFTA 2MNRA 1F8WA 3QA8A 4P1BC 2GGIA 2AL2B 4YXMA 2IO2B 2WLBA 3QU4A 5FR6A 2KZRA 3SSZA 3RI7C 1F9JA 3BS7A 2QC8A 2LRUA 4J3OD 3GRTA 3H7VA 2HHXA 4BKSA 1JPMA 5KG5A 3RJEA 5EE1A 2YX8A 1UHUA 4YMNA 3NVZA 4Z17A 1GO3F 3MC1A 3PO0A 4K7SA 2HXTA 3CSFA 1PQSA 5LNK1 4UB6U 4JB1A 1ZRNA 3NO1A 3MR5A 1WUEA 1RYSA 2HTHA 3PLVA 2RK5A 1NKBA 2BYEA 5KL8B 5ALNA 2NRTA 2V4RA 1C77A 4EQRA 5J0TA 4DYEA 3QU2A 3ZLGA 4AOFA 1N61C 5ALJA 4APNA 1E10A 3C29A 1BT0A 3TMPB 3ONNA 2GL5A 3RB6A 5G55A 5DBAA 4B6WA 1FFVC 2HW3A 3DG3A 2CJNA 2FCSA 2IO1B 2JZPA 3UCDA 2A1JA 4ZOHC 4NAWA 8ICYA 3ZTCA 3DIPA 1ZQNA 1SIFA 4WH4A 1KF6B 3M3JA 1BUIC 4USAA 1JWUD 1PYWD 2RD0A 3WK6A 3E2EA 1Q46A 1ZW7A 2W9AA 5EWFA 1JROA 1WGDA 1E8XA 2DYMA 2BQQA 4W9LA 3WANA 3ZVHB 2P3HA 3ZQ4A 3LVVA 3JPSA 2WHEA 3R25A 4XQ8A 4DBGA 3AEBB 3M63B 3T3OA 3N4FA 2KKCA 2JEIA 3LXDA 2V3NA 3TL5A 1TIFA 3G6YA 2ZNVC 1MO9A 4QWDA 1AARA 2WXOA 2MP2B 5ALYA 2HVHA 3DBSA 4A20A 1E8YA 4AUQC 4MFFA 2K4HA 4RZRA 5KFBA 2Z8LA 4MGKE 4L1BA 7ICPA 4KLQA 3VTWA 2IDYA 5FXEA 1ONEA 1R7SA 3ZXVA 5HMRA 3V6KA 5DB9A 2EXRA 2PKEA 2RRDA 2HVIA 3H1UA 1YT3A 2WP6A 4JMUA 4B6JA 2BZFA 2B3AA 1SV0C 5C1ZA 1T5XD 3DGHA 2F8LA 3O65B 4NL9A 4O5CA 4DOCA 4UARA 3B9JB 3QZ8A 1PK1A 5KFGA 5KFJA 8ICIA 3AUOA 4LZGA 2GOLA 2IY1B 2KN4A 2KQ4X 2LVOA 4MSQB 1MVKA 4DFPA 3VH4B 5KFAA 1JWAD 9ICEA 2LPEA 2MA9B 2VZKD 1IP9A 3SN1A 2D11A 2JZZA 2LM4A 2AL2A 2KJ9A 3UF8A 2F1JA 5AIBA 3WU2U 4KLFA 4C8NA 1GSNA 4CF4A 2JV3A 4C0ZA 5JHAA 4I2GA 1GPXA 1X2HA 4Z1YA 3TFRA 5JZEB 5IA7A 4WJPA 4C8LA 2M8SA 2JWUA 1HTOA 3HW2A 2K39A 4DF4A 9ICOA 1L6UA 3ZJUA 1WXAA 1ZKHA 1J0GA 4EUTA 2JRHA 4FBTA 3EEZA 5ALVA 4O0IA 4IRKA 1QKZA 1MBTA 3QU9A 1SKWA 4FBUA 3KVFB 4QZCA 1NHQA 5IIOA 4GGHA 2OQHA 5ALIA 3R9KA 2HJ8A 5CEHA 2LASA 3F5EA 4B9MA 1T0YA 2G07A 2ZPYA 2V3AA 3TJIA 1AW7A 1ZR6A 1UPHA 2WXQA 1Z1BA 1KBUA 1ZQFA 3KKAA 4UAWA 2PTWA 3AM9A 2YVSA 3O13A 2KHQA 9ICKA 1NDDA 4A6QA 4KLEA 7ICFA 2LGYA 1Z2MA 5FMHA 4ACOA 3FYYA 2OFJA 3BW7A 1H2IA 1K53A 2BCUA 4US8A 4DNSA 2JK6A 1XO3A 4F7ZA 4BDPA 3VQIA 4FS1A 2BQRA 3TWAA 2KHWB 4FADA 4MKSA 7ICSA 2WF7A 2OZ8A 5KHQA 4QZFA 4NJ8A 3APFA 1WG8A 4J9NA 5J0XA 2EELA 3FCPA 1BPZA 2HHQA 4WIPA 4E74A 5KFPA 4YD1A 4G50A 3JS8A 2FUG1 3GRSA 2BC0A 3PWGA 4GXJA 2OEDA 3FW8A 2PCEA 3NZSA 4N9F4 2PPGA 1N48A 3IHQB 5HFYA 5HP4A 4HNLA 4PH5A 2NQLA 2FCNA 2ZCBA 2LMRA 4Y2SA 1VZ6A 1WF9A 2BB6A 2KZ3A 2OXOA 2YN4A 5ALZA 1I4HA 3OHAA 1QT9A 2WDVB 4XWTA 3UI3A 1W1QA 1KRPA 1MQ3A 3MGHA 1L8OA 1V81A 3CNHA 2GH1A 2Q5WD 3C5GA 4BBNF 4YR0A 4M02A 4P4PA 2M9NA 4JWSC 2NYVA 1P7EA 2RGFA 3GIKA 2M19A 1AROP 2D10A 5JHBA 2UUVA 1R6WA 5KG6A 3L13A 5J2HA 3VRAB 2GO7A 5E6NA 2HOQA 1UGJA 4K4GA 3M6KA 3ZDDA 4LNIA 1ZD2P 4TSSA 3AE2B 3UJ2A 3EJEB 2EQ6A 4MMWA 2C28A 3RRAA 1WJ6A 4QZAA 3H7PB 9ICLA 2N9XA 2BVGA 2Y4GA 2ZTCA 9ICCA 2CS4A 2WU5B 5KG7A 3H8JA 8ICWA 1TKEA 3GE3C 2GMIC 2G4DB 1WUFA 1KKXA 2A4ZA 4TV3A 3P4RB 3OP2A 1AWDA 4WWOA 2VFVA 1BXTA 4F5NA 3C5FA 4UB8U 3V61A 1GXFA 3QEBZ 5HQXA 1NJYA 4JX1C 1WE6A 3RH6A 3IXSA 4LNNA 1JQ4A 3DGBA 4KITB 1P7DA 2BW2A 2JHDA 2BVHA 4F92B 4QNLA 3C2KA 2W9CA 1X9WA 4RF1A 1KL9A 4UB2A 1Z3EB 3JW0X 3DBHB 5GTIU 3PZPA 4IL6U 1P9DU 5I1WA 4XC2A 1RXVA 4GIRA 1CZPA 5KT6A 4UATA 3SV3A 2WOWA 5KFKA 3V5FA 1RDFA 2SAKA 5IO9A 2LI6A 3UGVA 2MU2A 2R8HA 4EBCA 3TAPA 3N7SC 4I2FA 4KLUA 4S17A 5BMHA 2KSOB 3OTRA 4NY0A 3QJZA 1JEHA 3N97B 1XSLA 2VFRA 2KK8A 5IILA 4Q2JA 1X40A 4FJYA 4U7CA 1BQGA 4RQ3A 1FPYA 5D4BA 1QILA 3V60A 4ECRA 4DXFA 1IIPA 3ZD8A 3GU3A 5AKKA 2KICA 4R66A 1PUTA 4O3QA 4RPZA 3EPIA 3DDCB 3TADC 2LI5A 1L5UA 3EJDB 4F4YA 4FE3A 2R8IA 4GB9A 1GUAB 3PVLA 3M7DA 4P0QB 3QX7A 2GRTA 5AKXA 4K7ZA 2ACZB 2N7JA 1E9MA 1V6EA 2PPHA 4YTNB 1A77A 1KLVA 1WY8A 3ECIA 4NV0A 2X99A 4ZH4A 4QIWC 4DLGA 4EZ6A 3KHRA 3AE9B 4HKQA 3N28A 9ICGA 2L8JA 2XK5B 3DDHA 1YN5A 4ECTA 1UA1A 2MBRA 3SEIA 4WWPA 1K1QA 1WVFA 2WPFA 1GAQB 4FLHA 3PK7A 3SAHA 3H7PA 4N6EB 2GSHA 3P93A 4PL1A 2BGWA 4JV0A 2J53A 3DFHA 5HHHA 1MI0A 1FIQA 1OFFA 1QOGA 4H4QA 2UWQA 2D3GA 5HHZA 4TURA 3KUZA 1C1YB 2N9KA 2YAUA 2MWSB 4RGTA 4DDGD 3APDA 4W9CA 2OJRA 3T3NA 3PSPA 1MA7A 1J7AA 3DQ0A 3B2FA 1TE6A 2KVSA 2EZYA 1COKA 3RNMA 5AM1A 3RO6A 1STEA 3AU5A 2WDQB 4MLAA 5DG7A 2JEJA 5AZFA 2CU3A 2F76X 1H6VA 5ALUA 3MGVA 3GE8C 3VFCA 5J2IA 1QOAA 3U2SC 1MOKA 1ZDLA 4G9BA 4HPMB 1F9CA 4BOSC 1BPDA 4P16A 4BXOB 3MBYA 2W8LA 1YZ6A 4NY8A 1WCLA 4I6PA 2IPIA 1XLNA 4YMOA 1S0MA 3K9OB 3H4BA 1WX7A 3PG6A 1LKYB 3OJSA 2MBOA 3Q2AC 1FXAA 4RQ7A 3WAMA 1ZQQA 5KFMA 2WAQF 2EAMA 2QJMA 4EMWA 3ABVB 3RNFC 2BR0A 4Y2RA 3KUDB 2FMQA 4TQSA 4A35A 3SQIA 7ICUA 2WF6A 1EM7A 3AEGB 1MN8A 2HHSA 5EBKA 4RGOS 4O3NA 5U1OA 4GYPC 5FR3A 2XO7A 2BCQA 2IYDB 4NPNA 5CHVC 4DHJB 2DZJA 4HAIA 2WF5A 2CHRA 3Q3FA 2K8BA 4PZNA 4UBCA 3TEXA 4B0EA 2C60A 4RGNA 4JK1A 4J9SA 2EAOA 2AEHA 2L52A 2BS2B 2WAQC 3TKAA 2N9EB 2ZCCA 3SD5A 2M17A 1D3ZA 1Y88A 2A1AA 2OWOA 1EWCA 1UT8A 1WH3A 2WS3B 3UQAA 4O3SA 2KFZA 4ANXA 1HSKA 2X50A 1KTKA 3BYTB 3N1XC 4OVVA 4M6WB 4NLBA 3BZDB 2WXFA 1JX4A 2N9PC 4WQMA 4DS5A 1RFKA 2YEPB 1T94A 3M62B 5J2JA 1GB4A 9ICFA 7ICMA 4DWFA 1YN4A 3IV6A 1SJED 2PI5A 2Z0DB 1URJA 2DPJA 1EWYC 5ALOA 4PJ0U 1U47A 4HJKA 2J0MA 3R11A 5J2BA 4B9KA 2RR9A 1TYTA 2ZZCA 3KHHA 1CQVA 3KZIU 1BWCA 4H4PA 5KVIA 4HCDA 3RF9A 3GD3A 4RM9A 4WWNA 3TUOA 5JTIA 4O3OA 1OUQA 1S77D 1ZQAA 2O6VD 2IY0B 1F52A 4EX6A 4BC7A 4TKNA 3OJ3A 5C5JA 3B97A 3DVNV 5J0WA 2C2EA 1RXWA 4OJOA 3PZDA 5AHXA 4OJLA 9ICRA 1SJAA 1TKKA 3ZKJC 1XLPA 2I1QA 3RJKA 2PIAA 1P3QU 1L3SA 1ZK7A 2GGJA 3D9XA 4IM0A 1X42A 2FJ6A 2K8CB 1A70A 1XLOA 4G8TA 3AB5A 5DLGA 1JN3A 1ZOYB 5DGBA 4BXOA 5KFCA 3QN3A 3S1EA 4I2AA 2FIDA 3HX0A 3AXCA 3BY4B 2GR1A 2XGZA 1K51A 4GFJA 2M0XA 1QLBB 4ZRPA 1N62A 3POPA 5FS9A 4O1NA 1RYJA 3L17A 2ZZBA 4P4MA 5KG1A 5IIJA 3V7JA 4WJ3B 3PS6A 4QZHA 3NOBA 2OG9A 1RLFA 3VDZA 3RRGA 3UJEA 1VZ8A 1NK8A 2UUUA 1MDRA 4IWPA 1QLNA 3C0RB 1ZETA 3HP6A 4DNAA 5AWVA 3UQ2A 3MWCA 4M9LA 3Q3MC 4RM8A 4ECYA 1VDVA 2AL3A 1WFYA 2CN1A 3AH7A 4LCDE 1SE2A 3K9PB 5I4DA 2AQ2B 2FAZA 3JVZX 3QX1A 4KMOB 5EE3A 4IC9A 3MR2A 2K4EA 4H4XA 2DENB 4Q44A 3NY5A 1NVID 1XC9A 1QQ7A 2KP7A 4M6WA 4KGTA 3VFKA 2E8NA 3WKEA 4AJWA 1GRFA 1VQZA 3UMCA 1N5WA 2R8DA 1RM6B 1FNWA 2VJ5A 3V7LA 2DW7A 3VUXA 2E8MA 3ZJVA 3UQBA 1OEYJ 3H8AA 3RPFC 5DBCA 1OTRB 4IZGA 3PX6A 5CHWA 3DBRB 3T5KA 2LUEA 3PO5A 3APCA 3MUCA 4PL2A 2L76A 3HIZA 4LDTB 2L7RA 1ZY8A 3H4DA 2FCMA 1ZUD2 2JWZA 4HK2A 2MBQA 3ZW3A 2VRRB 1C76A 3N1YC 5DDMA 4DLEA 4M0WB 1NJXA 8ICEA 4ZYNA 2AGQA 2Z0EB 5BO4B 3SDLC 3FW9A 5D79A 3NGDA 2LRWA 2NO4A 1EUVB 3AEFB 3VUYA 3DDMA 3TAQA 1PDXA 2F3NA 1Q1WA 2EQ7A 3CXBA 4WQOB 3SFDB 3TW9A 1DGJA 3B0XA 2V9HA 2Z7JA 4H83A 3EYZA 3PY8A 3PTFC 2WF8A 7ICRA 4K1WA 3HT3A 2ZJ8A 2P66A 4N58A 4F93B 3CMMB 3PVXA 1ZGUB 4IQWA 5AKHA 1FEAA 2NPXA 2XY6A 5B5EU 2Y1JA 4DSKA 2LKYA 4NXZA 2G3QB 1YNTE 3RZFA 2N9LA 5AM4A 4FO6A 4DCCA 2B76B 1L8LA 3D2QA 4Y2PA 3TFSA 3THUA 5AK3A 1BPXA 1UH6A 2KG5A 1G6JA 4F4RA 2DZKA 3ZDCA 5FJOA 2ZIVA 5AUKA 2KFKB 2LGXA 1WIAA 2AYOB 5DG8A 4DQIA 5LXIB 1SBBB 4RCOA 1GV4A 3ZLZA 1XD3B 1KD0A 3PM9A 2QAEA 3EFUA 1L3UA 5BOLA 3MTNB 2INNE 2N0SB 5BMGA 4KLSA 2YMQA 1AN8A 1OEPA 1D6EC 4KLTA 2BWFA 4H2HA 4FULA 5FJUA 3L5OA 3O0FA 1FEHA 2IMWP 4NL9C 1M4VA 2Y3AA 4AWJA 4EQWA 8ICCA 4BV6A 1L5PA 4UB4A 3H0MB 2NRWA 2DAFA 3VTVA 4DHZE 5ALWA 1Z00B 3EANA 5LLIA 3ML8A 4PS7A 2GGGA 4R8UA 2MSNA 1ESFA 2XCAA 4P2HA 4MGYE 4AP4C 3A0HU 4J9MA 4QWAA 4ECXA 1LGRA 1ZX9A 1FRRA 3HILA 2WBAA 3FKYA 1N2XA 1KDHA 4JLCA 5F3XB 1OQYA 2PP1A 5J8YA 4EEWA 1TAQA 4M0WA 2KOXA 3WALA 5BMIA 2XSXA 3WKBA 3W5UB 4HCPB 5AK5A 1KLGD 4B0MA 3W2DA 2JYEA 4CHKA 2ASQA 3HK0A 4ACFA 3EZ5A 2LM1A 4DL4A 3LAEA 3QIJA 3QU7A 2FPLA 1ZQEA 2EMTA 4M0XA 1GRTA 5ALSA 3FAHA 1SJDA 1IPGA 3RUIB 4NEWA 2H89B 2KYWA 3EJBB 4UAVA 2QB0A 3TEZA 1BPBA 4J9OA 7ENLA 2DKZA 3SZ2A 2F44A 3IVFA 3EUB3 1HIWA 3KKAC 2ZJ5A 1X9XA 1W1JA 1W1MA 1UQVA 1UBQA 5KFQA 4GIVA 4YR3A 1J8CA 4AYBF 4XWWA 3ZLHA 2CXYA 3AMZA 3DWGC 1JALA 2CR5A 3AQFA 2E8PA 1HQRD 2NVKX 3C21A 1ZD3A 4CF5A 2HDEA 5J17A 1GRAA 4DO9A 1WX9A 3T9LA 4HDOA 4K2SA 5BOMA 4NNJB 2Y5BB 5J0RA 1P43A 2WXNA 1YIWA 1LO5D 3V6HA 3QE9Y 2RPVA 3CB3A 4QZ8A 3S1DA 4F8CB 2KLCA 2F5ZA 3N4EA 2GBRA 4AYBC 4BWMA 1X9MA 4KLMA 1NK7A 5KFLA 5AIAA 4JN7A 3KHLA 3TSSA 1WGYA 5HHIA 1C7YA 1ZQDA 3URYA 4YG2A 1XCTL 2G0AA 3BVGA 4W9JA 3RCZA 1WGGA 2L0TA 3H0RB 1QOBA 4IUMB 4IRCA 3IG8A 8ICXA 2DL0A 2KT7A 3C0PA 2NV3A 1DOQA 1TTNA 3CGDA 5KFOA 3PMNA 1SE4A 3DG6A 4XX5A 1E0ZA 1ZYQA 4PGYA 1KRHA 4HEA1 3DV9A 4XYCA 2W43A 3QUBA 3PR5B 2GGEA 3L4PA 4FBJB 1EXNA 2I38A 3BYYB 2HHUA 2KK0A 4RUAA 4YSYB 5J2RA 4DHZB 1W6TA 2M0AA 4C56C 3I28A 2GBKA 3Q45A 3PW2A 8ICVA 1ACCA 5HR6A 4X2PA 1FFUA 4F8RA 3SD7A 4RQ5A 4PGXA 4LNFA 4BCAA 2OZ3A 2P88A 2WP5A 2KDEB 4IQUA 4CDGA 5FXFA 4NQKE 3T9PA 3PV8A 2KD1A 2UVWA 3IJLA 2ZJAA 3MJWA 5AZGA 1IG6A 2FLNA 5J0YA 1T0RC 2GR3A 3DG7A 1GC6A 4R65A 2BT6A 2HTME 3UIPB 2KOBA 3H8HA 4BZAA 3Q8RB 1FXIA 1SXEA 1L4ZB 2HHVA 3C1YA 4QWCA 1Q0WB 3O0HA 4IP5A 2NCNA 2ZUBA 3V3XA 4I2IA 3H7IA 5JCKA 4IS7A 2MHJA 1J2NA 3ZRCA 2AGOA 1I7HA 3Q4DA 2MBHA 3BJSA 1ZXHA 4EQXA 1WRDB 4KDLB 4OZBA 1QCKA 2V1YA 2KDFB 4F71A 4GISA 3OZMA 1V5TA 4CE6A 1UWXA 2WDRB 2HDOA 3HKZF 1IUEA 1XF5L 3PHXB 1IV8A 2K5PA 3IT6B 2W3RA 4K1RB 3SBFA 2BYVE 4FA6A 2QQ6A 4HYKA 4KLOA 1S0NA 5CP2A 2W04A 2ISPA 4LK0M 2J4XA 4PHDA 2DW6A 1YX6B 5JCNA 5KNIA 9ICXA 1RAXA 2DPIA 5AK6A 3V6JA 1UELA 3M9NB 1DZNA 3D2JA 2RPQA 1U48A 3Q8BA 1SE3A 3QNMA 2JU6X 3Q3NC 5KFYA 4C4VB 3RTVA 7ICHA 2R8JA 5KT2A 3IAS1 2I1KA 3LLBA 2EQ9A 3FDSA 4UASA 2Y08A 3E0FA 2KO3A 2K4IA 3GV5B 1VAOA 4MGGA 2ZW1A 1TY2A 2MJDA 1JWSD 3DOWA 2BPCA 3TQ1A 4HROA 2H5XA 5F9NA 3RN9C 1H4RA 3MFGA 4ZRKA 3GDXA 4MM3A 1YJIA 2P13A 3KD3A 1TY0A 3NS1B 1S5LU 2PMVA 2O6KA 1IGCA 2MH7A 1L8PA 5DB8A 1TE2A 4GGBA 2EQ8A 1DXLA 3T5LA 3TI0A 3PZ7A 4CQNA 3GZFA 4GDKA 2GB1A 1GOZA 1T8EA 2ZZ0A 4OJPA 4RQ2A 4Z6FA 2BDPA 2XNAC 4PK1A 1PVRA 5L1JA 5KT7A 2V4LA 2HBLA 4J9QA 5IIMA 1TK5A 3WA0A 5JU5A 2QVHA 3R1ZA 5G5HB 2ZXIA 2GBMA 3BVMA 2KVCA 5KFRA 2YVJA 5EU9A 4JL9A 2KNJA 3PQBA 2GLEA 5DCNA 1OGWA 2CU1A 5IAAC 1HTQA 1F0MA 3VHTC 3DBLI 1NK6A 2NRVA 2D5GA 2KDMA 1D4BA 3AI5A 3WK5A 1S97A 1UD7A 2XN9C 2WYQA 4DL3A 2HOIA 1MFWA 2JY6A 2GOWA 4MJSB 3RULA 3I99A 4GLSC 1D5XC 5KTQA 4LVSA 1D8BA 5HNKA 4YFKA 1JCKB 4KLHA 2MLBA 3R3MA 5IIIA 3ZNZB 2PP0A 5ER0A 4FZLA 5AKJA 3FC4A 1WR6E 2Y1IA 3GY1A 3QFBA 3C19A 3NVVB 5IINA 2JPHA 3QK0A 3ZDMC 3ENEA 1D9DA 1IYFA 1WSPA 4J56A 4MELA 2IZVB 3VAWA 3WAOA 4TQ1A 2BKEA 1N5XA 4X5VA 1KFDA 1SXDA 4W9HA 3RNBC 1X2IA 2WP9B 1AHZA 4ED2A 3NHEB 2IA6A 2NPTB 3QAQA 8ICKA 2DYOA 1CI4A 2BQ3A 5D46A 1N60A 4PVKA 3HW8A 3BQ7A 3L3FX 2JXJA 4IQTA 1ZP0B 1SJBA 5AKLA 2CPRA 1K8RB 1WYWB 4UAZA 3HRDC 3P4PB 1JWBD 2JRIB 5KFEA 2DQNB 5ALEA 1YOVB 9ICVA 2ICIA 3R07C 1TZZA 4ARIA 2Y0SF 4OJ6A 5KT3A 4O3PA 4MEXA 1OQRA 3ZVHA 1W1OA 1GNUA 2ISOA 1KW4A 1V49A 3CT2A 4TUSA 2QB1A 2JSVX 3ZXRA 3NS1A 2HMXA 4YWGG 1JCTA 3STPA 3CGCA 3UXLA 2FNJB 5DQIA 2JH7A 2PMZF 4G3XB 3SFEB 9ICWA 1L7NA 3FJ4A 3ZD9A 1A5RA 5KFNA 3R66C 2MP2A 1WJNA 3I57A 3PSFA 1NJZA 4J6IA 1GRHA 4GC6A 4PS8A 1TKYA 2WXPA 5JH5C 4ZA0A 2XI9A 4HPPA 5ALPA 2Y3SA 2FI1A 2YB4A 2KTFA 4JWMA 2MRPA 2IJ0A 2Y0SC 4GMVA 1RG6A 4I27A 1CUKA 3VR8B 3ICXA 4Q8FA 2D3CA 3P4SB 1L6VA 4EMJA 4KLJA 2UVVA 5G5HA 1U4AA 4FJVB 1T3QA 3HPFA 2PMZC 2LHDA 3QYPA 1CMXB 4KN4A 2QARB 3H8MA 3I4KA 1U9LA 2PVOD 2VZKB 3V05A 4FHJA 3VTUA 5L95C 3GZNB 3B9JA 4OALA 5AM0A 4TQRA 5ALXA 3KYCD 5IKCM 4XUSA 3A1QA 2ES6A 3PW0A 1V8CA 1DK3A 3IAM1 3A7AA 2LEKA 1YQBA 5L1LA 4ELTA 3UINB 2NMQA 1VZ7A 2MBEA 3BOXA 2WPEA 1HUOA 4NM1A 1XXGA 3ZUNA 3K1ZA 2XY5A 3DERA 4K7WA 4ZOHB 2M4NA 2LXAA 3R0UA 2DGZA 4F4WA 2W0HA 3NVVA 1E7VA 1YJ1A 3DK9A 2G5IB 3JPQA 2NO5A 3AU6A 3A9JB 1YEYA 1XSNA 3C28A 3II4A 2IOHA 1WZ3A 3TARA 4JV2A 3HVDA 4H2AA 4RF0A 2J3NA 3NG0A 2WDTB 3D46A 3AE3B 1O08A 1AOGA 1L7MA 2X8GA 1E6EB 1AQ6A 1SGHA 3QUTA 2G09A 3A9KB 1WJUA 3DVGY 2JGAA 4DOAA 2ZNVB 3AU2A 2X8XX 4BBNC 4HCHA 1TYPA 4RQ6A 4R3DA 3VA8A 5JCMA 3OHBA 2J42A 2KC2A 8ICHA 2H3FA 1UGMA 4O9MA 4OZCA 5JUMA 3G6VA 1L3TA 4DXAB 3AE7B 3TJPA 8ICLA 2L83A 1N62C 2OKTA 2R2ZA 2ALZA 4DL7A 3S5SA 1U49A 9ICIA 1FCLA 4KIKB 3BQ2A 2ZZPB 2ZXHA 4J1OA 1ZE3D 3QWZB 1KKOA 4L23A 3NVWB 1F2RC 3UM9A 1XANA 1SJHD 2AXTU 4O5KA 3QU5A 3TX1A 3IFWB 2VA2A 2EKIA 1DIIA 3RFAA 2IO3B 1Z1VA 2CDUA 3T8QA 3PSTA 4B95A 2V4IB 4M9JA 4C80A 5TISU 2LD9A 2P35A 1NYRA 2YEPF 2ASJA 3S1FA 1ISNA 4L2YA 4ECWA 1GRGA 4Z6DA 1T3NA 1RQLA 4F2SA 3TCAA 1UWMA 2IGDA 1L0XB 2WOVA 1U4BA 3S6JA 2BBCA 2GR2A 4K8DA 2PMQA 1TGZB 1EBDA 2MX2A 1C4PA 4ECVA 3UGBB 3EECA 4RGMA 3VXWA 4II2B 2K8AA 1N5WC 1ZQCA 9ICHA 2QARA 5CA7A 5E6OA 3NVYB 2LJIA 5DPSA 2C2DA 2BCSA 3MC9A 4Q43A 2HXUA 2OYYA 1F0XA 4NLNA 3EFCA 1WMHB 4J9KA 2C9WB 3I3TB 4IWQA 3TACB 2DWQA 2WB1F 1N63A 1QH9A 5KFFA 3LK9A 4DQRA 1UA0A 2QILA 3I6TA 2PKOA 3THVA 1LV5A 2K8HA 4J9RA 1I4GA 4IRDA 3OPSA 4MH0E 2Y5PA 5K4LA 3HSUA 4E5TA 2LVPA 3OJ4B 2W54A 3A9JA 3FVDA 3N6HA 3Q6BA 3UPQA 1FD6A 1ONFA 3N9YC 3JW7A 1DOYA 2V0GA 1SEBD 4M6UA 3ETRB 5KG0A 5CR0A 5CB1A 2WB1C 2N7EA 2G5HB 3CWIA 1STZA 2PTYA 2Q4TA 4LIIA 5JXVA 5T14A 2CHZA 4C8KA 1S7MA 3DHIC 2V6OA 2RDHA 2YVGA 5TR3A 3UJRA 1A76A 3DQVA 1ZQIA 3DJJA 1SWWA 2KX3A 3PGEA 1DOXA 3I5JC 4YXJA 2JR5A 2N7DA 3QARA 2AKMA 3P0WA 4XZ4A 5KAIU 2QDDA 4P1CC 1PGAA 1TS2A 3WAPA 1Q8KA 4GLXA 2JZ3B 2WU2B 4A3OA 2V4QA 4ARCA 2PU0A 1C9FA 2QLTA 3K4GA 4A3RA 2AJQA 5AM2A 1KSPA 3BIID 4H4SA 4HPNA 4DL5A 2XH0A 4FZMA 2R2QA 1ZQLA 2FBWB 3B2GA 1JXLA 1V85A 3I1YA 3HHMA 2WPCA 2HBJA 3VRBB 3AV8A 4JAYA 4YWSA 4XLOA 3T8MA 1AHVA 2QGYA 1RYRA 2QEJC 3WK7A 1FHVA 1ZMDA 5KG3A 5FJPA 5KVHA 3T79A 1V86A 4DHGA 1SF0A 3BK2A 4Q8EA 1FRDA 5ALKA 2IHMA 1IXRA 4OD0A 3Q3OC 2KSOA 4EEKA 1XPYA 1J97A 1E7UA 3SMVA 2PGEA 3X0WA 1RM6C 2C5LC 2LHEA 1IGDA 1I4QA 2DYBA 4DFKA 3EWAA 3NVYA 5KFUA 1XSPA 3KH0A 4BKTA 2CJOA 3ZJTA 2OZTA 4WAFA 2FPMA 2J0JA 2Q0ZX 1MUCA 2XGQA 1L6NA 3U7DA 4HYRA 2AL1A 5I1VA 1WMHA 2KMCA 4YMMA 3KWVA 3U4EG 4FDCB 1TKDA 3GFKB 2BB5A 2DZIA 2VH2A 3NS8A 1ET9A 1JDFA 2QPMA 2HOFA 3Q8PB 1TBEA 2Y5CA 4KPLA 5J8YC 3NJTA 2WXRA 5DB6A 2I6XA 1PDZA 1JWMD 3RJ8A 1L0YB 5DQGA 3P3BA 4P0QA 1SB3B 2HBMA 1DTNA 4GSWA 2NRXA 5ALLA 4I2EA 1WGHA 2KFNA 2I5QA 2PTLA 3R10A 5CJ7A 1SL0A 3KLSX 4KGRA 4MF2A 5AK4A 3ETRA 2IGHA 2I2YA 1FEZA 2XK5A 3IT4B 2N1WA 1MG4A 1UF0A 1WXMA 8ICSA 2AAQA 4XGAB 1DOIA 3QTPA 3AN1A 4WURA 4HLEA 3QPEA 3KUCB 1SV4A 1YJJA 4KKJA 5D49A 7ICEA 3KBBA 4QZGA 2BQUA 1P0RA 1D8YA 1GB1A 1IM4A 1SKRA 2WWZA 5EOZA 4A8EA 4QZBA 2MBBB 4JDRA 1L7YA 3RB0A 3EF6A 1ZQKA 1T0QC 3NRZB 3K75D 3EKGA 2IBKA 4PVEA 2MEKA 1SGGA 4UW9A 2OO6A 4I6LB 1VJ5A 2FKPA 1YZ7A 1R4NI 3PHWB 1NYQA 2D3AA 2OQYA 2EQYA 3QXGA 3PPAA 5DB7A 2KJRA 8ICBA 2OOBB 5AKGA 2RSUA 5KG2A 1ECQA 1SKSA 3UJSA 1F5SA 2O2VB 3OWEB 4HG0A 5L83A 1KFTA 4IP4A 2HE7A 4KX3A 5ALTA 4M04A 2MJEA 3E9SA 2KMAA 1SWVA 4S0RA 4RMAA 1N6ZA 3N32A 4HRSA 4LNOA 2YLMA 1K4QA 2ZTDA 4CGZA 1MJDA 4RNMA 2HD5B 4B9NA 1XS9D 3T5HA 4M9GA 4LDTD 5TR5A 3RGTA 3RB3A 4IOIE 3DK8A 3MZNA 1LKYA 2KE7A 4ECSA 4B9LA 4HKZE 4WWMA 4RQNA 1ZQHA 4KTQA 1YN3A 4EQSA 4IR1A 4O3RA 2A3VA 5B66U 1IBXB 5AI9A 3TEWA 2KKVA 2KN7A 1EU3A 2ZG6A 2NBUA 1TV9A 9ICNA 5KFWA 1N56A 2K6DB 3H8WA 2AQ4A 4HPLB 1B22A 2JXTA 3NZGA 3ZRFA 1KN0A 2ZC8A 3UMGA 4LNKA 4IHCA 2AHOB 1FFUC 5DLFA 4EE2A 2O3GA 3R7RA 1LVHA 4UQGA 1C78A 2FE9A 4BJQA 4C7YA 4EKUA 1QF6A 4K3CA 3S47A 2KVRA 5J2GA 3RT3B 3MSYA 3MKCA 5J2FA 2XGPA 4ANWA 2UVUA 2AQ3B 1FCCC 2F2AB 1V1OA 2W82A 3ALBA 3VUWA 3LJ3A 3QC8B 3Q8EA 4BUGA 4II3B 1SZHA 1L0VB 1JI7A 2C2RA 1XQQA 1GREA 2HHWA 4DK5A 2GR0A 4AJYB 3OSPA 3GD4A 1WVEA 3K1GA 1KFYB 2IBIB 2FLPA 3H4KA 3T4WA 1TVAA 4PVJA 2Q4WA 1K52A 2OLAA 4N59A 5ALHA 3Q3JA 5J2EA 4HDQA 3MDAA 1OW5A 5KG4A 2DHZA 2CHXA 2O6VB 2BYTA 4PWBA 4UD8A 5F9LA 2VA3A 3ISBA 3ISCA 1WYGA 4EFOA 2E8OA 3SAFA 4RPYA 1TJEA 2G4SA 3SR6B 2KANA 2JEGA 4OHJA 3NRZA 4IM3A 4JWUC 2M0NA 4PZFA 1VD2A 3GC2A 3H12A 3A4RA 4NJ7A 4GXIA 3MGIA 5D3IB 2EMSA 4F5RA 1R4MB 2GBJA 1ZQTA 3DHGC 5ALRA 3DGZA 2DLBA 1DNCA 2ZIWB 1YQ4B 3LXFA 1PUZA 3QUQA 1ZQOA 4NQLB 1JPDX 3JZUA 2C7NB 2K8CA 3VVWB 1RRBA 4M8MA 3VH3B 4AS1A 4GU2A 4HN8A 3RR1A 4E4FA 4E8GA 5ALFA 4Z6CA 1RVKA 1ZOLA 3CAWA 2W9NA 1XO1A 4RU9A 4YWOA 3V62A 1WJ4A 4M00A 4EBEA 4XRHA 3H6NA 1HEKA 1CK1A 3QCAA 5J2DA 3ZDBA 1PGBA 1ZRMA 1LB2B 4DQQA 4M2YA 5KFVA 4H4RA 4J9LA 3MC0B 3UQ0A 4UAUA 1SE9A 3OG5A 3SAGA 1GETA 5HR7A 1IBXA 4TQ0A 3TANA 5AE1A 4ECUA 2R18A 3UMBA 1WWVA 2GBNA 3E58A 3EPGA 2K60A 2AQ1B 5A0LA 2E3TA 3WIMA 4J9PA 5C23A 3V6EB 7ICNA 1D5ZC 2KX0A 4P4OA 3IC9A 3ZNGC 2ZTEA 4DF8A 4H4TA 1PFDA 4YXDB 4BWJA 4H4UA 2EANA 4UAYA 3Q8QB 4F91B 1F2RI 1QQ6A 2AH5A 5ALGA 3PR4A 1ZQMA 3N7RC 5ALMA 1NK0A 3RCYA 4A9AA 4MFAA 3A0BU 5ADZA 3BS5B 3MR3A 4BOZB 2BCRA 1QQ5A 2WXKA 2BGFA 5IP4D 2XH7A 2RHFA 4C4SA 1B43A 3AEAB 2PA6A 2JZBB 8ICJA 4PVHA 4C8MA 2ZPNA 2I5HA 4C4TA 2FIFA 2G9HD 4M47A 3W1SA 1D9FA 2ZIUB 4BKSD 3D2DA 5KT4A 3TBLD 1NELA 4FHKA 3GV7B 5FK9C 3R7QA 1XEEA 4HCNB 4DOBA 4DQSA 3PRZA 2W3SA 1V1PB 2OPJA 3B0YA 4ITKA 1W1RA 3H7SA 3AU4A 4FXCA 2QDEA 1C3TA 1Z5SB 4US9A 1Z19A 5DKWA 3I63C 4H50A 1F0ZA 3A7RA 1MC8A 3S1CA 2NBWB 1LPFA 4H4WA 3VCCA 3DJGX 5AUIA 4M9NA 2ZUCA 1FNVA 1S76D 4A6GA 1J7CA 2LYBA 4DSJA 1B1ZA 4EELA 3TOYA 3VTEA 3JPNA 3SEBA 4BGDA 2XEWA 3ZNHB 1SXTA 1X6IA 4KEMA 4NZLB 3PRPB 1V59A 2HI0A 1WUDA 4RPXA 1Q5WB 2ZIWA 3BDPA 4ML8A 1N60C 2AKZA 3IJQA 4DXKA 2XY7A 4ED1A 4ROPA 3ETLA 1YQZA 4PHEA 2MUTB 4CYEA 4EWJA 1EBGA 4E3CA 1GRBA 2BC1A 2QCZA 1KTQA 3V6CB 4YT0B 1T6BX 5TSSA 2Y3RA 3WKDA 4YD2A 1Y56A 4BKGA 4DX3A 3DFYA 4OVUA 1E0YA 1KN5A 2JH1A 3KTQA 2W9MA 1ZQVA 5AICA 3AULA 4JHMA 5DGAA 4LA1A 4F72A 1WGRA 1LFDA 1NDAA 2JQRB 2XIDA 1MG8A 2KDIA 4MACA 2KFKA 4NJ6A 3RZWC 1FEBA 3DESA 3N6JA 2TSSA 4JIOU 5J18A 2ZVOA 1NPXA 3FWAA 2PODA 1TZ1A 1I19A 3FW7A 2KWUB 2JEFA 1V38A 2YMLA 4DQPA 5LXHA 3EW9A 1T3QC 4JE3B 3BS5A 1EC7A 3HUIA 4DL6A 5KAFU 1U45A 2INPE 2KTRB 2BCVA 1NHPA 1XDIA 5AM5A 2ZJDA 2TPRA 1AYFA 2JZBA 4PHPA 1MBBA 3DEEA 2VFTA 2GGHA 3Q8AA 2BDUA 4Y2VA 1WM2A 1Z00A 3WK4A 4C8OA 5D6JB 2ZIUA 5CRXA 2R8GA 2KDBA 2PGWA 1T4GA 4JUZA 2GI9A 2FYMA 4BC9A 2FUHB 4KKIA 3PX0A 2EZXA 4I2HA 1V1PA 4PWCA 3N7PD 3U52E 5J0UA 3MP9A 3ML9A 4PYTA 8ICGA 2HBKA 2A1JB 4NAWB 1S10A 4JQ9A 5U25A 3U9IA 4IKGA 4M01A 1K50A 1TAUA 2LUMA 3DVGX 4NLGA 3LYYA 1X1MA 4QZIA 2JX5A 2RDGA 4QZEA 3RJIA 2QJJA 1XNSA 2PLPA 4K8GA 1I4RA 4KLDA 1FO4A 1GERA 1HE8A 3ED5A 2BVCA 2J6TA 4RQ4A 1CEZA 2QHOA 3P4QB 5D7GA 3KJMA 1V5OA 4W9FA 4C4RA 3RJAA 1GJZA 4M8NA 2D8CA 1TZOA 1A6SA 1F1HA 1NBFC 3IG3A 5D3DA 1UBIA 1QSSA 3ZTDA 1ZQUA 2CFYA 3M6ZA 3RJJA 3RH4A 4K3BA 2PS2A 2DUYA 2VKQA 2OCEA 4KDIC 2Q85A 4CRXA 3KUMA 3GILA 5J2CA 3MR6A 2LHTA 1Q3VA 1BNPA 1NI2A 1BPEA 3ORYA 4DEZA 1ZQ1C 2W7PA 1XT9B 1ZJNA 1T7PA 3J9CA 2X8HA 2RLTA 3QUCA 4B9TA 3L16A 4FI4A 2NTTA 1ZQBA 3G6XA 3FXGA 2K22A 4MEYA 3F53A 3ENLA 2VIXA 1PK1B 2PFPA 1CRXA 4R64A 1NZBA 1SL1A 2YY6A 3RR7A 3PMLA 7ICLA 2M1MA 3HM3A 5BOFA 4CCHA 4QWEA 5J0QA 1FMAD 3QHTA 2EKEC 2FMSA 1QTMA 3Q8LA 1F44A 3HKZC 3UXNA 4FP1A 4ENLA 1LQBA 4OJ5A 4KLGA 2GWSA 2G08A 5GXGB 2OVLA 5HG2A 4ECZA 4I2BA 2KTRA 2KTQA 2HZGA 2E6XA 3R2TA 5GMVA 2NQWA 1E8ZA 3PREA 2PLSA 1K5OA 4QW9A 1DYQA 2WNMA 2HSZA 2K25A 4LJPB 3W1YA 5AKYA 1FNUA 1S8OA 5EWEA 3FM9A 1TT5B 2FE8A 3A1QB 2KQSA 3CGBA 3GD6A 3WKCA 4DWIA 9ICTA 1EU4A 3KW5B 2PTXA 1PZNA 1N63C 2E5SA 4KX5A 4K4IA 2M56B 4FZNA 4NAMA 3RBEA 3E56A 3KWLA 4PT5A 3CGEA 4DN1A 5AKZA 2F1HA 2D2QA 3DCGA 3H0LB 1BPYA 3L08A 4W9KA 1F3PA 1NZPA 4B9SA 3L0WB 1A0PA 4Y2QA 2YTUA 1NHSA 2DX5B 4A8XC 3JPOA 1FM0D 3JVAA 3DWMA 9ICBA 4G11A 2F1IA 3ZNID 3RNAC 3I6EA 1QSYA 1LM8B 2HCFA 2JF5A 5DPTA 2J6SA 2IOFK 3J81j 2WXIA 3ZDAA 4HJGE 4RQ8A 4KX6B 1DIQA 2QKNA 1WXSA 2KC1A 8ICAA 3ALRA 3GV8B 2L1AA 4ED0A 1D8LA 2OHFA 4OCZA 1LXDA 2PFQA 5AKIA 1HEZE 3B08A 2KHVA 3P2BA 4KZ0A 4I28A 3PW5A 2W55A 3PWIA 2KJHB 1J7BA 4JGHB 2IOFA 3RNGC 1P48A 2INCC 4FFDA 1ZQJA 1RWSA 4TVYA 4LZDA 7ICVA 3W8ZA 2ASLA 4LLGM 3U26A 2MQJA 2OX4A 5L6GA 5JCLA 1COOA 2NVUI 3DPDA 4Y2UA 1KLUD 4ED8A 3TEYA 3BWUD 2UYZB 4UB1A 2VAOA 2VJ4A 4F4ZA 5J0SA 4BURA 2OH2A 4URKA 4C7ZA 4DL2A 2OEHA 4H19A 3C23A 4F50A 3NUQA 5EE9A 2V9WA 3OSNA 1V80A 1EBHA 3I76A 1ZDVA
chains in the Genus database with same CATH topology
1D5MC 3W8XA 5AWVA 1W1KA 4EC3A 2W54A 3NVZB 5MPOA 1VDVA 1W1LA 1VRAB 3AH7A 3KQ4A 1FD6A 1SE2A 3N9YC 1JRPA 5I4DA 2AQ2B 1DOYA 1I4PA 1SEBD 2V0GA 3ETRB 4YTMB 5EE3A 5C3JB 3CWIA 3AEDB 5JXVA 2GRIA 1P7FA 1NVID 2RDHA 3NZ3A 4KGSA 1ZXIA 5BYRA 4KGTA 2PLIA 1VQZA 1DOXA 1N5WA 2R8DA 1RM6B 1FNWA 1HXYD 2OAIA 3ZJVA 3RPFC 1PGAA 1TS2A 1E8FA 1VLBA 1ET6A 2I0KA 2QIEB 2WU2B 2MJ3A 4ARCA 4A90A 1C9FA 1YQ3B 1ZUD2 4OZAA 4MM3B 1CJEA 1KH0A 3BIID 1TKGA 2FBWB 3B2GA 1C76A 4RFBA 1ENFA 3VRBB 2VFUA 3FW9A 3AV8A 4JAYA 5D79A 4XLOA 1AHVA 2QEJC 3AEFB 2ONQA 4GDKB 3AEEB 2NTSA 2IGGA 1SF0A 3BK2A 2AXRA 2BS4B 1PDXA 3P63A 1FRDA 2GQUA 1JMLA 3SFDB 1DGJA 3D2HA 5HHDG 1RM6C 2LHEA 1IGDA 1I4QA 1W1SA 4N58A 3NVYA 3HVZA 3ZJTA 2CJOA 2WQYB 4WAFA 2PW9A 1BMLC 2AX5A 1HZ5A 5I1VA 1YNTE 4A55A 3KWVA 1F77A 2N9LA 3U4EG 1X2GA 2BB5A 2WXLA 2B76B 1ET9A 3W8WA 2QPMA 2Y5CA 3TSJA 3RJ8A 2WLBA 2WXRA 3HRDD 1JWMD 4J3OD 1L0YB 3AE1B 5AUKA 3GSYA 1SB3B 5EE1A 3NVZA 3AECB 1SBBB 3PO0A 4RCOA 5LNK1 2SEBD 2PTLA 3PM9A 4JB1A 3KLSX 4KGRA 3AE8B 3R8BA 2RK5A 3ETRA 2IGHA 2I2YA 3MJ5A 2INNE 2N0SB 5BMGA 1C77A 3IT4B 1AN8A 1D6EC 3AE6B 1N61C 1E10A 4OW0A 1FEHA 2Y3AA 1DOIA 1M4VA 2ZW0A 3AN1A 4WURA 1FFVC 2CJNA 1L5PA 2JZPA 4ZOHC 2L32A 1YJJA 3Q8FA 4KKJA 4WH4A 1KF6B 1GB1A 1BUIC 2QSDA 1ESFA 4USAA 1JWUD 1PYWD 2QJLA 2QMTA 1JROA 2DYMA 2P3HA 3NRZB 4PVEA 2MEKA 5FXPA 3ZQ4A 3U7ZA 1FIQB 3T3OA 1FRRA 3AEBB 3MHZA 1SB3C 3GB1A 2V3NA 1NYQA 3GP7A 1UNSA 4M0WA 5BMIA 3EUB2 2WXOA 3W5UB 1KLGD 4B0MA 3W2DA 4L1BA 2Z8LA 4HG0A 2JYEA 3OWEB 4GDLB 1C4CA 3E9SA 2MJEA 2IDYA 5FXEA 4ZHOA 1R7SA 5HMRA 3LAEA 4HRSA 3FAHA 2EXRA 2H89B 4IOIE 3TEZA 2X38A 4HKZE 2LMCA 1N61A 4WWMA 1T5XD 4TMAB 3EUB3 1YN3A 1W1MA 1W1JA 5EE0A 1IBXB 3TEWA 1FFVA 1EU3A 5C2TB 4XWWA 3B9JB 4BBYA 3AMZA 1ZDXA 3DWGC 1JALA 2KN4A 2KQ4X 2JXTA 1HQRD 1MVKA 2K0PA 2R61A 4O95A 1JWAD 2VZKD 2HDEA 4D2KA 1FFUC 1WXQA 4EE2A 1SSNA 4REZA 2O3GA 3AE5B 4NJCA 1C78A 4JPSA 3Q8CA 4C7YA 2WXNA 1QF6A 2RPVA 1LO5D 3S1DA 5FXDA 1GPXA 2AQ3B 1FCCC 1V1OA 1X2HA 2W82A 3Q8EA 2JWUA 1L0VB 3TSSA 1V97A 1L6UA 2VFSA 3ZJUA 3URYA 1MBTA 1QKZA 1XCTL 3BVGA 1WVEA 1UXYA 1KFYB 1QOBA 5FKAC 5BYQA 4PVJA 2Q4WA 1K52A 4N59A 3C0PA 2V3PA 2BYTA 4PWBA 3NVWA 4UD8A 1AW7A 1SE4A 1ZR6A 1E0ZA 2WXQA 3TSHA 1KRHA 1WYGA 4HEA1 3AM9A 1MHXA 3P1MA 2YVSA 3O13A 3L4PA 1TJEA 4A6QA 3SR6B 2I38A 2ON8A 3BYYB 4OHJA 4RH6A 3NRZA 2G1EA 4YSYB 2M0AA 4C56C 3BW7A 4JWUC 1K53A 4PZFA 1ACCA 1FFUA 2GQTA 4US8A 4DNSA 3I9V1 5D3IB 4BCAA 2BTEA 1XO3A 3VQIA 5FXFA 2DLBA 4P6VF 1YQ4B 3LXFA 4AS1A 3W5VB 1NI3A 5AE2A 1QOFA 2BT6A 2HTME 3H8HA 2WXHA 2WXGA 1FXIA 1L4ZB 2EELA 3Q69A 1CK1A 4LTUA 4WIPA 1PGBA 3JS8A 2FUG1 3V3XA 3AE4B 2DBYA 2OEDA 3MC0B 3FW8A 1C79A 1I7HA 1L4DB 1IBXA 4TQ0A 1ZXHA 5HFYA 1HZ6A 1TS3A 5AE1A 4OZBA 1E8GA 3ZYYX 2AQ1B 2WDRB 1UWXA 1IUEA 1XF5L 2E3TA 1VZ6A 2BB6A 1I4HA 2K5PA 3IT6B 1QT9A 2W3RA 1D5ZC 2IPKD 2WDVB 4XWTA 2JYTA 3UI3A 1W1QA 5G5GB 3PZ8A 5L6FA 1HA5A 1PFDA 4YXDB 4LK0M 2J4XA 1F2RI 1XLQA 4RNAA 1WGKA 2Q5WD 4AQ7A 5K8EA 1OQQA 4JWSC 4A9AA 5ADZA 2WDWA 1P7EA 2WXKA 2M19A 3CIRB 3EGRA 3AEAB 2UUVA 1DZNA 3D2JA 3VRAB 4PVHA 3Q8BA 1SE3A 2JU6X 3C8YA 1UGJA 2G9HD 3IAS1 3W1SA 3D2DA 3LLBA 3FILB 2Y08A 4TSSA 3AE2B 1VAOA 5FK9C 2WXJA 1TY2A 1XEEA 1JWSD 2MJDA 2ZW1A 2W3SA 1V1PB 4HROA 4YTPB 2Y4GA 2BVGA 4ITKA 2WU5B 3W9CB 1W1RA 4FXCA 1MPEA 1TKEA 3MFGA 2PVGC 1YJIA 2P13A 4US9A 1TY0A 3NS1B 2PMVA 1F0ZA 3P4RB 3A7RA 1Q10A 3S1CA 1IGCA 1AWDA 2MH7A 4XDDA 1BXTA 5AUIA 3RFZB 2VFVA 1FNVA 1J7CA 2WXMA 5HQXA 3PZ7A 1B1ZA 4CQNA 4JX1C 3IXSA 3VTEA 2GB1A 3SEBA 1JQ4A 1GOZA 2BW2A 1NEKB 1SXTA 2BVHA 4NZLB 2XNAC 4RF1A 4ML8A 1N60C 5E6JA 4XE0A 5G5HB 3P42A 5I1WA 1B9RA 3BVMA 1CZPA 3PQBA 1SIJA 4YT0B 5AE3A 1T6BX 2SAKA 5TSSA 1WWTA 2Y3RA 5BMHA 1Y56A 2D5GA 2KDMA 1D4BA 2BS3B 2XN9C 1TS4A 1E0YA 3I99A 5H92C 3R2IA 4GLSC 1D5XC 1JCKB 1NENB 4MH8A 2VFRA 4Q2JA 5BYSA 3FC4A 1QILA 2JQRB 2LGIA 4MACA 3NVVB 4DXFA 1E7PB 2TSSA 5G5GA 1PUTA 1WSPA 4TQ1A 3FWAA 1N5XA 1I19A 3FW7A 3GS2A 4IDIA 1AHZA 2WP9B 1T3QC 4JE3B 4YSXB 2ACZB 2N7JA 1E9MA 3HUIA 2DYOA 4YTNB 2INPE 2J52A 1AYFA 1N60A 2K3UA 4PVKA 1MBBA 2VFTA 3Q8AA 3AE9B 4HKQA 1ZP0B 3HRDC 3P4PB 1JWBD 1YN5A 3FILA 2MBRA 1C4AA 2GI9A 2ICIA 1WVFA 4BC9A 1GAQB 3R07C 1PGXA 4ARIA 4KKIA 3BVZA 1V1PA 1OQRA 4N6EB 4PWCA 4PYTA 3U52E 3MP9A 1W1OA 2J53A 1MI0A 1OFFA 1FIQA 1QOGA 4NAWB 4IKGA 2JSVX 5HHZA 3DEDA 1K50A 3NS1A 2LUMA 4YWGG 3EA6A 1ROEA 2N9KA 3LYYA 3SFEB 2JX5A 2RDGA 4RGTA 3T3NA 2PLPA 3I57A 1J7AA 3DQ0A 3B2FA 1I4RA 1TKYA 2WXPA 1FO4A 2E5AA 2KMMA 2Y3SA 1STEA 3ZGZA 2WDQB 4MLAA 3P4QB 5D7GA 3KJMA 2IJ0A 2CU3A 1QQRA 1VR9A 3RJAA 3VR8B 1QOAA 2KAJA 3U2SC 3WCQA 1TZOA 3P4SB 1L6VA 5D3DA 5G5HA 1T3QA 2LHDA 2RMMA 2PVOD 4P16A 4DXGA 2VZKB 3V05A 2Q85A 1E8HA 1JW9D 3B9JA 2IPIA 1XLNA 4OALA 5H8YE 1UUPA 4ZHPA 3A7AA 3J9CA 1FXAA 1V8CA 3IAM1 1XCQL 4TVWA 2LEKA 2NTTA 2NMQA 3ABVB 1VZ7A 2K22A 1XXGA 3AEGB 1EM7A 1ZPSA 4ZOHB 4RGOS 5FR3A 2KACA 1AHUA 3NVVA 2LFIA 4DQOC 1TS5A 1FMAD 3TEXA 4B0EA 3HVDA 4H2AA 4RF0A 4RGNA 3AE3B 2L52A 2BS2B 1E6EB 5GXGB 2WS3B 5HI1A 1EWCA 5HG2A 1WRIA 4OVZA 1HSKA 1KTKA 3BYTB 2E6XA 3R2TA 2NQWA 2PLSA 3BZDB 1DYQA 2WNMA 4R3DA 2J42A 2WXFA 1FNUA 4OZCA 4WQMA 1RFKA 2FE8A 2YEPB 3AE7B 1GB4A 4MT5A 2L83A 1N62C 2R2ZA 1EU4A 1QLTA 1YN4A 1SJED 3SR6A 1EWYC 1FCLA 1YMHE 1N63C 4NAMA 2M56B 2P4PA 3E56A 3KWLA 4PT5A 1I4XA 1ZE3D 2KWDA 4UDUC 4L23A 3NVWB 1F2RC 1SJHD 3TX1A 1CQVA 2EKIA 4A8XC 1DIIA 1FM0D 2K9XA 3DWMA 2V4IB 2YEPF 4C80A 3S1FA 1NYRA 3TUOA 1TYGB 4L2YA 3NUHB 4BC7A 1QLUA 2WXIA 1MHHE 1UWMA 4HJGE 2IGDA 4KX6B 1L0XB 4ZRQA 1DIQA 2QKNA 2BBCA 5T8IA 1XLPA 2L1AA 2PIAA 2OHFA 1C4PA 1HEZE 1ZXIC 3BK1A 4RGMA 1A70A 3VR9B 2W55A 1XLOA 3LB8C 1N5WC 3AB5A 1J7BA 1ZOYB 1RWSA 4TVYA 3S1EA 2LJIA 3W8ZA 3NVYB 4LLGM 5L6GA 1K51A 1F0XA 1QLBB 1VJKA 1N62A 4ZRPA 3POPA 1KLUD 3TEYA 3BWUD 4O1NA 1RYJA 2BVFA 3A7UA 2VAOA 2DWQA 1N63A 4C7ZA 2QILA 2PKOA 4YSZB 2H88B 4ZYSA 5EE9A 1I4GA 1VZ8A 2UUUA 4XDCA 2Y5PA 3HSUA 1ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8X A;  1W1K A;  4EC3 A;  2W54 A;  3NVZ B;  5MPO A;  1VDV A;  1W1L A;  3AH7 A;  1JRP A;  1DOY A;  3ETR B;  4YTM B;  5EE3 A;  5C3J B;  3CWI A;  3AED B;  1NVI D;  1ZXI A;  2PLI A;  1VQZ A;  1DOX A;  1N5W A;  2R8D A;  1RM6 B;  2OAI A;  3RPF C;  1E8F A;  1VLB A;  2I0K A;  2QIE B;  2WU2 B;  2MJ3 A;  1YQ3 B;  1ZUD 2;  1CJE A;  3BII D;  1TKG A;  2FBW B;  3B2G A;  3VRB B;  2VFU A;  3FW9 A;  3AV8 A;  4JAY A;  5D79 A;  4XLO A;  1AHV A;  3AEF B;  3AEE B;  1SF0 A;  2AXR A;  2BS4 B;  1PDX A;  3P63 A;  1FRD A;  2GQU A;  3SFD B;  1DGJ A;  3D2H A;  1RM6 C;  1W1S A;  4N58 A;  3NVY A;  3HVZ A;  2CJO A;  2WQY B;  2AX5 A;  1X2G A;  2B76 B;  3W8W A;  2QPM A;  2Y5C A;  3TSJ A;  2WLB A;  3HRD D;  3AE1 B;  5AUK A;  3GSY A;  1SB3 B;  5EE1 A;  3NVZ A;  3AEC B;  3PO0 A;  4JB1 A;  3PM9 A;  3AE8 B;  2RK5 A;  3ETR A;  2N0S B;  1N61 C;  3AE6 B;  1E10 A;  1DOI A;  3AN1 A;  1FFV C;  2CJN A;  1L5P A;  4ZOH C;  1YJJ A;  1KF6 B;  2QJL A;  4USA A;  1JRO A;  2P3H A;  3NRZ B;  4PVE A;  5FXP A;  1FIQ B;  3AEB B;  1FRR A;  1SB3 C;  1NYQ A;  3EUB 2;  3W5U B;  4HG0 A;  2MJE A;  5FXE A;  4ZHO A;  1R7S A;  5HMR A;  3LAE A;  4HRS A;  3FAH A;  2EXR A;  2H89 B;  4WWM A;  1N61 A;  3EUB 3;  1W1M A;  1W1J A;  5EE0 A;  1FFV A;  5C2T B;  3B9J B;  4BBY A;  3AMZ A;  3DWG C;  1JAL A;  4O95 A;  1JWA D;  1FFU C;  1WXQ A;  2O3G A;  3AE5 B;  4C7Y A;  1QF6 A;  3S1D A;  5FXD A;  1GPX A;  1X2H A;  1L0V B;  1V97 A;  1L6U A;  2VFS A;  1MBT A;  1WVE A;  1UXY A;  1KFY B;  1QOB A;  4PVJ A;  2Q4W A;  4N59 A;  3C0P A;  4PWB A;  4UD8 A;  3NVW A;  1ZR6 A;  1E0Z A;  3TSH A;  1KRH A;  1WYG A;  3AM9 A;  3P1M A;  2YVS A;  3L4P A;  1TJE A;  3SR6 B;  3NRZ A;  2G1E A;  4YSY B;  3BW7 A;  4JWU C;  4PZF A;  1FFU A;  2GQT A;  4US8 A;  4DNS A;  4BCA A;  1XO3 A;  5FXF A;  4P6V F;  1YQ4 B;  3LXF A;  3W5V B;  1NI3 A;  5AE2 A;  1QOF A;  2BT6 A;  2HTM E;  1FXI A;  4LTU A;  3JS8 A;  3AE4 B;  2DBY A;  3FW8 A;  1I7H A;  5AE1 A;  1E8G A;  3ZYY X;  2WDR B;  1IUE A;  2E3T A;  2K5P A;  1QT9 A;  2W3R A;  2WDV B;  1W1Q A;  5G5G B;  1PFD A;  4YXD B;  1XLQ A;  1WGK A;  2Q5W D;  1OQQ A;  4JWS C;  4A9A A;  5ADZ A;  2M19 A;  3CIR B;  3AEA B;  1DZN A;  3D2J A;  3VRA B;  4PVH A;  3D2D A;  3LLB A;  3AE2 B;  1VAO A;  2MJD A;  2W3S A;  4HRO A;  4YTP B;  2BVG A;  3W9C B;  4ITK A;  2WU5 B;  1W1R A;  4FXC A;  1TKE A;  2PVG C;  1YJI A;  2P13 A;  4US9 A;  3NS1 B;  1F0Z A;  3P4R B;  3A7R A;  3S1C A;  1AWD A;  2MH7 A;  2VFV A;  5AUI A;  1J7C A;  5HQX A;  4JX1 C;  3VTE A;  1JQ4 A;  1NEK B;  2BVH A;  4ML8 A;  1N60 C;  5G5H B;  1B9R A;  1CZP A;  1SIJ A;  4YT0 B;  5AE3 A;  1WWT A;  2BS3 B;  1E0Y A;  3I99 A;  5H92 C;  1NEN B;  2VFR A;  3FC4 A;  2JQR B;  3NVV B;  1E7P B;  5G5G A;  1PUT A;  3FWA A;  1N5X A;  1I19 A;  3FW7 A;  4IDI A;  1AHZ A;  2WP9 B;  1T3Q C;  4YSX B;  2ACZ B;  3HUI A;  1E9M A;  4YTN B;  1AYF A;  1N60 A;  4PVK A;  1MBB A;  2VFT A;  3AE9 B;  1ZP0 B;  3HRD C;  3P4P B;  1JWB D;  2MBR A;  3R07 C;  1WVF A;  4BC9 A;  1GAQ B;  4N6E B;  1OQR A;  4PWC A;  4PYT A;  1W1O A;  1OFF A;  1QOG A;  1FIQ A;  5HHZ A;  3DED A;  3NS1 A;  1ROE A;  3SFE B;  2JX5 A;  1J7A A;  3DQ0 A;  3B2F A;  1TKY A;  2E5A A;  1FO4 A;  2KMM A;  2WDQ B;  4MLA A;  3P4Q B;  3KJM A;  2CU3 A;  3VR8 B;  1QOA A;  2KAJ A;  3WCQ A;  3P4S B;  1L6V A;  5G5H A;  1T3Q A;  2PVO D;  2Q85 A;  1E8H A;  1JW9 D;  3B9J A;  1XLN A;  4OAL A;  5H8Y E;  4ZHP A;  3A7A A;  1FXA A;  1V8C A;  4TVW A;  2LEK A;  3ABV B;  2K22 A;  3AEG B;  4ZOH B;  1AHU A;  3NVV A;  1FMA D;  3AE3 B;  2L52 A;  2BS2 B;  1E6E B;  5GXG B;  2WS3 B;  1WRI A;  1HSK A;  2NQW A;  2PLS A;  4WQM A;  1RFK A;  3AE7 B;  2L83 A;  1N62 C;  2R2Z A;  1QLT A;  3SR6 A;  1EWY C;  1N63 C;  2M56 B;  2P4P A;  3KWL A;  3NVW B;  3TX1 A;  2EKI A;  1DII A;  1FM0 D;  2K9X A;  3DWM A;  3S1F A;  4C80 A;  1NYR A;  1TYG B;  4BC7 A;  1QLU A;  1UWM A;  4KX6 B;  1DIQ A;  2QKN A;  1XLP A;  2PIA A;  2OHF A;  1ZXI C;  1A70 A;  3VR9 B;  2W55 A;  1XLO A;  3LB8 C;  1N5W C;  3AB5 A;  1J7B A;  1ZOY B;  1RWS A;  4TVY A;  3S1E A;  3W8Z A;  3NVY B;  1F0X A;  1QLB B;  1VJK A;  1N62 A;  2BVF A;  3A7U A;  1RYJ A;  2VAO A;  2DWQ A;  1N63 A;  4C7Z A;  2PKO A;  4YSZ B;  2H88 B;  5EE9 A; 
#chains in the Genus database with same CATH topology
 1D5M C;  2NBV B;  1W1K A;  4EEY A;  4EC3 A;  4GXB A;  2XH4 A;  1J19 A;  1GG3 A;  4ADW A;  2KJ8 A;  2ZEQ A;  1VRA B;  4M0A A;  4QZD A;  3N4M B;  1Q3U A;  1WZ0 A;  4C4V A;  2UVR A;  2WOI A;  3PO4 A;  2PEA A;  2WGS A;  3C2L A;  3PSI A;  1S1Q B;  2KFJ A;  8ICO A;  5KFH A;  4BX9 C;  3CYJ A;  4GFI A;  1ZXI A;  2L3Z A;  4KWS A;  5CHF A;  4GME A;  3LB8 A;  3AL0 B;  1E9I A;  4F5P A;  3N3K B;  3TJ4 A;  1OXJ A;  4I2D A;  7ICK A;  1VLB A;  1ET6 A;  1S9F A;  5KFS A;  5L1M A;  2QIE B;  2MJ3 A;  4A90 A;  5CWR A;  5GTH U;  5FS7 A;  3H9D A;  3LYS A;  1GC7 A;  3WKA A;  4KV2 A;  4OZA A;  1CJE A;  1KH0 A;  3ZLF A;  4W9I A;  3C2M A;  5AZH A;  4EZJ A;  1KKR A;  2BCP A;  3L5K A;  3NAS A;  4KN7 A;  4TUQ A;  1E5W A;  1ENF A;  4RFB A;  4CO7 A;  4DDI D;  1C20 A;  4WJQ A;  3RAX A;  2KJ5 A;  2W03 A;  4DS4 A;  1BKH A;  4EX7 A;  2D3D A;  2NTS A;  3M95 A;  2IGG A;  3SQP A;  2AXR A;  4DFJ A;  2L0F A;  2BS4 B;  2W9C B;  2ODG A;  2GQU A;  1JML A;  4ASW C;  4F1S A;  4C00 A;  1JOA A;  4LJX A;  3UIO B;  3S2A A;  4P7I A;  4QW8 A;  5HHD G;  2R9Z A;  4MJS A;  1ZQW A;  2DKX A;  3ES8 A;  3TTE A;  2MCN B;  2RDI A;  4ICA A;  3HVZ A;  3D2N A;  4IC7 B;  2X8C A;  2UU7 A;  2WQY B;  3KOO A;  5DG9 A;  2XH2 A;  4P0P B;  2PW9 A;  3U30 A;  2VAN A;  1ZJM A;  1BML C;  3DEQ A;  2A8X A;  4A55 A;  1OEY A;  1EO6 A;  1JUD A;  4ED7 A;  2NS5 A;  3UCC A;  2H3Q A;  4IW0 A;  3N1Z C;  3TSJ A;  2PP3 A;  2KN5 A;  3HRD D;  4Y2Y A;  4RNO A;  3L54 A;  3F2D A;  3WK8 A;  3QFA A;  3AE1 B;  3GSY A;  1PVQ A;  7ICT A;  2IHN A;  3H8S A;  1EF5 A;  1R0M A;  2NPT A;  3TWB A;  4BAX A;  3AEC B;  3DVN U;  3RR8 A;  1L7P A;  2SEB D;  1TK0 A;  3R8B A;  3AE8 B;  3ZDT A;  4I2J A;  3MJ5 A;  5E79 U;  4MGZ E;  5ENL A;  3HWT A;  2KKP A;  4UB5 A;  2W7O A;  3FYH A;  3AE6 B;  1FHU A;  3KFU F;  3T6C A;  4OW0 A;  2PSN A;  1ZQZ A;  2MRL A;  2ZUD A;  4CF3 A;  2ZW0 A;  5AI0 A;  2BF8 B;  2HJ1 A;  2L32 A;  4MFC A;  2G45 B;  5HML A;  8ICZ A;  2KD0 A;  3Q8F A;  5IDZ A;  8ICU A;  2YVC A;  3U8Z A;  2QSD A;  2QJL A;  4F4K A;  2QMT A;  3NFU A;  1KCZ A;  3V7K A;  2ESE A;  2P8C A;  3ZIM A;  1Q1R A;  4EZK A;  3IM1 A;  3IN5 A;  5FXP A;  1JXE A;  3U7Z A;  8ICR A;  4YQW A;  1FIQ B;  4F2R A;  4HWI B;  3MHZ A;  4GRT A;  3ZI4 A;  1SB3 C;  5HKH A;  3GB1 A;  2C22 A;  1R4N B;  3NZU A;  4I29 A;  3JPT A;  3GP7 A;  1UNS A;  5DDY A;  3EUB 2;  2N1R A;  1WI0 A;  3SQS A;  9ICS A;  5KFD A;  3NTU A;  4XA5 A;  5KT5 A;  1PVP A;  1P98 A;  1C4C A;  3EC8 A;  4K4H A;  4GDL B;  9ICQ A;  3IK4 A;  4W9G A;  4ZHO A;  3PT2 B;  3IDW A;  3BZC A;  5AM3 A;  3PNC A;  2V3B A;  1Q1O A;  1WWU A;  4EZ9 A;  3QKE A;  2W8K A;  3Q6J A;  2X38 A;  1GES A;  4RNN A;  1N61 A;  2LMC A;  3L10 B;  3OAW A;  1ZQP A;  1XWL A;  2IO0 B;  4TMA B;  2GQW A;  1XHC A;  3LAD A;  2N4F A;  1TAM A;  5EE0 A;  2AGP A;  3RJF A;  3RMK C;  3CST A;  1FFV A;  1H8C A;  3MFI A;  1V2Y A;  5C2T B;  4BBY A;  4P0P A;  2Y9T A;  1ZDX A;  3V4B A;  2G06 A;  2YB1 A;  3GIJ A;  4RQ1 A;  5GRT A;  2K0P A;  2R61 A;  4O95 A;  7ICO A;  4D2K A;  5AI8 A;  1WXQ A;  1SSN A;  4REZ A;  3AE5 B;  2W9B B;  1FXT B;  4NJC A;  1MNS A;  4MHV A;  3OW1 A;  4JPS A;  3Q8C A;  2HNE A;  3M9M B;  1RZT A;  3A9K A;  5J0O A;  4QIW F;  4GIB A;  5FXD A;  4CNQ A;  3AQE A;  5HMM A;  4PHA A;  4RT2 A;  3CP8 A;  3LDA A;  5ALQ A;  3BJY A;  2K8B B;  7ICG A;  1V97 A;  3DHH C;  2VFS A;  1PDY A;  3FV9 A;  4DHJ D;  3BQ1 A;  2GH5 A;  5FS8 A;  4EOY A;  2MUC A;  4NEV A;  3ZVV A;  1UXY A;  2XC9 A;  5FKA C;  3JPR A;  5BYQ A;  4ANU A;  4KIK A;  3SN4 A;  2P6U A;  4K81 A;  4E6M A;  3SN0 A;  2V3P A;  4O5E A;  3N20 C;  3NVW A;  3EAO A;  3KLJ A;  1SV0 A;  1WE7 A;  4IL0 A;  4Y2J A;  3TSH A;  1MHX A;  4GN1 A;  3P1M A;  4IR9 A;  3VC5 A;  2REX A;  4B9V A;  2KIW A;  2ON8 A;  4RH6 A;  1K1S A;  2G1E A;  3SHQ A;  4FN2 A;  5DQH A;  4QJF B;  5AI6 A;  3HJE A;  5TZV A;  3OGU A;  4GXK A;  2GQT A;  2RDB C;  4A3P A;  3I9V 1;  4ICV A;  2BTE A;  1TFR A;  1X9S A;  4MSM B;  4P6V F;  3OZY A;  3B0A A;  1RPL A;  5J04 A;  1I35 A;  4H4V A;  3W5V B;  1TK8 A;  1NI3 A;  2BYF A;  5J29 A;  4E4U A;  5AE2 A;  4RUC A;  1DXS A;  1QOF A;  4GDL A;  1ZQG A;  3V72 A;  4I6N B;  3W1S C;  1BGX T;  2ASD A;  2WXH A;  3Q14 C;  2K6Q A;  2WXG A;  4GOC A;  5AI5 A;  3LVW A;  3Q69 A;  3QZ7 A;  4LTU A;  2CHW A;  3SV4 A;  5BPC A;  3OLM D;  2PJH A;  3B1L X;  2KV2 A;  3PV1 A;  2LXC A;  5IOI A;  1LVL A;  4FS2 A;  3AE4 B;  3PLU A;  3IBE A;  2DBY A;  3H40 A;  8ICT A;  2AWT A;  1C79 A;  7ICQ A;  1L4D B;  9ICU A;  4JB3 A;  5EDS A;  1HZ6 A;  1TS3 A;  5D2M B;  3GZN I;  4EZL A;  1DRG A;  2BPS A;  1E8G A;  3RBD A;  1ZQY A;  1S0O A;  3ZYY X;  1E90 A;  2F77 X;  2KLG A;  1Z4N A;  5CX3 A;  3U4F A;  4E0D A;  1KEJ A;  1L7O A;  1YX5 B;  2IPK D;  5KFX A;  2JYT A;  4FJZ A;  3OC4 A;  5G5G B;  3CK5 A;  3PZ8 A;  5L6F A;  1HA5 A;  2W9B A;  4FX9 A;  4DFD A;  1JIH A;  2D3B A;  1XLQ A;  1FEC A;  4H1Z A;  1L3V A;  1T0S C;  1WGK A;  4RNA A;  4AQ7 A;  5K8E A;  2XVT A;  1KJT A;  1OQQ A;  5DPR A;  3LWM A;  4J03 A;  4E71 A;  2WDW A;  2BPF A;  4ICU A;  3CIR B;  2LGD A;  3EGR A;  2KJ6 A;  3JYU A;  5EWG A;  2PE9 A;  3C8Y A;  2LWP A;  4JN8 A;  7ICI A;  2IND C;  2BKF A;  2Z59 B;  5G2N A;  4ZCW A;  4DSF A;  3Q8K A;  4JQW C;  3FIL B;  4PYU A;  4PGQ A;  5KHO A;  1EC8 A;  3C1Z A;  3JSV B;  1NK9 A;  5L9X A;  2WXJ A;  1PK3 A;  3T5J A;  4G0N B;  5CTR C;  4YN4 A;  4IWO A;  1NKE A;  4YTP B;  3W9C B;  2H3V A;  1XU4 A;  4G3I A;  4TUU A;  1MPE A;  1RQN A;  1UZX B;  3A4S C;  1EC9 A;  2PVG C;  3CXO A;  3MDC A;  2CKH B;  1S3S G;  4NLK A;  4ZRJ A;  5JRT A;  7ICJ A;  1Q10 A;  1M6Y A;  2QJN A;  4W9D A;  1KOT A;  4MDK E;  6ENL A;  2JVC A;  4XDD A;  2LBO A;  4IG7 B;  3RFZ B;  2KEY A;  3BZK A;  3M9O B;  2WXM A;  5JCI A;  3CRX A;  3CYM A;  3NXL A;  2PTZ A;  2DZM A;  5FS6 A;  2RQ5 A;  1NEK B;  4KVG B;  4WJO A;  5FP0 A;  2KMD A;  3A33 B;  9ICJ A;  2PE6 B;  4GR1 A;  5BOE A;  3MQT A;  3DBH I;  5E6J A;  4XE0 A;  2JUO A;  1UT5 A;  1KFS A;  3P42 A;  2WX0 A;  1B9R A;  3DH9 A;  2Y9U A;  2MW5 A;  4KT2 A;  4WAA A;  1SIJ A;  4O3M A;  2VA8 A;  5AE3 A;  2MSE D;  3HM6 X;  3VDG A;  5L1K A;  9ICP A;  3TQP A;  8ICM A;  1XO0 A;  4F3O A;  1WWT A;  2KNB A;  2YMP A;  2HHT A;  2NR2 A;  4K7U A;  1WM3 A;  2BS3 B;  3TCS A;  1TS4 A;  1O03 A;  2E1F A;  5H92 C;  3R2I A;  1M94 A;  1NEN B;  1ZQX A;  1EF1 A;  4MH8 A;  1BVS A;  2EH9 A;  3RYT A;  3VC8 A;  1NK4 A;  2RDJ A;  5BYS A;  1RYU A;  9ICA A;  4DSE A;  4ANV A;  2PU1 A;  3NRW A;  2LGI A;  4EEN A;  4U6P A;  3ONS A;  2QKQ A;  2V3S A;  3RNE C;  3F5A A;  4JV1 A;  1UCV A;  1E7P B;  2DNF A;  4H4Y A;  4PZO A;  4NLC A;  5G5G A;  3SEN A;  3X23 A;  2KVZ A;  2QDF A;  4EYI B;  3BSM A;  3MFH A;  3UXO A;  2H3Z A;  1L2N A;  2VH1 A;  3GS2 A;  2ZIV B;  4IDI A;  2H3I A;  5KL1 B;  5D94 A;  2P0I A;  4YSX B;  5H2F U;  4TUP A;  2C3D A;  1Z4O A;  1SL2 A;  2D07 B;  2GLS A;  2J52 A;  2PFN A;  2K3U A;  2YVF A;  2EAP A;  2LYH A;  1E8W A;  4LJO B;  1ZQS A;  1MRA A;  2DF4 B;  4BFR A;  4ED3 A;  1NJW A;  2B0C A;  4KMU A;  3FIL A;  3BQT A;  3MY9 A;  1C4A A;  2J6U A;  1B0X A;  4F5O A;  2P8B A;  4M9H A;  1PGX A;  3JSV A;  2FCQ A;  3IHP C;  2A5U A;  3VCB A;  1S0V A;  4B9U A;  3BVZ A;  4KSK C;  3IJI A;  4M52 A;  4WJN A;  3IRU A;  2WX1 A;  3ZVI A;  4HXD A;  3DED A;  4R8U B;  4HCL A;  8ICN A;  3EA6 A;  1ROE A;  4J3Z A;  2P6R A;  2GDQ A;  4HNC A;  3RRH A;  1ZMC A;  3D6J A;  2E5A A;  2KIV A;  2KMM A;  3IG5 A;  4EYH B;  2O2V A;  2L05 A;  3ZGZ A;  4UB3 A;  1KQQ A;  1XS2 A;  4QZ9 A;  2PFO A;  4W9E A;  3TAD A;  1QQR A;  1VR9 A;  2LJ5 A;  5AEK B;  4UBB A;  3PW4 A;  2KAJ A;  2L5Y A;  1MSW D;  2XBB C;  2EDU A;  3WCQ A;  3VC6 A;  1DK2 A;  3ZDE A;  1ZD4 A;  4EMI A;  3KZX A;  3RJG A;  4ELV A;  2HQM A;  2RMM A;  4DXG A;  1SZP A;  4IL2 A;  8ICP A;  3WK9 A;  5C0Y A;  2DAJ A;  1JW9 D;  4DSL A;  1E8H A;  4MGI E;  2MAX A;  3RIT A;  5H8Y E;  2FPK A;  1UUP A;  1Y8R C;  1P1A A;  1MQ2 A;  2QB0 B;  1GEU A;  3SU8 X;  4ZHP A;  2AQ0 A;  3RNC C;  3BQ0 A;  4TVW A;  1XCQ L;  4QWB A;  1KM7 A;  1V9J A;  4F4X A;  1VCB A;  1YD8 U;  4YL8 A;  3DK4 A;  3TIX A;  2K4P A;  1NHR A;  2AL6 A;  2LZ6 A;  2RP5 A;  3CW2 C;  2L00 B;  1ZPS A;  4EM4 A;  3GII A;  2I1J A;  4PS3 A;  3D2S A;  2DFL A;  2KAC A;  1AHU A;  2LFI A;  4DQO C;  3M8R A;  2JT4 B;  1TS5 A;  1WXV A;  4MEM A;  1SJC A;  4G7F A;  3LWL A;  1ZD5 A;  3RJH A;  3M1Y A;  1BNO A;  5J2A A;  3VCN A;  2ZIX B;  3QEA Z;  4OO1 J;  2F8K A;  5HI1 A;  4AP9 A;  3Q8M A;  4KSL C;  1NU5 A;  5DPW A;  2XIC A;  1WRI A;  3PRM B;  4OVZ A;  2R2O A;  1I42 A;  2RDX A;  1WR1 A;  5IIK A;  2WFA A;  4ELU A;  2C7H A;  3MC8 A;  1NKC A;  2O6V A;  5AKE A;  3RAQ A;  4R63 A;  4IQV A;  4MT5 A;  2KXJ A;  5E6P A;  1D7Y A;  1X6J A;  4PPX A;  3URH A;  1QLT A;  2YQE A;  3R0K A;  4KLL A;  2EZZ A;  3SR6 A;  2C3C A;  2K1F A;  4HVB A;  1YMH E;  2YQU A;  2P4P A;  4MF8 A;  1I4X A;  2KWD A;  4UDU C;  3PW7 A;  4ZDV A;  4EBD A;  1ECW A;  1QSL A;  1HUZ A;  3OPX A;  3SI8 A;  2C7M B;  8ICF A;  1MDL A;  2LYA A;  2K9X A;  3ZO5 B;  3GIM A;  3F2B A;  2E1E A;  1TYG B;  4GYP A;  4YCX A;  3NUH B;  1QLU A;  2BHN A;  4NLZ A;  1ED1 A;  1MHH E;  1JMS A;  3SJN A;  3CF6 E;  3UXP A;  4DWD A;  3SYZ A;  3RH5 A;  1RFA A;  4X57 B;  4ZRQ A;  2ZAD A;  5T8I A;  2P3Z A;  2WTF A;  8ICQ A;  5IN7 A;  3DBL B;  2NRZ A;  3BK1 A;  1ZXI C;  3UXK A;  5FJT A;  3VR9 B;  2W11 A;  3LB8 C;  3N30 A;  2R8K A;  3PX4 A;  3EHV A;  4ZRI A;  4IT1 A;  3M8S A;  5FJR A;  5KFZ A;  1ZQR A;  3QQ8 B;  4KZC A;  4RQ0 A;  1BZL A;  4NM2 A;  4QAY A;  2BWE S;  1VJK A;  3T3F A;  2ONE A;  5CHG A;  4DSI A;  2PI4 A;  2KZZ A;  2BVF A;  2MA1 A;  1M6I A;  1WX8 A;  3A7U A;  4KPR A;  2XCP A;  2FMP A;  3RD2 A;  1OJT A;  1X66 A;  2I9G A;  4YSZ B;  2H88 B;  4ZYS A;  4RT3 A;  2PXI A;  1JRU A;  2J0K A;  4F5Q A;  4XDC A;  1WCN A;  3F2C A;  4RQM A;  3FG2 P;  3PFR A;  3W8X A;  1NNL A;  5JRB A;  1HJP A;  5KFI A;  1DGS A;  4ED6 A;  5MPO A;  3NVZ B;  1W1L A;  4ECQ A;  4EM3 A;  3KQ4 A;  3Q8S B;  2LVQ A;  1JRP A;  1ZKQ A;  2FDR A;  2ZIX A;  1I4P A;  1J2M A;  4YTM B;  5J2K A;  4Q45 A;  5C3J B;  4YP3 A;  4YR2 A;  3AED B;  2GRI A;  1P7F A;  3MAB A;  3NZ3 A;  3MHS D;  4I2C A;  4KGS A;  4NWI A;  2WF9 A;  5BYR A;  3H70 A;  2ATL A;  2PLI A;  4Y2X A;  1HXY D;  2LGS A;  2D6F C;  2N1V A;  3GQC A;  4YVZ A;  2OAI A;  2POZ A;  3JPP A;  3L8K A;  2KQ7 A;  1E8F A;  3K1R B;  2KZM A;  2KWC A;  3DBR I;  2I0K A;  3D47 A;  2B21 A;  2K89 A;  4Y2T A;  3GO2 A;  1NOM A;  3KYD D;  1YQ3 B;  4PYZ A;  2WHI A;  1V9P A;  3GOE A;  4MM3 B;  1NK5 A;  5AI4 A;  2YMM A;  2OM6 A;  2AU0 A;  1TKG A;  3UJF A;  3LDZ E;  9ICM A;  2BKR B;  1IYX A;  2VFU A;  4Z6E A;  3BIN A;  4JWN A;  4IM2 A;  1QZE A;  2O56 A;  5L1I A;  2MUT A;  2ONQ A;  4GDK B;  2JXX A;  3AEE B;  5J0P A;  4DFM A;  3V5C A;  1R4M I;  4H4Z A;  4J57 A;  3P63 A;  3OTQ A;  2JMG A;  3PSE B;  4KLI A;  3D2H A;  5ALD A;  2JRZ A;  3KHG A;  3D32 A;  2CRX A;  2KWV B;  3V3W A;  4GGQ A;  1B4F A;  1W1S A;  3ES7 A;  2ZVN A;  2A19 A;  3OJU A;  3QLD A;  2OJW A;  4GC7 A;  2B6G A;  3ISD A;  3HPO A;  3AEV A;  2FLL A;  4BVU C;  3RB4 A;  2AX5 A;  1HZ5 A;  2RAB A;  2J7Q B;  1F77 A;  3IP4 B;  1KLN A;  1H38 A;  1ELS A;  2BPG A;  1X2G A;  2WXL A;  5DBB A;  3W8W A;  5KFT A;  2MNR A;  1F8W A;  3QA8 A;  4P1B C;  2GGI A;  2AL2 B;  4YXM A;  2IO2 B;  2WLB A;  3QU4 A;  5FR6 A;  2KZR A;  3SSZ A;  3RI7 C;  1F9J A;  3BS7 A;  2QC8 A;  2LRU A;  4J3O D;  3GRT A;  3H7V A;  2HHX A;  4BKS A;  1JPM A;  5KG5 A;  3RJE A;  5EE1 A;  2YX8 A;  1UHU A;  4YMN A;  3NVZ A;  4Z17 A;  1GO3 F;  3MC1 A;  3PO0 A;  4K7S A;  2HXT A;  3CSF A;  1PQS A;  5LNK 1;  4UB6 U;  4JB1 A;  1ZRN A;  3NO1 A;  3MR5 A;  1WUE A;  1RYS A;  2HTH A;  3PLV A;  2RK5 A;  1NKB A;  2BYE A;  5KL8 B;  5ALN A;  2NRT A;  2V4R A;  1C77 A;  4EQR A;  5J0T A;  4DYE A;  3QU2 A;  3ZLG A;  4AOF A;  1N61 C;  5ALJ A;  4APN A;  1E10 A;  3C29 A;  1BT0 A;  3TMP B;  3ONN A;  2GL5 A;  3RB6 A;  5G55 A;  5DBA A;  4B6W A;  1FFV C;  2HW3 A;  3DG3 A;  2CJN A;  2FCS A;  2IO1 B;  2JZP A;  3UCD A;  2A1J A;  4ZOH C;  4NAW A;  8ICY A;  3ZTC A;  3DIP A;  1ZQN A;  1SIF A;  4WH4 A;  1KF6 B;  3M3J A;  1BUI C;  4USA A;  1JWU D;  1PYW D;  2RD0 A;  3WK6 A;  3E2E A;  1Q46 A;  1ZW7 A;  2W9A A;  5EWF A;  1JRO A;  1WGD A;  1E8X A;  2DYM A;  2BQQ A;  4W9L A;  3WAN A;  3ZVH B;  2P3H A;  3ZQ4 A;  3LVV A;  3JPS A;  2WHE A;  3R25 A;  4XQ8 A;  4DBG A;  3AEB B;  3M63 B;  3T3O A;  3N4F A;  2KKC A;  2JEI A;  3LXD A;  2V3N A;  3TL5 A;  1TIF A;  3G6Y A;  2ZNV C;  1MO9 A;  4QWD A;  1AAR A;  2WXO A;  2MP2 B;  5ALY A;  2HVH A;  3DBS A;  4A20 A;  1E8Y A;  4AUQ C;  4MFF A;  2K4H A;  4RZR A;  5KFB A;  2Z8L A;  4MGK E;  4L1B A;  7ICP A;  4KLQ A;  3VTW A;  2IDY A;  5FXE A;  1ONE A;  1R7S A;  3ZXV A;  5HMR A;  3V6K A;  5DB9 A;  2EXR A;  2PKE A;  2RRD A;  2HVI A;  3H1U A;  1YT3 A;  2WP6 A;  4JMU A;  4B6J A;  2BZF A;  2B3A A;  1SV0 C;  5C1Z A;  1T5X D;  3DGH A;  2F8L A;  3O65 B;  4NL9 A;  4O5C A;  4DOC A;  4UAR A;  3B9J B;  3QZ8 A;  1PK1 A;  5KFG A;  5KFJ A;  8ICI A;  3AUO A;  4LZG A;  2GOL A;  2IY1 B;  2KN4 A;  2KQ4 X;  2LVO A;  4MSQ B;  1MVK A;  4DFP A;  3VH4 B;  5KFA A;  1JWA D;  9ICE A;  2LPE A;  2MA9 B;  2VZK D;  1IP9 A;  3SN1 A;  2D11 A;  2JZZ A;  2LM4 A;  2AL2 A;  2KJ9 A;  3UF8 A;  2F1J A;  5AIB A;  3WU2 U;  4KLF A;  4C8N A;  1GSN A;  4CF4 A;  2JV3 A;  4C0Z A;  5JHA A;  4I2G A;  1GPX A;  1X2H A;  4Z1Y A;  3TFR A;  5JZE B;  5IA7 A;  4WJP A;  4C8L A;  2M8S A;  2JWU A;  1HTO A;  3HW2 A;  2K39 A;  4DF4 A;  9ICO A;  1L6U A;  3ZJU A;  1WXA A;  1ZKH A;  1J0G A;  4EUT A;  2JRH A;  4FBT A;  3EEZ A;  5ALV A;  4O0I A;  4IRK A;  1QKZ A;  1MBT A;  3QU9 A;  1SKW A;  4FBU A;  3KVF B;  4QZC A;  1NHQ A;  5IIO A;  4GGH A;  2OQH A;  5ALI A;  3R9K A;  2HJ8 A;  5CEH A;  2LAS A;  3F5E A;  4B9M A;  1T0Y A;  2G07 A;  2ZPY A;  2V3A A;  3TJI A;  1AW7 A;  1ZR6 A;  1UPH A;  2WXQ A;  1Z1B A;  1KBU A;  1ZQF A;  3KKA A;  4UAW A;  2PTW A;  3AM9 A;  2YVS A;  3O13 A;  2KHQ A;  9ICK A;  1NDD A;  4A6Q A;  4KLE A;  7ICF A;  2LGY A;  1Z2M A;  5FMH A;  4ACO A;  3FYY A;  2OFJ A;  3BW7 A;  1H2I A;  1K53 A;  2BCU A;  4US8 A;  4DNS A;  2JK6 A;  1XO3 A;  4F7Z A;  4BDP A;  3VQI A;  4FS1 A;  2BQR A;  3TWA A;  2KHW B;  4FAD A;  4MKS A;  7ICS A;  2WF7 A;  2OZ8 A;  5KHQ A;  4QZF A;  4NJ8 A;  3APF A;  1WG8 A;  4J9N A;  5J0X A;  2EEL A;  3FCP A;  1BPZ A;  2HHQ A;  4WIP A;  4E74 A;  5KFP A;  4YD1 A;  4G50 A;  3JS8 A;  2FUG 1;  3GRS A;  2BC0 A;  3PWG A;  4GXJ A;  2OED A;  3FW8 A;  2PCE A;  3NZS A;  4N9F 4;  2PPG A;  1N48 A;  3IHQ B;  5HFY A;  5HP4 A;  4HNL A;  4PH5 A;  2NQL A;  2FCN A;  2ZCB A;  2LMR A;  4Y2S A;  1VZ6 A;  1WF9 A;  2BB6 A;  2KZ3 A;  2OXO A;  2YN4 A;  5ALZ A;  1I4H A;  3OHA A;  1QT9 A;  2WDV B;  4XWT A;  3UI3 A;  1W1Q A;  1KRP A;  1MQ3 A;  3MGH A;  1L8O A;  1V81 A;  3CNH A;  2GH1 A;  2Q5W D;  3C5G A;  4BBN F;  4YR0 A;  4M02 A;  4P4P A;  2M9N A;  4JWS C;  2NYV A;  1P7E A;  2RGF A;  3GIK A;  2M19 A;  1ARO P;  2D10 A;  5JHB A;  2UUV A;  1R6W A;  5KG6 A;  3L13 A;  5J2H A;  3VRA B;  2GO7 A;  5E6N A;  2HOQ A;  1UGJ A;  4K4G A;  3M6K A;  3ZDD A;  4LNI A;  1ZD2 P;  4TSS A;  3AE2 B;  3UJ2 A;  3EJE B;  2EQ6 A;  4MMW A;  2C28 A;  3RRA A;  1WJ6 A;  4QZA A;  3H7P B;  9ICL A;  2N9X A;  2BVG A;  2Y4G A;  2ZTC A;  9ICC A;  2CS4 A;  2WU5 B;  5KG7 A;  3H8J A;  8ICW A;  1TKE A;  3GE3 C;  2GMI C;  2G4D B;  1WUF A;  1KKX A;  2A4Z A;  4TV3 A;  3P4R B;  3OP2 A;  1AWD A;  4WWO A;  2VFV A;  1BXT A;  4F5N A;  3C5F A;  4UB8 U;  3V61 A;  1GXF A;  3QEB Z;  5HQX A;  1NJY A;  4JX1 C;  1WE6 A;  3RH6 A;  3IXS A;  4LNN A;  1JQ4 A;  3DGB A;  4KIT B;  1P7D A;  2BW2 A;  2JHD A;  2BVH A;  4F92 B;  4QNL A;  3C2K A;  2W9C A;  1X9W A;  4RF1 A;  1KL9 A;  4UB2 A;  1Z3E B;  3JW0 X;  3DBH B;  5GTI U;  3PZP A;  4IL6 U;  1P9D U;  5I1W A;  4XC2 A;  1RXV A;  4GIR A;  1CZP A;  5KT6 A;  4UAT A;  3SV3 A;  2WOW A;  5KFK A;  3V5F A;  1RDF A;  2SAK A;  5IO9 A;  2LI6 A;  3UGV A;  2MU2 A;  2R8H A;  4EBC A;  3TAP A;  3N7S C;  4I2F A;  4KLU A;  4S17 A;  5BMH A;  2KSO B;  3OTR A;  4NY0 A;  3QJZ A;  1JEH A;  3N97 B;  1XSL A;  2VFR A;  2KK8 A;  5IIL A;  4Q2J A;  1X40 A;  4FJY A;  4U7C A;  1BQG A;  4RQ3 A;  1FPY A;  5D4B A;  1QIL A;  3V60 A;  4ECR A;  4DXF A;  1IIP A;  3ZD8 A;  3GU3 A;  5AKK A;  2KIC A;  4R66 A;  1PUT A;  4O3Q A;  4RPZ A;  3EPI A;  3DDC B;  3TAD C;  2LI5 A;  1L5U A;  3EJD B;  4F4Y A;  4FE3 A;  2R8I A;  4GB9 A;  1GUA B;  3PVL A;  3M7D A;  4P0Q B;  3QX7 A;  2GRT A;  5AKX A;  4K7Z A;  2ACZ B;  2N7J A;  1E9M A;  1V6E A;  2PPH A;  4YTN B;  1A77 A;  1KLV A;  1WY8 A;  3ECI A;  4NV0 A;  2X99 A;  4ZH4 A;  4QIW C;  4DLG A;  4EZ6 A;  3KHR A;  3AE9 B;  4HKQ A;  3N28 A;  9ICG A;  2L8J A;  2XK5 B;  3DDH A;  1YN5 A;  4ECT A;  1UA1 A;  2MBR A;  3SEI A;  4WWP A;  1K1Q A;  1WVF A;  2WPF A;  1GAQ B;  4FLH A;  3PK7 A;  3SAH A;  3H7P A;  4N6E B;  2GSH A;  3P93 A;  4PL1 A;  2BGW A;  4JV0 A;  2J53 A;  3DFH A;  5HHH A;  1MI0 A;  1FIQ A;  1OFF A;  1QOG A;  4H4Q A;  2UWQ A;  2D3G A;  5HHZ A;  4TUR A;  3KUZ A;  1C1Y B;  2N9K A;  2YAU A;  2MWS B;  4RGT A;  4DDG D;  3APD A;  4W9C A;  2OJR A;  3T3N A;  3PSP A;  1MA7 A;  1J7A A;  3DQ0 A;  3B2F A;  1TE6 A;  2KVS A;  2EZY A;  1COK A;  3RNM A;  5AM1 A;  3RO6 A;  1STE A;  3AU5 A;  2WDQ B;  4MLA A;  5DG7 A;  2JEJ A;  5AZF A;  2CU3 A;  2F76 X;  1H6V A;  5ALU A;  3MGV A;  3GE8 C;  3VFC A;  5J2I A;  1QOA A;  3U2S C;  1MOK A;  1ZDL A;  4G9B A;  4HPM B;  1F9C A;  4BOS C;  1BPD A;  4P16 A;  4BXO B;  3MBY A;  2W8L A;  1YZ6 A;  4NY8 A;  1WCL A;  4I6P A;  2IPI A;  1XLN A;  4YMO A;  1S0M A;  3K9O B;  3H4B A;  1WX7 A;  3PG6 A;  1LKY B;  3OJS A;  2MBO A;  3Q2A C;  1FXA A;  4RQ7 A;  3WAM A;  1ZQQ A;  5KFM A;  2WAQ F;  2EAM A;  2QJM A;  4EMW A;  3ABV B;  3RNF C;  2BR0 A;  4Y2R A;  3KUD B;  2FMQ A;  4TQS A;  4A35 A;  3SQI A;  7ICU A;  2WF6 A;  1EM7 A;  3AEG B;  1MN8 A;  2HHS A;  5EBK A;  4RGO S;  4O3N A;  5U1O A;  4GYP C;  5FR3 A;  2XO7 A;  2BCQ A;  2IYD B;  4NPN A;  5CHV C;  4DHJ B;  2DZJ A;  4HAI A;  2WF5 A;  2CHR A;  3Q3F A;  2K8B A;  4PZN A;  4UBC A;  3TEX A;  4B0E A;  2C60 A;  4RGN A;  4JK1 A;  4J9S A;  2EAO A;  2AEH A;  2L52 A;  2BS2 B;  2WAQ C;  3TKA A;  2N9E B;  2ZCC A;  3SD5 A;  2M17 A;  1D3Z A;  1Y88 A;  2A1A A;  2OWO A;  1EWC A;  1UT8 A;  1WH3 A;  2WS3 B;  3UQA A;  4O3S A;  2KFZ A;  4ANX A;  1HSK A;  2X50 A;  1KTK A;  3BYT B;  3N1X C;  4OVV A;  4M6W B;  4NLB A;  3BZD B;  2WXF A;  1JX4 A;  2N9P C;  4WQM A;  4DS5 A;  1RFK A;  2YEP B;  1T94 A;  3M62 B;  5J2J A;  1GB4 A;  9ICF A;  7ICM A;  4DWF A;  1YN4 A;  3IV6 A;  1SJE D;  2PI5 A;  2Z0D B;  1URJ A;  2DPJ A;  1EWY C;  5ALO A;  4PJ0 U;  1U47 A;  4HJK A;  2J0M A;  3R11 A;  5J2B A;  4B9K A;  2RR9 A;  1TYT A;  2ZZC A;  3KHH A;  1CQV A;  3KZI U;  1BWC A;  4H4P A;  5KVI A;  4HCD A;  3RF9 A;  3GD3 A;  4RM9 A;  4WWN A;  3TUO A;  5JTI A;  4O3O A;  1OUQ A;  1S77 D;  1ZQA A;  2O6V D;  2IY0 B;  1F52 A;  4EX6 A;  4BC7 A;  4TKN A;  3OJ3 A;  5C5J A;  3B97 A;  3DVN V;  5J0W A;  2C2E A;  1RXW A;  4OJO A;  3PZD A;  5AHX A;  4OJL A;  9ICR A;  1SJA A;  1TKK A;  3ZKJ C;  1XLP A;  2I1Q A;  3RJK A;  2PIA A;  1P3Q U;  1L3S A;  1ZK7 A;  2GGJ A;  3D9X A;  4IM0 A;  1X42 A;  2FJ6 A;  2K8C B;  1A70 A;  1XLO A;  4G8T A;  3AB5 A;  5DLG A;  1JN3 A;  1ZOY B;  5DGB A;  4BXO A;  5KFC A;  3QN3 A;  3S1E A;  4I2A A;  2FID A;  3HX0 A;  3AXC A;  3BY4 B;  2GR1 A;  2XGZ A;  1K51 A;  4GFJ A;  2M0X A;  1QLB B;  4ZRP A;  1N62 A;  3POP A;  5FS9 A;  4O1N A;  1RYJ A;  3L17 A;  2ZZB A;  4P4M A;  5KG1 A;  5IIJ A;  3V7J A;  4WJ3 B;  3PS6 A;  4QZH A;  3NOB A;  2OG9 A;  1RLF A;  3VDZ A;  3RRG A;  3UJE A;  1VZ8 A;  1NK8 A;  2UUU A;  1MDR A;  4IWP A;  1QLN A;  3C0R B;  1ZET A;  3HP6 A;  4DNA A;  5AWV A;  3UQ2 A;  3MWC A;  4M9L A;  3Q3M C;  4RM8 A;  4ECY A;  1VDV A;  2AL3 A;  1WFY A;  2CN1 A;  3AH7 A;  4LCD E;  1SE2 A;  3K9P B;  5I4D A;  2AQ2 B;  2FAZ A;  3JVZ X;  3QX1 A;  4KMO B;  5EE3 A;  4IC9 A;  3MR2 A;  2K4E A;  4H4X A;  2DEN B;  4Q44 A;  3NY5 A;  1NVI D;  1XC9 A;  1QQ7 A;  2KP7 A;  4M6W A;  4KGT A;  3VFK A;  2E8N A;  3WKE A;  4AJW A;  1GRF A;  1VQZ A;  3UMC A;  1N5W A;  2R8D A;  1RM6 B;  1FNW A;  2VJ5 A;  3V7L A;  2DW7 A;  3VUX A;  2E8M A;  3ZJV A;  3UQB A;  1OEY J;  3H8A A;  3RPF C;  5DBC A;  1OTR B;  4IZG A;  3PX6 A;  5CHW A;  3DBR B;  3T5K A;  2LUE A;  3PO5 A;  3APC A;  3MUC A;  4PL2 A;  2L76 A;  3HIZ A;  4LDT B;  2L7R A;  1ZY8 A;  3H4D A;  2FCM A;  1ZUD 2;  2JWZ A;  4HK2 A;  2MBQ A;  3ZW3 A;  2VRR B;  1C76 A;  3N1Y C;  5DDM A;  4DLE A;  4M0W B;  1NJX A;  8ICE A;  4ZYN A;  2AGQ A;  2Z0E B;  5BO4 B;  3SDL C;  3FW9 A;  5D79 A;  3NGD A;  2LRW A;  2NO4 A;  1EUV B;  3AEF B;  3VUY A;  3DDM A;  3TAQ A;  1PDX A;  2F3N A;  1Q1W A;  2EQ7 A;  3CXB A;  4WQO B;  3SFD B;  3TW9 A;  1DGJ A;  3B0X A;  2V9H A;  2Z7J A;  4H83 A;  3EYZ A;  3PY8 A;  3PTF C;  2WF8 A;  7ICR A;  4K1W A;  3HT3 A;  2ZJ8 A;  2P66 A;  4N58 A;  4F93 B;  3CMM B;  3PVX A;  1ZGU B;  4IQW A;  5AKH A;  1FEA A;  2NPX A;  2XY6 A;  5B5E U;  2Y1J A;  4DSK A;  2LKY A;  4NXZ A;  2G3Q B;  1YNT E;  3RZF A;  2N9L A;  5AM4 A;  4FO6 A;  4DCC A;  2B76 B;  1L8L A;  3D2Q A;  4Y2P A;  3TFS A;  3THU A;  5AK3 A;  1BPX A;  1UH6 A;  2KG5 A;  1G6J A;  4F4R A;  2DZK A;  3ZDC A;  5FJO A;  2ZIV A;  5AUK A;  2KFK B;  2LGX A;  1WIA A;  2AYO B;  5DG8 A;  4DQI A;  5LXI B;  1SBB B;  4RCO A;  1GV4 A;  3ZLZ A;  1XD3 B;  1KD0 A;  3PM9 A;  2QAE A;  3EFU A;  1L3U A;  5BOL A;  3MTN B;  2INN E;  2N0S B;  5BMG A;  4KLS A;  2YMQ A;  1AN8 A;  1OEP A;  1D6E C;  4KLT A;  2BWF A;  4H2H A;  4FUL A;  5FJU A;  3L5O A;  3O0F A;  1FEH A;  2IMW P;  4NL9 C;  1M4V A;  2Y3A A;  4AWJ A;  4EQW A;  8ICC A;  4BV6 A;  1L5P A;  4UB4 A;  3H0M B;  2NRW A;  2DAF A;  3VTV A;  4DHZ E;  5ALW A;  1Z00 B;  3EAN A;  5LLI A;  3ML8 A;  4PS7 A;  2GGG A;  4R8U A;  2MSN A;  1ESF A;  2XCA A;  4P2H A;  4MGY E;  4AP4 C;  3A0H U;  4J9M A;  4QWA A;  4ECX A;  1LGR A;  1ZX9 A;  1FRR A;  3HIL A;  2WBA A;  3FKY A;  1N2X A;  1KDH A;  4JLC A;  5F3X B;  1OQY A;  2PP1 A;  5J8Y A;  4EEW A;  1TAQ A;  4M0W A;  2KOX A;  3WAL A;  5BMI A;  2XSX A;  3WKB A;  3W5U B;  4HCP B;  5AK5 A;  1KLG D;  4B0M A;  3W2D A;  2JYE A;  4CHK A;  2ASQ A;  3HK0 A;  4ACF A;  3EZ5 A;  2LM1 A;  4DL4 A;  3LAE A;  3QIJ A;  3QU7 A;  2FPL A;  1ZQE A;  2EMT A;  4M0X A;  1GRT A;  5ALS A;  3FAH A;  1SJD A;  1IPG A;  3RUI B;  4NEW A;  2H89 B;  2KYW A;  3EJB B;  4UAV A;  2QB0 A;  3TEZ A;  1BPB A;  4J9O A;  7ENL A;  2DKZ A;  3SZ2 A;  2F44 A;  3IVF A;  3EUB 3;  1HIW A;  3KKA C;  2ZJ5 A;  1X9X A;  1W1J A;  1W1M A;  1UQV A;  1UBQ A;  5KFQ A;  4GIV A;  4YR3 A;  1J8C A;  4AYB F;  4XWW A;  3ZLH A;  2CXY A;  3AMZ A;  3DWG C;  1JAL A;  2CR5 A;  3AQF A;  2E8P A;  1HQR D;  2NVK X;  3C21 A;  1ZD3 A;  4CF5 A;  2HDE A;  5J17 A;  1GRA A;  4DO9 A;  1WX9 A;  3T9L A;  4HDO A;  4K2S A;  5BOM A;  4NNJ B;  2Y5B B;  5J0R A;  1P43 A;  2WXN A;  1YIW A;  1LO5 D;  3V6H A;  3QE9 Y;  2RPV A;  3CB3 A;  4QZ8 A;  3S1D A;  4F8C B;  2KLC A;  2F5Z A;  3N4E A;  2GBR A;  4AYB C;  4BWM A;  1X9M A;  4KLM A;  1NK7 A;  5KFL A;  5AIA A;  4JN7 A;  3KHL A;  3TSS A;  1WGY A;  5HHI A;  1C7Y A;  1ZQD A;  3URY A;  4YG2 A;  1XCT L;  2G0A A;  3BVG A;  4W9J A;  3RCZ A;  1WGG A;  2L0T A;  3H0R B;  1QOB A;  4IUM B;  4IRC A;  3IG8 A;  8ICX A;  2DL0 A;  2KT7 A;  3C0P A;  2NV3 A;  1DOQ A;  1TTN A;  3CGD A;  5KFO A;  3PMN A;  1SE4 A;  3DG6 A;  4XX5 A;  1E0Z A;  1ZYQ A;  4PGY A;  1KRH A;  4HEA 1;  3DV9 A;  4XYC A;  2W43 A;  3QUB A;  3PR5 B;  2GGE A;  3L4P A;  4FBJ B;  1EXN A;  2I38 A;  3BYY B;  2HHU A;  2KK0 A;  4RUA A;  4YSY B;  5J2R A;  4DHZ B;  1W6T A;  2M0A A;  4C56 C;  3I28 A;  2GBK A;  3Q45 A;  3PW2 A;  8ICV A;  1ACC A;  5HR6 A;  4X2P A;  1FFU A;  4F8R A;  3SD7 A;  4RQ5 A;  4PGX A;  4LNF A;  4BCA A;  2OZ3 A;  2P88 A;  2WP5 A;  2KDE B;  4IQU A;  4CDG A;  5FXF A;  4NQK E;  3T9P A;  3PV8 A;  2KD1 A;  2UVW A;  3IJL A;  2ZJA A;  3MJW A;  5AZG A;  1IG6 A;  2FLN A;  5J0Y A;  1T0R C;  2GR3 A;  3DG7 A;  1GC6 A;  4R65 A;  2BT6 A;  2HTM E;  3UIP B;  2KOB A;  3H8H A;  4BZA A;  3Q8R B;  1FXI A;  1SXE A;  1L4Z B;  2HHV A;  3C1Y A;  4QWC A;  1Q0W B;  3O0H A;  4IP5 A;  2NCN A;  2ZUB A;  3V3X A;  4I2I A;  3H7I A;  5JCK A;  4IS7 A;  2MHJ A;  1J2N A;  3ZRC A;  2AGO A;  1I7H A;  3Q4D A;  2MBH A;  3BJS A;  1ZXH A;  4EQX A;  1WRD B;  4KDL B;  4OZB A;  1QCK A;  2V1Y A;  2KDF B;  4F71 A;  4GIS A;  3OZM A;  1V5T A;  4CE6 A;  1UWX A;  2WDR B;  2HDO A;  3HKZ F;  1IUE A;  1XF5 L;  3PHX B;  1IV8 A;  2K5P A;  3IT6 B;  2W3R A;  4K1R B;  3SBF A;  2BYV E;  4FA6 A;  2QQ6 A;  4HYK A;  4KLO A;  1S0N A;  5CP2 A;  2W04 A;  2ISP A;  4LK0 M;  2J4X A;  4PHD A;  2DW6 A;  1YX6 B;  5JCN A;  5KNI A;  9ICX A;  1RAX A;  2DPI A;  5AK6 A;  3V6J A;  1UEL A;  3M9N B;  1DZN A;  3D2J A;  2RPQ A;  1U48 A;  3Q8B A;  1SE3 A;  3QNM A;  2JU6 X;  3Q3N C;  5KFY A;  4C4V B;  3RTV A;  7ICH A;  2R8J A;  5KT2 A;  3IAS 1;  2I1K A;  3LLB A;  2EQ9 A;  3FDS A;  4UAS A;  2Y08 A;  3E0F A;  2KO3 A;  2K4I A;  3GV5 B;  1VAO A;  4MGG A;  2ZW1 A;  1TY2 A;  2MJD A;  1JWS D;  3DOW A;  2BPC A;  3TQ1 A;  4HRO A;  2H5X A;  5F9N A;  3RN9 C;  1H4R A;  3MFG A;  4ZRK A;  3GDX A;  4MM3 A;  1YJI A;  2P13 A;  3KD3 A;  1TY0 A;  3NS1 B;  1S5L U;  2PMV A;  2O6K A;  1IGC A;  2MH7 A;  1L8P A;  5DB8 A;  1TE2 A;  4GGB A;  2EQ8 A;  1DXL A;  3T5L A;  3TI0 A;  3PZ7 A;  4CQN A;  3GZF A;  4GDK A;  2GB1 A;  1GOZ A;  1T8E A;  2ZZ0 A;  4OJP A;  4RQ2 A;  4Z6F A;  2BDP A;  2XNA C;  4PK1 A;  1PVR A;  5L1J A;  5KT7 A;  2V4L A;  2HBL A;  4J9Q A;  5IIM A;  1TK5 A;  3WA0 A;  5JU5 A;  2QVH A;  3R1Z A;  5G5H B;  2ZXI A;  2GBM A;  3BVM A;  2KVC A;  5KFR A;  2YVJ A;  5EU9 A;  4JL9 A;  2KNJ A;  3PQB A;  2GLE A;  5DCN A;  1OGW A;  2CU1 A;  5IAA C;  1HTQ A;  1F0M A;  3VHT C;  3DBL I;  1NK6 A;  2NRV A;  2D5G A;  2KDM A;  1D4B A;  3AI5 A;  3WK5 A;  1S97 A;  1UD7 A;  2XN9 C;  2WYQ A;  4DL3 A;  2HOI A;  1MFW A;  2JY6 A;  2GOW A;  4MJS B;  3RUL A;  3I99 A;  4GLS C;  1D5X C;  5KTQ A;  4LVS A;  1D8B A;  5HNK A;  4YFK A;  1JCK B;  4KLH A;  2MLB A;  3R3M A;  5III A;  3ZNZ B;  2PP0 A;  5ER0 A;  4FZL A;  5AKJ A;  3FC4 A;  1WR6 E;  2Y1I A;  3GY1 A;  3QFB A;  3C19 A;  3NVV B;  5IIN A;  2JPH A;  3QK0 A;  3ZDM C;  3ENE A;  1D9D A;  1IYF A;  1WSP A;  4J56 A;  4MEL A;  2IZV B;  3VAW A;  3WAO A;  4TQ1 A;  2BKE A;  1N5X A;  4X5V A;  1KFD A;  1SXD A;  4W9H A;  3RNB C;  1X2I A;  2WP9 B;  1AHZ A;  4ED2 A;  3NHE B;  2IA6 A;  2NPT B;  3QAQ A;  8ICK A;  2DYO A;  1CI4 A;  2BQ3 A;  5D46 A;  1N60 A;  4PVK A;  3HW8 A;  3BQ7 A;  3L3F X;  2JXJ A;  4IQT A;  1ZP0 B;  1SJB A;  5AKL A;  2CPR A;  1K8R B;  1WYW B;  4UAZ A;  3HRD C;  3P4P B;  1JWB D;  2JRI B;  5KFE A;  2DQN B;  5ALE A;  1YOV B;  9ICV A;  2ICI A;  3R07 C;  1TZZ A;  4ARI A;  2Y0S F;  4OJ6 A;  5KT3 A;  4O3P A;  4MEX A;  1OQR A;  3ZVH A;  1W1O A;  1GNU A;  2ISO A;  1KW4 A;  1V49 A;  3CT2 A;  4TUS A;  2QB1 A;  2JSV X;  3ZXR A;  3NS1 A;  2HMX A;  4YWG G;  1JCT A;  3STP A;  3CGC A;  3UXL A;  2FNJ B;  5DQI A;  2JH7 A;  2PMZ F;  4G3X B;  3SFE B;  9ICW A;  1L7N A;  3FJ4 A;  3ZD9 A;  1A5R A;  5KFN A;  3R66 C;  2MP2 A;  1WJN A;  3I57 A;  3PSF A;  1NJZ A;  4J6I A;  1GRH A;  4GC6 A;  4PS8 A;  1TKY A;  2WXP A;  5JH5 C;  4ZA0 A;  2XI9 A;  4HPP A;  5ALP A;  2Y3S A;  2FI1 A;  2YB4 A;  2KTF A;  4JWM A;  2MRP A;  2IJ0 A;  2Y0S C;  4GMV A;  1RG6 A;  4I27 A;  1CUK A;  3VR8 B;  3ICX A;  4Q8F A;  2D3C A;  3P4S B;  1L6V A;  4EMJ A;  4KLJ A;  2UVV A;  5G5H A;  1U4A A;  4FJV B;  1T3Q A;  3HPF A;  2PMZ C;  2LHD A;  3QYP A;  1CMX B;  4KN4 A;  2QAR B;  3H8M A;  3I4K A;  1U9L A;  2PVO D;  2VZK B;  3V05 A;  4FHJ A;  3VTU A;  5L95 C;  3GZN B;  3B9J A;  4OAL A;  5AM0 A;  4TQR A;  5ALX A;  3KYC D;  5IKC M;  4XUS A;  3A1Q A;  2ES6 A;  3PW0 A;  1V8C A;  1DK3 A;  3IAM 1;  3A7A A;  2LEK A;  1YQB A;  5L1L A;  4ELT A;  3UIN B;  2NMQ A;  1VZ7 A;  2MBE A;  3BOX A;  2WPE A;  1HUO A;  4NM1 A;  1XXG A;  3ZUN A;  3K1Z A;  2XY5 A;  3DER A;  4K7W A;  4ZOH B;  2M4N A;  2LXA A;  3R0U A;  2DGZ A;  4F4W A;  2W0H A;  3NVV A;  1E7V A;  1YJ1 A;  3DK9 A;  2G5I B;  3JPQ A;  2NO5 A;  3AU6 A;  3A9J B;  1YEY A;  1XSN A;  3C28 A;  3II4 A;  2IOH A;  1WZ3 A;  3TAR A;  4JV2 A;  3HVD A;  4H2A A;  4RF0 A;  2J3N A;  3NG0 A;  2WDT B;  3D46 A;  3AE3 B;  1O08 A;  1AOG A;  1L7M A;  2X8G A;  1E6E B;  1AQ6 A;  1SGH A;  3QUT A;  2G09 A;  3A9K B;  1WJU A;  3DVG Y;  2JGA A;  4DOA A;  2ZNV B;  3AU2 A;  2X8X X;  4BBN C;  4HCH A;  1TYP A;  4RQ6 A;  4R3D A;  3VA8 A;  5JCM A;  3OHB A;  2J42 A;  2KC2 A;  8ICH A;  2H3F A;  1UGM A;  4O9M A;  4OZC A;  5JUM A;  3G6V A;  1L3T A;  4DXA B;  3AE7 B;  3TJP A;  8ICL A;  2L83 A;  1N62 C;  2OKT A;  2R2Z A;  2ALZ A;  4DL7 A;  3S5S A;  1U49 A;  9ICI A;  1FCL A;  4KIK B;  3BQ2 A;  2ZZP B;  2ZXH A;  4J1O A;  1ZE3 D;  3QWZ B;  1KKO A;  4L23 A;  3NVW B;  1F2R C;  3UM9 A;  1XAN A;  1SJH D;  2AXT U;  4O5K A;  3QU5 A;  3TX1 A;  3IFW B;  2VA2 A;  2EKI A;  1DII A;  3RFA A;  2IO3 B;  1Z1V A;  2CDU A;  3T8Q A;  3PST A;  4B95 A;  2V4I B;  4M9J A;  4C80 A;  5TIS U;  2LD9 A;  2P35 A;  1NYR A;  2YEP F;  2ASJ A;  3S1F A;  1ISN A;  4L2Y A;  4ECW A;  1GRG A;  4Z6D A;  1T3N A;  1RQL A;  4F2S A;  3TCA A;  1UWM A;  2IGD A;  1L0X B;  2WOV A;  1U4B A;  3S6J A;  2BBC A;  2GR2 A;  4K8D A;  2PMQ A;  1TGZ B;  1EBD A;  2MX2 A;  1C4P A;  4ECV A;  3UGB B;  3EEC A;  4RGM A;  3VXW A;  4II2 B;  2K8A A;  1N5W C;  1ZQC A;  9ICH A;  2QAR A;  5CA7 A;  5E6O A;  3NVY B;  2LJI A;  5DPS A;  2C2D A;  2BCS A;  3MC9 A;  4Q43 A;  2HXU A;  2OYY A;  1F0X A;  4NLN A;  3EFC A;  1WMH B;  4J9K A;  2C9W B;  3I3T B;  4IWQ A;  3TAC B;  2DWQ A;  2WB1 F;  1N63 A;  1QH9 A;  5KFF A;  3LK9 A;  4DQR A;  1UA0 A;  2QIL A;  3I6T A;  2PKO A;  3THV A;  1LV5 A;  2K8H A;  4J9R A;  1I4G A;  4IRD A;  3OPS A;  4MH0 E;  2Y5P A;  5K4L A;  3HSU A;  4E5T A;  2LVP A;  3OJ4 B;  2W54 A;  3A9J A;  3FVD A;  3N6H A;  3Q6B A;  3UPQ A;  1FD6 A;  1ONF A;  3N9Y C;  3JW7 A;  1DOY A;  2V0G A;  1SEB D;  4M6U A;  3ETR B;  5KG0 A;  5CR0 A;  5CB1 A;  2WB1 C;  2N7E A;  2G5H B;  3CWI A;  1STZ A;  2PTY A;  2Q4T A;  4LII A;  5JXV A;  5T14 A;  2CHZ A;  4C8K A;  1S7M A;  3DHI C;  2V6O A;  2RDH A;  2YVG A;  5TR3 A;  3UJR A;  1A76 A;  3DQV A;  1ZQI A;  3DJJ A;  1SWW A;  2KX3 A;  3PGE A;  1DOX A;  3I5J C;  4YXJ A;  2JR5 A;  2N7D A;  3QAR A;  2AKM A;  3P0W A;  4XZ4 A;  5KAI U;  2QDD A;  4P1C C;  1PGA A;  1TS2 A;  3WAP A;  1Q8K A;  4GLX A;  2JZ3 B;  2WU2 B;  4A3O A;  2V4Q A;  4ARC A;  2PU0 A;  1C9F A;  2QLT A;  3K4G A;  4A3R A;  2AJQ A;  5AM2 A;  1KSP A;  3BII D;  4H4S A;  4HPN A;  4DL5 A;  2XH0 A;  4FZM A;  2R2Q A;  1ZQL A;  2FBW B;  3B2G A;  1JXL A;  1V85 A;  3I1Y A;  3HHM A;  2WPC A;  2HBJ A;  3VRB B;  3AV8 A;  4JAY A;  4YWS A;  4XLO A;  3T8M A;  1AHV A;  2QGY A;  1RYR A;  2QEJ C;  3WK7 A;  1FHV A;  1ZMD A;  5KG3 A;  5FJP A;  5KVH A;  3T79 A;  1V86 A;  4DHG A;  1SF0 A;  3BK2 A;  4Q8E A;  1FRD A;  5ALK A;  2IHM A;  1IXR A;  4OD0 A;  3Q3O C;  2KSO A;  4EEK A;  1XPY A;  1J97 A;  1E7U A;  3SMV A;  2PGE A;  3X0W A;  1RM6 C;  2C5L C;  2LHE A;  1IGD A;  1I4Q A;  2DYB A;  4DFK A;  3EWA A;  3NVY A;  5KFU A;  1XSP A;  3KH0 A;  4BKT A;  2CJO A;  3ZJT A;  2OZT A;  4WAF A;  2FPM A;  2J0J A;  2Q0Z X;  1MUC A;  2XGQ A;  1L6N A;  3U7D A;  4HYR A;  2AL1 A;  5I1V A;  1WMH A;  2KMC A;  4YMM A;  3KWV A;  3U4E G;  4FDC B;  1TKD A;  3GFK B;  2BB5 A;  2DZI A;  2VH2 A;  3NS8 A;  1ET9 A;  1JDF A;  2QPM A;  2HOF A;  3Q8P B;  1TBE A;  2Y5C A;  4KPL A;  5J8Y C;  3NJT A;  2WXR A;  5DB6 A;  2I6X A;  1PDZ A;  1JWM D;  3RJ8 A;  1L0Y B;  5DQG A;  3P3B A;  4P0Q A;  1SB3 B;  2HBM A;  1DTN A;  4GSW A;  2NRX A;  5ALL A;  4I2E A;  1WGH A;  2KFN A;  2I5Q A;  2PTL A;  3R10 A;  5CJ7 A;  1SL0 A;  3KLS X;  4KGR A;  4MF2 A;  5AK4 A;  3ETR A;  2IGH A;  2I2Y A;  1FEZ A;  2XK5 A;  3IT4 B;  2N1W A;  1MG4 A;  1UF0 A;  1WXM A;  8ICS A;  2AAQ A;  4XGA B;  1DOI A;  3QTP A;  3AN1 A;  4WUR A;  4HLE A;  3QPE A;  3KUC B;  1SV4 A;  1YJJ A;  4KKJ A;  5D49 A;  7ICE A;  3KBB A;  4QZG A;  2BQU A;  1P0R A;  1D8Y A;  1GB1 A;  1IM4 A;  1SKR A;  2WWZ A;  5EOZ A;  4A8E A;  4QZB A;  2MBB B;  4JDR A;  1L7Y A;  3RB0 A;  3EF6 A;  1ZQK A;  1T0Q C;  3NRZ B;  3K75 D;  3EKG A;  2IBK A;  4PVE A;  2MEK A;  1SGG A;  4UW9 A;  2OO6 A;  4I6L B;  1VJ5 A;  2FKP A;  1YZ7 A;  1R4N I;  3PHW B;  1NYQ A;  2D3A A;  2OQY A;  2EQY A;  3QXG A;  3PPA A;  5DB7 A;  2KJR A;  8ICB A;  2OOB B;  5AKG A;  2RSU A;  5KG2 A;  1ECQ A;  1SKS A;  3UJS A;  1F5S A;  2O2V B;  3OWE B;  4HG0 A;  5L83 A;  1KFT A;  4IP4 A;  2HE7 A;  4KX3 A;  5ALT A;  4M04 A;  2MJE A;  3E9S A;  2KMA A;  1SWV A;  4S0R A;  4RMA A;  1N6Z A;  3N32 A;  4HRS A;  4LNO A;  2YLM A;  1K4Q A;  2ZTD A;  4CGZ A;  1MJD A;  4RNM A;  2HD5 B;  4B9N A;  1XS9 D;  3T5H A;  4M9G A;  4LDT D;  5TR5 A;  3RGT A;  3RB3 A;  4IOI E;  3DK8 A;  3MZN A;  1LKY A;  2KE7 A;  4ECS A;  4B9L A;  4HKZ E;  4WWM A;  4RQN A;  1ZQH A;  4KTQ A;  1YN3 A;  4EQS A;  4IR1 A;  4O3R A;  2A3V A;  5B66 U;  1IBX B;  5AI9 A;  3TEW A;  2KKV A;  2KN7 A;  1EU3 A;  2ZG6 A;  2NBU A;  1TV9 A;  9ICN A;  5KFW A;  1N56 A;  2K6D B;  3H8W A;  2AQ4 A;  4HPL B;  1B22 A;  2JXT A;  3NZG A;  3ZRF A;  1KN0 A;  2ZC8 A;  3UMG A;  4LNK A;  4IHC A;  2AHO B;  1FFU C;  5DLF A;  4EE2 A;  2O3G A;  3R7R A;  1LVH A;  4UQG A;  1C78 A;  2FE9 A;  4BJQ A;  4C7Y A;  4EKU A;  1QF6 A;  4K3C A;  3S47 A;  2KVR A;  5J2G A;  3RT3 B;  3MSY A;  3MKC A;  5J2F A;  2XGP A;  4ANW A;  2UVU A;  2AQ3 B;  1FCC C;  2F2A B;  1V1O A;  2W82 A;  3ALB A;  3VUW A;  3LJ3 A;  3QC8 B;  3Q8E A;  4BUG A;  4II3 B;  1SZH A;  1L0V B;  1JI7 A;  2C2R A;  1XQQ A;  1GRE A;  2HHW A;  4DK5 A;  2GR0 A;  4AJY B;  3OSP A;  3GD4 A;  1WVE A;  3K1G A;  1KFY B;  2IBI B;  2FLP A;  3H4K A;  3T4W A;  1TVA A;  4PVJ A;  2Q4W A;  1K52 A;  2OLA A;  4N59 A;  5ALH A;  3Q3J A;  5J2E A;  4HDQ A;  3MDA A;  1OW5 A;  5KG4 A;  2DHZ A;  2CHX A;  2O6V B;  2BYT A;  4PWB A;  4UD8 A;  5F9L A;  2VA3 A;  3ISB A;  3ISC A;  1WYG A;  4EFO A;  2E8O A;  3SAF A;  4RPY A;  1TJE A;  2G4S A;  3SR6 B;  2KAN A;  2JEG A;  4OHJ A;  3NRZ A;  4IM3 A;  4JWU C;  2M0N A;  4PZF A;  1VD2 A;  3GC2 A;  3H12 A;  3A4R A;  4NJ7 A;  4GXI A;  3MGI A;  5D3I B;  2EMS A;  4F5R A;  1R4M B;  2GBJ A;  1ZQT A;  3DHG C;  5ALR A;  3DGZ A;  2DLB A;  1DNC A;  2ZIW B;  1YQ4 B;  3LXF A;  1PUZ A;  3QUQ A;  1ZQO A;  4NQL B;  1JPD X;  3JZU A;  2C7N B;  2K8C A;  3VVW B;  1RRB A;  4M8M A;  3VH3 B;  4AS1 A;  4GU2 A;  4HN8 A;  3RR1 A;  4E4F A;  4E8G A;  5ALF A;  4Z6C A;  1RVK A;  1ZOL A;  3CAW A;  2W9N A;  1XO1 A;  4RU9 A;  4YWO A;  3V62 A;  1WJ4 A;  4M00 A;  4EBE A;  4XRH A;  3H6N A;  1HEK A;  1CK1 A;  3QCA A;  5J2D A;  3ZDB A;  1PGB A;  1ZRM A;  1LB2 B;  4DQQ A;  4M2Y A;  5KFV A;  4H4R A;  4J9L A;  3MC0 B;  3UQ0 A;  4UAU A;  1SE9 A;  3OG5 A;  3SAG A;  1GET A;  5HR7 A;  1IBX A;  4TQ0 A;  3TAN A;  5AE1 A;  4ECU A;  2R18 A;  3UMB A;  1WWV A;  2GBN A;  3E58 A;  3EPG A;  2K60 A;  2AQ1 B;  5A0L A;  2E3T A;  3WIM A;  4J9P A;  5C23 A;  3V6E B;  7ICN A;  1D5Z C;  2KX0 A;  4P4O A;  3IC9 A;  3ZNG C;  2ZTE A;  4DF8 A;  4H4T A;  1PFD A;  4YXD B;  4BWJ A;  4H4U A;  2EAN A;  4UAY A;  3Q8Q B;  4F91 B;  1F2R I;  1QQ6 A;  2AH5 A;  5ALG A;  3PR4 A;  1ZQM A;  3N7R C;  5ALM A;  1NK0 A;  3RCY A;  4A9A A;  4MFA A;  3A0B U;  5ADZ A;  3BS5 B;  3MR3 A;  4BOZ B;  2BCR A;  1QQ5 A;  2WXK A;  2BGF A;  5IP4 D;  2XH7 A;  2RHF A;  4C4S A;  1B43 A;  3AEA B;  2PA6 A;  2JZB B;  8ICJ A;  4PVH A;  4C8M A;  2ZPN A;  2I5H A;  4C4T A;  2FIF A;  2G9H D;  4M47 A;  3W1S A;  1D9F A;  2ZIU B;  4BKS D;  3D2D A;  5KT4 A;  3TBL D;  1NEL A;  4FHK A;  3GV7 B;  5FK9 C;  3R7Q A;  1XEE A;  4HCN B;  4DOB A;  4DQS A;  3PRZ A;  2W3S A;  1V1P B;  2OPJ A;  3B0Y A;  4ITK A;  1W1R A;  3H7S A;  3AU4 A;  4FXC A;  2QDE A;  1C3T A;  1Z5S B;  4US9 A;  1Z19 A;  5DKW A;  3I63 C;  4H50 A;  1F0Z A;  3A7R A;  1MC8 A;  3S1C A;  2NBW B;  1LPF A;  4H4W A;  3VCC A;  3DJG X;  5AUI A;  4M9N A;  2ZUC A;  1FNV A;  1S76 D;  4A6G A;  1J7C A;  2LYB A;  4DSJ A;  1B1Z A;  4EEL A;  3TOY A;  3VTE A;  3JPN A;  3SEB A;  4BGD A;  2XEW A;  3ZNH B;  1SXT A;  1X6I A;  4KEM A;  4NZL B;  3PRP B;  1V59 A;  2HI0 A;  1WUD A;  4RPX A;  1Q5W B;  2ZIW A;  3BDP A;  4ML8 A;  1N60 C;  2AKZ A;  3IJQ A;  4DXK A;  2XY7 A;  4ED1 A;  4ROP A;  3ETL A;  1YQZ A;  4PHE A;  2MUT B;  4CYE A;  4EWJ A;  1EBG A;  4E3C A;  1GRB A;  2BC1 A;  2QCZ A;  1KTQ A;  3V6C B;  4YT0 B;  1T6B X;  5TSS A;  2Y3R A;  3WKD A;  4YD2 A;  1Y56 A;  4BKG A;  4DX3 A;  3DFY A;  4OVU A;  1E0Y A;  1KN5 A;  2JH1 A;  3KTQ A;  2W9M A;  1ZQV A;  5AIC A;  3AUL A;  4JHM A;  5DGA A;  4LA1 A;  4F72 A;  1WGR A;  1LFD A;  1NDA A;  2JQR B;  2XID A;  1MG8 A;  2KDI A;  4MAC A;  2KFK A;  4NJ6 A;  3RZW C;  1FEB A;  3DES A;  3N6J A;  2TSS A;  4JIO U;  5J18 A;  2ZVO A;  1NPX A;  3FWA A;  2POD A;  1TZ1 A;  1I19 A;  3FW7 A;  2KWU B;  2JEF A;  1V38 A;  2YML A;  4DQP A;  5LXH A;  3EW9 A;  1T3Q C;  4JE3 B;  3BS5 A;  1EC7 A;  3HUI A;  4DL6 A;  5KAF U;  1U45 A;  2INP E;  2KTR B;  2BCV A;  1NHP A;  1XDI A;  5AM5 A;  2ZJD A;  2TPR A;  1AYF A;  2JZB A;  4PHP A;  1MBB A;  3DEE A;  2VFT A;  2GGH A;  3Q8A A;  2BDU A;  4Y2V A;  1WM2 A;  1Z00 A;  3WK4 A;  4C8O A;  5D6J B;  2ZIU A;  5CRX A;  2R8G A;  2KDB A;  2PGW A;  1T4G A;  4JUZ A;  2GI9 A;  2FYM A;  4BC9 A;  2FUH B;  4KKI A;  3PX0 A;  2EZX A;  4I2H A;  1V1P A;  4PWC A;  3N7P D;  3U52 E;  5J0U A;  3MP9 A;  3ML9 A;  4PYT A;  8ICG A;  2HBK A;  2A1J B;  4NAW B;  1S10 A;  4JQ9 A;  5U25 A;  3U9I A;  4IKG A;  4M01 A;  1K50 A;  1TAU A;  2LUM A;  3DVG X;  4NLG A;  3LYY A;  1X1M A;  4QZI A;  2JX5 A;  2RDG A;  4QZE A;  3RJI A;  2QJJ A;  1XNS A;  2PLP A;  4K8G A;  1I4R A;  4KLD A;  1FO4 A;  1GER A;  1HE8 A;  3ED5 A;  2BVC A;  2J6T A;  4RQ4 A;  1CEZ A;  2QHO A;  3P4Q B;  5D7G A;  3KJM A;  1V5O A;  4W9F A;  4C4R A;  3RJA A;  1GJZ A;  4M8N A;  2D8C A;  1TZO A;  1A6S A;  1F1H A;  1NBF C;  3IG3 A;  5D3D A;  1UBI A;  1QSS A;  3ZTD A;  1ZQU A;  2CFY A;  3M6Z A;  3RJJ A;  3RH4 A;  4K3B A;  2PS2 A;  2DUY A;  2VKQ A;  2OCE A;  4KDI C;  2Q85 A;  4CRX A;  3KUM A;  3GIL A;  5J2C A;  3MR6 A;  2LHT A;  1Q3V A;  1BNP A;  1NI2 A;  1BPE A;  3ORY A;  4DEZ A;  1ZQ1 C;  2W7P A;  1XT9 B;  1ZJN A;  1T7P A;  3J9C A;  2X8H A;  2RLT A;  3QUC A;  4B9T A;  3L16 A;  4FI4 A;  2NTT A;  1ZQB A;  3G6X A;  3FXG A;  2K22 A;  4MEY A;  3F53 A;  3ENL A;  2VIX A;  1PK1 B;  2PFP A;  1CRX A;  4R64 A;  1NZB A;  1SL1 A;  2YY6 A;  3RR7 A;  3PML A;  7ICL A;  2M1M A;  3HM3 A;  5BOF A;  4CCH A;  4QWE A;  5J0Q A;  1FMA D;  3QHT A;  2EKE C;  2FMS A;  1QTM A;  3Q8L A;  1F44 A;  3HKZ C;  3UXN A;  4FP1 A;  4ENL A;  1LQB A;  4OJ5 A;  4KLG A;  2GWS A;  2G08 A;  5GXG B;  2OVL A;  5HG2 A;  4ECZ A;  4I2B A;  2KTR A;  2KTQ A;  2HZG A;  2E6X A;  3R2T A;  5GMV A;  2NQW A;  1E8Z A;  3PRE A;  2PLS A;  1K5O A;  4QW9 A;  1DYQ A;  2WNM A;  2HSZ A;  2K25 A;  4LJP B;  3W1Y A;  5AKY A;  1FNU A;  1S8O A;  5EWE A;  3FM9 A;  1TT5 B;  2FE8 A;  3A1Q B;  2KQS A;  3CGB A;  3GD6 A;  3WKC A;  4DWI A;  9ICT A;  1EU4 A;  3KW5 B;  2PTX A;  1PZN A;  1N63 C;  2E5S A;  4KX5 A;  4K4I A;  2M56 B;  4FZN A;  4NAM A;  3RBE A;  3E56 A;  3KWL A;  4PT5 A;  3CGE A;  4DN1 A;  5AKZ A;  2F1H A;  2D2Q A;  3DCG A;  3H0L B;  1BPY A;  3L08 A;  4W9K A;  1F3P A;  1NZP A;  4B9S A;  3L0W B;  1A0P A;  4Y2Q A;  2YTU A;  1NHS A;  2DX5 B;  4A8X C;  3JPO A;  1FM0 D;  3JVA A;  3DWM A;  9ICB A;  4G11 A;  2F1I A;  3ZNI D;  3RNA C;  3I6E A;  1QSY A;  1LM8 B;  2HCF A;  2JF5 A;  5DPT A;  2J6S A;  2IOF K;  3J81 j;  2WXI A;  3ZDA A;  4HJG E;  4RQ8 A;  4KX6 B;  1DIQ A;  2QKN A;  1WXS A;  2KC1 A;  8ICA A;  3ALR A;  3GV8 B;  2L1A A;  4ED0 A;  1D8L A;  2OHF A;  4OCZ A;  1LXD A;  2PFQ A;  5AKI A;  1HEZ E;  3B08 A;  2KHV A;  3P2B A;  4KZ0 A;  4I28 A;  3PW5 A;  2W55 A;  3PWI A;  2KJH B;  1J7B A;  4JGH B;  2IOF A;  3RNG C;  1P48 A;  2INC C;  4FFD A;  1ZQJ A;  1RWS A;  4TVY A;  4LZD A;  7ICV A;  3W8Z A;  2ASL A;  4LLG M;  3U26 A;  2MQJ A;  2OX4 A;  5L6G A;  5JCL A;  1COO A;  2NVU I;  3DPD A;  4Y2U A;  1KLU D;  4ED8 A;  3TEY A;  3BWU D;  2UYZ B;  4UB1 A;  2VAO A;  2VJ4 A;  4F4Z A;  5J0S A;  4BUR A;  2OH2 A;  4URK A;  4C7Z A;  4DL2 A;  2OEH A;  4H19 A;  3C23 A;  4F50 A;  3NUQ A;  5EE9 A;  2V9W A;  3OSN A;  1V80 A;  1EBH A;  3I76 A;  1ZDV A; 
#chains in the Genus database with same CATH homology
 1D5M C;  3W8X A;  5AWV A;  1W1K A;  4EC3 A;  2W54 A;  3NVZ B;  5MPO A;  1VDV A;  1W1L A;  1VRA B;  3AH7 A;  3KQ4 A;  1FD6 A;  1SE2 A;  3N9Y C;  1JRP A;  5I4D A;  2AQ2 B;  1DOY A;  1I4P A;  1SEB D;  2V0G A;  3ETR B;  4YTM B;  5EE3 A;  5C3J B;  3CWI A;  3AED B;  5JXV A;  2GRI A;  1P7F A;  1NVI D;  2RDH A;  3NZ3 A;  4KGS A;  1ZXI A;  5BYR A;  4KGT A;  2PLI A;  1VQZ A;  1DOX A;  1N5W A;  2R8D A;  1RM6 B;  1FNW A;  1HXY D;  2OAI A;  3ZJV A;  3RPF C;  1PGA A;  1TS2 A;  1E8F A;  1VLB A;  1ET6 A;  2I0K A;  2QIE B;  2WU2 B;  2MJ3 A;  4ARC A;  4A90 A;  1C9F A;  1YQ3 B;  1ZUD 2;  4OZA A;  4MM3 B;  1CJE A;  1KH0 A;  3BII D;  1TKG A;  2FBW B;  3B2G A;  1C76 A;  4RFB A;  1ENF A;  3VRB B;  2VFU A;  3FW9 A;  3AV8 A;  4JAY A;  5D79 A;  4XLO A;  1AHV A;  2QEJ C;  3AEF B;  2ONQ A;  4GDK B;  3AEE B;  2NTS A;  2IGG A;  1SF0 A;  3BK2 A;  2AXR A;  2BS4 B;  1PDX A;  3P63 A;  1FRD A;  2GQU A;  1JML A;  3SFD B;  1DGJ A;  3D2H A;  5HHD G;  1RM6 C;  2LHE A;  1IGD A;  1I4Q A;  1W1S A;  4N58 A;  3NVY A;  3HVZ A;  3ZJT A;  2CJO A;  2WQY B;  4WAF A;  2PW9 A;  1BML C;  2AX5 A;  1HZ5 A;  5I1V A;  1YNT E;  4A55 A;  3KWV A;  1F77 A;  2N9L A;  3U4E G;  1X2G A;  2BB5 A;  2WXL A;  2B76 B;  1ET9 A;  3W8W A;  2QPM A;  2Y5C A;  3TSJ A;  3RJ8 A;  2WLB A;  2WXR A;  3HRD D;  1JWM D;  4J3O D;  1L0Y B;  3AE1 B;  5AUK A;  3GSY A;  1SB3 B;  5EE1 A;  3NVZ A;  3AEC B;  1SBB B;  3PO0 A;  4RCO A;  5LNK 1;  2SEB D;  2PTL A;  3PM9 A;  4JB1 A;  3KLS X;  4KGR A;  3AE8 B;  3R8B A;  2RK5 A;  3ETR A;  2IGH A;  2I2Y A;  3MJ5 A;  2INN E;  2N0S B;  5BMG A;  1C77 A;  3IT4 B;  1AN8 A;  1D6E C;  3AE6 B;  1N61 C;  1E10 A;  4OW0 A;  1FEH A;  2Y3A A;  1DOI A;  1M4V A;  2ZW0 A;  3AN1 A;  4WUR A;  1FFV C;  2CJN A;  1L5P A;  2JZP A;  4ZOH C;  2L32 A;  1YJJ A;  3Q8F A;  4KKJ A;  4WH4 A;  1KF6 B;  1GB1 A;  1BUI C;  2QSD A;  1ESF A;  4USA A;  1JWU D;  1PYW D;  2QJL A;  2QMT A;  1JRO A;  2DYM A;  2P3H A;  3NRZ B;  4PVE A;  2MEK A;  5FXP A;  3ZQ4 A;  3U7Z A;  1FIQ B;  3T3O A;  1FRR A;  3AEB B;  3MHZ A;  1SB3 C;  3GB1 A;  2V3N A;  1NYQ A;  3GP7 A;  1UNS A;  4M0W A;  5BMI A;  3EUB 2;  2WXO A;  3W5U B;  1KLG D;  4B0M A;  3W2D A;  4L1B A;  2Z8L A;  4HG0 A;  2JYE A;  3OWE B;  4GDL B;  1C4C A;  3E9S A;  2MJE A;  2IDY A;  5FXE A;  4ZHO A;  1R7S A;  5HMR A;  3LAE A;  4HRS A;  3FAH A;  2EXR A;  2H89 B;  4IOI E;  3TEZ A;  2X38 A;  4HKZ E;  2LMC A;  1N61 A;  4WWM A;  1T5X D;  4TMA B;  3EUB 3;  1YN3 A;  1W1M A;  1W1J A;  5EE0 A;  1IBX B;  3TEW A;  1FFV A;  1EU3 A;  5C2T B;  4XWW A;  3B9J B;  4BBY A;  3AMZ A;  1ZDX A;  3DWG C;  1JAL A;  2KN4 A;  2KQ4 X;  2JXT A;  1HQR D;  1MVK A;  2K0P A;  2R61 A;  4O95 A;  1JWA D;  2VZK D;  2HDE A;  4D2K A;  1FFU C;  1WXQ A;  4EE2 A;  1SSN A;  4REZ A;  2O3G A;  3AE5 B;  4NJC A;  1C78 A;  4JPS A;  3Q8C A;  4C7Y A;  2WXN A;  1QF6 A;  2RPV A;  1LO5 D;  3S1D A;  5FXD A;  1GPX A;  2AQ3 B;  1FCC C;  1V1O A;  1X2H A;  2W82 A;  3Q8E A;  2JWU A;  1L0V B;  3TSS A;  1V97 A;  1L6U A;  2VFS A;  3ZJU A;  3URY A;  1MBT A;  1QKZ A;  1XCT L;  3BVG A;  1WVE A;  1UXY A;  1KFY B;  1QOB A;  5FKA C;  5BYQ A;  4PVJ A;  2Q4W A;  1K52 A;  4N59 A;  3C0P A;  2V3P A;  2BYT A;  4PWB A;  3NVW A;  4UD8 A;  1AW7 A;  1SE4 A;  1ZR6 A;  1E0Z A;  2WXQ A;  3TSH A;  1KRH A;  1WYG A;  4HEA 1;  3AM9 A;  1MHX A;  3P1M A;  2YVS A;  3O13 A;  3L4P A;  1TJE A;  4A6Q A;  3SR6 B;  2I38 A;  2ON8 A;  3BYY B;  4OHJ A;  4RH6 A;  3NRZ A;  2G1E A;  4YSY B;  2M0A A;  4C56 C;  3BW7 A;  4JWU C;  1K53 A;  4PZF A;  1ACC A;  1FFU A;  2GQT A;  4US8 A;  4DNS A;  3I9V 1;  5D3I B;  4BCA A;  2BTE A;  1XO3 A;  3VQI A;  5FXF A;  2DLB A;  4P6V F;  1YQ4 B;  3LXF A;  4AS1 A;  3W5V B;  1NI3 A;  5AE2 A;  1QOF A;  2BT6 A;  2HTM E;  3H8H A;  2WXH A;  2WXG A;  1FXI A;  1L4Z B;  2EEL A;  3Q69 A;  1CK1 A;  4LTU A;  4WIP A;  1PGB A;  3JS8 A;  2FUG 1;  3V3X A;  3AE4 B;  2DBY A;  2OED A;  3MC0 B;  3FW8 A;  1C79 A;  1I7H A;  1L4D B;  1IBX A;  4TQ0 A;  1ZXH A;  5HFY A;  1HZ6 A;  1TS3 A;  5AE1 A;  4OZB A;  1E8G A;  3ZYY X;  2AQ1 B;  2WDR B;  1UWX A;  1IUE A;  1XF5 L;  2E3T A;  1VZ6 A;  2BB6 A;  1I4H A;  2K5P A;  3IT6 B;  1QT9 A;  2W3R A;  1D5Z C;  2IPK D;  2WDV B;  4XWT A;  2JYT A;  3UI3 A;  1W1Q A;  5G5G B;  3PZ8 A;  5L6F A;  1HA5 A;  1PFD A;  4YXD B;  4LK0 M;  2J4X A;  1F2R I;  1XLQ A;  4RNA A;  1WGK A;  2Q5W D;  4AQ7 A;  5K8E A;  1OQQ A;  4JWS C;  4A9A A;  5ADZ A;  2WDW A;  1P7E A;  2WXK A;  2M19 A;  3CIR B;  3EGR A;  3AEA B;  2UUV A;  1DZN A;  3D2J A;  3VRA B;  4PVH A;  3Q8B A;  1SE3 A;  2JU6 X;  3C8Y A;  1UGJ A;  2G9H D;  3IAS 1;  3W1S A;  3D2D A;  3LLB A;  3FIL B;  2Y08 A;  4TSS A;  3AE2 B;  1VAO A;  5FK9 C;  2WXJ A;  1TY2 A;  1XEE A;  1JWS D;  2MJD A;  2ZW1 A;  2W3S A;  1V1P B;  4HRO A;  4YTP B;  2Y4G A;  2BVG A;  4ITK A;  2WU5 B;  3W9C B;  1W1R A;  4FXC A;  1MPE A;  1TKE A;  3MFG A;  2PVG C;  1YJI A;  2P13 A;  4US9 A;  1TY0 A;  3NS1 B;  2PMV A;  1F0Z A;  3P4R B;  3A7R A;  1Q10 A;  3S1C A;  1IGC A;  1AWD A;  2MH7 A;  4XDD A;  1BXT A;  5AUI A;  3RFZ B;  2VFV A;  1FNV A;  1J7C A;  2WXM A;  5HQX A;  3PZ7 A;  1B1Z A;  4CQN A;  4JX1 C;  3IXS A;  3VTE A;  2GB1 A;  3SEB A;  1JQ4 A;  1GOZ A;  2BW2 A;  1NEK B;  1SXT A;  2BVH A;  4NZL B;  2XNA C;  4RF1 A;  4ML8 A;  1N60 C;  5E6J A;  4XE0 A;  5G5H B;  3P42 A;  5I1W A;  1B9R A;  3BVM A;  1CZP A;  3PQB A;  1SIJ A;  4YT0 B;  5AE3 A;  1T6B X;  2SAK A;  5TSS A;  1WWT A;  2Y3R A;  5BMH A;  1Y56 A;  2D5G A;  2KDM A;  1D4B A;  2BS3 B;  2XN9 C;  1TS4 A;  1E0Y A;  3I99 A;  5H92 C;  3R2I A;  4GLS C;  1D5X C;  1JCK B;  1NEN B;  4MH8 A;  2VFR A;  4Q2J A;  5BYS A;  3FC4 A;  1QIL A;  2JQR B;  2LGI A;  4MAC A;  3NVV B;  4DXF A;  1E7P B;  2TSS A;  5G5G A;  1PUT A;  1WSP A;  4TQ1 A;  3FWA A;  1N5X A;  1I19 A;  3FW7 A;  3GS2 A;  4IDI A;  1AHZ A;  2WP9 B;  1T3Q C;  4JE3 B;  4YSX B;  2ACZ B;  2N7J A;  1E9M A;  3HUI A;  2DYO A;  4YTN B;  2INP E;  2J52 A;  1AYF A;  1N60 A;  2K3U A;  4PVK A;  1MBB A;  2VFT A;  3Q8A A;  3AE9 B;  4HKQ A;  1ZP0 B;  3HRD C;  3P4P B;  1JWB D;  1YN5 A;  3FIL A;  2MBR A;  1C4A A;  2GI9 A;  2ICI A;  1WVF A;  4BC9 A;  1GAQ B;  3R07 C;  1PGX A;  4ARI A;  4KKI A;  3BVZ A;  1V1P A;  1OQR A;  4N6E B;  4PWC A;  4PYT A;  3U52 E;  3MP9 A;  1W1O A;  2J53 A;  1MI0 A;  1OFF A;  1FIQ A;  1QOG A;  4NAW B;  4IKG A;  2JSV X;  5HHZ A;  3DED A;  1K50 A;  3NS1 A;  2LUM A;  4YWG G;  3EA6 A;  1ROE A;  2N9K A;  3LYY A;  3SFE B;  2JX5 A;  2RDG A;  4RGT A;  3T3N A;  2PLP A;  3I57 A;  1J7A A;  3DQ0 A;  3B2F A;  1I4R A;  1TKY A;  2WXP A;  1FO4 A;  2E5A A;  2KMM A;  2Y3S A;  1STE A;  3ZGZ A;  2WDQ B;  4MLA A;  3P4Q B;  5D7G A;  3KJM A;  2IJ0 A;  2CU3 A;  1QQR A;  1VR9 A;  3RJA A;  3VR8 B;  1QOA A;  2KAJ A;  3U2S C;  3WCQ A;  1TZO A;  3P4S B;  1L6V A;  5D3D A;  5G5H A;  1T3Q A;  2LHD A;  2RMM A;  2PVO D;  4P16 A;  4DXG A;  2VZK B;  3V05 A;  2Q85 A;  1E8H A;  1JW9 D;  3B9J A;  2IPI A;  1XLN A;  4OAL A;  5H8Y E;  1UUP A;  4ZHP A;  3A7A A;  3J9C A;  1FXA A;  1V8C A;  3IAM 1;  1XCQ L;  4TVW A;  2LEK A;  2NTT A;  2NMQ A;  3ABV B;  1VZ7 A;  2K22 A;  1XXG A;  3AEG B;  1EM7 A;  1ZPS A;  4ZOH B;  4RGO S;  5FR3 A;  2KAC A;  1AHU A;  3NVV A;  2LFI A;  4DQO C;  1TS5 A;  1FMA D;  3TEX A;  4B0E A;  3HVD A;  4H2A A;  4RF0 A;  4RGN A;  3AE3 B;  2L52 A;  2BS2 B;  1E6E B;  5GXG B;  2WS3 B;  5HI1 A;  1EWC A;  5HG2 A;  1WRI A;  4OVZ A;  1HSK A;  1KTK A;  3BYT B;  2E6X A;  3R2T A;  2NQW A;  2PLS A;  3BZD B;  1DYQ A;  2WNM A;  4R3D A;  2J42 A;  2WXF A;  1FNU A;  4OZC A;  4WQM A;  1RFK A;  2FE8 A;  2YEP B;  3AE7 B;  1GB4 A;  4MT5 A;  2L83 A;  1N62 C;  2R2Z A;  1EU4 A;  1QLT A;  1YN4 A;  1SJE D;  3SR6 A;  1EWY C;  1FCL A;  1YMH E;  1N63 C;  4NAM A;  2M56 B;  2P4P A;  3E56 A;  3KWL A;  4PT5 A;  1I4X A;  1ZE3 D;  2KWD A;  4UDU C;  4L23 A;  3NVW B;  1F2R C;  1SJH D;  3TX1 A;  1CQV A;  2EKI A;  4A8X C;  1DII A;  1FM0 D;  2K9X A;  3DWM A;  2V4I B;  2YEP F;  4C80 A;  3S1F A;  1NYR A;  3TUO A;  1TYG B;  4L2Y A;  3NUH B;  4BC7 A;  1QLU A;  2WXI A;  1MHH E;  1UWM A;  4HJG E;  2IGD A;  4KX6 B;  1L0X B;  4ZRQ A;  1DIQ A;  2QKN A;  2BBC A;  5T8I A;  1XLP A;  2L1A A;  2PIA A;  2OHF A;  1C4P A;  1HEZ E;  1ZXI C;  3BK1 A;  4RGM A;  1A70 A;  3VR9 B;  2W55 A;  1XLO A;  3LB8 C;  1N5W C;  3AB5 A;  1J7B A;  1ZOY B;  1RWS A;  4TVY A;  3S1E A;  2LJI A;  3W8Z A;  3NVY B;  4LLG M;  5L6G A;  1K51 A;  1F0X A;  1QLB B;  1VJK A;  1N62 A;  4ZRP A;  3POP A;  1KLU D;  3TEY A;  3BWU D;  4O1N A;  1RYJ A;  2BVF A;  3A7U A;  2VAO A;  2DWQ A;  1N63 A;  4C7Z A;  2QIL A;  2PKO A;  4YSZ B;  2H88 B;  4ZYS A;  5EE9 A;  1I4G A;  1VZ8 A;  2UUU A;  4XDC A;  2Y5P A;  3HSU A;  1ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...