1JROA

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords xanthine dehydrogenase, chain A
total genus 129
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jroA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jroA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1jroA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jroA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jroA04
3FWAA 1N5WC 3S1EA 3DQ0A 5G5HB 3SFEB 5AUIA 4MLAA 1VQZA 1ZUD2 3HRDC 2QJLA 1DOYA 3AV8A 3EUB3 3NVZA 1E8FA 3D2JA 1SB3C 2W54A 5EE1A 2W55A 4JAYA 2WU2B 2BVGA 3RPFC 1DOIA 4N58A 3LLBA 1KF6B 3VTEA 3P63A 1E10A 3A7RA 1XO3A 1QOBA 1TKYA 3C0PA 1DOXA 1FIQA 3PM9A 4KX6B 3D2HA 2H89B 1AHVA 4USAA 3P4RB 3LB8C 3P4SB 2QPMA 3FW7A 3KJMA 2GQUA 5HQXA 3AE1B 3AEGB 2EXRA 2P13A 4HROA 1MBTA 3NS1A 2VFUA 5D79A 3AE9B 5EE3A 3ZYYX 2WDVB 1L5PA 3AE4B 2MBRA 4EC3A 1N60C 2ACZB 4O95A 3A7UA 1XLOA 2NQWA 3AEFB 2L83A 2WQYB 1QF6A 1SIJA 3FAHA 2Q5WD 5G5GB 1QOGA 2PIAA 1E8HA 2K5PA 2DWQA 2QKNA 5H92C 5GXGB 4IDIA 1V8CA 5FXEA 1ZOYB 2MJEA 1MBBA 2CJNA 1JALA 4ML8A 3AE2B 4C7ZA 2VFTA 5MPOA 5AUKA 2MJ3A 3AE3B 2RK5A 3CWIA 3AEBB 3P1MA 2OAIA 3HVZA 1I7HA 2G1EA 3DEDA 1OFFA 3ABVB 1WWTA 3NVYB 1QOAA 1VJKA 3AEAB 2VFSA 1TJEA 2WLBA 4YTNB 1W1OA 1DZNA 1W1LA 1DGJA 1XLPA 1ZR6A 4YSZB 3W8XA 2PLSA 3JS8A 1RM6C 1RYJA 4BC7A 1VAOA 3KWLA 1E8GA 3S1DA 3S1CA 2MJDA 3FW8A 1WYGA 3VR8B 2LEKA 1UWMA 5HHZA 1WVEA 2BS3B 1NVID 1XLQA 1AHUA 3SR6A 1FFUA 1N5WA 3W9CB 3AE7B 2CJOA 1X2HA 1VLBA 1XLNA 4OALA 5HMRA 5FXFA 1DIQA 5EE0A 1HSKA 3ETRA 1W1JA 3ETRB 1J7CA 4YTMB 3NVVA 1ZXIA 5FXPA 1N63C 3FW9A 1W1QA 3R07C 1UXYA 1NI3A 5H8YE 1YQ4B 3TSJA 4A9AA 1T3QC 2VAOA 1QT9A 3GSYA 1F0XA 1F0ZA 2AX5A 5EE9A 3B9JA 2WDQB 5FXDA 1X2GA 4C7YA 2M19A 2BVFA 1NYQA 3AEEB 3W5UB 1TYGB 3AM9A 1YQ3B 2HTME 1NYRA 1L6VA 1J7BA 3LAEA 4HG0A 4TVYA 4PWCA 2VFRA 4XLOA 3TX1A 1IUEA 1QLBB 2QIEB 3VR9B 3BIID 2R2ZA 1FFVA 1I19A 3P4QB 3AH7A 4TVWA 1NEKB 2AXRA 1DIIA 1TKGA 1FIQB 1N61C 3W5VB 4YSYB 2VFVA 2CU3A 2E3TA 2KAJA 5G5HA 1FFVC 3SFDB 2EKIA 4WWMA 3B2FA 4N59A 3W8ZA 1RM6B 1B9RA 1JRPA 2WS3B 1GPXA 2YVSA 4ZOHC 5AE3A 3NVZB 1J7AA 3B2GA 1ROEA 3HRDD 1YJIA 1E0YA 2M56B 1JWBD 4HRSA 3TSHA 1JROA 3DWMA 1T3QA 1E6EB 4P6VF 1A70A 1JQ4A 2KMMA 1NENB 1V97A 1N62C 3AN1A 3AE5B 4JX1C 1TKEA 4US8A 4YT0B 1EWYC 1N60A 1RWSA 1N62A 4US9A 3NRZB 1E9MA 4ZHPA 3SR6B 5AE1A 3NS1B 4UD8A 1ZXIC 3VRAB 4JWSC 5C3JB 4PVKA 1W1KA 2R8DA 2L52A 3EUB2 3NVVB 3PO0A 1W1SA 3I99A 2P3HA 2O3GA 4JWUC 1FFUC 3HUIA 2DBYA 1FO4A 4PZFA 1FMAD 1CZPA 1PUTA 4PWBA 2H88B 1YJJA 2PVOD 3CIRB 1W1RA 1SB3B 4PVEA 2PKOA 4YTPB 2BS4B 2MH7A 1OQQA 4PYTA 2W3SA 2OHFA 3AB5A 3NVYA 1WGKA 2E5AA 3AMZA 3AE8B 1AWDA 1PDXA 4ZHOA 4YXDB 2WU5B 2Y5CA 5C2TB 3VRBB 1L6UA 1N61A 3A7AA 1FRRA 1E0ZA 2JX5A 3P4PB 1JWAD 1WRIA 2N0SB 2Q4WA 4LTUA 1FM0D 1AHZA 2BVHA 2Q85A 2WP9B 2PLIA 2BT6A 3WCQA 2GQTA 1WVFA 3D2DA 3FC4A 1PFDA 1KFYB 4DNSA 4ITKA 4PVHA 1OQRA 2W3RA 1QOFA 1SF0A 3LXFA 2JQRB 3L4PA 3AEDB 4YSXB 1FXIA 3W8WA 2I0KA 3AECB 4ZOHB 1JW9D 1CJEA 3NRZA 4N6EB 1AYFA 2BS2B 4BCAA 4PVJA 5ADZA 1W1MA 2WDRB 2K22A 1QLUA 1E7PB 4BC9A 1QLTA 3B9JB 2FBWB 3NVWB 1ZP0B 4JB1A 1GAQB 4WQMA 2B76B 2P4PA 1N63A 1R7SA 1WXQA 4C80A 3AE6B 3BW7A 5G5GA 5AE2A 4FXCA 1L0VB 4BBYA 1FRDA 1N5XA 3DWGC 2K9XA 1KRHA 2PVGC 3S1FA 1FXAA 1VDVA 3NVWA 1RFKA
chains in the Genus database with same CATH superfamily
2JF5A 5LLIA 5DPSA 2ZCBA 4I2CA 3WKEA 1U4BA 4NZLB 2C9WB 1JDFA 3DIPA 4HWIB 4S0RA 4IL2A 2LKYA 2MP2A 3EWAA 1UF0A 9ICKA 2HBLA 4IC9A 1U45A 2WX1A 3U4EG 3RH4A 3Q69A 4MKSA 2ONQA 4XX5A 3RYTA 4MLAA 1WUEA 3UJRA 1NPXA 4LNKA 2CXYA 5KT7A 1ZUD2 2VZKB 3KKAC 3BINA 3EUB3 3S6JA 2Y9TA 2K1FA 1E8FA 2FKPA 2P88A 2XBBC 4XQ8A 8ICCA 2HNEA 4ED3A 1SL0A 3RJ8A 5KFLA 4Z6CA 3BY4B 4GDLB 3C1YA 1ISNA 4HCLA 1ESFA 4B9VA 3TOYA 5J0WA 4UB5A 4WJ3B 3PWIA 4GDKB 2QARA 4YN4A 2DZIA 3TI0A 2WU2B 3JYUA 3RJHA 2BVGA 4QZCA 2PTXA 1JEHA 2QAEA 5J0YA 2BYTA 2WXFA 4W9DA 1WUDA 3DFHA 5IP4D 3UCDA 3RAQA 5DB8A 2J42A 5DPRA 4ASWC 1QOBA 2JZZA 2IGHA 2OZ8A 3CW2C 2OVLA 4EZ9A 3OPSA 4M04A 4ZRKA 1LB2B 1FIQA 1DOXA 3DBHI 3HW2A 1YN3A 3QX7A 3FG2P 2MHJA 4KN7A 4KLOA 4MGKE 5BMHA 3D2HA 3UPQA 4OJPA 2ZIUA 4J9MA 1AHVA 3C5FA 2XEWA 3DQVA 3B0XA 4ECQA 3HT3A 1NK6A 1P0RA 4IWPA 3A1QA 2DYOA 3LB8C 1FCCC 4YXMA 3ZI4A 5J2JA 2C3DA 2ZC8A 3QZ7A 1PK1A 1NZBA 1D8LA 2HOFA 2NPTA 2BDPA 3NUQA 2GGJA 2R8KA 3UQ2A 3IAM1 4FADA 2F8LA 4HPPA 5FK9C 2W11A 2HI0A 3UGBB 1T3NA 2P13A 1MBTA 2KSOA 4E6MA 3QU5A 3ZLZA 4DFKA 2WAQC 3J81j 2M9NA 1MPEA 5AHXA 5D79A 2KO3A 3AE9B 3TEYA 1SGHA 3V6CB 2MBBB 1YX6B 2AHOB 1HEKA 3CT2A 3KHLA 1WGHA 1EC7A 5AKKA 3UINB 2GWSA 3PO4A 2OO6A 2K8BA 4RPZA 3DPDA 2ACZB 3SJNA 2EZYA 4DHZE 2FMSA 4UAUA 4WQOB 1SJHD 2YVFA 3N6HA 3FYHA 9ICWA 2NQWA 3P3BA 2HBJA 2HXUA 3FKYA 5J2EA 2K25A 2F2AB 2NO5A 2X38A 2EQ9A 3UQBA 4GIBA 2GBNA 3FAHA 1GETA 1WIAA 2EDUA 1S5LU 3PX4A 4EEYA 3TFRA 3WA0A 3RO6A 2GLSA 2DZKA 4IW0A 3QUTA 5AKEA 3QNMA 1RLFA 3RR8A 3SQSA 3M7DA 5CEHA 4X5VA 2LWPA 2NYVA 2YX8A 5HKHA 2KKVA 1GJZA 3N97B 5J2KA 4P1BC 1XANA 1Z00A 2HHWA 5H92C 2BGFA 1ZMDA 1ZD2P 1E5WA 3FV9A 1TK8A 1QQ7A 1DK2A 3Q6BA 2YQUA 1NNLA 4REZA 5IIOA 1MG4A 4E71A 3MSYA 2IHNA 2Y4GA 1K1QA 1MBBA 5FS9A 1YZ6A 3KZIU 2CJNA 4ADWA 4KITB 3LB8A 4OHJA 5F3XB 1SJBA 3DFYA 5MPOA 2Z7JA 1GNUA 2WF5A 4O3QA 2HVIA 3VA8A 2J4XA 3CGEA 3M3JA 1SXEA 4HK2A 1KW4A 4J9PA 3QXGA 1SBBB 2QJNA 2WPEA 2C7MB 3OPXA 4ZDVA 3RCYA 9ICLA 4UAVA 3GRSA 4I28A 4KSLC 3CGBA 1CRXA 3HVZA 2OG9A 2O6VB 3KOOA 5AI6A 4RGTA 2ZADA 1OGWA 2MRLA 1OFFA 4FHJA 2I5HA 2WXHA 1C7YA 9ICCA 5HP4A 3HX0A 1QZEA 3VUWA 2N7EA 5CTRC 3Q8PB 1SJED 3PZ8A 2WXLA 1O03A 3ZO5B 2Z8LA 3WKBA 3HP6A 4NY0A 2KHVA 3M6KA 4YTNB 4J9NA 1WGYA 3IAS1 1DZNA 1SEBD 3U2SC 1W1LA 2OFJA 3TWAA 2PLPA 5AM0A 1TK0A 1DGJA 2NCNA 4ACFA 2VJ5A 2WPCA 3QKEA 4NLNA 1QQ5A 4IRDA 2KFZA 2O56A 5L83A 2I1JA 3IG8A 9ICJA 1ZQFA 4TKNA 5KG0A 4BUGA 2YEPB 1ET6A 4Q2JA 1BKHA 3Q8MA 1MQ3A 7ICEA 3KWLA 5KG3A 3Q8QB 1RXVA 2MBOA 3S1CA 4UB6U 4B9MA 2E8NA 4FZNA 4A3RA 3NOBA 1JCTA 3VR8B 3WK4A 4YD1A 4AYBC 1X40A 2BW2A 1MNSA 1B43A 1X9SA 1N56A 9ICMA 3FILB 8ICJA 1UWMA 4CHKA 7ICOA 4NLCA 3WKAA 5HHZA 5DPTA 2LGDA 1K8RB 2KFNA 1F52A 5ALJA 4M01A 2CPRA 3ZTDA 5J29A 5GTHU 2HHXA 4JN7A 5AKIA 4EZKA 2WF6A 4GFJA 2DHZA 2KXJA 4QIWC 2LXAA 2XIDA 4FBTA 5J17A 3VC6A 2EMTA 4AP9A 1N5WA 4H4UA 3N4MB 1S1QB 3RD2A 5I4DA 3H8SA 4PL1A 5AKLA 3QK0A 5L1IA 3PW2A 1WM2A 1CMXB 1NHSA 5CRXA 2DENB 2LYBA 3TBLD 1XHCA 1DIQA 2XICA 5EE0A 2OCEA 4QW9A 4PK1A 2F1IA 4JIOU 4F4RA 3PX0A 4ANVA 3ETRB 2NBWB 4MM3A 1N6ZA 1M6IA 1BPBA 1XDIA 2JEIA 4W9EA 4KLJA 2YVJA 3UXNA 4RQ7A 5AWVA 1VD2A 4NLKA 2YTUA 9ICEA 3LVVA 4XE0A 1W1QA 5J0SA 3R07C 2QB0B 1NI3A 4J56A 2ZJDA 3RCZA 3MDCA 1JOAA 1WE6A 4IZGA 3U7DA 3WIMA 3FYYA 3BYTB 2FIDA 4W9IA 4D2KA 4J9QA 2KQSA 4IUMB 2VAOA 1Z4NA 2JXJA 4RT2A 4FULA 3OG5A 5J8YC 2EQ7A 3T8MA 5AK4A 8ICFA 4I2BA 5AI8A 4LVSA 4J3OD 4I2DA 1LGRA 2LGIA 2N9XA 1X2GA 4KTQA 3AEEB 1F9JA 3QFAA 3ZLGA 5DCNA 3N1YC 2LFIA 1JIHA 4MFFA 1QKZA 2HHSA 1K5OA 2E5SA 3BWUD 1NYRA 1I42A 4HJGE 3ZJVA 4H4ZA 1LKYA 3PZDA 2FI1A 4X2PA 4ENLA 1RQNA 1UWXA 3OJSA 2BPFA 2QIEB 2RPVA 3RNAC 4O3NA 2DYBA 1ZQVA 2R61A 2NPXA 2WNMA 5ALOA 2ZTCA 3AEVA 4NNJB 4P2HA 2MSED 5D3IB 1L2NA 2GH1A 2K8AA 5AK3A 1D8YA 8ICTA 4ICUA 4M8NA 1RYUA 4DL7A 4GYPC 4ZA0A 5DG7A 5J2DA 1QSYA 5KG5A 2ONEA 5AKZA 4Q43A 4P4MA 2N1WA 4KEMA 1Q46A 4DCCA 4RGMA 1COOA 4ANUA 5AI9A 3DBLI 3KHRA 3RN9C 3UIOB 4MFAA 2PTLA 1FIQB 1ZQKA 4OVVA 3PO5A 1AOGA 2G9HD 3W5VB 3IVFA 3FJ4A 4YSYB 3BZCA 2WPFA 1T0SC 2ZZCA 5C5JA 3D32A 2VFVA 3JVAA 4A3OA 3N28A 1RRBA 2KVZA 2BQRA 1ZD4A 2CU3A 2GBKA 4KLGA 4EX7A 5IIKA 2B3AA 5KTQA 1NKCA 4K4IA 2MSNA 5F9LA 5DLGA 9ICQA 2IPKD 4Y2YA 4GR1A 3RITA 3RRHA 4DDGD 1UELA 2WXGA 5FJOA 1YZ7A 3EPGA 1SV4A 1SWVA 2GGEA 4FDCB 5KFDA 3VH3B 3C29A 4WJQA 3P93A 1K4QA 3W8ZA 2Y0SC 3ZVHA 1GPXA 2KC1A 1K50A 3P0WA 1Z00B 3N3KB 3NVZB 4RM9A 4ED7A 2XK5B 4C4SA 5G55A 3I6EA 1A77A 3HRDD 7ICTA 1ZETA 1G6JA 3CYJA 2REXA 2M56B 1HA5A 3MJ5A 1E0YA 3KHHA 1T94A 1FNUA 4TQ1A 3RNEC 5JH5C 1SKSA 4LZGA 2NRWA 4L1BA 5BOMA 1LO5D 1JQ4A 3K75D 2KMMA 5BYRA 4II2B 4B0MA 9ICUA 4BXOB 2IHMA 3MGVA 5KFBA 4KLEA 1NENB 1KFSA 1A6SA 7ICNA 1L7YA 1N62C 2UVWA 2JR5A 1WFYA 3OSNA 2KTFA 4ECSA 2MUTA 2IOFA 1KKOA 4M52A 3UXOA 5KFGA 3PREA 3PRZA 4JX1C 4AYBF 3ZRCA 4DWDA 4HCHA 4RQ6A 1WE7A 2K8CB 2NVUI 4TURA 2KOXA 4C4TA 4EWJA 1E8WA 3SR6B 5AE1A 4AQ7A 4QZ9A 1KKRA 4H4WA 4IOIE 1ZXIC 3V3XA 3ZUNA 1KFTA 5C3JB 1TS3A 3I57A 4MH0E 3VAWA 4F4XA 2FDRA 2WHEA 2HOIA 2ASDA 2PFOA 1GRGA 5DBBA 3ZNZB 1ZY8A 3A0BU 4P0QA 4UW9A 5AK5A 3PO0A 1W1SA 2WF7A 1ZPSA 3I99A 4Y2UA 4JWUC 5AM1A 5AK6A 1FFUC 1NDDA 3PW0A 3QA8A 2DBYA 2F1JA 9ICXA 2HBKA 1CZPA 1SXTA 2BTEA 4WWPA 4LZDA 2RQ5A 2KKCA 4GRTA 2JEFA 2MU2A 1ZQEA 5U25A 5C0YA 3HW8A 2KD0A 2BZFA 4PYZA 5KFVA 2HSZA 1XCQL 4NJ8A 1NK5A 8ICUA 2R18A 1TIFA 4O5CA 1GRAA 2QDDA 5DGBA 4DFJA 2JZ3B 4FX9A 1F5SA 2C5LC 4PHPA 1KTKA 1S3SG 2RDIA 2W3SA 1R4MI 2ZVNA 4A90A 4ARCA 1TYPA 4W9GA 2KV2A 3QARA 2OZ3A 3PTFC 4EQXA 2D8CA 1JMLA 3AQFA 1ZE3D 3D2NA 3K9PB 4UQGA 3ECIA 4R8UB 3DV9A 3M95A 4PT5A 4DXAB 1EM7A 2E5AA 4J9SA 3T5HA 1IYXA 3RFAA 2MQJA 4LDTD 3QFBA 4ZHOA 1WR6E 4IWOA 4YXDB 2WU5B 1GV4A 2Y5CA 4AJWA 1ZQHA 3N1ZC 2MEKA 1MVKA 3VRBB 3QLDA 2W03A 4DS4A 3L08A 5DB6A 1TS4A 2N0SB 5IINA 1TTNA 4CE6A 5KFXA 1ZQDA 3PK7A 2INPE 4KLFA 4K7ZA 2HE7A 3UF8A 2EANA 1JWUD 3IP4B 4TUQA 1E9IA 3WCQA 2GQTA 5IAAC 1J0GA 3LDAA 3R66C 3MR6A 4KIKB 1GXFA 3RBEA 4I2HA 1KFYB 3HM6X 5AZGA 8ICRA 1NBFC 3BQ7A 3DERA 1IIPA 1LVHA 1WWUA 5AZHA 2L3ZA 4QAYA 2DYMA 4JHMA 4EBEA 3EJBB 4URKA 5JHAA 3RH6A 2ZIVA 1B0XA 2W3RA 5GTIU 2R8HA 1OQRA 3LXFA 1T6BX 2J3NA 2CR5A 3L4PA 4YSXB 1VZ8A 2AU0A 4C00A 2I0KA 2BYFA 4J03A 3S5SA 2INDC 2ASJA 1EBHA 2V4QA 3BQ1A 3SEBA 4FP1A 1Z19A 2KACA 3SHQA 2CFYA 2GGHA 1SE4A 2JWZA 2XGZA 3NG0A 4WIPA 2KJ6A 5KVHA 3LVWA 1PK3A 4DQOC 4BCAA 2BS2B 4FJYA 2AQ0A 5JZEB 5ADZA 1I4GA 3PX6A 2ZIXB 4XWTA 1ZQMA 1V9PA 2KZRA 4UB2A 5AKYA 2F44A 4A55A 1C9FA 5KG7A 1F2RC 2UUUA 1EXNA 3DDCB 2WOVA 1YMHE 5DQIA 1U47A 2KMDA 1ZKQA 2FBWB 2PA6A 2V6OA 1BZLA 2GGGA 3RRAA 1QQRA 4M0XA 4JB1A 3DHHC 2FAZA 4QNLA 3GS2A 1SKRA 3JW0X 1GAQB 2IGDA 2D6FC 2B76B 4C80A 1BT0A 2WXMA 4J9KA 3ZDMC 3BQTA 4KZ0A 4F50A 2PP1A 5CHVC 1L0VB 3ZNGC 2ASQA 4LJXA 4IR1A 2Z0DB 3RH5A 3AQEA 2FLNA 3BQ2A 3KVFB 2QILA 2P0IA 1FXAA 2H3IA 2H3ZA 7ICUA 1P3QU 2ESEA 4TUUA 4FZMA 1V2YA 2O2VB 4DL2A 4WWOA 2BQ3A 4DSIA 4IM2A 1KFDA 3WKCA 1I4XA 1MJDA 1T0RC 2BHNA 3CNHA 2GB1A 4A20A 1J2MA 1B4FA 2MBEA 5A0LA 3WK6A 3V05A 5G5HB 2KHQA 2Z59B 2CU1A 4R3DA 2V3PA 2CHXA 4G3XB 5I1WA 3TADA 4RQNA 1MRAA 5BMGA 3Q8RB 2RABA 4GU2A 3II4A 2JXTA 3RR1A 1VQZA 4YCXA 2N9EB 4JK1A 1WJ6A 3W2DA 1L7MA 2BPSA 1F3PA 3NVZA 1FEBA 1WUFA 1SB3C 4WH4A 4Q44A 3IXSA 3H0LB 4LNOA 3IC9A 2W7OA 2W54A 4QZEA 1ZXHA 4FBJB 4KSKC 3Q3FA 2PMVA 1UPHA 1ZQ1C 4NLZA 4NM2A 1TS2A 3DHIC 2Q4TA 3QWZB 1ZD3A 4F5NA 1ZQBA 2VA3A 3R0KA 2BCVA 4M0AA 4N58A 2PEAA 2ISPA 1TYTA 4M8MA 3CGCA 4F5PA 4YR3A 1UA1A 4F4KA 3LLBA 2RGFA 2WX0A 1WX7A 3H8AA 4MEXA 2X8XX 2BDUA 2KQ7A 3VH4B 5CHGA 1XO3A 2RDHA 4UATA 1A0PA 3LYSA 1V86A 1WX8A 1OQYA 3PSIA 8ICWA 3MUCA 5FS7A 2ZJ8A 2JVCA 1P43A 4O0IA 4DHGA 4KX6B 3UMGA 3MGHA 1Q1OA 4RF1A 4F8CB 7ICPA 2H89B 4GC6A 4EENA 2OM6A 5B66U 4K4HA 1FPYA 1YEYA 1BWCA 1L8OA 3PVXA 4TUPA 5KFZA 3GV5B 5DQGA 4EBCA 4USAA 4DQQA 4B9LA 3RB3A 2LVOA 1X66A 1S8OA 1FHUA 3QPEA 1X42A 2PMZC 1ZQRA 4FN2A 4EX6A 2AKMA 1ZK7A 5ALPA 4Y2QA 5KFFA 2Q0ZX 4NAWA 4I29A 4DL5A 4P0QB 4ZRPA 3R7RA 1I4QA 2DKXA 3BZKA 5U1OA 2KJ8A 3V7KA 2DGZA 4FS2A 2BCUA 1F44A 1D5ZC 2KC2A 3HVDA 2LJ5A 4M9GA 5ALWA 4B6WA 2K89A 4EEWA 3D2QA 3EA6A 4YMMA 3MR5A 1P7DA 3NZ3A 2KX3A 1PGBA 5CWRA 3DVNU 2M0NA 3PSTA 2DZJA 8ICHA 1JPDX 2J0MA 4ED8A 3QEAZ 4E8GA 5HMMA 5J8YA 2W7PA 2LPEA 3EEZA 2ES6A 8ICLA 2KOBA 4F71A 1XLOA 3KQ4A 5ALZA 3GV7B 1ZQOA 3OTRA 2A19A 2L83A 2WQYB 1QF6A 2BPCA 1GREA 3E56A 4BWJA 1BUIC 1M4VA 2AYOB 3TJIA 3ICXA 1YNTE 3PZPA 2Q5WD 2JH1A 2AGPA 1MDLA 2KSOB 2WWZA 1JMSA 4C4VB 5KG2A 2G45B 2ZIWB 1KTQA 3BS5A 3LK9A 3ZJUA 1RZTA 4F2SA 4A3PA 1ET9A 4LDTB 5KFQA 1E8HA 2K5PA 1Z2MA 1PK1B 1P98A 3TACB 3PWGA 2J6SA 3W1SC 3RJJA 1WSPA 2N9KA 3A1QB 9ICRA 4IDIA 1XSPA 2GBMA 1NZPA 3H8JA 3PGEA 2OJRA 4IQUA 3IG5A 5CJ7A 2MJEA 1KQQA 5ALIA 1GUAB 5FXEA 3L5OA 1JALA 4ML8A 4DF8A 1NKEA 1ZX9A 4Q45A 1ZQLA 2P6UA 1QTMA 2KZZA 2O6VD 2VFTA 4PGQA 4BV6A 7ICMA 4O1NA 3R2TA 2RDJA 3TIXA 1XF5L 2MJ3A 2M8SA 3JVZX 2D3CA 9ICPA 2RK5A 2I2YA 3CWIA 3QU2A 1EWCA 7ICHA 4NAWB 2OAIA 2GR3A 3JPQA 1T8EA 2UWQA 2VRRB 1V5TA 3QE9Y 5JRBA 4NWIA 4RFBA 5JCMA 3H7VA 3Q3NC 2KVSA 1KN0A 2ZCCA 4KV2A 5L1LA 2AWTA 2PU1A 1QOAA 3AEAB 4MSQB 3VTWA 1S77D 3GZFA 5KFMA 3ONNA 2AGOA 3CAWA 1V38A 1YX5B 3IN5A 3TUOA 1WXVA 3ZDTA 2R8IA 4KPRA 4CF4A 2P3ZA 1CK1A 1ZR6A 3ZDAA 2FJ6A 1A5RA 2I5QA 3ALRA 3RBDA 1WF9A 3AULA 5ALTA 4JMUA 3H6NA 4Z1YA 2MAXA 3Q8KA 1WYWB 2NBVB 2PLSA 2PKEA 2A3VA 3VCCA 3ZTCA 2BBCA 3MTNB 3UMCA 1EF5A 2KFKA 1COKA 3IBEA 4MF2A 1VZ6A 3NFUA 3M1YA 4RT3A 5KFPA 5KFSA 1OTRB 2XVTA 2DF4B 3U7ZA 4BVUC 3Q6JA 2KDEB 2V4LA 3SD5A 4M9JA 1H8CA 1WVEA 2D3BA 1S76D 2YMMA 2BWES 3AUOA 2EQ8A 1AHUA 3IJIA 2F3NA 2I6XA 5D3DA 3PQBA 1TY0A 1XLNA 1ZQAA 2KKPA 3DGZA 2HVHA 1HQRD 4ECTA 1KJTA 3SN4A 4EQSA 4TQSA 4NEVA 3E58A 4U7CA 4PZOA 1BPEA 1VR9A 2UVVA 2JGAA 4DXGA 2KLGA 1ZW7A 5B5EU 4ROPA 1U49A 4KN4A 5D4BA 3Q8EA 4TUSA 4YTMB 3NVVA 4F8RA 2HHTA 1X9MA 2JWUA 2GGIA 5FXPA 2L00B 2DPJA 5JCNA 2VA8A 7ICFA 1EU3A 3DH9A 5D6JB 2K4PA 5IIMA 4O3SA 1UNSA 4RQ5A 4PGXA 5JUMA 4YWSA 5KFAA 5AM4A 1EF1A 1VJ5A 2FCSA 4HNLA 3A9KA 1QT9A 4EOYA 4U6PA 2AL3A 2PFQA 1F0XA 1OEPA 3I5JC 2C2RA 1XT9B 3TCAA 2D10A 5ALDA 3NRWA 3PT2B 2WDWA 5ALYA 2QLTA 3UJSA 3PLUA 2IMWP 3NZGA 4H4XA 4HCNB 4M2YA 4PS3A 2A5UA 2B21A 2NRZA 2M19A 2BVFA 3IK4A 5KFYA 1NYQA 3GIJA 3ZDBA 5E6OA 4O5KA 1BPZA 3W5UB 2K60A 2FCQA 2VH2A 5AICA 1D6EC 3R0UA 4NL9A 1SL1A 3BZDB 3NUHB 2EZZA 4WJPA 1C76A 2IPIA 1NK4A 7ICIA 1KM7A 2HMXA 2FCMA 4BDPA 4M6WB 3Q8FA 3B97A 4DLEA 1L6VA 3KUMA 4DX3A 3V4BA 1E8XA 1MDRA 1KLVA 5E6JA 2VFRA 5ALLA 1UBIA 3T4WA 1ENFA 3CK5A 3TX1A 1QLBB 1IXRA 4OO1J 2FPMA 5AM2A 1QCKA 2JMGA 3BYYB 1Q3UA 4J1OA 5AKXA 2E8OA 4OJ6A 3EGRA 4TV3A 3VR9B 4W9KA 3ZNID 1FFVA 3ZW3A 2AL2A 4ELVA 3ONSA 2BWFA 3QUQA 4DL6A 1SL2A 2EZXA 3QU4A 2XY6A 2J53A 3PR4A 4KLIA 3TJ4A 2L1AA 1MSWD 2ZNVC 1DIIA 3L10B 4X57B 2AXTU 4OCZA 8ICYA 3WK7A 4M0WA 1H2IA 4I2GA 2KJHB 5DG9A 4BZAA 4NQKE 5EWGA 1DK3A 4XYCA 2KP7A 2Y3RA 4QWEA 7ICSA 2WXKA 3KWVA 1WJ4A 4IHCA 1EBGA 3VDZA 2RLTA 4H1ZA 2R8JA 1WGDA 1XCTL 2C7HA 2KAJA 4I6PA 3QN3A 2F77X 1FFVC 4C8MA 4FI4A 5AKJA 4QZDA 1P9DU 4DFMA 2EKIA 3EW9A 4PH5A 4H4VA 4R8UA 1KH0A 4WWMA 4N59A 2D11A 1D3ZA 1OEYJ 2O6VA 2WS3B 2YVSA 1K52A 2IOFK 2AL1A 4ED1A 4EMIA 3PZ7A 2V9WA 1ZDLA 3SYZA 3B2GA 2ZZPB 2DAJA 1VRAB 2K6DB 3W1SA 4FO6A 2PFNA 1YJIA 4J57A 2JH7A 5FJTA 2FYMA 2INCC 4OD0A 3TSHA 2KD1A 5ALUA 4M6WA 4NPNA 2LRUA 2V3BA 1MG8A 4FJZA 2EAPA 5DDYA 4DLGA 4KGSA 2MP2B 4NV0A 4XUSA 2CHZA 4RZRA 1E6EB 3QIJA 4PHAA 5IA7A 5D49A 4P16A 5KG4A 2BC1A 1Q8KA 4G0NB 5JU5A 4DOCA 2DNFA 3SV3A 2CN1A 2P35A 3B0YA 7ICVA 3T79A 1IGCA 2KTRB 2MWSB 3AE5B 2YVGA 1ACCA 4YT0B 2AH5A 2ZIXA 4UAZA 1R4NI 3QHTA 3RB0A 2K3UA 3AU4A 2E1EA 3C8YA 4C4VA 3CSFA 2IA6A 3NRZB 2J7QB 3NS1B 3VUYA 4IT1A 3VRAB 4C8LA 3Q8LA 3M9MB 1JUDA 2EAMA 1Q3VA 2ZTEA 2J0JA 2ZPYA 4HYKA 3MY9A 4MGZE 3MP9A 5AEKB 1X1MA 1FEZA 3MR2A 5IN7A 4F5OA 2MUTB 2JZPA 1BVSA 2EH9A 3KLSX 3NY5A 3O0FA 4YWOA 1LPFA 2KTRA 4CRXA 1SV0C 2YEPF 4HDQA 4B9UA 5L1MA 1SJAA 4IR9A 3IT6B 2IO1B 4PZFA 4DFDA 3D2SA 1PVQA 2X8GA 4E0DA 1PUTA 4AJYB 3BSMA 4RNOA 4QZBA 1UT8A 3Q8CA 3QCAA 2H88B 1YJJA 2XH4A 1CUKA 4ICAA 4DQIA 2BQQA 3Q14C 1F9CA 1RVKA 1RQLA 5KVIA 2G09A 5H2FU 3H12A 3CIRB 2N7DA 4XZ4A 4PS7A 1W1RA 4O3PA 4PVEA 3JW7A 4Z17A 1RG6A 2IY1B 2FIFA 1K51A 1FXTB 3GC2A 2QC8A 4GB9A 1I4HA 2CDUA 2C22A 2V1YA 1BMLC 2WXOA 3B1LX 5DB7A 3A9JA 3SU8X 3B08A 2IBIB 3GD3A 3RF9A 2D3GA 2V3NA 4E4FA 3H7PB 2V9HA 1WGKA 4QZ8A 5TR5A 4B9KA 1STEA 2J52A 3AMZA 3VXWA 2PSNA 4UB8U 4K7WA 3DBRB 1AWDA 1TBEA 2P66A 2KFKB 3L17A 3IFWB 4DWFA 2KDBA 3QUBA 2NVKX 2XN9C 4DEZA 2X50A 1PVRA 2PGWA 4JN8A 2A1JA 4ICVA 3KFUF 1Y8RC 4P4OA 5KFEA 2AEHA 1NK0A 4HXDA 4WAFA 1MOKA 3MZNA 4GIVA 4FLHA 3G6VA 1FM0D 1UGJA 2DAFA 2BVHA 3GRTA 4W9LA 5J2BA 9ICNA 4AOFA 3H8HA 3R1ZA 1V49A 2JSVX 2M1MA 5T8IA 2BT6A 3ENEA 2K4EA 3HHMA 4P7IA 1P48A 1WVFA 3D2DA 3FC4A 2KIWA 1ZQQA 3ISBA 5FMHA 4ANXA 4R63A 3SAGA 9ICTA 1LVLA 3P42A 4DNSA 1ZQNA 4ITKA 1ZGUB 2UYZB 4RQ3A 4K1WA 2LMCA 2J0KA 3ZKJC 4HYRA 4O5EA 1LM8B 1R6WA 3Q45A 1QILA 2F8KA 3GE8C 3FXGA 4Y2SA 3BQ0A 1GRHA 1IBXB 1GRTA 2JQRB 2OJWA 3C2LA 2BVCA 4HVBA 1FXIA 2ZIWA 2JUOA 4HPMB 4EFOA 1X9XA 3TQ1A 2FE9A 4NJ6A 2KIVA 4ECUA 1LKYB 2DW7A 1O08A 1JW9D 4LJPB 2F1HA 8ICPA 1YQBA 5T14A 4K1RB 3NRZA 9ICHA 1AYFA 4KKIA 4N6EB 2DL0A 3IT4B 9ICOA 1NELA 1TGZB 2W04A 2FUHB 4WAAA 2G06A 2LGXA 2K22A 5E6PA 2QDEA 4MFCA 1V81A 4JQWC 1CEZA 4QZFA 2Y3SA 3RI7C 1QLTA 5L1JA 1E8ZA 2KG5A 2PODA 3NVWB 4CNQA 4FFDA 3OJ3A 3FDSA 1I4PA 1PDYA 1X2IA 3DOWA 3BS5B 1BNPA 4IKGA 3SZ2A 5ER0A 5GRTA 3HSUA 4WURA 4WQMA 4NEWA 2OQHA 1AN8A 4HKQA 4K81A 5ALSA 1S9FA 1RYSA 3TJPA 3ZIMA 1IYFA 3BW7A 5AE2A 4FXCA 2LGYA 4KLQA 4BBYA 3PVLA 4DSKA 3K9OB 4DK5A 5LNK1 3GV8B 1NJYA 2FMPA 2LI5A 3HILA 2PVGC 2DFLA 2G0AA 1VDVA 5CHFA 2LM4A 3A4SC 1V9JA 1HE8A 1JRUA 3ISCA 1RFKA 2JRIB 3DBHB 5IOIA 5J2AA 4CQNA 2BKRB 1ECQA 1N5WC 3APCA 2NTSA 1Z1VA 2G07A 4Z6FA 3MFIA 4EYIB 2SAKA 3S1EA 5CX3A 4Y2PA 3A4RA 1X6JA 5JXVA 2LUEA 4I6LB 3KYCD 2QVHA 3RB4A 2WHIA 3Q8BA 2K4HA 4R64A 4GFIA 4FBUA 3S2AA 1KDHA 4PPXA 3MHZA 4YR0A 4W9JA 4AS1A 2YMQA 3OWEB 2QDFA 3TMPB 4KLDA 2KN5A 1R4NB 3BJSA 3IHPC 4GXBA 5JCIA 3K4GA 2GDQA 3GE3C 4QWDA 5EE1A 3RR7A 1V5OA 3L5KA 1V80A 2QCZA 2UU7A 2WBAA 1EC9A 2LVQA 2YY6A 1WR1A 2LUMA 4YMOA 1L7NA 1DOIA 3RPFC 4BKSA 4I27A 1XPYA 5AI5A 3EFCA 2QQ6A 1KF6B 1NKBA 3P63A 4KDLB 1E10A 3M62B 3A7RA 4FE3A 2BCQA 5EU9A 1PZNA 2DKZA 4YG2A 1L8PA 1X9WA 3UJEA 5TISU 3Q4DA 2INNE 1Y56A 3I9V1 2Y08A 3U9IA 3LDZE 1L8LA 3C0PA 4H4TA 5L9XA 3PM9A 1Y88A 4M9LA 2JYEA 2NO4A 4A8EA 3QJZA 1L3TA 1STZA 2RD0A 3DESA 1C79A 2MA9B 1FECA 3TFSA 4DHJB 3M9NB 3VFCA 2OX4A 1Z4OA 4DSJA 1GC7A 2HCFA 2FUG1 2KWDA 2V0GA 1XU4A 3QYPA 4O3RA 4I2IA 2W0HA 2O6KA 4QJFB 4C4RA 2WFAA 2DPIA 4MELA 4MGYE 1Z1BA 1ZQCA 2QPMA 1WXMA 5ALRA 3TADC 4HAIA 4DSLA 3KJMA 4C8KA 2GQUA 3GD4A 2KWUB 2SEBD 3IM1A 1XSNA 1YJ1A 2QB1A 2LRWA 3AEGB 4EYHB 4HROA 2FNJB 2XGPA 2W8KA 4FJVB 3ML8A 3NS1A 5J0RA 1ZJNA 2VFUA 1E8YA 3ZDDA 5AKHA 1Q1RA 1FEAA 2OOBB 5KT4A 5FS6A 2LGSA 3Q3JA 1QSLA 3S47A 2BQUA 4O3MA 3AE4B 2MBRA 4GN1A 2L7RA 1A76A 4E4UA 4EC3A 3EJDB 4H19A 3M63B 1NJZA 9ICBA 4EUTA 4CF3A 4O95A 3A7UA 1TS5A 3KUZA 3HPFA 3R11A 1XWLA 4K8DA 7ENLA 1N2XA 1EO6A 5ALEA 1FCLA 4EMWA 3G6XA 4F92B 4I2EA 3LJ3A 5HFYA 2OZTA 2GR1A 5EDSA 2ZJ5A 3F2DA 9ICGA 5DPWA 3CMMB 1GO3F 2MX2A 4UAYA 3OLMD 4LLGM 8ICBA 1UGMA 2ZPNA 2GMIC 5AI4A 3B0AA 3EFUA 4PGYA 3VTVA 5BYSA 5TR3A 3ZQ4A 4HCPB 2PCEA 3RJIA 2C7NB 2NV3A 3DEEA 5IIJA 2HHQA 1S0VA 2PIAA 4YP3A 1WWVA 4RNMA 1J19A 2DWQA 2W82A 4DHJD 4MT5A 4E74A 4ZH4A 4RU9A 5GXGB 2D2QA 3PSFA 1V8CA 2YQEA 3DDMA 4BX9C 4Y2RA 5HHIA 4RUAA 4JWMA 1ZOYB 4ZYSA 2W9BA 2MBQA 4H4PA 4QZIA 1WZ3A 3WK9A 1D4BA 3NHEB 3D9XA 4C7ZA 4F4WA 9ICFA 3P2BA 4ZYNA 2AJQA 1ZQIA 1D7YA 3DK8A 1ZQXA 4YMNA 4KKJA 2CHWA 3ED5A 4IP5A 3ZNHB 4XWWA 1MI0A 2EQYA 2K8HA 1K1SA 4JV2A 2C60A 4EKUA 5DGAA 4P4PA 2WAQF 3UIPB 3VQIA 4IWQA 2L0TA 4II3B 2NMQA 4PL2A 2G1EA 3DEDA 1UCVA 2CS4A 3R8BA 3ABVB 4C0ZA 2AL6A 2PMQA 1TKDA 5FJUA 3L8KA 4Z6EA 3JPPA 3WK8A 4ZRQA 1KEJA 3V6EB 3RZWC 4LIIA 1D9FA 3C0RB 1WWTA 2DX5B 5AIBA 3ZDCA 1VJKA 1V1PA 4JL9A 2E6XA 3OTQA 2KWVB 3KUCB 1TJEA 3ZJTA 3VC8A 3MDAA 1W1OA 4JDRA 1H6VA 4UBBA 5KAIU 2HDOA 2JRZA 1JX4A 2PMZF 2R9ZA 3DK4A 1ONFA 1WX9A 4OZAA 3POPA 4QWCA 2EAOA 7ICRA 4GLSC 5DG8A 3MC8A 4S17A 3MQTA 3BJYA 5GMVA 1RM6C 2V3AA 2W9BB 2E8MA 1FNVA 2MJDA 1SWWA 1WYGA 4XDDA 4TQRA 1F0MA 3C5GA 5KL1B 4DL4A 1JCKB 5TZVA 3TWBA 4DS5A 3TL5A 4KLTA 5L6FA 1KKXA 3GD6A 3KH0A 4QZAA 2HW3A 2C3CA 3DDHA 3O13A 3ZLHA 3VCBA 1NVID 3LXDA 2I38A 5D94A 1XLQA 5DKWA 1ED1A 3SR6A 4RQ2A 4BOSC 4A6QA 8ICQA 1FFUA 3GDXA 3C2MA 3TKAA 1PQSA 2CJOA 3AE7B 3RT3B 2KYWA 1AARA 3W9CB 1VLBA 3EKGA 4IL6U 5J0OA 1JWSD 2XH0A 3JPSA 3WAPA 3OZYA 2XY5A 1WJNA 5HMRA 1DGSA 1QQ6A 3IJLA 5JCLA 3TQPA 1HSKA 2W9MA 3ETRA 1T0QC 3PV1A 4NJCA 3VTUA 4H4YA 1ZQPA 1T0YA 1W1JA 8ICZA 2N7JA 1OEYA 3F2CA 4HCDA 4MHVA 1J7CA 1GC6A 4HEA1 1ZXIA 2JEJA 4MGIE 4IL0A 5K4LA 2VJ4A 1WM3A 2BF8B 4BKSD 1YOVB 5E79U 4FHKA 4Y2TA 1D8BA 3H1UA 3FW9A 4F4ZA 4F3OA 1YQ4B 3N20C 5H8YE 2YMPA 3TSSA 4MMWA 4RQMA 3JSVB 3OAWA 2PU0A 4A9AA 5KT2A 3U30A 5ALXA 4PHEA 1T3QC 3OW1A 2JRHA 3AU5A 1E90A 3JPTA 3PMNA 3AL0B 5DB9A 2VH1A 3I1YA 4RNNA 5F9NA 5KG1A 2KICA 1DOQA 1LQBA 2NPTB 4EM4A 4BKGA 4GXKA 2HZGA 4MM3B 2AX5A 5EE9A 3R10A 2JZBA 2YVCA 4NJ7A 5FXDA 1TAUA 4C7YA 5AI0A 2NR2A 3DVGX 3MC1A 4M9HA 1TYGB 5HMLA 1KLGD 1T5XD 2MRPA 4EZJA 2KE7A 5KT3A 3H4KA 2DUYA 2GO7A 2W9AA 2ZIUB 3NTUA 4OJOA 3RJFA 5DBCA 2KVRA 4Z6DA 1YQ3B 2QMTA 2Y5PA 4MSMB 4YFKA 1GRBA 1JXEA 3PFRA 3AI5A 1J7BA 4MACA 3LAEA 4H2HA 2K0PA 4GXIA 2LHEA 4TVYA 2AGQA 2FPLA 4PWCA 2LYHA 4F91B 4Y2VA 4ECVA 1EUVB 4XLOA 2YLMA 4KPLA 2AQ2B 4TMAB 4DBGA 3QX1A 4MEYA 3MFGA 3H40A 2ODGA 3L13A 3DG3A 4NXZA 2L5YA 1K53A 3P4QB 3SQPA 3HJEA 4DL3A 3DVGY 3NJTA 4WWNA 3AH7A 3SN0A 1J2NA 4KLSA 1X6IA 5KFIA 1SE2A 2GQWA 3OJUA 4B9SA 4E3CA 3CGDA 2KX0A 2HDEA 3H7PA 3V61A 4HKZE 3T6CA 2N4FA 3CRXA 1XSLA 2XI9A 3DVNV 1FNWA 4IM3A 5FKAC 1KOTA 1ONEA 4J9RA 4N9F4 3TAPA 3TARA 4KVGB 4DNAA 3NXLA 2A1JB 7ICJA 4GYPA 4J9OA 2KDIA 4CF5A 1C77A 2E3TA 2RP5A 5FJRA 5J2IA 2PPGA 2JU6X 4LNIA 2AKZA 4OJ5A 1LV5A 2NRVA 5G5HA 2MBHA 1IV8A 4GSWA 2CKHB 1BGXT 1L6NA 4HDOA 3SFDB 3EAOA 1PGAA 2K39A 3MBYA 1XEEA 2O2VA 3CYMA 1D9DA 2JZBB 1NI2A 3PS6A 1B9RA 1JRPA 4ZOHC 3L0WB 3WANA 3MWCA 4B0EA 1DYQA 1J7AA 3RZFA 1WY8A 3V62A 2WXNA 3UI3A 3BK2A 1WH3A 1SV0A 3PG6A 1P7EA 1ROEA 3KUDB 4G9BA 3D46A 3ENLA 3O65B 2MNRA 4HRSA 2IO0B 5KHOA 5IILA 3DJGX 4KLMA 3JPNA 3N7PD 4UB1A 3UJFA 1JROA 5HR6A 1SGGA 4K7SA 5LXHA 1ZRNA 2BCPA 4DFPA 1GOZA 3LWMA 2E1FA 2D07B 1A70A 4P6VF 3ETLA 4K3BA 1TVAA 4M00A 4FS1A 1WCLA 4Q8FA 1C4CA 3CB3A 2ZUDA 1V97A 2JV3A 1BPDA 1ZMCA 1ZQZA 3TEXA 5I1VA 3IG3A 2Z0EB 2DLBA 3C19A 3AN1A 4NY8A 2IO3B 4ANWA 2KMAA 1TKEA 2WOIA 4JV1A 1OUQA 2R8GA 1TT5B 2NTTA 3URYA 1IM4A 3D47A 4GMVA 1RWSA 4US9A 5J2HA 4ECYA 1E9MA 2MCNB 5ALKA 4UD8A 1WCNA 9ICVA 1TZZA 4PS8A 4A35A 2OYYA 2KWCA 2GSHA 1W1KA 2ZJAA 2N1VA 4RPYA 2L0FA 5KFOA 2XO7A 3A0HU 8ICNA 1XD3B 1AQ6A 2L52A 4XGAB 3RNCC 4P0PB 1WXAA 3DG7A 4HPNA 1XS9D 4DYEA 4IP4A 3HKZF 5EBKA 3IJQA 2O3GA 4MH8A 2JPHA 1UT5A 3UM9A 2F5ZA 2WXRA 4KDIC 5HG2A 2IOHA 1BXTA 3U8ZA 5J18A 5HI1A 3K1ZA 4R66A 2JY6A 1J8CA 4PWBA 1B1ZA 3C23A 1L7PA 5KNIA 1NHRA 3PY8A 1XXGA 2PVOD 3SAHA 2P6RA 3BVMA 3ZVVA 4I6NB 4F7ZA 5JRTA 5L1KA 1ZDXA 1NHQA 4NLBA 3WAOA 4PYTA 3FILA 1MO9A 1JI7A 3V6HA 2M17A 3AB5A 1ZYQA 2CRXA 4OZBA 2L8JA 9ICIA 1HUZA 5KFTA 4PHDA 3RGTA 2WDTB 3ZGZA 2KZ3A 3AE8B 2G08A 2NBUA 1KN5A 2RMMA 4IQWA 1KCZA 4KMOB 4JWNA 1MA7A 1JWMD 4HLEA 4RQ8A 2JXXA 2IJ0A 1SJDA 2C2EA 2FCNA 5C2TB 3KLJA 4UASA 2XGQA 1N61A 1L6UA 4LK0M 3A7AA 2JX5A 2WXJA 3P4PB 1JWAD 3LWLA 1MFWA 1S7MA 1WJUA 2Q4WA 3X0WA 4AP4C 1JXLA 4LTUA 1DTNA 1GG3A 1AHZA 3N30A 3HPOA 3RFZB 2RDBC 2Q85A 5CB1A 2KTQA 2WF8A 2WP9B 2D3AA 2KMCA 1NK8A 3KYDD 3MR3A 4J3ZA 2HXTA 3GIMA 1V1PB 2ZUCA 5AM5A 3DBSA 1C78A 4KMUA 3Q8AA 4RUCA 1PFDA 2RDGA 1BNOA 2QGYA 3OHBA 3HIZA 5KFUA 4JPSA 4M9NA 4JB3A 4PVHA 1TZOA 3D6JA 2W43A 3GQCA 4NL9C 1V1OA 3T3FA 2LASA 4BAXA 4RGNA 3V72A 4B95A 3A9JB 2KDMA 5J2GA 5EWFA 1HXYD 4ZRJA 4KX3A 1HJPA 3I28A 3C2KA 1UBQA 3W8WA 5EWEA 5C1ZA 2RRDA 3TEWA 2A8XA 2J6TA 3X23A 3AECB 4RQ1A 3UQAA 3AU2A 3VUXA 2HHVA 2DW6A 3TW9A 5AM3A 3H8MA 4BOZB 2TPRA 2XH7A 4G7FA 2FMQA 2VZKD 2K8CA 3EECA 4DN1A 2FPKA 4P1CC 4Y2JA 4YL8A 1S0NA 1ZDVA 4ELUA 1QLUA 3GZNI 4J6IA 3OJ4B 1NK9A 2KK0A 3M9OB 1PVPA 4W9CA 3R9KA 4P0PA 3H4DA 1H4RA 1WMHB 1ZP0B 2Y1IA 4LJOB 4MJSB 1Z5SB 2KHWB 1GSNA 5CR0A 4NAMA 1ZOLA 4BJQA 2K4IA 1BQGA 4OW0A 2Y1JA 1FEHA 2P4PA 4L2YA 3WU2U 1N63A 1R7SA 1WXQA 2PTYA 3AE6B 4QWAA 2HJ1A 2IY0B 5CA7A 2XC9A 1C4AA 2WYQA 1FRDA 4LCDE 2Y0SF 2M4NA 3DWGC 2GRTA 2K9XA 2X99A 1KRHA 4QW8A 3H9DA 2PTWA 4XA5A 4GMEA 3EC8A 2JYTA 3S1FA 2F76X 1IBXA 3NVWA 2VANA 2AQ4A 2LI6A 4TSSA 3W1YA 3FWAA 3RNGC 3UXLA 3C21A 3N32A 1P7FA 2L32A 2RPQA 4GGQA 5J0UA 5J2CA 3EJEB 3I6TA 1Q5WB 2KJ9A 3CF6E 5IO9A 4C56C 3DQ0A 3NO1A 5FJPA 3KZXA 5KFRA 4K2SA 1OW5A 4F93B 4DQPA 4L23A 5DBAA 1N48A 3SFEB 2BYEA 5AUIA 3Q3OC 3VDGA 1TY2A 2QJMA 2BCSA 1L4DB 2FLPA 3HRDC 2QJLA 2GOLA 3APFA 1DOYA 1WXSA 3AV8A 2PPHA 3TCSA 2OKTA 1NOMA 3D2JA 4Y2XA 4DDID 2ZUBA 1TKKA 4J9LA 2KQ4X 8ICXA 1F1HA 2H3FA 3N9YC 4IRKA 3Q3MC 1W6TA 1M94A 3OHAA 2W55A 4JAYA 3ZDEA 4JQ9A 2WTFA 4B6JA 2OEDA 2LYAA 2WB1F 4ED2A 2C28A 1RAXA 4JV0A 3N6JA 2W9CB 2B6GA 3TTEA 1KL9A 3NASA 2M0XA 1UQVA 2YMLA 4ECZA 4F1SA 3VTEA 5FS8A 3WAMA 1L4ZB 1PGXA 2DQNB 4PZNA 4CDGA 4DO9A 2P8CA 3DBLB 3KBBA 3ES7A 1HUOA 5L95C 2AQ3B 1SZPA 3E2EA 1ZKHA 1TKYA 3T3OA 3V6JA 3PW5A 3M6ZA 3EPIA 4OVZA 5E6NA 4O3OA 8ICSA 1TK5A 4BBNF 2RR9A 2AQ1B 1DNCA 9ICSA 5AKGA 4I2AA 4UB3A 1VCBA 5ALNA 4NM1A 2KEYA 2KFJA 2P8BA 4EEKA 5J0XA 4GISA 7ICLA 3I4KA 4UDUC 4A6GA 2K6QA 3P4RB 9ICAA 5KAFU 3UXPA 3KKAA 4DOAA 4H4RA 2ZW0A 4MF8A 4YR2A 5TSSA 3CXOA 3P4SB 3QTPA 1MHHE 2UVRA 3IHQB 2IGGA 3ZD9A 2W8LA 1S0MA 1KLNA 2TSSA 3RJGA 1BPXA 3FW7A 4QZHA 3KW5B 4RF0A 4CGZA 4QWBA 2ICIA 5IIIA 3AE1B 2L05A 5HQXA 4RNAA 2EXRA 1GEUA 3O0HA 4MGGA 3JSVA 2H5XA 4EQRA 5BMIA 2LZ6A 2RSUA 1RYRA 3AXCA 2ASLA 2FLLA 2R2OA 2V3SA 4W9HA 5EE3A 1NK7A 3T9LA 3ZYYX 1XQQA 2WDVB 2OEHA 1XNSA 3DG6A 4OZCA 1L5PA 3N4FA 1YQZA 1ZRMA 1YN4A 1UA0A 2HQMA 3N7SC 3V7LA 3C28A 1N60C 5FR6A 2PE6B 5EOZA 2VA2A 3RMKC 2ZW1A 5ALVA 2JK6A 3ZXVA 4APNA 2PFPA 1SE3A 2KJRA 3AEFB 2BPGA 2KN4A 3DGHA 1EC8A 3V5CA 1SIJA 3N1XC 2N9PC 3SAFA 6ENLA 4DXKA 1SXDA 4G50A 5G5GB 3PHXB 3QC8B 4IRCA 4PYUA 3GIIA 3MFHA 8ICMA 4RPXA 2KNJA 3SEIA 3M8SA 1NJXA 4RMAA 4DHZB 2VKQA 3K1RB 1QOGA 3OZMA 5D46A 2BR0A 3SMVA 4F5QA 1UUPA 3SV4A 2GRIA 3PHWB 1F2RI 3R7QA 2H3QA 3V6KA 8ICGA 5J0TA 1WZ0A 2QKNA 2QJJA 3ZVHB 3WKDA 8ICAA 5LXIB 3ZLFA 2WF9A 4M02A 4KGRA 4H50A 1HZ6A 2PI5A 2KT7A 1SZHA 2AAQA 2JHDA 3RB6A 3RJKA 4G11A 5IKCM 2X8CA 2QKQA 4QIWF 3AE2B 4IM0A 3HK0A 2KNBA 2OXOA 1KRPA 3APDA 3H0RB 3L54A 4BKTA 2OH2A 2A1AA 3T5JA 5AUKA 2MUCA 2OQYA 3BOXA 4GGHA 5KT6A 2A4ZA 1DXSA 1C1YB 4OVUA 1H38A 3AE3B 3BS7A 4KZCA 1MUCA 1ZQSA 3AEBB 5IDZA 1R4MB 3P1MA 4RM8A 4W9FA 2NRXA 2LHTA 3NGDA 2V4RA 3SBFA 1I7HA 4JUZA 2ZNVB 1ZQJA 1QLNA 2BKEA 3L16A 3OSPA 3DBRI 4GDKA 1HZ5A 4EBDA 3RUIB 3T8QA 2G5HB 2WB1C 1QH9A 3NVYB 1D5XC 3E0FA 1Q10A 2ZVOA 3T5LA 2GBRA 4HJKA 4IQTA 2M0AA 2VFSA 8ICIA 4KT2A 3L3FX 2WLBA 3VVWB 1EBDA 1KBUA 1HIWA 3J9CA 1URJA 2LM1A 2PI4A 1ZJMA 4NLGA 5BYQA 3GILA 1XLPA 4CYEA 4EE2A 1GRFA 3U26A 2WGSA 2G4DB 2WXPA 4YSZB 2PTZA 3VC5A 5JTIA 1RDFA 1XO0A 1BPYA 1HTOA 3W8XA 3RJAA 1M6YA 5J0QA 4MDKE 3JS8A 1RYJA 3RJEA 4BC7A 3VCNA 2QARB 4H2AA 2HBMA 1E8GA 3RTVA 1VAOA 4H83A 3DHGC 5ALGA 3S1DA 1F8WA 2HTHA 1YT3A 3WK5A 2KZMA 1YD8U 2GL5A 4HPLB 1SKWA 4KLLA 3TAQA 2KK8A 3FW8A 5L6GA 3PR5B 2LEKA 2PP0A 3ORYA 2VIXA 4AUQC 1TE6A 2OPJA 3F53A 3H7IA 2KJ5A 7ICQA 1JPMA 3PMLA 1SJCA 5HNKA 3A9KB 3C1ZA 3TEZA 2BCRA 4EQWA 2FE8A 1L5UA 5ALQA 2BS3B 2Y5BB 3PRMB 1CQVA 3PRPB 1OXJA 3ES8A 5K8EA 5BOEA 5HHDG 2QB0A 1AROP 4YWGG 4F4YA 2L76A 1X2HA 1IPGA 1PUZA 4GOCA 1WMHA 4MJSA 3PPAA 4OALA 2E8PA 3PSEB 5FXFA 3CXBA 3PSPA 2KVCA 3STPA 3RRGA 2H3VA 4RQ4A 5HR7A 2K8BB 3HWTA 4DQSA 4IS7A 4EM3A 4ECXA 2BGWA 4EZLA 1R0MA 3ZXRA 1YIWA 3E9SA 4Q8EA 8ICKA 2I1KA 3GOEA 4HN8A 3H0MB 4DXFA 3GIKA 4ED6A 2ZXIA 1N63C 3V3WA 2LBOA 1PYWD 1SE9A 3GP7A 5C23A 1HEZE 3NS8A 3ZRFA 5ALFA 5KFJA 1UXYA 3TSJA 1IG6A 2QSDA 1NHPA 2R2QA 2Y9UA 5AZFA 3IV6A 2HOQA 1ZD5A 3EHVA 1MC8A 1WRDB 3GSYA 4ZCWA 3GU3A 3R3MA 5KFWA 2GI9A 2GH5A 4BWMA 1RFAA 2ATLA 2WXQA 3B9JA 1F0ZA 1ELSA 2D3DA 3MGIA 2WDQB 1TV9A 3URHA 4G8TA 1RXWA 2WP5A 4GGBA 1XC9A 3DK9A 3AM9A 5KL8B 2HTME 1QSSA 1U9LA 5BPCA 3EYZA 2C2DA 5ALMA 2HJ8A 2PJHA 1UHUA 5KT5A 4HG0A 1UZXB 4WJNA 3FVDA 3QEBZ 1L3SA 3MC9A 4O9MA 3G6YA 3ZD8A 1IUEA 2UUVA 2ZG6A 2G4SA 1VZ7A 2G3QB 3NZUA 3BK1A 5J2FA 3UXKA 1OJTA 3BIID 5ALHA 4M6UA 3QZ8A 2R2ZA 1I19A 3KD3A 4TVWA 4DSFA 1WG8A 1ZQWA 1U48A 3N7RC 3OC4A 2EKEC 5DLFA 1S10A 1NEKB 1ZQYA 1Z3EB 5CHWA 3V60A 3BDPA 2AXRA 4GDLA 4NQLB 1NU5A 3UMBA 2AL2B 4ECRA 3QU9A 3SN1A 1TKGA 4KLUA 4RCOA 3GB1A 3DEQA 1MN8A 4BFRA 3GY1A 4LNFA 1N61C 1V59A 5HHHA 3QAQA 1JN3A 1AW7A 4FA6A 4RQ0A 4G3IA 1J97A 3UQ0A 4XRHA 3V7JA 4M0WB 8ICVA 1Q1WA 2N9LA 2OLAA 2MA1A 5JHBA 4DOBA 2GR0A 3MKCA 3EZ5A 5J04A 4JGHB 2ISOA 8ICEA 3IDWA 1EU4A 5J2RA 3DCGA 4R65A 1S0OA 2BC0A 5CP2A 5BO4B 2WOWA 1GESA 2EQ6A 3GFKB 4GLXA 3B2FA 1RM6B 2RDXA 3THVA 3SENA 1S97A 1T4GA 4C8NA 4GXJA 1L3UA 2GBJA 1Q0WB 2PW9A 5AE3A 3F2BA 2ZZBA 7ICKA 3THUA 5J0PA 2I9GA 2LXCA 4CO7A 4B9TA 1D5MC 3ISDA 3QQ8B 4DWIA 1JWBD 3JZUA 4DSEA 3ALBA 4XDCA 1LFDA 2ZEQA 1ZQTA 1WI0A 4EMJA 1YN5A 5KFHA 2IBKA 2W9NA 3DWMA 1DXLA 2LMRA 1TZ1A 4IC7B 1T3QA 3FM9A 4RH6A 3PW7A 1ZQGA 4ECWA 3GO2A 3U4FA 5DQHA 5FR3A 3UCCA 3BVGA 1ZQUA 1TAMA 3H8WA 4UAWA 3FCPA 4K8GA 5BOLA 4BXOA 1I35A 3PV8A 3JPRA 4DQRA 4US8A 4F5RA 4GC7A 2XSXA 2UVUA 1EWYC 1MQ2A 2XCAA 2Y3AA 3MC0B 3ML9A 3RULA 2NQLA 1N60A 3OP2A 2CHRA 2KN7A 1N62A 4PJ0U 4GIRA 5BOFA 4ZHPA 2NRTA 1SSNA 4YQWA 4F72A 4XC2A 1MHXA 3LYYA 4JWSC 3R2IA 2NS5A 4PVKA 1TAQA 1L0XB 2BYVE 2PGEA 2PS2A 3MABA 5KG6A 5KFKA 1DRGA 1KLUD 3Q8SB 4K7UA 2R8DA 3UJ2A 2V4IB 4A8XC 4ARIA 3EUB2 1E7UA 3NVVB 2BKFA 5D2MB 1KD0A 2XH2A 2P3HA 3PW4A 1HTQA 4RGOS 3HUIA 1WGGA 1FO4A 1KSPA 5D7GA 2KANA 1FMAD 4BBNC 3F5EA 2KDFB 4YVZA 5DDMA 2BB6A 1L0YB 3K1GA 4KIKA 3ZVIA 4HNCA 4KWSA 5ENLA 2QEJC 3KTQA 5KFCA 1SB3B 4EZ6A 3SD7A 2DZMA 2OWOA 2PKOA 4YTPB 1ECWA 5FP0A 3M8RA 1OQQA 2BS4B 2MH7A 4C8OA 3U52E 2B0CA 2XK5A 1RPLA 2IYDB 3RNMA 2OHFA 2WXIA 3RNFC 4ELTA 2ZIVB 4ACOA 4I2JA 2JEGA 5G2NA 1IP9A 2QHOA 2N1RA 3NVYA 3RNBC 4UARA 1NDAA 2LHDA 2D5GA 1GB4A 2LJIA 3T3NA 1PDXA 1TFRA 2HHUA 3R25A 4OJLA 5KFNA 3DGBA 3V5FA 1UD7A 2ZTDA 1TE2A 4IG7B 3T9PA 3SQIA 1FRRA 1E0ZA 1XO1A 1WRIA 3I63C 2PE9A 3VFKA 2PP3A 2YAUA 2LD9A 4H4SA 1I4RA 3H4BA 3SSZA 4BURA 2PLIA 1XS2A 4JE3B 4FZLA 3TANA 1C3TA 2IDYA 2POZA 2RHFA 2YB1A 3EANA 4ZRIA 4BGDA 2GOWA 3CSTA 3PNCA 2W9CA 3HM3A 1V85A 4KX5A 2IO2B 1V6EA 1SIFA 4KGTA 3H70A 3SDLC 3N4EA 1E7VA 3LADA 3QUCA 3DJJA 3I76A 2X8HA 4EELA 4JLCA 3SI8A 1GERA 2ALZA 2JT4B 1QOFA 1SF0A 3F5AA 4CCHA 4K4GA 4E5TA 4TQ0A 2GLEA 1GB1A 3HKZC 2ON8A 2BB5A 3AEDB 3A33B 3GZNB 4IQVA 2ZXHA 3KHGA 3RAXA 2YB4A 1F77A 2MW5A 5KHQA 8ICOA 1FD6A 2ZZ0A 3VHTC 5AIAA 1LXDA 4ZOHB 1C4PA 2KLCA 4WJOA 4AWJA 3CP8A 2EMSA 2MLBA 1CJEA 4PVJA 3QU7A 1L7OA 1W1MA 2EELA 2GR2A 4DF4A 2PXIA 1CI4A 2WDRB 4K3CA 2I1QA 4UBCA 4M47A 1P1AA 1E7PB 4B9NA 4MEMA 4BC9A 2WP6A 3IRUA 1U4AA 1T7PA 3Q2AC 2LVPA 3NZSA 4LNNA 3B9JB 1L3VA 3WALA 3PLVA 4LA1A 4F2RA 3I3TB 4YD2A 2XNAC 3EF6A 1UH6A 3BVZA 3UGVA 3H7SA 4QZGA 2G5IB 1PDZA 4KLHA 3MHSD 3JPOA 2XCPA 7ICGA 1WGRA 5G5GA 2J6UA 3MJWA 3OGUA 4YXJA 3AU6A 4ED0A 4I2FA 1FHVA 5JCKA 2XY7A 1NJWA 2HD5B 1N5XA 2YN4A 4UB4A 1IGDA 2IZVB 4H4QA 1B22A 1C20A 3T5KA
chains in the Genus database with same CATH topology
4TSSA 3FWAA 1N5WC 2NTSA 1P7FA 1GB4A 2L32A 1I4XA 2GB1A 4NZLB 2SAKA 3S1EA 3DQ0A 4C56C 3V05A 5G5HB 5JXVA 4R3DA 2V3PA 4L23A 3SFEB 3U4EG 5I1WA 3Q69A 2ONQA 5AUIA 1TY2A 5BMGA 3Q8BA 4MLAA 1L4DB 2JXTA 1VQZA 1ZUD2 2VZKB 2QJLA 3MHZA 1DOYA 3HRDC 3AV8A 3W2DA 4AS1A 3EUB3 3OWEB 3NVZA 1E8FA 3D2JA 1SB3C 4WH4A 3IXSA 2KQ4X 3N9YC 2W54A 1ZXHA 5EE1A 3RJ8A 4GDLB 2W55A 4JAYA 2PMVA 1ESFA 1TS2A 2OEDA 4GDKB 2LUMA 2WU2B 2BVGA 3RPFC 1DOIA 4N58A 3LLBA 1KF6B 3VTEA 3P63A 2BYTA 2WXFA 1L4ZB 1PGXA 1E10A 3A7RA 1XO3A 2J42A 2RDHA 1QOBA 2AQ3B 2IGHA 1TKYA 1Y56A 2INNE 3I9V1 3T3OA 2Y08A 4OVZA 3C0PA 1DOXA 1FIQA 3PM9A 1YN3A 2JYEA 4KX6B 2AQ1B 5BMHA 4RF1A 3D2HA 2H89B 1C79A 1AHVA 4USAA 4UDUC 3P4RB 2FUG1 2KWDA 2V0GA 2ZW0A 2DYOA 3LB8C 1FCCC 5TSSA 3P4SB 4ZRPA 2QPMA 1MHHE 1I4QA 2IGGA 2TSSA 3FW7A 3IAM1 4RF0A 3KJMA 2GQUA 1D5ZC 2SEBD 2ICIA 5FK9C 3AE1B 3AEGB 3HVDA 4RNAA 2EXRA 5HQXA 4HROA 2P13A 1MBTA 3EA6A 3NS1A 1MPEA 2VFUA 3NZ3A 5D79A 5BMIA 3AE9B 3TEYA 1PGBA 5EE3A 3ZYYX 2WDVB 4OZCA 1L5PA 3AE4B 2MBRA 1YN4A 4EC3A 1N60C 2ACZB 4O95A 3A7UA 1TS5A 1SJHD 1XLOA 3KQ4A 2ZW1A 2NQWA 1FCLA 1SE3A 5HFYA 3AEFB 2KN4A 2L83A 2WQYB 1QF6A 1SIJA 3E56A 1M4VA 1BUIC 2X38A 1YNTE 3FAHA 2Q5WD 4LLGM 5G5GB 5BYSA 3ZQ4A 1QOGA 3ZJUA 1UUPA 2PIAA 1ET9A 1E8HA 2GRIA 2K5PA 2DWQA 1F2RI 2W82A 4MT5A 5H92C 2QKNA 5GXGB 1WSPA 2N9KA 4IDIA 4REZA 1V8CA 4KGRA 1HZ6A 2Y4GA 5FXEA 1ZOYB 2MJEA 4ZYSA 1MBBA 2CJNA 1JALA 1D4BA 4ML8A 3AE2B 4C7ZA 4OHJA 2VFTA 4KKJA 5MPOA 4XWWA 5AUKA 1MI0A 4O1NA 2J4XA 3R2TA 1XF5L 2MJ3A 3AE3B 2RK5A 1SBBB 2I2YA 3CWIA 3VQIA 3AEBB 1EWCA 3P1MA 4NAWB 2OAIA 3HVZA 2NMQA 1I7HA 2G1EA 3DEDA 4RGTA 1OFFA 3ABVB 3R8BA 2WXHA 4RFBA 1HZ5A 4ZRQA 1WWTA 3NVYB 1D5XC 1Q10A 1QOAA 1VJKA 1V1PA 3AEAB 1SJED 3PZ8A 2WXLA 2M0AA 2E6XA 2VFSA 2Z8LA 1TJEA 2WLBA 3ZJTA 4YTNB 3IAS1 1W1OA 1DZNA 1W1LA 1SEBD 3J9CA 3TUOA 3U2SC 2PLPA 5BYQA 1DGJA 1XLPA 4EE2A 1CK1A 4OZAA 2WXPA 4YSZB 1ZR6A 3POPA 3W8XA 3RJAA 2YEPB 4GLSC 1ET6A 2PLSA 3JS8A 4Q2JA 1RM6C 2BBCA 1RYJA 4BC7A 4H2AA 3KWLA 1E8GA 1FNVA 1VAOA 1VZ6A 3S1DA 3S1CA 2MJDA 3FW8A 1WYGA 5L6GA 4XDDA 3VR8B 2BW2A 2LEKA 3U7ZA 1JCKB 3FILB 5L6FA 1UWMA 5HHZA 1WVEA 3TEZA 2FE8A 3O13A 2BS3B 1NVID 2I38A 1CQVA 1XLQA 1AHUA 3SR6A 5K8EA 5D3DA 5HHDG 4YWGG 4A6QA 1FFUA 1N5WA 3W9CB 3AE7B 5I4DA 2CJOA 3PQBA 1TY0A 1X2HA 1VLBA 1XLNA 1JWSD 1HQRD 4CQNA 4OALA 5HMRA 5FXFA 1DIQA 5EE0A 1HSKA 4NJCA 3ETRA 1VR9A 4DXGA 1W1JA 3ETRB 2N7JA 3Q8EA 1J7CA 4YTMB 3NVVA 4HEA1 3E9SA 1ZXIA 2JWUA 5FXPA 1N63C 4DXFA 5AWVA 1EU3A 4XE0A 1PYWD 3GP7A 1W1QA 1UXYA 3FW9A 1HEZE 1YQ4B 1NI3A 5H8YE 3R07C 1UNSA 3TSJA 3TSSA 2QSDA 4A9AA 1T3QC 3BYTB 4D2KA 2VAOA 1QT9A 3GSYA 1F0XA 2WDWA 2GI9A 2WXQA 2AX5A 3B9JA 4J3OD 4MM3B 5EE9A 2LGIA 2WDQB 1F0ZA 5FXDA 1X2GA 4C7YA 2M19A 2BVFA 1NYQA 3AEEB 3W5UB 1TYGB 1T5XD 1KLGD 1D6EC 3BZDB 2QMTA 3NUHB 3AM9A 1C76A 2LFIA 2Y5PA 1YQ3B 2HTME 1QKZA 3BWUD 1NYRA 4HJGE 3Q8FA 3ZJVA 1L6VA 1J7BA 4MACA 3LAEA 4HG0A 2K0PA 2LHEA 4TVYA 1UWXA 5E6JA 2VFRA 4PWCA 1ENFA 4XLOA 3TX1A 1IUEA 1QLBB 2AQ2B 2UUVA 2QIEB 2RPVA 4TMAB 3BYYB 2R61A 1VZ7A 2WNMA 3BK1A 3EGRA 3MFGA 3VR9B 3BIID 2R2ZA 1FFVA 5D3IB 1I19A 1K53A 3P4QB 3AH7A 4TVWA 2J53A 1NEKB 1SE2A 2L1AA 2AXRA 1DIIA 2HDEA 4HKZE 4RGMA 1TKGA 4M0WA 4RCOA 3GB1A 2PTLA 1FIQB 1FNWA 1N61C 2G9HD 3W5VB 5FKAC 4YSYB 1AW7A 2VFVA 2Y3RA 2WXKA 3KWVA 2CU3A 2N9LA 1C77A 2E3TA 2KAJA 2IPKD 1XCTL 2JU6X 5G5HA 1EU4A 3SFDB 2WXGA 1FFVC 1PGAA 2EKIA 1XEEA 4WWMA 1KH0A 3B2FA 4N59A 3W8ZA 1RM6B 2PW9A 1B9RA 1JRPA 2WS3B 1GPXA 2YVSA 1K50A 4ZOHC 1K52A 3NVZB 5AE3A 4B0EA 1DYQA 1J7AA 3PZ7A 2WXNA 3UI3A 3BK2A 3B2GA 1VRAB 1P7EA 3W1SA 1D5MC 1ROEA 3HRDD 1YJIA 3MJ5A 2M56B 1HA5A 1JWBD 4HRSA 1E0YA 3TSHA 4XDCA 1YN5A 4TQ1A 1FNUA 1JROA 3DWMA 4KGSA 4L1BA 1T3QA 1GOZA 1E6EB 4RH6A 4P6VF 1LO5D 1A70A 1JQ4A 2KMMA 4P16A 1C4CA 5BYRA 4B0MA 5FR3A 3BVGA 1NENB 1V97A 1N62C 3TEXA 5I1VA 1IGCA 2DLBA 3AN1A 3AE5B 4JX1C 1TKEA 4US8A 1ACCA 4YT0B 2NTTA 1EWYC 2Y3AA 3MC0B 3URYA 1N60A 1RWSA 2K3UA 1N62A 4US9A 3C8YA 3NRZB 1E9MA 4ZHPA 3SR6B 1SSNA 4AQ7A 3NS1B 4UD8A 5AE1A 1MHXA 3LYYA 4IOIE 1ZXIC 3V3XA 3VRAB 4JWSC 5C3JB 3R2IA 4PVKA 1L0XB 1TS3A 3I57A 1W1KA 1KLUD 2R8DA 3MP9A 2L52A 2V4IB 4A8XC 4ARIA 3EUB2 3NVVB 2JZPA 3PO0A 1W1SA 3KLSX 1ZPSA 3I99A 2O3GA 2P3HA 4MH8A 2YEPF 4JWUC 1FFUC 4RGOS 3HUIA 2DBYA 1FO4A 2WXRA 3IT6B 5D7GA 5HG2A 4PZFA 1FMAD 1CZPA 1SXTA 1BXTA 2BTEA 2BB6A 1L0YB 1PUTA 5HI1A 3Q8CA 4PWBA 1B1ZA 2H88B 1YJJA 3A7AA 1XCQL 1XXGA 2PVOD 3BVMA 2QEJC 3CIRB 1W1RA 1SB3B 4PVEA 2PKOA 4YTPB 2BS4B 2MH7A 1OQQA 1ZDXA 3U52E 1K51A 1KTKA 3FILA 2W3SA 4A90A 4ARCA 4PYTA 2IPIA 1I4HA 2OHFA 1BMLC 2WXIA 2WXOA 3AB5A 1JMLA 1ZE3D 2V3NA 4OZBA 4PT5A 3NVYA 1WGKA 1STEA 2J52A 1EM7A 3AMZA 3AE8B 2LHDA 2D5GA 3ZGZA 2E5AA 2RMMA 2LJIA 3T3NA 1AWDA 1PDXA 4ZHOA 1JWMD 4YXDB 2WU5B 2XN9C 2Y5CA 2IJ0A 5C2TB 2MEKA 1L6UA 1N61A 1MVKA 4LK0M 3VRBB 1FRRA 1E0ZA 2JX5A 2WXJA 3P4PB 1JWAD 1TS4A 1WRIA 2N0SB 2Q4WA 4WAFA 4LTUA 1FM0D 1UGJA 2INPE 1AHZA 2BVHA 3RFZB 2Q85A 1I4RA 2WP9B 2PLIA 3H8HA 4JE3B 1JWUD 2JSVX 5T8IA 2BT6A 3WCQA 2IDYA 1V1PB 2GQTA 1WVFA 3D2DA 3FC4A 1C78A 3Q8AA 1PFDA 2RDGA 3P42A 1KFYB 4DNSA 4ITKA 4KGTA 2LMCA 4JPSA 1QILA 4PVHA 1TZOA 2DYMA 1V1OA 4RGNA 1OQRA 2W3RA 2KDMA 1QOFA 1SF0A 3LXFA 1IBXB 2JQRB 1HXYD 1T6BX 4TQ0A 1GB1A 3L4PA 2BB5A 2ON8A 3AEDB 1FXIA 1VZ8A 4YSXB 3W8WA 1F77A 2I0KA 3TEWA 1FD6A 3AECB 4ZOHB 3SEBA 1C4PA 2KACA 1JW9D 1SE4A 4WIPA 4KKIA 1CJEA 3NRZA 4N6EB 1AYFA 2BS2B 2VZKD 4DQOC 4PVJA 3IT4B 4BCAA 1I4GA 5ADZA 1W1MA 2EELA 4XWTA 2WDRB 1ZDVA 2K22A 4A55A 1C9FA 1F2RC 1E7PB 1QLUA 4BC9A 2UUUA 2Y3SA 1YMHE 1QLTA 3B9JB 2FBWB 3NVWB 1QQRA 1ZP0B 1I4PA 2XNAC 4JB1A 3BVZA 4IKGA 3GS2A 3HSUA 1GAQB 2IGDA 4NAMA 4WURA 4WQMA 4OW0A 1FEHA 2B76B 1AN8A 4L2YA 1N63A 1R7SA 1WXQA 4C80A 3AE6B 4HKQA 2P4PA 2WXMA 5G5GA 3BW7A 5AE2A 4FXCA 1L0VB 1C4AA 4BBYA 1FRDA 1N5XA 3DWGC 2K9XA 5LNK1 1KRHA 1IGDA 2PVGC 2JYTA 2QILA 1FXAA 3S1FA 1IBXA 1VDVA 3NVWA 1RFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWA A;  1N5W C;  3S1E A;  3DQ0 A;  5G5H B;  3SFE B;  5AUI A;  4MLA A;  1VQZ A;  1ZUD 2;  3HRD C;  2QJL A;  1DOY A;  3AV8 A;  3EUB 3;  3NVZ A;  1E8F A;  3D2J A;  1SB3 C;  2W54 A;  5EE1 A;  2W55 A;  4JAY A;  2WU2 B;  2BVG A;  3RPF C;  1DOI A;  4N58 A;  3LLB A;  1KF6 B;  3VTE A;  3P63 A;  1E10 A;  3A7R A;  1XO3 A;  1QOB A;  1TKY A;  3C0P A;  1DOX A;  1FIQ A;  3PM9 A;  4KX6 B;  3D2H A;  2H89 B;  1AHV A;  4USA A;  3P4R B;  3LB8 C;  3P4S B;  2QPM A;  3FW7 A;  3KJM A;  2GQU A;  5HQX A;  3AE1 B;  3AEG B;  2EXR A;  2P13 A;  4HRO A;  1MBT A;  3NS1 A;  2VFU A;  5D79 A;  3AE9 B;  5EE3 A;  3ZYY X;  2WDV B;  1L5P A;  3AE4 B;  2MBR A;  4EC3 A;  1N60 C;  2ACZ B;  4O95 A;  3A7U A;  1XLO A;  2NQW A;  3AEF B;  2L83 A;  2WQY B;  1QF6 A;  1SIJ A;  3FAH A;  2Q5W D;  5G5G B;  1QOG A;  2PIA A;  1E8H A;  2K5P A;  2DWQ A;  2QKN A;  5H92 C;  5GXG B;  4IDI A;  1V8C A;  5FXE A;  1ZOY B;  2MJE A;  1MBB A;  2CJN A;  1JAL A;  4ML8 A;  3AE2 B;  4C7Z A;  2VFT A;  5MPO A;  5AUK A;  2MJ3 A;  3AE3 B;  2RK5 A;  3CWI A;  3AEB B;  3P1M A;  2OAI A;  3HVZ A;  1I7H A;  2G1E A;  3DED A;  1OFF A;  3ABV B;  1WWT A;  3NVY B;  1QOA A;  1VJK A;  3AEA B;  2VFS A;  1TJE A;  2WLB A;  4YTN B;  1W1O A;  1DZN A;  1W1L A;  1DGJ A;  1XLP A;  1ZR6 A;  4YSZ B;  3W8X A;  2PLS A;  3JS8 A;  1RM6 C;  1RYJ A;  4BC7 A;  1VAO A;  3KWL A;  1E8G A;  3S1D A;  3S1C A;  2MJD A;  3FW8 A;  1WYG A;  3VR8 B;  2LEK A;  1UWM A;  5HHZ A;  1WVE A;  2BS3 B;  1NVI D;  1XLQ A;  1AHU A;  3SR6 A;  1FFU A;  1N5W A;  3W9C B;  3AE7 B;  2CJO A;  1X2H A;  1VLB A;  1XLN A;  4OAL A;  5HMR A;  5FXF A;  1DIQ A;  5EE0 A;  1HSK A;  3ETR A;  1W1J A;  3ETR B;  1J7C A;  4YTM B;  3NVV A;  1ZXI A;  5FXP A;  1N63 C;  3FW9 A;  1W1Q A;  3R07 C;  1UXY A;  1NI3 A;  5H8Y E;  1YQ4 B;  3TSJ A;  4A9A A;  1T3Q C;  2VAO A;  1QT9 A;  3GSY A;  1F0X A;  1F0Z A;  2AX5 A;  5EE9 A;  3B9J A;  2WDQ B;  5FXD A;  1X2G A;  4C7Y A;  2M19 A;  2BVF A;  1NYQ A;  3AEE B;  3W5U B;  1TYG B;  3AM9 A;  1YQ3 B;  2HTM E;  1NYR A;  1L6V A;  1J7B A;  3LAE A;  4HG0 A;  4TVY A;  4PWC A;  2VFR A;  4XLO A;  3TX1 A;  1IUE A;  1QLB B;  2QIE B;  3VR9 B;  3BII D;  2R2Z A;  1FFV A;  1I19 A;  3P4Q B;  3AH7 A;  4TVW A;  1NEK B;  2AXR A;  1DII A;  1TKG A;  1FIQ B;  1N61 C;  3W5V B;  4YSY B;  2VFV A;  2CU3 A;  2E3T A;  2KAJ A;  5G5H A;  1FFV C;  3SFD B;  2EKI A;  4WWM A;  3B2F A;  4N59 A;  3W8Z A;  1RM6 B;  1B9R A;  1JRP A;  2WS3 B;  1GPX A;  2YVS A;  4ZOH C;  5AE3 A;  3NVZ B;  1J7A A;  3B2G A;  1ROE A;  3HRD D;  1YJI A;  1E0Y A;  2M56 B;  1JWB D;  4HRS A;  3TSH A;  1JRO A;  3DWM A;  1T3Q A;  1E6E B;  4P6V F;  1A70 A;  1JQ4 A;  2KMM A;  1NEN B;  1V97 A;  1N62 C;  3AN1 A;  3AE5 B;  4JX1 C;  1TKE A;  4US8 A;  4YT0 B;  1EWY C;  1N60 A;  1RWS A;  1N62 A;  4US9 A;  3NRZ B;  1E9M A;  4ZHP A;  3SR6 B;  5AE1 A;  3NS1 B;  4UD8 A;  1ZXI C;  3VRA B;  4JWS C;  5C3J B;  4PVK A;  1W1K A;  2R8D A;  2L52 A;  3EUB 2;  3NVV B;  3PO0 A;  1W1S A;  3I99 A;  2P3H A;  2O3G A;  4JWU C;  1FFU C;  3HUI A;  2DBY A;  1FO4 A;  4PZF A;  1FMA D;  1CZP A;  1PUT A;  4PWB A;  2H88 B;  1YJJ A;  2PVO D;  3CIR B;  1W1R A;  1SB3 B;  4PVE A;  2PKO A;  4YTP B;  2BS4 B;  2MH7 A;  1OQQ A;  4PYT A;  2W3S A;  2OHF A;  3AB5 A;  3NVY A;  1WGK A;  2E5A A;  3AMZ A;  3AE8 B;  1AWD A;  1PDX A;  4ZHO A;  4YXD B;  2WU5 B;  2Y5C A;  5C2T B;  3VRB B;  1L6U A;  1N61 A;  3A7A A;  1FRR A;  1E0Z A;  2JX5 A;  3P4P B;  1JWA D;  1WRI A;  2N0S B;  2Q4W A;  4LTU A;  1FM0 D;  1AHZ A;  2BVH A;  2Q85 A;  2WP9 B;  2PLI A;  2BT6 A;  3WCQ A;  2GQT A;  1WVF A;  3D2D A;  3FC4 A;  1PFD A;  1KFY B;  4DNS A;  4ITK A;  4PVH A;  1OQR A;  2W3R A;  1QOF A;  1SF0 A;  3LXF A;  2JQR B;  3L4P A;  3AED B;  4YSX B;  1FXI A;  3W8W A;  2I0K A;  3AEC B;  4ZOH B;  1JW9 D;  1CJE A;  3NRZ A;  4N6E B;  1AYF A;  2BS2 B;  4BCA A;  4PVJ A;  5ADZ A;  1W1M A;  2WDR B;  2K22 A;  1QLU A;  1E7P B;  4BC9 A;  1QLT A;  3B9J B;  2FBW B;  3NVW B;  1ZP0 B;  4JB1 A;  1GAQ B;  4WQM A;  2B76 B;  2P4P A;  1N63 A;  1R7S A;  1WXQ A;  4C80 A;  3AE6 B;  3BW7 A;  5G5G A;  5AE2 A;  4FXC A;  1L0V B;  4BBY A;  1FRD A;  1N5X A;  3DWG C;  2K9X A;  1KRH A;  2PVG C;  3S1F A;  1FXA A;  1VDV A;  3NVW A;  1RFK A; 
#chains in the Genus database with same CATH topology
 2JF5 A;  5LLI A;  5DPS A;  2ZCB A;  4I2C A;  3WKE A;  1U4B A;  4NZL B;  2C9W B;  1JDF A;  3DIP A;  4HWI B;  4S0R A;  4IL2 A;  2LKY A;  2MP2 A;  3EWA A;  1UF0 A;  9ICK A;  2HBL A;  4IC9 A;  1U45 A;  2WX1 A;  3U4E G;  3RH4 A;  3Q69 A;  4MKS A;  2ONQ A;  4XX5 A;  3RYT A;  4MLA A;  1WUE A;  3UJR A;  1NPX A;  4LNK A;  2CXY A;  5KT7 A;  1ZUD 2;  2VZK B;  3KKA C;  3BIN A;  3EUB 3;  3S6J A;  2Y9T A;  2K1F A;  1E8F A;  2FKP A;  2P88 A;  2XBB C;  4XQ8 A;  8ICC A;  2HNE A;  4ED3 A;  1SL0 A;  3RJ8 A;  5KFL A;  4Z6C A;  3BY4 B;  4GDL B;  3C1Y A;  1ISN A;  4HCL A;  1ESF A;  4B9V A;  3TOY A;  5J0W A;  4UB5 A;  4WJ3 B;  3PWI A;  4GDK B;  2QAR A;  4YN4 A;  2DZI A;  3TI0 A;  2WU2 B;  3JYU A;  3RJH A;  2BVG A;  4QZC A;  2PTX A;  1JEH A;  2QAE A;  5J0Y A;  2BYT A;  2WXF A;  4W9D A;  1WUD A;  3DFH A;  5IP4 D;  3UCD A;  3RAQ A;  5DB8 A;  2J42 A;  5DPR A;  4ASW C;  1QOB A;  2JZZ A;  2IGH A;  2OZ8 A;  3CW2 C;  2OVL A;  4EZ9 A;  3OPS A;  4M04 A;  4ZRK A;  1LB2 B;  1FIQ A;  1DOX A;  3DBH I;  3HW2 A;  1YN3 A;  3QX7 A;  3FG2 P;  2MHJ A;  4KN7 A;  4KLO A;  4MGK E;  5BMH A;  3D2H A;  3UPQ A;  4OJP A;  2ZIU A;  4J9M A;  1AHV A;  3C5F A;  2XEW A;  3DQV A;  3B0X A;  4ECQ A;  3HT3 A;  1NK6 A;  1P0R A;  4IWP A;  3A1Q A;  2DYO A;  3LB8 C;  1FCC C;  4YXM A;  3ZI4 A;  5J2J A;  2C3D A;  2ZC8 A;  3QZ7 A;  1PK1 A;  1NZB A;  1D8L A;  2HOF A;  2NPT A;  2BDP A;  3NUQ A;  2GGJ A;  2R8K A;  3UQ2 A;  3IAM 1;  4FAD A;  2F8L A;  4HPP A;  5FK9 C;  2W11 A;  2HI0 A;  3UGB B;  1T3N A;  2P13 A;  1MBT A;  2KSO A;  4E6M A;  3QU5 A;  3ZLZ A;  4DFK A;  2WAQ C;  3J81 j;  2M9N A;  1MPE A;  5AHX A;  5D79 A;  2KO3 A;  3AE9 B;  3TEY A;  1SGH A;  3V6C B;  2MBB B;  1YX6 B;  2AHO B;  1HEK A;  3CT2 A;  3KHL A;  1WGH A;  1EC7 A;  5AKK A;  3UIN B;  2GWS A;  3PO4 A;  2OO6 A;  2K8B A;  4RPZ A;  3DPD A;  2ACZ B;  3SJN A;  2EZY A;  4DHZ E;  2FMS A;  4UAU A;  4WQO B;  1SJH D;  2YVF A;  3N6H A;  3FYH A;  9ICW A;  2NQW A;  3P3B A;  2HBJ A;  2HXU A;  3FKY A;  5J2E A;  2K25 A;  2F2A B;  2NO5 A;  2X38 A;  2EQ9 A;  3UQB A;  4GIB A;  2GBN A;  3FAH A;  1GET A;  1WIA A;  2EDU A;  1S5L U;  3PX4 A;  4EEY A;  3TFR A;  3WA0 A;  3RO6 A;  2GLS A;  2DZK A;  4IW0 A;  3QUT A;  5AKE A;  3QNM A;  1RLF A;  3RR8 A;  3SQS A;  3M7D A;  5CEH A;  4X5V A;  2LWP A;  2NYV A;  2YX8 A;  5HKH A;  2KKV A;  1GJZ A;  3N97 B;  5J2K A;  4P1B C;  1XAN A;  1Z00 A;  2HHW A;  5H92 C;  2BGF A;  1ZMD A;  1ZD2 P;  1E5W A;  3FV9 A;  1TK8 A;  1QQ7 A;  1DK2 A;  3Q6B A;  2YQU A;  1NNL A;  4REZ A;  5IIO A;  1MG4 A;  4E71 A;  3MSY A;  2IHN A;  2Y4G A;  1K1Q A;  1MBB A;  5FS9 A;  1YZ6 A;  3KZI U;  2CJN A;  4ADW A;  4KIT B;  3LB8 A;  4OHJ A;  5F3X B;  1SJB A;  3DFY A;  5MPO A;  2Z7J A;  1GNU A;  2WF5 A;  4O3Q A;  2HVI A;  3VA8 A;  2J4X A;  3CGE A;  3M3J A;  1SXE A;  4HK2 A;  1KW4 A;  4J9P A;  3QXG A;  1SBB B;  2QJN A;  2WPE A;  2C7M B;  3OPX A;  4ZDV A;  3RCY A;  9ICL A;  4UAV A;  3GRS A;  4I28 A;  4KSL C;  3CGB A;  1CRX A;  3HVZ A;  2OG9 A;  2O6V B;  3KOO A;  5AI6 A;  4RGT A;  2ZAD A;  1OGW A;  2MRL A;  1OFF A;  4FHJ A;  2I5H A;  2WXH A;  1C7Y A;  9ICC A;  5HP4 A;  3HX0 A;  1QZE A;  3VUW A;  2N7E A;  5CTR C;  3Q8P B;  1SJE D;  3PZ8 A;  2WXL A;  1O03 A;  3ZO5 B;  2Z8L A;  3WKB A;  3HP6 A;  4NY0 A;  2KHV A;  3M6K A;  4YTN B;  4J9N A;  1WGY A;  3IAS 1;  1DZN A;  1SEB D;  3U2S C;  1W1L A;  2OFJ A;  3TWA A;  2PLP A;  5AM0 A;  1TK0 A;  1DGJ A;  2NCN A;  4ACF A;  2VJ5 A;  2WPC A;  3QKE A;  4NLN A;  1QQ5 A;  4IRD A;  2KFZ A;  2O56 A;  5L83 A;  2I1J A;  3IG8 A;  9ICJ A;  1ZQF A;  4TKN A;  5KG0 A;  4BUG A;  2YEP B;  1ET6 A;  4Q2J A;  1BKH A;  3Q8M A;  1MQ3 A;  7ICE A;  3KWL A;  5KG3 A;  3Q8Q B;  1RXV A;  2MBO A;  3S1C A;  4UB6 U;  4B9M A;  2E8N A;  4FZN A;  4A3R A;  3NOB A;  1JCT A;  3VR8 B;  3WK4 A;  4YD1 A;  4AYB C;  1X40 A;  2BW2 A;  1MNS A;  1B43 A;  1X9S A;  1N56 A;  9ICM A;  3FIL B;  8ICJ A;  1UWM A;  4CHK A;  7ICO A;  4NLC A;  3WKA A;  5HHZ A;  5DPT A;  2LGD A;  1K8R B;  2KFN A;  1F52 A;  5ALJ A;  4M01 A;  2CPR A;  3ZTD A;  5J29 A;  5GTH U;  2HHX A;  4JN7 A;  5AKI A;  4EZK A;  2WF6 A;  4GFJ A;  2DHZ A;  2KXJ A;  4QIW C;  2LXA A;  2XID A;  4FBT A;  5J17 A;  3VC6 A;  2EMT A;  4AP9 A;  1N5W A;  4H4U A;  3N4M B;  1S1Q B;  3RD2 A;  5I4D A;  3H8S A;  4PL1 A;  5AKL A;  3QK0 A;  5L1I A;  3PW2 A;  1WM2 A;  1CMX B;  1NHS A;  5CRX A;  2DEN B;  2LYB A;  3TBL D;  1XHC A;  1DIQ A;  2XIC A;  5EE0 A;  2OCE A;  4QW9 A;  4PK1 A;  2F1I A;  4JIO U;  4F4R A;  3PX0 A;  4ANV A;  3ETR B;  2NBW B;  4MM3 A;  1N6Z A;  1M6I A;  1BPB A;  1XDI A;  2JEI A;  4W9E A;  4KLJ A;  2YVJ A;  3UXN A;  4RQ7 A;  5AWV A;  1VD2 A;  4NLK A;  2YTU A;  9ICE A;  3LVV A;  4XE0 A;  1W1Q A;  5J0S A;  3R07 C;  2QB0 B;  1NI3 A;  4J56 A;  2ZJD A;  3RCZ A;  3MDC A;  1JOA A;  1WE6 A;  4IZG A;  3U7D A;  3WIM A;  3FYY A;  3BYT B;  2FID A;  4W9I A;  4D2K A;  4J9Q A;  2KQS A;  4IUM B;  2VAO A;  1Z4N A;  2JXJ A;  4RT2 A;  4FUL A;  3OG5 A;  5J8Y C;  2EQ7 A;  3T8M A;  5AK4 A;  8ICF A;  4I2B A;  5AI8 A;  4LVS A;  4J3O D;  4I2D A;  1LGR A;  2LGI A;  2N9X A;  1X2G A;  4KTQ A;  3AEE B;  1F9J A;  3QFA A;  3ZLG A;  5DCN A;  3N1Y C;  2LFI A;  1JIH A;  4MFF A;  1QKZ A;  2HHS A;  1K5O A;  2E5S A;  3BWU D;  1NYR A;  1I42 A;  4HJG E;  3ZJV A;  4H4Z A;  1LKY A;  3PZD A;  2FI1 A;  4X2P A;  4ENL A;  1RQN A;  1UWX A;  3OJS A;  2BPF A;  2QIE B;  2RPV A;  3RNA C;  4O3N A;  2DYB A;  1ZQV A;  2R61 A;  2NPX A;  2WNM A;  5ALO A;  2ZTC A;  3AEV A;  4NNJ B;  4P2H A;  2MSE D;  5D3I B;  1L2N A;  2GH1 A;  2K8A A;  5AK3 A;  1D8Y A;  8ICT A;  4ICU A;  4M8N A;  1RYU A;  4DL7 A;  4GYP C;  4ZA0 A;  5DG7 A;  5J2D A;  1QSY A;  5KG5 A;  2ONE A;  5AKZ A;  4Q43 A;  4P4M A;  2N1W A;  4KEM A;  1Q46 A;  4DCC A;  4RGM A;  1COO A;  4ANU A;  5AI9 A;  3DBL I;  3KHR A;  3RN9 C;  3UIO B;  4MFA A;  2PTL A;  1FIQ B;  1ZQK A;  4OVV A;  3PO5 A;  1AOG A;  2G9H D;  3W5V B;  3IVF A;  3FJ4 A;  4YSY B;  3BZC A;  2WPF A;  1T0S C;  2ZZC A;  5C5J A;  3D32 A;  2VFV A;  3JVA A;  4A3O A;  3N28 A;  1RRB A;  2KVZ A;  2BQR A;  1ZD4 A;  2CU3 A;  2GBK A;  4KLG A;  4EX7 A;  5IIK A;  2B3A A;  5KTQ A;  1NKC A;  4K4I A;  2MSN A;  5F9L A;  5DLG A;  9ICQ A;  2IPK D;  4Y2Y A;  4GR1 A;  3RIT A;  3RRH A;  4DDG D;  1UEL A;  2WXG A;  5FJO A;  1YZ7 A;  3EPG A;  1SV4 A;  1SWV A;  2GGE A;  4FDC B;  5KFD A;  3VH3 B;  3C29 A;  4WJQ A;  3P93 A;  1K4Q A;  3W8Z A;  2Y0S C;  3ZVH A;  1GPX A;  2KC1 A;  1K50 A;  3P0W A;  1Z00 B;  3N3K B;  3NVZ B;  4RM9 A;  4ED7 A;  2XK5 B;  4C4S A;  5G55 A;  3I6E A;  1A77 A;  3HRD D;  7ICT A;  1ZET A;  1G6J A;  3CYJ A;  2REX A;  2M56 B;  1HA5 A;  3MJ5 A;  1E0Y A;  3KHH A;  1T94 A;  1FNU A;  4TQ1 A;  3RNE C;  5JH5 C;  1SKS A;  4LZG A;  2NRW A;  4L1B A;  5BOM A;  1LO5 D;  1JQ4 A;  3K75 D;  2KMM A;  5BYR A;  4II2 B;  4B0M A;  9ICU A;  4BXO B;  2IHM A;  3MGV A;  5KFB A;  4KLE A;  1NEN B;  1KFS A;  1A6S A;  7ICN A;  1L7Y A;  1N62 C;  2UVW A;  2JR5 A;  1WFY A;  3OSN A;  2KTF A;  4ECS A;  2MUT A;  2IOF A;  1KKO A;  4M52 A;  3UXO A;  5KFG A;  3PRE A;  3PRZ A;  4JX1 C;  4AYB F;  3ZRC A;  4DWD A;  4HCH A;  4RQ6 A;  1WE7 A;  2K8C B;  2NVU I;  4TUR A;  2KOX A;  4C4T A;  4EWJ A;  1E8W A;  3SR6 B;  5AE1 A;  4AQ7 A;  4QZ9 A;  1KKR A;  4H4W A;  4IOI E;  1ZXI C;  3V3X A;  3ZUN A;  1KFT A;  5C3J B;  1TS3 A;  3I57 A;  4MH0 E;  3VAW A;  4F4X A;  2FDR A;  2WHE A;  2HOI A;  2ASD A;  2PFO A;  1GRG A;  5DBB A;  3ZNZ B;  1ZY8 A;  3A0B U;  4P0Q A;  4UW9 A;  5AK5 A;  3PO0 A;  1W1S A;  2WF7 A;  1ZPS A;  3I99 A;  4Y2U A;  4JWU C;  5AM1 A;  5AK6 A;  1FFU C;  1NDD A;  3PW0 A;  3QA8 A;  2DBY A;  2F1J A;  9ICX A;  2HBK A;  1CZP A;  1SXT A;  2BTE A;  4WWP A;  4LZD A;  2RQ5 A;  2KKC A;  4GRT A;  2JEF A;  2MU2 A;  1ZQE A;  5U25 A;  5C0Y A;  3HW8 A;  2KD0 A;  2BZF A;  4PYZ A;  5KFV A;  2HSZ A;  1XCQ L;  4NJ8 A;  1NK5 A;  8ICU A;  2R18 A;  1TIF A;  4O5C A;  1GRA A;  2QDD A;  5DGB A;  4DFJ A;  2JZ3 B;  4FX9 A;  1F5S A;  2C5L C;  4PHP A;  1KTK A;  1S3S G;  2RDI A;  2W3S A;  1R4M I;  2ZVN A;  4A90 A;  4ARC A;  1TYP A;  4W9G A;  2KV2 A;  3QAR A;  2OZ3 A;  3PTF C;  4EQX A;  2D8C A;  1JML A;  3AQF A;  1ZE3 D;  3D2N A;  3K9P B;  4UQG A;  3ECI A;  4R8U B;  3DV9 A;  3M95 A;  4PT5 A;  4DXA B;  1EM7 A;  2E5A A;  4J9S A;  3T5H A;  1IYX A;  3RFA A;  2MQJ A;  4LDT D;  3QFB A;  4ZHO A;  1WR6 E;  4IWO A;  4YXD B;  2WU5 B;  1GV4 A;  2Y5C A;  4AJW A;  1ZQH A;  3N1Z C;  2MEK A;  1MVK A;  3VRB B;  3QLD A;  2W03 A;  4DS4 A;  3L08 A;  5DB6 A;  1TS4 A;  2N0S B;  5IIN A;  1TTN A;  4CE6 A;  5KFX A;  1ZQD A;  3PK7 A;  2INP E;  4KLF A;  4K7Z A;  2HE7 A;  3UF8 A;  2EAN A;  1JWU D;  3IP4 B;  4TUQ A;  1E9I A;  3WCQ A;  2GQT A;  5IAA C;  1J0G A;  3LDA A;  3R66 C;  3MR6 A;  4KIK B;  1GXF A;  3RBE A;  4I2H A;  1KFY B;  3HM6 X;  5AZG A;  8ICR A;  1NBF C;  3BQ7 A;  3DER A;  1IIP A;  1LVH A;  1WWU A;  5AZH A;  2L3Z A;  4QAY A;  2DYM A;  4JHM A;  4EBE A;  3EJB B;  4URK A;  5JHA A;  3RH6 A;  2ZIV A;  1B0X A;  2W3R A;  5GTI U;  2R8H A;  1OQR A;  3LXF A;  1T6B X;  2J3N A;  2CR5 A;  3L4P A;  4YSX B;  1VZ8 A;  2AU0 A;  4C00 A;  2I0K A;  2BYF A;  4J03 A;  3S5S A;  2IND C;  2ASJ A;  1EBH A;  2V4Q A;  3BQ1 A;  3SEB A;  4FP1 A;  1Z19 A;  2KAC A;  3SHQ A;  2CFY A;  2GGH A;  1SE4 A;  2JWZ A;  2XGZ A;  3NG0 A;  4WIP A;  2KJ6 A;  5KVH A;  3LVW A;  1PK3 A;  4DQO C;  4BCA A;  2BS2 B;  4FJY A;  2AQ0 A;  5JZE B;  5ADZ A;  1I4G A;  3PX6 A;  2ZIX B;  4XWT A;  1ZQM A;  1V9P A;  2KZR A;  4UB2 A;  5AKY A;  2F44 A;  4A55 A;  1C9F A;  5KG7 A;  1F2R C;  2UUU A;  1EXN A;  3DDC B;  2WOV A;  1YMH E;  5DQI A;  1U47 A;  2KMD A;  1ZKQ A;  2FBW B;  2PA6 A;  2V6O A;  1BZL A;  2GGG A;  3RRA A;  1QQR A;  4M0X A;  4JB1 A;  3DHH C;  2FAZ A;  4QNL A;  3GS2 A;  1SKR A;  3JW0 X;  1GAQ B;  2IGD A;  2D6F C;  2B76 B;  4C80 A;  1BT0 A;  2WXM A;  4J9K A;  3ZDM C;  3BQT A;  4KZ0 A;  4F50 A;  2PP1 A;  5CHV C;  1L0V B;  3ZNG C;  2ASQ A;  4LJX A;  4IR1 A;  2Z0D B;  3RH5 A;  3AQE A;  2FLN A;  3BQ2 A;  3KVF B;  2QIL A;  2P0I A;  1FXA A;  2H3I A;  2H3Z A;  7ICU A;  1P3Q U;  2ESE A;  4TUU A;  4FZM A;  1V2Y A;  2O2V B;  4DL2 A;  4WWO A;  2BQ3 A;  4DSI A;  4IM2 A;  1KFD A;  3WKC A;  1I4X A;  1MJD A;  1T0R C;  2BHN A;  3CNH A;  2GB1 A;  4A20 A;  1J2M A;  1B4F A;  2MBE A;  5A0L A;  3WK6 A;  3V05 A;  5G5H B;  2KHQ A;  2Z59 B;  2CU1 A;  4R3D A;  2V3P A;  2CHX A;  4G3X B;  5I1W A;  3TAD A;  4RQN A;  1MRA A;  5BMG A;  3Q8R B;  2RAB A;  4GU2 A;  3II4 A;  2JXT A;  3RR1 A;  1VQZ A;  4YCX A;  2N9E B;  4JK1 A;  1WJ6 A;  3W2D A;  1L7M A;  2BPS A;  1F3P A;  3NVZ A;  1FEB A;  1WUF A;  1SB3 C;  4WH4 A;  4Q44 A;  3IXS A;  3H0L B;  4LNO A;  3IC9 A;  2W7O A;  2W54 A;  4QZE A;  1ZXH A;  4FBJ B;  4KSK C;  3Q3F A;  2PMV A;  1UPH A;  1ZQ1 C;  4NLZ A;  4NM2 A;  1TS2 A;  3DHI C;  2Q4T A;  3QWZ B;  1ZD3 A;  4F5N A;  1ZQB A;  2VA3 A;  3R0K A;  2BCV A;  4M0A A;  4N58 A;  2PEA A;  2ISP A;  1TYT A;  4M8M A;  3CGC A;  4F5P A;  4YR3 A;  1UA1 A;  4F4K A;  3LLB A;  2RGF A;  2WX0 A;  1WX7 A;  3H8A A;  4MEX A;  2X8X X;  2BDU A;  2KQ7 A;  3VH4 B;  5CHG A;  1XO3 A;  2RDH A;  4UAT A;  1A0P A;  3LYS A;  1V86 A;  1WX8 A;  1OQY A;  3PSI A;  8ICW A;  3MUC A;  5FS7 A;  2ZJ8 A;  2JVC A;  1P43 A;  4O0I A;  4DHG A;  4KX6 B;  3UMG A;  3MGH A;  1Q1O A;  4RF1 A;  4F8C B;  7ICP A;  2H89 B;  4GC6 A;  4EEN A;  2OM6 A;  5B66 U;  4K4H A;  1FPY A;  1YEY A;  1BWC A;  1L8O A;  3PVX A;  4TUP A;  5KFZ A;  3GV5 B;  5DQG A;  4EBC A;  4USA A;  4DQQ A;  4B9L A;  3RB3 A;  2LVO A;  1X66 A;  1S8O A;  1FHU A;  3QPE A;  1X42 A;  2PMZ C;  1ZQR A;  4FN2 A;  4EX6 A;  2AKM A;  1ZK7 A;  5ALP A;  4Y2Q A;  5KFF A;  2Q0Z X;  4NAW A;  4I29 A;  4DL5 A;  4P0Q B;  4ZRP A;  3R7R A;  1I4Q A;  2DKX A;  3BZK A;  5U1O A;  2KJ8 A;  3V7K A;  2DGZ A;  4FS2 A;  2BCU A;  1F44 A;  1D5Z C;  2KC2 A;  3HVD A;  2LJ5 A;  4M9G A;  5ALW A;  4B6W A;  2K89 A;  4EEW A;  3D2Q A;  3EA6 A;  4YMM A;  3MR5 A;  1P7D A;  3NZ3 A;  2KX3 A;  1PGB A;  5CWR A;  3DVN U;  2M0N A;  3PST A;  2DZJ A;  8ICH A;  1JPD X;  2J0M A;  4ED8 A;  3QEA Z;  4E8G A;  5HMM A;  5J8Y A;  2W7P A;  2LPE A;  3EEZ A;  2ES6 A;  8ICL A;  2KOB A;  4F71 A;  1XLO A;  3KQ4 A;  5ALZ A;  3GV7 B;  1ZQO A;  3OTR A;  2A19 A;  2L83 A;  2WQY B;  1QF6 A;  2BPC A;  1GRE A;  3E56 A;  4BWJ A;  1BUI C;  1M4V A;  2AYO B;  3TJI A;  3ICX A;  1YNT E;  3PZP A;  2Q5W D;  2JH1 A;  2AGP A;  1MDL A;  2KSO B;  2WWZ A;  1JMS A;  4C4V B;  5KG2 A;  2G45 B;  2ZIW B;  1KTQ A;  3BS5 A;  3LK9 A;  3ZJU A;  1RZT A;  4F2S A;  4A3P A;  1ET9 A;  4LDT B;  5KFQ A;  1E8H A;  2K5P A;  1Z2M A;  1PK1 B;  1P98 A;  3TAC B;  3PWG A;  2J6S A;  3W1S C;  3RJJ A;  1WSP A;  2N9K A;  3A1Q B;  9ICR A;  4IDI A;  1XSP A;  2GBM A;  1NZP A;  3H8J A;  3PGE A;  2OJR A;  4IQU A;  3IG5 A;  5CJ7 A;  2MJE A;  1KQQ A;  5ALI A;  1GUA B;  5FXE A;  3L5O A;  1JAL A;  4ML8 A;  4DF8 A;  1NKE A;  1ZX9 A;  4Q45 A;  1ZQL A;  2P6U A;  1QTM A;  2KZZ A;  2O6V D;  2VFT A;  4PGQ A;  4BV6 A;  7ICM A;  4O1N A;  3R2T A;  2RDJ A;  3TIX A;  1XF5 L;  2MJ3 A;  2M8S A;  3JVZ X;  2D3C A;  9ICP A;  2RK5 A;  2I2Y A;  3CWI A;  3QU2 A;  1EWC A;  7ICH A;  4NAW B;  2OAI A;  2GR3 A;  3JPQ A;  1T8E A;  2UWQ A;  2VRR B;  1V5T A;  3QE9 Y;  5JRB A;  4NWI A;  4RFB A;  5JCM A;  3H7V A;  3Q3N C;  2KVS A;  1KN0 A;  2ZCC A;  4KV2 A;  5L1L A;  2AWT A;  2PU1 A;  1QOA A;  3AEA B;  4MSQ B;  3VTW A;  1S77 D;  3GZF A;  5KFM A;  3ONN A;  2AGO A;  3CAW A;  1V38 A;  1YX5 B;  3IN5 A;  3TUO A;  1WXV A;  3ZDT A;  2R8I A;  4KPR A;  4CF4 A;  2P3Z A;  1CK1 A;  1ZR6 A;  3ZDA A;  2FJ6 A;  1A5R A;  2I5Q A;  3ALR A;  3RBD A;  1WF9 A;  3AUL A;  5ALT A;  4JMU A;  3H6N A;  4Z1Y A;  2MAX A;  3Q8K A;  1WYW B;  2NBV B;  2PLS A;  2PKE A;  2A3V A;  3VCC A;  3ZTC A;  2BBC A;  3MTN B;  3UMC A;  1EF5 A;  2KFK A;  1COK A;  3IBE A;  4MF2 A;  1VZ6 A;  3NFU A;  3M1Y A;  4RT3 A;  5KFP A;  5KFS A;  1OTR B;  2XVT A;  2DF4 B;  3U7Z A;  4BVU C;  3Q6J A;  2KDE B;  2V4L A;  3SD5 A;  4M9J A;  1H8C A;  1WVE A;  2D3B A;  1S76 D;  2YMM A;  2BWE S;  3AUO A;  2EQ8 A;  1AHU A;  3IJI A;  2F3N A;  2I6X A;  5D3D A;  3PQB A;  1TY0 A;  1XLN A;  1ZQA A;  2KKP A;  3DGZ A;  2HVH A;  1HQR D;  4ECT A;  1KJT A;  3SN4 A;  4EQS A;  4TQS A;  4NEV A;  3E58 A;  4U7C A;  4PZO A;  1BPE A;  1VR9 A;  2UVV A;  2JGA A;  4DXG A;  2KLG A;  1ZW7 A;  5B5E U;  4ROP A;  1U49 A;  4KN4 A;  5D4B A;  3Q8E A;  4TUS A;  4YTM B;  3NVV A;  4F8R A;  2HHT A;  1X9M A;  2JWU A;  2GGI A;  5FXP A;  2L00 B;  2DPJ A;  5JCN A;  2VA8 A;  7ICF A;  1EU3 A;  3DH9 A;  5D6J B;  2K4P A;  5IIM A;  4O3S A;  1UNS A;  4RQ5 A;  4PGX A;  5JUM A;  4YWS A;  5KFA A;  5AM4 A;  1EF1 A;  1VJ5 A;  2FCS A;  4HNL A;  3A9K A;  1QT9 A;  4EOY A;  4U6P A;  2AL3 A;  2PFQ A;  1F0X A;  1OEP A;  3I5J C;  2C2R A;  1XT9 B;  3TCA A;  2D10 A;  5ALD A;  3NRW A;  3PT2 B;  2WDW A;  5ALY A;  2QLT A;  3UJS A;  3PLU A;  2IMW P;  3NZG A;  4H4X A;  4HCN B;  4M2Y A;  4PS3 A;  2A5U A;  2B21 A;  2NRZ A;  2M19 A;  2BVF A;  3IK4 A;  5KFY A;  1NYQ A;  3GIJ A;  3ZDB A;  5E6O A;  4O5K A;  1BPZ A;  3W5U B;  2K60 A;  2FCQ A;  2VH2 A;  5AIC A;  1D6E C;  3R0U A;  4NL9 A;  1SL1 A;  3BZD B;  3NUH B;  2EZZ A;  4WJP A;  1C76 A;  2IPI A;  1NK4 A;  7ICI A;  1KM7 A;  2HMX A;  2FCM A;  4BDP A;  4M6W B;  3Q8F A;  3B97 A;  4DLE A;  1L6V A;  3KUM A;  4DX3 A;  3V4B A;  1E8X A;  1MDR A;  1KLV A;  5E6J A;  2VFR A;  5ALL A;  1UBI A;  3T4W A;  1ENF A;  3CK5 A;  3TX1 A;  1QLB B;  1IXR A;  4OO1 J;  2FPM A;  5AM2 A;  1QCK A;  2JMG A;  3BYY B;  1Q3U A;  4J1O A;  5AKX A;  2E8O A;  4OJ6 A;  3EGR A;  4TV3 A;  3VR9 B;  4W9K A;  3ZNI D;  1FFV A;  3ZW3 A;  2AL2 A;  4ELV A;  3ONS A;  2BWF A;  3QUQ A;  4DL6 A;  1SL2 A;  2EZX A;  3QU4 A;  2XY6 A;  2J53 A;  3PR4 A;  4KLI A;  3TJ4 A;  2L1A A;  1MSW D;  2ZNV C;  1DII A;  3L10 B;  4X57 B;  2AXT U;  4OCZ A;  8ICY A;  3WK7 A;  4M0W A;  1H2I A;  4I2G A;  2KJH B;  5DG9 A;  4BZA A;  4NQK E;  5EWG A;  1DK3 A;  4XYC A;  2KP7 A;  2Y3R A;  4QWE A;  7ICS A;  2WXK A;  3KWV A;  1WJ4 A;  4IHC A;  1EBG A;  3VDZ A;  2RLT A;  4H1Z A;  2R8J A;  1WGD A;  1XCT L;  2C7H A;  2KAJ A;  4I6P A;  3QN3 A;  2F77 X;  1FFV C;  4C8M A;  4FI4 A;  5AKJ A;  4QZD A;  1P9D U;  4DFM A;  2EKI A;  3EW9 A;  4PH5 A;  4H4V A;  4R8U A;  1KH0 A;  4WWM A;  4N59 A;  2D11 A;  1D3Z A;  1OEY J;  2O6V A;  2WS3 B;  2YVS A;  1K52 A;  2IOF K;  2AL1 A;  4ED1 A;  4EMI A;  3PZ7 A;  2V9W A;  1ZDL A;  3SYZ A;  3B2G A;  2ZZP B;  2DAJ A;  1VRA B;  2K6D B;  3W1S A;  4FO6 A;  2PFN A;  1YJI A;  4J57 A;  2JH7 A;  5FJT A;  2FYM A;  2INC C;  4OD0 A;  3TSH A;  2KD1 A;  5ALU A;  4M6W A;  4NPN A;  2LRU A;  2V3B A;  1MG8 A;  4FJZ A;  2EAP A;  5DDY A;  4DLG A;  4KGS A;  2MP2 B;  4NV0 A;  4XUS A;  2CHZ A;  4RZR A;  1E6E B;  3QIJ A;  4PHA A;  5IA7 A;  5D49 A;  4P16 A;  5KG4 A;  2BC1 A;  1Q8K A;  4G0N B;  5JU5 A;  4DOC A;  2DNF A;  3SV3 A;  2CN1 A;  2P35 A;  3B0Y A;  7ICV A;  3T79 A;  1IGC A;  2KTR B;  2MWS B;  3AE5 B;  2YVG A;  1ACC A;  4YT0 B;  2AH5 A;  2ZIX A;  4UAZ A;  1R4N I;  3QHT A;  3RB0 A;  2K3U A;  3AU4 A;  2E1E A;  3C8Y A;  4C4V A;  3CSF A;  2IA6 A;  3NRZ B;  2J7Q B;  3NS1 B;  3VUY A;  4IT1 A;  3VRA B;  4C8L A;  3Q8L A;  3M9M B;  1JUD A;  2EAM A;  1Q3V A;  2ZTE A;  2J0J A;  2ZPY A;  4HYK A;  3MY9 A;  4MGZ E;  3MP9 A;  5AEK B;  1X1M A;  1FEZ A;  3MR2 A;  5IN7 A;  4F5O A;  2MUT B;  2JZP A;  1BVS A;  2EH9 A;  3KLS X;  3NY5 A;  3O0F A;  4YWO A;  1LPF A;  2KTR A;  4CRX A;  1SV0 C;  2YEP F;  4HDQ A;  4B9U A;  5L1M A;  1SJA A;  4IR9 A;  3IT6 B;  2IO1 B;  4PZF A;  4DFD A;  3D2S A;  1PVQ A;  2X8G A;  4E0D A;  1PUT A;  4AJY B;  3BSM A;  4RNO A;  4QZB A;  1UT8 A;  3Q8C A;  3QCA A;  2H88 B;  1YJJ A;  2XH4 A;  1CUK A;  4ICA A;  4DQI A;  2BQQ A;  3Q14 C;  1F9C A;  1RVK A;  1RQL A;  5KVI A;  2G09 A;  5H2F U;  3H12 A;  3CIR B;  2N7D A;  4XZ4 A;  4PS7 A;  1W1R A;  4O3P A;  4PVE A;  3JW7 A;  4Z17 A;  1RG6 A;  2IY1 B;  2FIF A;  1K51 A;  1FXT B;  3GC2 A;  2QC8 A;  4GB9 A;  1I4H A;  2CDU A;  2C22 A;  2V1Y A;  1BML C;  2WXO A;  3B1L X;  5DB7 A;  3A9J A;  3SU8 X;  3B08 A;  2IBI B;  3GD3 A;  3RF9 A;  2D3G A;  2V3N A;  4E4F A;  3H7P B;  2V9H A;  1WGK A;  4QZ8 A;  5TR5 A;  4B9K A;  1STE A;  2J52 A;  3AMZ A;  3VXW A;  2PSN A;  4UB8 U;  4K7W A;  3DBR B;  1AWD A;  1TBE A;  2P66 A;  2KFK B;  3L17 A;  3IFW B;  4DWF A;  2KDB A;  3QUB A;  2NVK X;  2XN9 C;  4DEZ A;  2X50 A;  1PVR A;  2PGW A;  4JN8 A;  2A1J A;  4ICV A;  3KFU F;  1Y8R C;  4P4O A;  5KFE A;  2AEH A;  1NK0 A;  4HXD A;  4WAF A;  1MOK A;  3MZN A;  4GIV A;  4FLH A;  3G6V A;  1FM0 D;  1UGJ A;  2DAF A;  2BVH A;  3GRT A;  4W9L A;  5J2B A;  9ICN A;  4AOF A;  3H8H A;  3R1Z A;  1V49 A;  2JSV X;  2M1M A;  5T8I A;  2BT6 A;  3ENE A;  2K4E A;  3HHM A;  4P7I A;  1P48 A;  1WVF A;  3D2D A;  3FC4 A;  2KIW A;  1ZQQ A;  3ISB A;  5FMH A;  4ANX A;  4R63 A;  3SAG A;  9ICT A;  1LVL A;  3P42 A;  4DNS A;  1ZQN A;  4ITK A;  1ZGU B;  2UYZ B;  4RQ3 A;  4K1W A;  2LMC A;  2J0K A;  3ZKJ C;  4HYR A;  4O5E A;  1LM8 B;  1R6W A;  3Q45 A;  1QIL A;  2F8K A;  3GE8 C;  3FXG A;  4Y2S A;  3BQ0 A;  1GRH A;  1IBX B;  1GRT A;  2JQR B;  2OJW A;  3C2L A;  2BVC A;  4HVB A;  1FXI A;  2ZIW A;  2JUO A;  4HPM B;  4EFO A;  1X9X A;  3TQ1 A;  2FE9 A;  4NJ6 A;  2KIV A;  4ECU A;  1LKY B;  2DW7 A;  1O08 A;  1JW9 D;  4LJP B;  2F1H A;  8ICP A;  1YQB A;  5T14 A;  4K1R B;  3NRZ A;  9ICH A;  1AYF A;  4KKI A;  4N6E B;  2DL0 A;  3IT4 B;  9ICO A;  1NEL A;  1TGZ B;  2W04 A;  2FUH B;  4WAA A;  2G06 A;  2LGX A;  2K22 A;  5E6P A;  2QDE A;  4MFC A;  1V81 A;  4JQW C;  1CEZ A;  4QZF A;  2Y3S A;  3RI7 C;  1QLT A;  5L1J A;  1E8Z A;  2KG5 A;  2POD A;  3NVW B;  4CNQ A;  4FFD A;  3OJ3 A;  3FDS A;  1I4P A;  1PDY A;  1X2I A;  3DOW A;  3BS5 B;  1BNP A;  4IKG A;  3SZ2 A;  5ER0 A;  5GRT A;  3HSU A;  4WUR A;  4WQM A;  4NEW A;  2OQH A;  1AN8 A;  4HKQ A;  4K81 A;  5ALS A;  1S9F A;  1RYS A;  3TJP A;  3ZIM A;  1IYF A;  3BW7 A;  5AE2 A;  4FXC A;  2LGY A;  4KLQ A;  4BBY A;  3PVL A;  4DSK A;  3K9O B;  4DK5 A;  5LNK 1;  3GV8 B;  1NJY A;  2FMP A;  2LI5 A;  3HIL A;  2PVG C;  2DFL A;  2G0A A;  1VDV A;  5CHF A;  2LM4 A;  3A4S C;  1V9J A;  1HE8 A;  1JRU A;  3ISC A;  1RFK A;  2JRI B;  3DBH B;  5IOI A;  5J2A A;  4CQN A;  2BKR B;  1ECQ A;  1N5W C;  3APC A;  2NTS A;  1Z1V A;  2G07 A;  4Z6F A;  3MFI A;  4EYI B;  2SAK A;  3S1E A;  5CX3 A;  4Y2P A;  3A4R A;  1X6J A;  5JXV A;  2LUE A;  4I6L B;  3KYC D;  2QVH A;  3RB4 A;  2WHI A;  3Q8B A;  2K4H A;  4R64 A;  4GFI A;  4FBU A;  3S2A A;  1KDH A;  4PPX A;  3MHZ A;  4YR0 A;  4W9J A;  4AS1 A;  2YMQ A;  3OWE B;  2QDF A;  3TMP B;  4KLD A;  2KN5 A;  1R4N B;  3BJS A;  3IHP C;  4GXB A;  5JCI A;  3K4G A;  2GDQ A;  3GE3 C;  4QWD A;  5EE1 A;  3RR7 A;  1V5O A;  3L5K A;  1V80 A;  2QCZ A;  2UU7 A;  2WBA A;  1EC9 A;  2LVQ A;  2YY6 A;  1WR1 A;  2LUM A;  4YMO A;  1L7N A;  1DOI A;  3RPF C;  4BKS A;  4I27 A;  1XPY A;  5AI5 A;  3EFC A;  2QQ6 A;  1KF6 B;  1NKB A;  3P63 A;  4KDL B;  1E10 A;  3M62 B;  3A7R A;  4FE3 A;  2BCQ A;  5EU9 A;  1PZN A;  2DKZ A;  4YG2 A;  1L8P A;  1X9W A;  3UJE A;  5TIS U;  3Q4D A;  2INN E;  1Y56 A;  3I9V 1;  2Y08 A;  3U9I A;  3LDZ E;  1L8L A;  3C0P A;  4H4T A;  5L9X A;  3PM9 A;  1Y88 A;  4M9L A;  2JYE A;  2NO4 A;  4A8E A;  3QJZ A;  1L3T A;  1STZ A;  2RD0 A;  3DES A;  1C79 A;  2MA9 B;  1FEC A;  3TFS A;  4DHJ B;  3M9N B;  3VFC A;  2OX4 A;  1Z4O A;  4DSJ A;  1GC7 A;  2HCF A;  2FUG 1;  2KWD A;  2V0G A;  1XU4 A;  3QYP A;  4O3R A;  4I2I A;  2W0H A;  2O6K A;  4QJF B;  4C4R A;  2WFA A;  2DPI A;  4MEL A;  4MGY E;  1Z1B A;  1ZQC A;  2QPM A;  1WXM A;  5ALR A;  3TAD C;  4HAI A;  4DSL A;  3KJM A;  4C8K A;  2GQU A;  3GD4 A;  2KWU B;  2SEB D;  3IM1 A;  1XSN A;  1YJ1 A;  2QB1 A;  2LRW A;  3AEG B;  4EYH B;  4HRO A;  2FNJ B;  2XGP A;  2W8K A;  4FJV B;  3ML8 A;  3NS1 A;  5J0R A;  1ZJN A;  2VFU A;  1E8Y A;  3ZDD A;  5AKH A;  1Q1R A;  1FEA A;  2OOB B;  5KT4 A;  5FS6 A;  2LGS A;  3Q3J A;  1QSL A;  3S47 A;  2BQU A;  4O3M A;  3AE4 B;  2MBR A;  4GN1 A;  2L7R A;  1A76 A;  4E4U A;  4EC3 A;  3EJD B;  4H19 A;  3M63 B;  1NJZ A;  9ICB A;  4EUT A;  4CF3 A;  4O95 A;  3A7U A;  1TS5 A;  3KUZ A;  3HPF A;  3R11 A;  1XWL A;  4K8D A;  7ENL A;  1N2X A;  1EO6 A;  5ALE A;  1FCL A;  4EMW A;  3G6X A;  4F92 B;  4I2E A;  3LJ3 A;  5HFY A;  2OZT A;  2GR1 A;  5EDS A;  2ZJ5 A;  3F2D A;  9ICG A;  5DPW A;  3CMM B;  1GO3 F;  2MX2 A;  4UAY A;  3OLM D;  4LLG M;  8ICB A;  1UGM A;  2ZPN A;  2GMI C;  5AI4 A;  3B0A A;  3EFU A;  4PGY A;  3VTV A;  5BYS A;  5TR3 A;  3ZQ4 A;  4HCP B;  2PCE A;  3RJI A;  2C7N B;  2NV3 A;  3DEE A;  5IIJ A;  2HHQ A;  1S0V A;  2PIA A;  4YP3 A;  1WWV A;  4RNM A;  1J19 A;  2DWQ A;  2W82 A;  4DHJ D;  4MT5 A;  4E74 A;  4ZH4 A;  4RU9 A;  5GXG B;  2D2Q A;  3PSF A;  1V8C A;  2YQE A;  3DDM A;  4BX9 C;  4Y2R A;  5HHI A;  4RUA A;  4JWM A;  1ZOY B;  4ZYS A;  2W9B A;  2MBQ A;  4H4P A;  4QZI A;  1WZ3 A;  3WK9 A;  1D4B A;  3NHE B;  3D9X A;  4C7Z A;  4F4W A;  9ICF A;  3P2B A;  4ZYN A;  2AJQ A;  1ZQI A;  1D7Y A;  3DK8 A;  1ZQX A;  4YMN A;  4KKJ A;  2CHW A;  3ED5 A;  4IP5 A;  3ZNH B;  4XWW A;  1MI0 A;  2EQY A;  2K8H A;  1K1S A;  4JV2 A;  2C60 A;  4EKU A;  5DGA A;  4P4P A;  2WAQ F;  3UIP B;  3VQI A;  4IWQ A;  2L0T A;  4II3 B;  2NMQ A;  4PL2 A;  2G1E A;  3DED A;  1UCV A;  2CS4 A;  3R8B A;  3ABV B;  4C0Z A;  2AL6 A;  2PMQ A;  1TKD A;  5FJU A;  3L8K A;  4Z6E A;  3JPP A;  3WK8 A;  4ZRQ A;  1KEJ A;  3V6E B;  3RZW C;  4LII A;  1D9F A;  3C0R B;  1WWT A;  2DX5 B;  5AIB A;  3ZDC A;  1VJK A;  1V1P A;  4JL9 A;  2E6X A;  3OTQ A;  2KWV B;  3KUC B;  1TJE A;  3ZJT A;  3VC8 A;  3MDA A;  1W1O A;  4JDR A;  1H6V A;  4UBB A;  5KAI U;  2HDO A;  2JRZ A;  1JX4 A;  2PMZ F;  2R9Z A;  3DK4 A;  1ONF A;  1WX9 A;  4OZA A;  3POP A;  4QWC A;  2EAO A;  7ICR A;  4GLS C;  5DG8 A;  3MC8 A;  4S17 A;  3MQT A;  3BJY A;  5GMV A;  1RM6 C;  2V3A A;  2W9B B;  2E8M A;  1FNV A;  2MJD A;  1SWW A;  1WYG A;  4XDD A;  4TQR A;  1F0M A;  3C5G A;  5KL1 B;  4DL4 A;  1JCK B;  5TZV A;  3TWB A;  4DS5 A;  3TL5 A;  4KLT A;  5L6F A;  1KKX A;  3GD6 A;  3KH0 A;  4QZA A;  2HW3 A;  2C3C A;  3DDH A;  3O13 A;  3ZLH A;  3VCB A;  1NVI D;  3LXD A;  2I38 A;  5D94 A;  1XLQ A;  5DKW A;  1ED1 A;  3SR6 A;  4RQ2 A;  4BOS C;  4A6Q A;  8ICQ A;  1FFU A;  3GDX A;  3C2M A;  3TKA A;  1PQS A;  2CJO A;  3AE7 B;  3RT3 B;  2KYW A;  1AAR A;  3W9C B;  1VLB A;  3EKG A;  4IL6 U;  5J0O A;  1JWS D;  2XH0 A;  3JPS A;  3WAP A;  3OZY A;  2XY5 A;  1WJN A;  5HMR A;  1DGS A;  1QQ6 A;  3IJL A;  5JCL A;  3TQP A;  1HSK A;  2W9M A;  3ETR A;  1T0Q C;  3PV1 A;  4NJC A;  3VTU A;  4H4Y A;  1ZQP A;  1T0Y A;  1W1J A;  8ICZ A;  2N7J A;  1OEY A;  3F2C A;  4HCD A;  4MHV A;  1J7C A;  1GC6 A;  4HEA 1;  1ZXI A;  2JEJ A;  4MGI E;  4IL0 A;  5K4L A;  2VJ4 A;  1WM3 A;  2BF8 B;  4BKS D;  1YOV B;  5E79 U;  4FHK A;  4Y2T A;  1D8B A;  3H1U A;  3FW9 A;  4F4Z A;  4F3O A;  1YQ4 B;  3N20 C;  5H8Y E;  2YMP A;  3TSS A;  4MMW A;  4RQM A;  3JSV B;  3OAW A;  2PU0 A;  4A9A A;  5KT2 A;  3U30 A;  5ALX A;  4PHE A;  1T3Q C;  3OW1 A;  2JRH A;  3AU5 A;  1E90 A;  3JPT A;  3PMN A;  3AL0 B;  5DB9 A;  2VH1 A;  3I1Y A;  4RNN A;  5F9N A;  5KG1 A;  2KIC A;  1DOQ A;  1LQB A;  2NPT B;  4EM4 A;  4BKG A;  4GXK A;  2HZG A;  4MM3 B;  2AX5 A;  5EE9 A;  3R10 A;  2JZB A;  2YVC A;  4NJ7 A;  5FXD A;  1TAU A;  4C7Y A;  5AI0 A;  2NR2 A;  3DVG X;  3MC1 A;  4M9H A;  1TYG B;  5HML A;  1KLG D;  1T5X D;  2MRP A;  4EZJ A;  2KE7 A;  5KT3 A;  3H4K A;  2DUY A;  2GO7 A;  2W9A A;  2ZIU B;  3NTU A;  4OJO A;  3RJF A;  5DBC A;  2KVR A;  4Z6D A;  1YQ3 B;  2QMT A;  2Y5P A;  4MSM B;  4YFK A;  1GRB A;  1JXE A;  3PFR A;  3AI5 A;  1J7B A;  4MAC A;  3LAE A;  4H2H A;  2K0P A;  4GXI A;  2LHE A;  4TVY A;  2AGQ A;  2FPL A;  4PWC A;  2LYH A;  4F91 B;  4Y2V A;  4ECV A;  1EUV B;  4XLO A;  2YLM A;  4KPL A;  2AQ2 B;  4TMA B;  4DBG A;  3QX1 A;  4MEY A;  3MFG A;  3H40 A;  2ODG A;  3L13 A;  3DG3 A;  4NXZ A;  2L5Y A;  1K53 A;  3P4Q B;  3SQP A;  3HJE A;  4DL3 A;  3DVG Y;  3NJT A;  4WWN A;  3AH7 A;  3SN0 A;  1J2N A;  4KLS A;  1X6I A;  5KFI A;  1SE2 A;  2GQW A;  3OJU A;  4B9S A;  4E3C A;  3CGD A;  2KX0 A;  2HDE A;  3H7P A;  3V61 A;  4HKZ E;  3T6C A;  2N4F A;  3CRX A;  1XSL A;  2XI9 A;  3DVN V;  1FNW A;  4IM3 A;  5FKA C;  1KOT A;  1ONE A;  4J9R A;  4N9F 4;  3TAP A;  3TAR A;  4KVG B;  4DNA A;  3NXL A;  2A1J B;  7ICJ A;  4GYP A;  4J9O A;  2KDI A;  4CF5 A;  1C77 A;  2E3T A;  2RP5 A;  5FJR A;  5J2I A;  2PPG A;  2JU6 X;  4LNI A;  2AKZ A;  4OJ5 A;  1LV5 A;  2NRV A;  5G5H A;  2MBH A;  1IV8 A;  4GSW A;  2CKH B;  1BGX T;  1L6N A;  4HDO A;  3SFD B;  3EAO A;  1PGA A;  2K39 A;  3MBY A;  1XEE A;  2O2V A;  3CYM A;  1D9D A;  2JZB B;  1NI2 A;  3PS6 A;  1B9R A;  1JRP A;  4ZOH C;  3L0W B;  3WAN A;  3MWC A;  4B0E A;  1DYQ A;  1J7A A;  3RZF A;  1WY8 A;  3V62 A;  2WXN A;  3UI3 A;  3BK2 A;  1WH3 A;  1SV0 A;  3PG6 A;  1P7E A;  1ROE A;  3KUD B;  4G9B A;  3D46 A;  3ENL A;  3O65 B;  2MNR A;  4HRS A;  2IO0 B;  5KHO A;  5IIL A;  3DJG X;  4KLM A;  3JPN A;  3N7P D;  4UB1 A;  3UJF A;  1JRO A;  5HR6 A;  1SGG A;  4K7S A;  5LXH A;  1ZRN A;  2BCP A;  4DFP A;  1GOZ A;  3LWM A;  2E1F A;  2D07 B;  1A70 A;  4P6V F;  3ETL A;  4K3B A;  1TVA A;  4M00 A;  4FS1 A;  1WCL A;  4Q8F A;  1C4C A;  3CB3 A;  2ZUD A;  1V97 A;  2JV3 A;  1BPD A;  1ZMC A;  1ZQZ A;  3TEX A;  5I1V A;  3IG3 A;  2Z0E B;  2DLB A;  3C19 A;  3AN1 A;  4NY8 A;  2IO3 B;  4ANW A;  2KMA A;  1TKE A;  2WOI A;  4JV1 A;  1OUQ A;  2R8G A;  1TT5 B;  2NTT A;  3URY A;  1IM4 A;  3D47 A;  4GMV A;  1RWS A;  4US9 A;  5J2H A;  4ECY A;  1E9M A;  2MCN B;  5ALK A;  4UD8 A;  1WCN A;  9ICV A;  1TZZ A;  4PS8 A;  4A35 A;  2OYY A;  2KWC A;  2GSH A;  1W1K A;  2ZJA A;  2N1V A;  4RPY A;  2L0F A;  5KFO A;  2XO7 A;  3A0H U;  8ICN A;  1XD3 B;  1AQ6 A;  2L52 A;  4XGA B;  3RNC C;  4P0P B;  1WXA A;  3DG7 A;  4HPN A;  1XS9 D;  4DYE A;  4IP4 A;  3HKZ F;  5EBK A;  3IJQ A;  2O3G A;  4MH8 A;  2JPH A;  1UT5 A;  3UM9 A;  2F5Z A;  2WXR A;  4KDI C;  5HG2 A;  2IOH A;  1BXT A;  3U8Z A;  5J18 A;  5HI1 A;  3K1Z A;  4R66 A;  2JY6 A;  1J8C A;  4PWB A;  1B1Z A;  3C23 A;  1L7P A;  5KNI A;  1NHR A;  3PY8 A;  1XXG A;  2PVO D;  3SAH A;  2P6R A;  3BVM A;  3ZVV A;  4I6N B;  4F7Z A;  5JRT A;  5L1K A;  1ZDX A;  1NHQ A;  4NLB A;  3WAO A;  4PYT A;  3FIL A;  1MO9 A;  1JI7 A;  3V6H A;  2M17 A;  3AB5 A;  1ZYQ A;  2CRX A;  4OZB A;  2L8J A;  9ICI A;  1HUZ A;  5KFT A;  4PHD A;  3RGT A;  2WDT B;  3ZGZ A;  2KZ3 A;  3AE8 B;  2G08 A;  2NBU A;  1KN5 A;  2RMM A;  4IQW A;  1KCZ A;  4KMO B;  4JWN A;  1MA7 A;  1JWM D;  4HLE A;  4RQ8 A;  2JXX A;  2IJ0 A;  1SJD A;  2C2E A;  2FCN A;  5C2T B;  3KLJ A;  4UAS A;  2XGQ A;  1N61 A;  1L6U A;  4LK0 M;  3A7A A;  2JX5 A;  2WXJ A;  3P4P B;  1JWA D;  3LWL A;  1MFW A;  1S7M A;  1WJU A;  2Q4W A;  3X0W A;  4AP4 C;  1JXL A;  4LTU A;  1DTN A;  1GG3 A;  1AHZ A;  3N30 A;  3HPO A;  3RFZ B;  2RDB C;  2Q85 A;  5CB1 A;  2KTQ A;  2WF8 A;  2WP9 B;  2D3A A;  2KMC A;  1NK8 A;  3KYD D;  3MR3 A;  4J3Z A;  2HXT A;  3GIM A;  1V1P B;  2ZUC A;  5AM5 A;  3DBS A;  1C78 A;  4KMU A;  3Q8A A;  4RUC A;  1PFD A;  2RDG A;  1BNO A;  2QGY A;  3OHB A;  3HIZ A;  5KFU A;  4JPS A;  4M9N A;  4JB3 A;  4PVH A;  1TZO A;  3D6J A;  2W43 A;  3GQC A;  4NL9 C;  1V1O A;  3T3F A;  2LAS A;  4BAX A;  4RGN A;  3V72 A;  4B95 A;  3A9J B;  2KDM A;  5J2G A;  5EWF A;  1HXY D;  4ZRJ A;  4KX3 A;  1HJP A;  3I28 A;  3C2K A;  1UBQ A;  3W8W A;  5EWE A;  5C1Z A;  2RRD A;  3TEW A;  2A8X A;  2J6T A;  3X23 A;  3AEC B;  4RQ1 A;  3UQA A;  3AU2 A;  3VUX A;  2HHV A;  2DW6 A;  3TW9 A;  5AM3 A;  3H8M A;  4BOZ B;  2TPR A;  2XH7 A;  4G7F A;  2FMQ A;  2VZK D;  2K8C A;  3EEC A;  4DN1 A;  2FPK A;  4P1C C;  4Y2J A;  4YL8 A;  1S0N A;  1ZDV A;  4ELU A;  1QLU A;  3GZN I;  4J6I A;  3OJ4 B;  1NK9 A;  2KK0 A;  3M9O B;  1PVP A;  4W9C A;  3R9K A;  4P0P A;  3H4D A;  1H4R A;  1WMH B;  1ZP0 B;  2Y1I A;  4LJO B;  4MJS B;  1Z5S B;  2KHW B;  1GSN A;  5CR0 A;  4NAM A;  1ZOL A;  4BJQ A;  2K4I A;  1BQG A;  4OW0 A;  2Y1J A;  1FEH A;  2P4P A;  4L2Y A;  3WU2 U;  1N63 A;  1R7S A;  1WXQ A;  2PTY A;  3AE6 B;  4QWA A;  2HJ1 A;  2IY0 B;  5CA7 A;  2XC9 A;  1C4A A;  2WYQ A;  1FRD A;  4LCD E;  2Y0S F;  2M4N A;  3DWG C;  2GRT A;  2K9X A;  2X99 A;  1KRH A;  4QW8 A;  3H9D A;  2PTW A;  4XA5 A;  4GME A;  3EC8 A;  2JYT A;  3S1F A;  2F76 X;  1IBX A;  3NVW A;  2VAN A;  2AQ4 A;  2LI6 A;  4TSS A;  3W1Y A;  3FWA A;  3RNG C;  3UXL A;  3C21 A;  3N32 A;  1P7F A;  2L32 A;  2RPQ A;  4GGQ A;  5J0U A;  5J2C A;  3EJE B;  3I6T A;  1Q5W B;  2KJ9 A;  3CF6 E;  5IO9 A;  4C56 C;  3DQ0 A;  3NO1 A;  5FJP A;  3KZX A;  5KFR A;  4K2S A;  1OW5 A;  4F93 B;  4DQP A;  4L23 A;  5DBA A;  1N48 A;  3SFE B;  2BYE A;  5AUI A;  3Q3O C;  3VDG A;  1TY2 A;  2QJM A;  2BCS A;  1L4D B;  2FLP A;  3HRD C;  2QJL A;  2GOL A;  3APF A;  1DOY A;  1WXS A;  3AV8 A;  2PPH A;  3TCS A;  2OKT A;  1NOM A;  3D2J A;  4Y2X A;  4DDI D;  2ZUB A;  1TKK A;  4J9L A;  2KQ4 X;  8ICX A;  1F1H A;  2H3F A;  3N9Y C;  4IRK A;  3Q3M C;  1W6T A;  1M94 A;  3OHA A;  2W55 A;  4JAY A;  3ZDE A;  4JQ9 A;  2WTF A;  4B6J A;  2OED A;  2LYA A;  2WB1 F;  4ED2 A;  2C28 A;  1RAX A;  4JV0 A;  3N6J A;  2W9C B;  2B6G A;  3TTE A;  1KL9 A;  3NAS A;  2M0X A;  1UQV A;  2YML A;  4ECZ A;  4F1S A;  3VTE A;  5FS8 A;  3WAM A;  1L4Z B;  1PGX A;  2DQN B;  4PZN A;  4CDG A;  4DO9 A;  2P8C A;  3DBL B;  3KBB A;  3ES7 A;  1HUO A;  5L95 C;  2AQ3 B;  1SZP A;  3E2E A;  1ZKH A;  1TKY A;  3T3O A;  3V6J A;  3PW5 A;  3M6Z A;  3EPI A;  4OVZ A;  5E6N A;  4O3O A;  8ICS A;  1TK5 A;  4BBN F;  2RR9 A;  2AQ1 B;  1DNC A;  9ICS A;  5AKG A;  4I2A A;  4UB3 A;  1VCB A;  5ALN A;  4NM1 A;  2KEY A;  2KFJ A;  2P8B A;  4EEK A;  5J0X A;  4GIS A;  7ICL A;  3I4K A;  4UDU C;  4A6G A;  2K6Q A;  3P4R B;  9ICA A;  5KAF U;  3UXP A;  3KKA A;  4DOA A;  4H4R A;  2ZW0 A;  4MF8 A;  4YR2 A;  5TSS A;  3CXO A;  3P4S B;  3QTP A;  1MHH E;  2UVR A;  3IHQ B;  2IGG A;  3ZD9 A;  2W8L A;  1S0M A;  1KLN A;  2TSS A;  3RJG A;  1BPX A;  3FW7 A;  4QZH A;  3KW5 B;  4RF0 A;  4CGZ A;  4QWB A;  2ICI A;  5III A;  3AE1 B;  2L05 A;  5HQX A;  4RNA A;  2EXR A;  1GEU A;  3O0H A;  4MGG A;  3JSV A;  2H5X A;  4EQR A;  5BMI A;  2LZ6 A;  2RSU A;  1RYR A;  3AXC A;  2ASL A;  2FLL A;  2R2O A;  2V3S A;  4W9H A;  5EE3 A;  1NK7 A;  3T9L A;  3ZYY X;  1XQQ A;  2WDV B;  2OEH A;  1XNS A;  3DG6 A;  4OZC A;  1L5P A;  3N4F A;  1YQZ A;  1ZRM A;  1YN4 A;  1UA0 A;  2HQM A;  3N7S C;  3V7L A;  3C28 A;  1N60 C;  5FR6 A;  2PE6 B;  5EOZ A;  2VA2 A;  3RMK C;  2ZW1 A;  5ALV A;  2JK6 A;  3ZXV A;  4APN A;  2PFP A;  1SE3 A;  2KJR A;  3AEF B;  2BPG A;  2KN4 A;  3DGH A;  1EC8 A;  3V5C A;  1SIJ A;  3N1X C;  2N9P C;  3SAF A;  6ENL A;  4DXK A;  1SXD A;  4G50 A;  5G5G B;  3PHX B;  3QC8 B;  4IRC A;  4PYU A;  3GII A;  3MFH A;  8ICM A;  4RPX A;  2KNJ A;  3SEI A;  3M8S A;  1NJX A;  4RMA A;  4DHZ B;  2VKQ A;  3K1R B;  1QOG A;  3OZM A;  5D46 A;  2BR0 A;  3SMV A;  4F5Q A;  1UUP A;  3SV4 A;  2GRI A;  3PHW B;  1F2R I;  3R7Q A;  2H3Q A;  3V6K A;  8ICG A;  5J0T A;  1WZ0 A;  2QKN A;  2QJJ A;  3ZVH B;  3WKD A;  8ICA A;  5LXI B;  3ZLF A;  2WF9 A;  4M02 A;  4KGR A;  4H50 A;  1HZ6 A;  2PI5 A;  2KT7 A;  1SZH A;  2AAQ A;  2JHD A;  3RB6 A;  3RJK A;  4G11 A;  5IKC M;  2X8C A;  2QKQ A;  4QIW F;  3AE2 B;  4IM0 A;  3HK0 A;  2KNB A;  2OXO A;  1KRP A;  3APD A;  3H0R B;  3L54 A;  4BKT A;  2OH2 A;  2A1A A;  3T5J A;  5AUK A;  2MUC A;  2OQY A;  3BOX A;  4GGH A;  5KT6 A;  2A4Z A;  1DXS A;  1C1Y B;  4OVU A;  1H38 A;  3AE3 B;  3BS7 A;  4KZC A;  1MUC A;  1ZQS A;  3AEB B;  5IDZ A;  1R4M B;  3P1M A;  4RM8 A;  4W9F A;  2NRX A;  2LHT A;  3NGD A;  2V4R A;  3SBF A;  1I7H A;  4JUZ A;  2ZNV B;  1ZQJ A;  1QLN A;  2BKE A;  3L16 A;  3OSP A;  3DBR I;  4GDK A;  1HZ5 A;  4EBD A;  3RUI B;  3T8Q A;  2G5H B;  2WB1 C;  1QH9 A;  3NVY B;  1D5X C;  3E0F A;  1Q10 A;  2ZVO A;  3T5L A;  2GBR A;  4HJK A;  4IQT A;  2M0A A;  2VFS A;  8ICI A;  4KT2 A;  3L3F X;  2WLB A;  3VVW B;  1EBD A;  1KBU A;  1HIW A;  3J9C A;  1URJ A;  2LM1 A;  2PI4 A;  1ZJM A;  4NLG A;  5BYQ A;  3GIL A;  1XLP A;  4CYE A;  4EE2 A;  1GRF A;  3U26 A;  2WGS A;  2G4D B;  2WXP A;  4YSZ B;  2PTZ A;  3VC5 A;  5JTI A;  1RDF A;  1XO0 A;  1BPY A;  1HTO A;  3W8X A;  3RJA A;  1M6Y A;  5J0Q A;  4MDK E;  3JS8 A;  1RYJ A;  3RJE A;  4BC7 A;  3VCN A;  2QAR B;  4H2A A;  2HBM A;  1E8G A;  3RTV A;  1VAO A;  4H83 A;  3DHG C;  5ALG A;  3S1D A;  1F8W A;  2HTH A;  1YT3 A;  3WK5 A;  2KZM A;  1YD8 U;  2GL5 A;  4HPL B;  1SKW A;  4KLL A;  3TAQ A;  2KK8 A;  3FW8 A;  5L6G A;  3PR5 B;  2LEK A;  2PP0 A;  3ORY A;  2VIX A;  4AUQ C;  1TE6 A;  2OPJ A;  3F53 A;  3H7I A;  2KJ5 A;  7ICQ A;  1JPM A;  3PML A;  1SJC A;  5HNK A;  3A9K B;  3C1Z A;  3TEZ A;  2BCR A;  4EQW A;  2FE8 A;  1L5U A;  5ALQ A;  2BS3 B;  2Y5B B;  3PRM B;  1CQV A;  3PRP B;  1OXJ A;  3ES8 A;  5K8E A;  5BOE A;  5HHD G;  2QB0 A;  1ARO P;  4YWG G;  4F4Y A;  2L76 A;  1X2H A;  1IPG A;  1PUZ A;  4GOC A;  1WMH A;  4MJS A;  3PPA A;  4OAL A;  2E8P A;  3PSE B;  5FXF A;  3CXB A;  3PSP A;  2KVC A;  3STP A;  3RRG A;  2H3V A;  4RQ4 A;  5HR7 A;  2K8B B;  3HWT A;  4DQS A;  4IS7 A;  4EM3 A;  4ECX A;  2BGW A;  4EZL A;  1R0M A;  3ZXR A;  1YIW A;  3E9S A;  4Q8E A;  8ICK A;  2I1K A;  3GOE A;  4HN8 A;  3H0M B;  4DXF A;  3GIK A;  4ED6 A;  2ZXI A;  1N63 C;  3V3W A;  2LBO A;  1PYW D;  1SE9 A;  3GP7 A;  5C23 A;  1HEZ E;  3NS8 A;  3ZRF A;  5ALF A;  5KFJ A;  1UXY A;  3TSJ A;  1IG6 A;  2QSD A;  1NHP A;  2R2Q A;  2Y9U A;  5AZF A;  3IV6 A;  2HOQ A;  1ZD5 A;  3EHV A;  1MC8 A;  1WRD B;  3GSY A;  4ZCW A;  3GU3 A;  3R3M A;  5KFW A;  2GI9 A;  2GH5 A;  4BWM A;  1RFA A;  2ATL A;  2WXQ A;  3B9J A;  1F0Z A;  1ELS A;  2D3D A;  3MGI A;  2WDQ B;  1TV9 A;  3URH A;  4G8T A;  1RXW A;  2WP5 A;  4GGB A;  1XC9 A;  3DK9 A;  3AM9 A;  5KL8 B;  2HTM E;  1QSS A;  1U9L A;  5BPC A;  3EYZ A;  2C2D A;  5ALM A;  2HJ8 A;  2PJH A;  1UHU A;  5KT5 A;  4HG0 A;  1UZX B;  4WJN A;  3FVD A;  3QEB Z;  1L3S A;  3MC9 A;  4O9M A;  3G6Y A;  3ZD8 A;  1IUE A;  2UUV A;  2ZG6 A;  2G4S A;  1VZ7 A;  2G3Q B;  3NZU A;  3BK1 A;  5J2F A;  3UXK A;  1OJT A;  3BII D;  5ALH A;  4M6U A;  3QZ8 A;  2R2Z A;  1I19 A;  3KD3 A;  4TVW A;  4DSF A;  1WG8 A;  1ZQW A;  1U48 A;  3N7R C;  3OC4 A;  2EKE C;  5DLF A;  1S10 A;  1NEK B;  1ZQY A;  1Z3E B;  5CHW A;  3V60 A;  3BDP A;  2AXR A;  4GDL A;  4NQL B;  1NU5 A;  3UMB A;  2AL2 B;  4ECR A;  3QU9 A;  3SN1 A;  1TKG A;  4KLU A;  4RCO A;  3GB1 A;  3DEQ A;  1MN8 A;  4BFR A;  3GY1 A;  4LNF A;  1N61 C;  1V59 A;  5HHH A;  3QAQ A;  1JN3 A;  1AW7 A;  4FA6 A;  4RQ0 A;  4G3I A;  1J97 A;  3UQ0 A;  4XRH A;  3V7J A;  4M0W B;  8ICV A;  1Q1W A;  2N9L A;  2OLA A;  2MA1 A;  5JHB A;  4DOB A;  2GR0 A;  3MKC A;  3EZ5 A;  5J04 A;  4JGH B;  2ISO A;  8ICE A;  3IDW A;  1EU4 A;  5J2R A;  3DCG A;  4R65 A;  1S0O A;  2BC0 A;  5CP2 A;  5BO4 B;  2WOW A;  1GES A;  2EQ6 A;  3GFK B;  4GLX A;  3B2F A;  1RM6 B;  2RDX A;  3THV A;  3SEN A;  1S97 A;  1T4G A;  4C8N A;  4GXJ A;  1L3U A;  2GBJ A;  1Q0W B;  2PW9 A;  5AE3 A;  3F2B A;  2ZZB A;  7ICK A;  3THU A;  5J0P A;  2I9G A;  2LXC A;  4CO7 A;  4B9T A;  1D5M C;  3ISD A;  3QQ8 B;  4DWI A;  1JWB D;  3JZU A;  4DSE A;  3ALB A;  4XDC A;  1LFD A;  2ZEQ A;  1ZQT A;  1WI0 A;  4EMJ A;  1YN5 A;  5KFH A;  2IBK A;  2W9N A;  3DWM A;  1DXL A;  2LMR A;  1TZ1 A;  4IC7 B;  1T3Q A;  3FM9 A;  4RH6 A;  3PW7 A;  1ZQG A;  4ECW A;  3GO2 A;  3U4F A;  5DQH A;  5FR3 A;  3UCC A;  3BVG A;  1ZQU A;  1TAM A;  3H8W A;  4UAW A;  3FCP A;  4K8G A;  5BOL A;  4BXO A;  1I35 A;  3PV8 A;  3JPR A;  4DQR A;  4US8 A;  4F5R A;  4GC7 A;  2XSX A;  2UVU A;  1EWY C;  1MQ2 A;  2XCA A;  2Y3A A;  3MC0 B;  3ML9 A;  3RUL A;  2NQL A;  1N60 A;  3OP2 A;  2CHR A;  2KN7 A;  1N62 A;  4PJ0 U;  4GIR A;  5BOF A;  4ZHP A;  2NRT A;  1SSN A;  4YQW A;  4F72 A;  4XC2 A;  1MHX A;  3LYY A;  4JWS C;  3R2I A;  2NS5 A;  4PVK A;  1TAQ A;  1L0X B;  2BYV E;  2PGE A;  2PS2 A;  3MAB A;  5KG6 A;  5KFK A;  1DRG A;  1KLU D;  3Q8S B;  4K7U A;  2R8D A;  3UJ2 A;  2V4I B;  4A8X C;  4ARI A;  3EUB 2;  1E7U A;  3NVV B;  2BKF A;  5D2M B;  1KD0 A;  2XH2 A;  2P3H A;  3PW4 A;  1HTQ A;  4RGO S;  3HUI A;  1WGG A;  1FO4 A;  1KSP A;  5D7G A;  2KAN A;  1FMA D;  4BBN C;  3F5E A;  2KDF B;  4YVZ A;  5DDM A;  2BB6 A;  1L0Y B;  3K1G A;  4KIK A;  3ZVI A;  4HNC A;  4KWS A;  5ENL A;  2QEJ C;  3KTQ A;  5KFC A;  1SB3 B;  4EZ6 A;  3SD7 A;  2DZM A;  2OWO A;  2PKO A;  4YTP B;  1ECW A;  5FP0 A;  3M8R A;  1OQQ A;  2BS4 B;  2MH7 A;  4C8O A;  3U52 E;  2B0C A;  2XK5 A;  1RPL A;  2IYD B;  3RNM A;  2OHF A;  2WXI A;  3RNF C;  4ELT A;  2ZIV B;  4ACO A;  4I2J A;  2JEG A;  5G2N A;  1IP9 A;  2QHO A;  2N1R A;  3NVY A;  3RNB C;  4UAR A;  1NDA A;  2LHD A;  2D5G A;  1GB4 A;  2LJI A;  3T3N A;  1PDX A;  1TFR A;  2HHU A;  3R25 A;  4OJL A;  5KFN A;  3DGB A;  3V5F A;  1UD7 A;  2ZTD A;  1TE2 A;  4IG7 B;  3T9P A;  3SQI A;  1FRR A;  1E0Z A;  1XO1 A;  1WRI A;  3I63 C;  2PE9 A;  3VFK A;  2PP3 A;  2YAU A;  2LD9 A;  4H4S A;  1I4R A;  3H4B A;  3SSZ A;  4BUR A;  2PLI A;  1XS2 A;  4JE3 B;  4FZL A;  3TAN A;  1C3T A;  2IDY A;  2POZ A;  2RHF A;  2YB1 A;  3EAN A;  4ZRI A;  4BGD A;  2GOW A;  3CST A;  3PNC A;  2W9C A;  3HM3 A;  1V85 A;  4KX5 A;  2IO2 B;  1V6E A;  1SIF A;  4KGT A;  3H70 A;  3SDL C;  3N4E A;  1E7V A;  3LAD A;  3QUC A;  3DJJ A;  3I76 A;  2X8H A;  4EEL A;  4JLC A;  3SI8 A;  1GER A;  2ALZ A;  2JT4 B;  1QOF A;  1SF0 A;  3F5A A;  4CCH A;  4K4G A;  4E5T A;  4TQ0 A;  2GLE A;  1GB1 A;  3HKZ C;  2ON8 A;  2BB5 A;  3AED B;  3A33 B;  3GZN B;  4IQV A;  2ZXH A;  3KHG A;  3RAX A;  2YB4 A;  1F77 A;  2MW5 A;  5KHQ A;  8ICO A;  1FD6 A;  2ZZ0 A;  3VHT C;  5AIA A;  1LXD A;  4ZOH B;  1C4P A;  2KLC A;  4WJO A;  4AWJ A;  3CP8 A;  2EMS A;  2MLB A;  1CJE A;  4PVJ A;  3QU7 A;  1L7O A;  1W1M A;  2EEL A;  2GR2 A;  4DF4 A;  2PXI A;  1CI4 A;  2WDR B;  4K3C A;  2I1Q A;  4UBC A;  4M47 A;  1P1A A;  1E7P B;  4B9N A;  4MEM A;  4BC9 A;  2WP6 A;  3IRU A;  1U4A A;  1T7P A;  3Q2A C;  2LVP A;  3NZS A;  4LNN A;  3B9J B;  1L3V A;  3WAL A;  3PLV A;  4LA1 A;  4F2R A;  3I3T B;  4YD2 A;  2XNA C;  3EF6 A;  1UH6 A;  3BVZ A;  3UGV A;  3H7S A;  4QZG A;  2G5I B;  1PDZ A;  4KLH A;  3MHS D;  3JPO A;  2XCP A;  7ICG A;  1WGR A;  5G5G A;  2J6U A;  3MJW A;  3OGU A;  4YXJ A;  3AU6 A;  4ED0 A;  4I2F A;  1FHV A;  5JCK A;  2XY7 A;  1NJW A;  2HD5 B;  1N5X A;  2YN4 A;  4UB4 A;  1IGD A;  2IZV B;  4H4Q A;  1B22 A;  1C20 A;  3T5K A; 
#chains in the Genus database with same CATH homology
 4TSS A;  3FWA A;  1N5W C;  2NTS A;  1P7F A;  1GB4 A;  2L32 A;  1I4X A;  2GB1 A;  4NZL B;  2SAK A;  3S1E A;  3DQ0 A;  4C56 C;  3V05 A;  5G5H B;  5JXV A;  4R3D A;  2V3P A;  4L23 A;  3SFE B;  3U4E G;  5I1W A;  3Q69 A;  2ONQ A;  5AUI A;  1TY2 A;  5BMG A;  3Q8B A;  4MLA A;  1L4D B;  2JXT A;  1VQZ A;  1ZUD 2;  2VZK B;  2QJL A;  3MHZ A;  1DOY A;  3HRD C;  3AV8 A;  3W2D A;  4AS1 A;  3EUB 3;  3OWE B;  3NVZ A;  1E8F A;  3D2J A;  1SB3 C;  4WH4 A;  3IXS A;  2KQ4 X;  3N9Y C;  2W54 A;  1ZXH A;  5EE1 A;  3RJ8 A;  4GDL B;  2W55 A;  4JAY A;  2PMV A;  1ESF A;  1TS2 A;  2OED A;  4GDK B;  2LUM A;  2WU2 B;  2BVG A;  3RPF C;  1DOI A;  4N58 A;  3LLB A;  1KF6 B;  3VTE A;  3P63 A;  2BYT A;  2WXF A;  1L4Z B;  1PGX A;  1E10 A;  3A7R A;  1XO3 A;  2J42 A;  2RDH A;  1QOB A;  2AQ3 B;  2IGH A;  1TKY A;  1Y56 A;  2INN E;  3I9V 1;  3T3O A;  2Y08 A;  4OVZ A;  3C0P A;  1DOX A;  1FIQ A;  3PM9 A;  1YN3 A;  2JYE A;  4KX6 B;  2AQ1 B;  5BMH A;  4RF1 A;  3D2H A;  2H89 B;  1C79 A;  1AHV A;  4USA A;  4UDU C;  3P4R B;  2FUG 1;  2KWD A;  2V0G A;  2ZW0 A;  2DYO A;  3LB8 C;  1FCC C;  5TSS A;  3P4S B;  4ZRP A;  2QPM A;  1MHH E;  1I4Q A;  2IGG A;  2TSS A;  3FW7 A;  3IAM 1;  4RF0 A;  3KJM A;  2GQU A;  1D5Z C;  2SEB D;  2ICI A;  5FK9 C;  3AE1 B;  3AEG B;  3HVD A;  4RNA A;  2EXR A;  5HQX A;  4HRO A;  2P13 A;  1MBT A;  3EA6 A;  3NS1 A;  1MPE A;  2VFU A;  3NZ3 A;  5D79 A;  5BMI A;  3AE9 B;  3TEY A;  1PGB A;  5EE3 A;  3ZYY X;  2WDV B;  4OZC A;  1L5P A;  3AE4 B;  2MBR A;  1YN4 A;  4EC3 A;  1N60 C;  2ACZ B;  4O95 A;  3A7U A;  1TS5 A;  1SJH D;  1XLO A;  3KQ4 A;  2ZW1 A;  2NQW A;  1FCL A;  1SE3 A;  5HFY A;  3AEF B;  2KN4 A;  2L83 A;  2WQY B;  1QF6 A;  1SIJ A;  3E56 A;  1M4V A;  1BUI C;  2X38 A;  1YNT E;  3FAH A;  2Q5W D;  4LLG M;  5G5G B;  5BYS A;  3ZQ4 A;  1QOG A;  3ZJU A;  1UUP A;  2PIA A;  1ET9 A;  1E8H A;  2GRI A;  2K5P A;  2DWQ A;  1F2R I;  2W82 A;  4MT5 A;  5H92 C;  2QKN A;  5GXG B;  1WSP A;  2N9K A;  4IDI A;  4REZ A;  1V8C A;  4KGR A;  1HZ6 A;  2Y4G A;  5FXE A;  1ZOY B;  2MJE A;  4ZYS A;  1MBB A;  2CJN A;  1JAL A;  1D4B A;  4ML8 A;  3AE2 B;  4C7Z A;  4OHJ A;  2VFT A;  4KKJ A;  5MPO A;  4XWW A;  5AUK A;  1MI0 A;  4O1N A;  2J4X A;  3R2T A;  1XF5 L;  2MJ3 A;  3AE3 B;  2RK5 A;  1SBB B;  2I2Y A;  3CWI A;  3VQI A;  3AEB B;  1EWC A;  3P1M A;  4NAW B;  2OAI A;  3HVZ A;  2NMQ A;  1I7H A;  2G1E A;  3DED A;  4RGT A;  1OFF A;  3ABV B;  3R8B A;  2WXH A;  4RFB A;  1HZ5 A;  4ZRQ A;  1WWT A;  3NVY B;  1D5X C;  1Q10 A;  1QOA A;  1VJK A;  1V1P A;  3AEA B;  1SJE D;  3PZ8 A;  2WXL A;  2M0A A;  2E6X A;  2VFS A;  2Z8L A;  1TJE A;  2WLB A;  3ZJT A;  4YTN B;  3IAS 1;  1W1O A;  1DZN A;  1W1L A;  1SEB D;  3J9C A;  3TUO A;  3U2S C;  2PLP A;  5BYQ A;  1DGJ A;  1XLP A;  4EE2 A;  1CK1 A;  4OZA A;  2WXP A;  4YSZ B;  1ZR6 A;  3POP A;  3W8X A;  3RJA A;  2YEP B;  4GLS C;  1ET6 A;  2PLS A;  3JS8 A;  4Q2J A;  1RM6 C;  2BBC A;  1RYJ A;  4BC7 A;  4H2A A;  3KWL A;  1E8G A;  1FNV A;  1VAO A;  1VZ6 A;  3S1D A;  3S1C A;  2MJD A;  3FW8 A;  1WYG A;  5L6G A;  4XDD A;  3VR8 B;  2BW2 A;  2LEK A;  3U7Z A;  1JCK B;  3FIL B;  5L6F A;  1UWM A;  5HHZ A;  1WVE A;  3TEZ A;  2FE8 A;  3O13 A;  2BS3 B;  1NVI D;  2I38 A;  1CQV A;  1XLQ A;  1AHU A;  3SR6 A;  5K8E A;  5D3D A;  5HHD G;  4YWG G;  4A6Q A;  1FFU A;  1N5W A;  3W9C B;  3AE7 B;  5I4D A;  2CJO A;  3PQB A;  1TY0 A;  1X2H A;  1VLB A;  1XLN A;  1JWS D;  1HQR D;  4CQN A;  4OAL A;  5HMR A;  5FXF A;  1DIQ A;  5EE0 A;  1HSK A;  4NJC A;  3ETR A;  1VR9 A;  4DXG A;  1W1J A;  3ETR B;  2N7J A;  3Q8E A;  1J7C A;  4YTM B;  3NVV A;  4HEA 1;  3E9S A;  1ZXI A;  2JWU A;  5FXP A;  1N63 C;  4DXF A;  5AWV A;  1EU3 A;  4XE0 A;  1PYW D;  3GP7 A;  1W1Q A;  1UXY A;  3FW9 A;  1HEZ E;  1YQ4 B;  1NI3 A;  5H8Y E;  3R07 C;  1UNS A;  3TSJ A;  3TSS A;  2QSD A;  4A9A A;  1T3Q C;  3BYT B;  4D2K A;  2VAO A;  1QT9 A;  3GSY A;  1F0X A;  2WDW A;  2GI9 A;  2WXQ A;  2AX5 A;  3B9J A;  4J3O D;  4MM3 B;  5EE9 A;  2LGI A;  2WDQ B;  1F0Z A;  5FXD A;  1X2G A;  4C7Y A;  2M19 A;  2BVF A;  1NYQ A;  3AEE B;  3W5U B;  1TYG B;  1T5X D;  1KLG D;  1D6E C;  3BZD B;  2QMT A;  3NUH B;  3AM9 A;  1C76 A;  2LFI A;  2Y5P A;  1YQ3 B;  2HTM E;  1QKZ A;  3BWU D;  1NYR A;  4HJG E;  3Q8F A;  3ZJV A;  1L6V A;  1J7B A;  4MAC A;  3LAE A;  4HG0 A;  2K0P A;  2LHE A;  4TVY A;  1UWX A;  5E6J A;  2VFR A;  4PWC A;  1ENF A;  4XLO A;  3TX1 A;  1IUE A;  1QLB B;  2AQ2 B;  2UUV A;  2QIE B;  2RPV A;  4TMA B;  3BYY B;  2R61 A;  1VZ7 A;  2WNM A;  3BK1 A;  3EGR A;  3MFG A;  3VR9 B;  3BII D;  2R2Z A;  1FFV A;  5D3I B;  1I19 A;  1K53 A;  3P4Q B;  3AH7 A;  4TVW A;  2J53 A;  1NEK B;  1SE2 A;  2L1A A;  2AXR A;  1DII A;  2HDE A;  4HKZ E;  4RGM A;  1TKG A;  4M0W A;  4RCO A;  3GB1 A;  2PTL A;  1FIQ B;  1FNW A;  1N61 C;  2G9H D;  3W5V B;  5FKA C;  4YSY B;  1AW7 A;  2VFV A;  2Y3R A;  2WXK A;  3KWV A;  2CU3 A;  2N9L A;  1C77 A;  2E3T A;  2KAJ A;  2IPK D;  1XCT L;  2JU6 X;  5G5H A;  1EU4 A;  3SFD B;  2WXG A;  1FFV C;  1PGA A;  2EKI A;  1XEE A;  4WWM A;  1KH0 A;  3B2F A;  4N59 A;  3W8Z A;  1RM6 B;  2PW9 A;  1B9R A;  1JRP A;  2WS3 B;  1GPX A;  2YVS A;  1K50 A;  4ZOH C;  1K52 A;  3NVZ B;  5AE3 A;  4B0E A;  1DYQ A;  1J7A A;  3PZ7 A;  2WXN A;  3UI3 A;  3BK2 A;  3B2G A;  1VRA B;  1P7E A;  3W1S A;  1D5M C;  1ROE A;  3HRD D;  1YJI A;  3MJ5 A;  2M56 B;  1HA5 A;  1JWB D;  4HRS A;  1E0Y A;  3TSH A;  4XDC A;  1YN5 A;  4TQ1 A;  1FNU A;  1JRO A;  3DWM A;  4KGS A;  4L1B A;  1T3Q A;  1GOZ A;  1E6E B;  4RH6 A;  4P6V F;  1LO5 D;  1A70 A;  1JQ4 A;  2KMM A;  4P16 A;  1C4C A;  5BYR A;  4B0M A;  5FR3 A;  3BVG A;  1NEN B;  1V97 A;  1N62 C;  3TEX A;  5I1V A;  1IGC A;  2DLB A;  3AN1 A;  3AE5 B;  4JX1 C;  1TKE A;  4US8 A;  1ACC A;  4YT0 B;  2NTT A;  1EWY C;  2Y3A A;  3MC0 B;  3URY A;  1N60 A;  1RWS A;  2K3U A;  1N62 A;  4US9 A;  3C8Y A;  3NRZ B;  1E9M A;  4ZHP A;  3SR6 B;  1SSN A;  4AQ7 A;  3NS1 B;  4UD8 A;  5AE1 A;  1MHX A;  3LYY A;  4IOI E;  1ZXI C;  3V3X A;  3VRA B;  4JWS C;  5C3J B;  3R2I A;  4PVK A;  1L0X B;  1TS3 A;  3I57 A;  1W1K A;  1KLU D;  2R8D A;  3MP9 A;  2L52 A;  2V4I B;  4A8X C;  4ARI A;  3EUB 2;  3NVV B;  2JZP A;  3PO0 A;  1W1S A;  3KLS X;  1ZPS A;  3I99 A;  2O3G A;  2P3H A;  4MH8 A;  2YEP F;  4JWU C;  1FFU C;  4RGO S;  3HUI A;  2DBY A;  1FO4 A;  2WXR A;  3IT6 B;  5D7G A;  5HG2 A;  4PZF A;  1FMA D;  1CZP A;  1SXT A;  1BXT A;  2BTE A;  2BB6 A;  1L0Y B;  1PUT A;  5HI1 A;  3Q8C A;  4PWB A;  1B1Z A;  2H88 B;  1YJJ A;  3A7A A;  1XCQ L;  1XXG A;  2PVO D;  3BVM A;  2QEJ C;  3CIR B;  1W1R A;  1SB3 B;  4PVE A;  2PKO A;  4YTP B;  2BS4 B;  2MH7 A;  1OQQ A;  1ZDX A;  3U52 E;  1K51 A;  1KTK A;  3FIL A;  2W3S A;  4A90 A;  4ARC A;  4PYT A;  2IPI A;  1I4H A;  2OHF A;  1BML C;  2WXI A;  2WXO A;  3AB5 A;  1JML A;  1ZE3 D;  2V3N A;  4OZB A;  4PT5 A;  3NVY A;  1WGK A;  1STE A;  2J52 A;  1EM7 A;  3AMZ A;  3AE8 B;  2LHD A;  2D5G A;  3ZGZ A;  2E5A A;  2RMM A;  2LJI A;  3T3N A;  1AWD A;  1PDX A;  4ZHO A;  1JWM D;  4YXD B;  2WU5 B;  2XN9 C;  2Y5C A;  2IJ0 A;  5C2T B;  2MEK A;  1L6U A;  1N61 A;  1MVK A;  4LK0 M;  3VRB B;  1FRR A;  1E0Z A;  2JX5 A;  2WXJ A;  3P4P B;  1JWA D;  1TS4 A;  1WRI A;  2N0S B;  2Q4W A;  4WAF A;  4LTU A;  1FM0 D;  1UGJ A;  2INP E;  1AHZ A;  2BVH A;  3RFZ B;  2Q85 A;  1I4R A;  2WP9 B;  2PLI A;  3H8H A;  4JE3 B;  1JWU D;  2JSV X;  5T8I A;  2BT6 A;  3WCQ A;  2IDY A;  1V1P B;  2GQT A;  1WVF A;  3D2D A;  3FC4 A;  1C78 A;  3Q8A A;  1PFD A;  2RDG A;  3P42 A;  1KFY B;  4DNS A;  4ITK A;  4KGT A;  2LMC A;  4JPS A;  1QIL A;  4PVH A;  1TZO A;  2DYM A;  1V1O A;  4RGN A;  1OQR A;  2W3R A;  2KDM A;  1QOF A;  1SF0 A;  3LXF A;  1IBX B;  2JQR B;  1HXY D;  1T6B X;  4TQ0 A;  1GB1 A;  3L4P A;  2BB5 A;  2ON8 A;  3AED B;  1FXI A;  1VZ8 A;  4YSX B;  3W8W A;  1F77 A;  2I0K A;  3TEW A;  1FD6 A;  3AEC B;  4ZOH B;  3SEB A;  1C4P A;  2KAC A;  1JW9 D;  1SE4 A;  4WIP A;  4KKI A;  1CJE A;  3NRZ A;  4N6E B;  1AYF A;  2BS2 B;  2VZK D;  4DQO C;  4PVJ A;  3IT4 B;  4BCA A;  1I4G A;  5ADZ A;  1W1M A;  2EEL A;  4XWT A;  2WDR B;  1ZDV A;  2K22 A;  4A55 A;  1C9F A;  1F2R C;  1E7P B;  1QLU A;  4BC9 A;  2UUU A;  2Y3S A;  1YMH E;  1QLT A;  3B9J B;  2FBW B;  3NVW B;  1QQR A;  1ZP0 B;  1I4P A;  2XNA C;  4JB1 A;  3BVZ A;  4IKG A;  3GS2 A;  3HSU A;  1GAQ B;  2IGD A;  4NAM A;  4WUR A;  4WQM A;  4OW0 A;  1FEH A;  2B76 B;  1AN8 A;  4L2Y A;  1N63 A;  1R7S A;  1WXQ A;  4C80 A;  3AE6 B;  4HKQ A;  2P4P A;  2WXM A;  5G5G A;  3BW7 A;  5AE2 A;  4FXC A;  1L0V B;  1C4A A;  4BBY A;  1FRD A;  1N5X A;  3DWG C;  2K9X A;  5LNK 1;  1KRH A;  1IGD A;  2PVG C;  2JYT A;  2QIL A;  1FXA A;  3S1F A;  1IBX A;  1VDV A;  3NVW A;  1RFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...