1JROA

Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLELLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xanthine dehydrogenase, chain A
publication title Crystal structures of the active and alloxanthine-inhibited forms of xanthine dehydrogenase from Rhodobacter capsulatus
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 129
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 1jroA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jroA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1jroA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1jroA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1jroA04
5H92C 1E0ZA 4BC9A 1N63C 1WYGA 1N5XA 1FFVC 2AX5A 3NVVA 1QOGA 3GSYA 1VAOA 3PO0A 1FIQA 4US9A 1B9RA 1UXYA 3R07C 1DOIA 2KMMA 2BVFA 1NYQA 1FMAD 5G5HB 2Y5CA 1N5WA 4N59A 3SR6B 3JS8A 3L4PA 3AV8A 3VR9B 3W9CB 4YSYB 5G5GA 2FBWB 1W1SA 3P63A 3NVWB 2VFVA 4WWMA 5AUKA 3A7UA 2MJEA 3NVZA 4US8A 4O95A 1VDVA 1IUEA 1L5PA 3ZYYX 4BC7A 3AEEB 2GQUA 2W3RA 1WGKA 1T3QC 3AEGB 1OQQA 1N60A 5FXEA 5HHZA 2K9XA 2OAIA 1FFUA 2VAOA 2BVGA 3TSJA 2QKNA 1E8FA 2O3GA 3ETRA 1PFDA 4IDIA 4ML8A 1N63A 1FFVA 1L6VA 2WQYB 3AH7A 4MLAA 3HRDD 1QOAA 1VJKA 1QLTA 1ZXIC 2W3SA 1N62A 2WDQB 2HTME 3NS1A 1A70A 1WVEA 4N58A 2VFTA 1NI3A 2VFUA 3CWIA 3AEFB 4A9AA 4PVJA 1W1RA 1F0XA 3NVYB 1YQ4B 3D2HA 2L83A 4N6EB 1L0VB 1JWBD 2BS2B 2WU2B 2W55A 3LLBA 3SFDB 3LB8C 1YQ3B 4JWSC 2PLIA 2LEKA 1QT9A 3NVVB 1FIQB 1DIIA 1RWSA 2KAJA 3EUB2 2P13A 3AEAB 4PZFA 3AN1A 3CIRB 5H8YE 3AE4B 4YTMB 1W1MA 1TYGB 2MBRA 1CZPA 3W8WA 2H89B 2CJNA 5AUIA 1AHVA 1SB3C 2MH7A 5ADZA 1FRRA 3NVZB 4TVWA 4PVEA 3S1DA 3AE1B 3TSHA 3S1FA 1SIJA 1JW9D 4JWUC 1NEKB 3HRDC 1RM6C 2W54A 2EKIA 2PVOD 3C0PA 2H88B 3VRAB 1W1OA 1YJJA 1N62C 5HQXA 4KX6B 2DBYA 2GQTA 2WLBA 4LTUA 1AYFA 1JROA 4FXCA 1GPXA 1PDXA 4ITKA 2WS3B 2BVHA 2E3TA 2QJLA 3P4SB 4XLOA 1VLBA 1FXIA 3HUIA 3AE6B 1UWMA 2ACZB 4YTPB 3FW7A 2P3HA 3W5UB 3NS1B 1JRPA 3BIID 3AE3B 4ZOHC 1MBBA 5EE0A 3P4RB 1KFYB 2Q4WA 4UD8A 1E7PB 1OFFA 2PLSA 2R2ZA 1ZUD2 2Q5WD 5GXGB 2DWQA 3PM9A 1E8GA 1L6UA 4ZHOA 3HVZA 3KJMA 3B9JB 2E5AA 3AECB 4DNSA 4HROA 3NRZA 1V97A 5AE1A 1FRDA 1XO3A 1DOXA 1KF6B 2K5PA 4YTNB 3AE2B 5AE3A 3LAEA 2L52A 1W1LA 1FXAA 1PUTA 5AE2A 3FWAA 4PYTA 2VFSA 4USAA 3W5VB 1MBTA 1XLPA 4JAYA 2CJOA 3P1MA 2QPMA 3BW7A 1J7AA 1DIQA 2OHFA 1ZOYB 3AMZA 1JWAD 2RK5A 1RFKA 1WWTA 3ABVB 1DGJA 1N61A 3B2GA 4YXDB 2YVSA 1J7CA 1TKEA 1R7SA 1EWYC 1ZR6A 4HRSA 1QLUA 3VTEA 5G5GB 1GAQB 2M56B 2K22A 1FO4A 5HMRA 3W8ZA 1X2HA 4OALA 2M19A 1TKGA 1ROEA 1J7BA 3DWMA 5MPOA 2BS3B 4PVHA 3W8XA 4EC3A 5FXFA 1QOFA 3ETRB 4ZHPA 2WP9B 2PKOA 3D2DA 1SB3B 1DOYA 2G1EA 1KRHA 2BT6A 4TVYA 1V8CA 1CJEA 1NVID 1NYRA 1RM6B 3FW8A 4WQMA 4JX1C 4BBYA 1E10A 2N0SB 3A7AA 1AHZA 3NRZB 1NENB 1VQZA 5FXDA 3I99A 3EUB3 3FAHA 1N61C 2MJ3A 3A7RA 1AHUA 2B76B 3AB5A 5G5HA 4C80A 3SR6A 1XLNA 5FXPA 3FC4A 3AEBB 3AM9A 3S1EA 3NVWA 2I0KA 1E6EB 3DEDA 1W1QA 2R8DA 1SF0A 2VFRA 4HG0A 1I7HA 1WVFA 4PWBA 3S1CA 2JX5A 1OQRA 1E0YA 4ZOHB 4YSXB 2QIEB 2WDVB 1ZP0B 3KWLA 1HSKA 2MJDA 5EE3A 5EE9A 4PWCA 3D2JA 3LXFA 3WCQA 2CU3A 4YSZB 1QLBB 1WRIA 2WU5B 2PVGC 3TX1A 1F0ZA 4YT0B 4C7YA 3P4PB 1E9MA 2AXRA 1T3QA 1TKYA 1TJEA 3B2FA 3AE7B 2JQRB 2BS4B 3FW9A 1N5WC 2PIAA 1W1JA 5C3JB 1JQ4A 3B9JA 2WDRB 1QOBA 3DQ0A 3P4QB 1FM0D 3SFEB 1AWDA 1QF6A 2EXRA 2Q85A 1JALA 2NQWA 4JB1A 3AE5B 1N60C 1DZNA 4PVKA 1I19A 2P4PA 1FFUC 3VR8B 3NVYA 4P6VF 1XLOA 1ZXIA 1YJIA 3AEDB 1RYJA 5C2TB 5D79A 3RPFC 3DWGC 3AE8B 5EE1A 1XLQA 1WXQA 1W1KA 4C7ZA 4BCAA 1X2GA 3VRBB 1E8HA 3AE9B
chains in the Genus database with same CATH superfamily
4BC9A 1K52A 2EQ6A 1N5XA 3SV4A 4GDLB 3NVVA 3MFIA 2NV3A 2NO5A 4US9A 1PDZA 5J2EA 3R07C 4J03A 4E8GA 4HCDA 2KFNA 3JPPA 5MPOA 1RPLA 2BPGA 2KMMA 3NUHB 3UJRA 3QNMA 5DQHA 3Q2AC 1SV0A 1C3TA 3H1UA 5JUMA 3IRUA 1GRTA 2Y5CA 1YQBA 3N7RC 4N59A 3N9YC 3ALBA 4RGOS 2E8PA 3KKAC 3JS8A 5LNK1 3ONSA 4DDID 3VR9B 3PSFA 4E74A 4X2PA 3W9CB 4UATA 1Q0WB 2VFVA 2JZZA 1RQLA 3SAHA 3LWLA 3Q3JA 9ICEA 4II3B 5TR5A 1OUQA 2OJRA 2ICIA 5AUKA 3DVGX 2BCRA 2MJEA 4G8TA 2I5HA 5K4LA 4US8A 4A8XC 3T5JA 5KFDA 4OZCA 5DG8A 3ZYYX 4O3MA 9ICHA 2N9EB 4BC7A 2IPIA 4ADWA 1WGKA 2Z7JA 2ZW0A 5CX3A 3T79A 3AEGB 2OYYA 3DJJA 5AIBA 5CWRA 1NJYA 5AZFA 5E6JA 4I6LB 4LK0M 2YB1A 1FFUA 2JUOA 2ODGA 4J6IA 2KVSA 4MJSA 3U7DA 1X9XA 2E1FA 1LO5D 4C4TA 1XO0A 5D46A 3PMLA 1E7UA 1TBEA 3DG7A 1B43A 3PSIA 4W9EA 3KUDB 3TSJA 2XY6A 4DX3A 1HJPA 1EBDA 4JV2A 2KG5A 5ALTA 5ALQA 1K5OA 5J29A 3R9KA 1B4FA 4J9OA 3RH5A 4RQ7A 1RAXA 2LXAA 3ZJVA 4Q44A 1I4RA 4RQ8A 2Y5PA 5BMHA 2JEGA 1RG6A 2RDXA 3K1ZA 4ML8A 2EELA 1B22A 3WIMA 2NRXA 3N7SC 1A77A 3QX1A 1YIWA 3DEQA 2PS2A 2PFPA 5ENLA 1S10A 3AH7A 3VA8A 3TCAA 2E8OA 2VJ5A 2ZTDA 3HRDD 5C0YA 5FR6A 2K4IA 4UW9A 4E6MA 4F92B 3H8JA 1TY0A 4K8DA 3Q45A 9ICAA 2HXTA 4JQWC 5AKLA 3GO2A 5J2HA 2DAJA 3IAS1 3T3FA 3RAXA 2B21A 4PHEA 2AQ1B 3VAWA 1ZQGA 2EAPA 3RNGC 2OO6A 4Q45A 3A9JA 4HNLA 7ENLA 1V1PA 3QARA 5JCIA 4KSLC 1KFDA 1U47A 4OCZA 1OQYA 3NUQA 2HTHA 4K7ZA 2KWVB 4DWIA 4YL8A 3K4GA 2VJ4A 2WPCA 1MPEA 3V5FA 2JT4B 4JIOU 5D6JB 3CWIA 3BZDB 1YN5A 3QWZB 4BWJA 2WXRA 4TUPA 1E8ZA 2KWUB 2MSED 4PVJA 3NVYB 2DYBA 4BURA 4DS4A 4NLBA 4ARIA 3UI3A 4TQ1A 2PFQA 2KJ5A 1YNTE 3DEEA 1NK0A 4IWPA 1V9PA 1UGMA 2NQLA 3EFCA 2P8CA 4J9KA 5F3XB 3UXOA 2KTRB 3VDGA 2JZ3B 4TKNA 4WWPA 1H4RA 2QGYA 4KPLA 1YQ3B 1HZ5A 3IG5A 4ED3A 4S0RA 2HVHA 3JPNA 1OEYJ 4EUTA 4UQGA 3DVGY 4MGYE 5LLIA 1FIQB 2LVQA 1DIIA 1RWSA 2Q0ZX 3MKCA 1WCLA 3IJIA 2ZIUB 2GRIA 3AEAB 3HM3A 2GQWA 4M8NA 3VDZA 1WMHB 2QDFA 3CIRB 3B0AA 1F52A 3OZYA 4Y2VA 5HMLA 3BS5A 8ICXA 1TYGB 4M02A 4QWEA 1QZEA 1WR6E 4GGHA 3IM1A 4O3OA 1QSLA 1CZPA 1Q10A 1KTQA 1OTRB 2VA8A 2ISOA 3EJBB 1U9LA 3KW5B 4MGIE 2KICA 1LM8B 4QZIA 4LDTD 4AJWA 3H0LB 3BWUD 1U49A 2YQUA 2BGWA 1SBBB 3KD3A 2INPE 2YB4A 3ZO5B 4M2YA 3SSZA 1D8LA 3ZJTA 3TSHA 5AKJA 4EBEA 2N9LA 3HRDC 2OEDA 3A33B 5ALLA 5DGBA 4O5CA 2AL6A 2EKIA 4XQ8A 1L4ZB 1MNSA 3KBBA 1ZRMA 3VRAB 1GERA 2FE9A 3C23A 4PL2A 1ZW7A 4FBUA 5IN7A 3CGEA 4QZ8A 2ZIXA 4DN1A 2B3AA 2Y0SF 4FA6A 3KLJA 4KX6B 3FYHA 3IG8A 4I2FA 1IBXB 4KDIC 2WLBA 2BTEA 8ICWA 2M0XA 4XUSA 1S0MA 3M3JA 1L3VA 1R4NI 3I5JC 2ZNVB 4Y2RA 2WS3B 4ZRJA 5BPCA 3H6NA 3A0HU 4RUCA 1HTOA 3V7KA 2J6TA 3H7PA 1PZNA 3V6JA 2QC8A 3V7JA 3NZ3A 3GD4A 1JMLA 2DZIA 1WYWB 5ALZA 4A55A 3AE6B 1UWMA 2GGEA 1IPGA 5TZVA 3ZKJC 3QTPA 2JWUA 2AAQA 1JN3A 1MG8A 3QKEA 1T8EA 5AKKA 4LNFA 3TEWA 3RR7A 3MJ5A 4KPRA 3NS1B 5ALUA 3DG6A 2B6GA 2MCNB 5AKEA 4N9F4 4A3PA 3HJEA 8ICKA 1JCKB 5U1OA 2ASDA 4Z17A 2FPMA 2WXLA 1C9FA 3UGBB 1KDHA 4FP1A 2BCUA 5L9XA 2MX2A 1R4MI 3HW8A 1L3TA 4ELVA 4H1ZA 1E7PB 2MAXA 5DB6A 3VH4B 2QDEA 2QQ6A 7ICPA 4QWCA 4X5VA 4IG7B 1E8XA 3B0YA 1ZQMA 2GMIC 3GB1A 2NCNA 4GIBA 4W9GA 1LFDA 1ZQBA 1L6UA 1KKXA 2KDBA 2DL0A 3QCAA 1T0YA 4ACFA 4TV3A 1VRAB 1ZYQA 1I4HA 3DGHA 3CP8A 4DWDA 3M1YA 1X2IA 2KJRA 5T8IA 3X0WA 7ICSA 1I42A 2OCEA 4C4VB 2BZFA 4ELTA 2ZZPB 2BYEA 2EMTA 4ZYSA 2MP2B 4EZLA 4RNMA 2FDRA 4OJLA 4KIKA 4A6GA 2RHFA 4A90A 4ANUA 1L8OA 4YTNB 3RR8A 2XH4A 1KFTA 1FECA 3PWGA 5KFNA 4ELUA 3KUZA 3MJWA 3PVLA 5AE3A 2KZZA 4DQSA 2FLPA 4MMWA 1Z00A 3ZLHA 1DYQA 2ZZBA 4NEWA 4RF1A 3PSTA 2XIDA 2Y9UA 4EWJA 2ALZA 2BCSA 4GMEA 2J42A 3FWAA 3ES8A 1UA0A 1NK8A 1K51A 2GBMA 4JUZA 3EANA 1MBTA 3Q8MA 2D3GA 3SV3A 2G5IB 2LRWA 3ISBA 3ZVVA 2CJOA 5KL8B 3Q8QB 4ED2A 2QPMA 2WYQA 3OJ4B 2MBHA 2QVHA 3QIJA 1SL1A 4XE0A 1S8OA 2ASQA 3BOXA 1MC8A 3ZDTA 1L0YB 3PSEB 2IO1B 2F8KA 5KAIU 3HIZA 2WXHA 3RJEA 3ABVB 3L17A 5KG0A 5CP2A 3DVNU 3RBEA 2X99A 3CGBA 3Q3MC 4IT1A 1J7CA 2FLNA 2KMCA 1R7SA 1D5MC 3H7SA 1RYSA 2BKRB 3CXOA 3W2DA 4P0PA 3IJQA 3NHEB 9ICTA 5L83A 3QXGA 4DQQA 1ZQLA 2OG9A 1KH0A 4OZAA 1ZQAA 3OG5A 1T5XD 3VTEA 2W0HA 2QJJA 3R0UA 1JWSD 4NEVA 4P7IA 4F4WA 2NPTA 5J2RA 2C22A 3SYZA 1UWXA 3N1XC 3RCYA 4F5NA 4YR3A 2KX0A 3T4WA 5HP4A 3BJYA 5AKYA 3M95A 3PPAA 1FO4A 3UINB 3GRSA 5AKHA 2LM1A 4BGDA 2JXTA 4K4GA 3ZVIA 4PL1A 4YN4A 2AL3A 5J0TA 1P3QU 4OZBA 1TKGA 4PJ0U 2M1MA 4TURA 4F3OA 1WFYA 2LGIA 2YLMA 4H50A 3DWMA 3OP2A 1DTNA 3BK1A 2QARA 3PREA 7ICFA 1BNOA 1YJ1A 1GEUA 4JQ9A 4G9BA 7ICOA 5CRXA 3DBLB 2MU2A 4KN7A 1S1QB 3NS8A 4XYCA 2XH7A 1A0PA 5KFYA 2JU6X 4ZHPA 3IVFA 2WP9B 2QLTA 3HVDA 1GREA 3LK9A 1IGCA 4CF4A 3DQVA 4GGQA 3POPA 2GLSA 3DPDA 3STPA 4MGZE 2YN4A 1CJEA 1P9DU 4PYUA 2UWQA 5D2MB 1XHCA 3GD6A 3CNHA 1C4AA 1Y8RC 4O3RA 2V3NA 2V9HA 2QCZA 3PX0A 2FAZA 4AS1A 4J3OD 1L7NA 3D47A 2DKZA 2LHDA 1B1ZA 4GIVA 1ZETA 3A7AA 4HKZE 1X6JA 1WJ4A 3MDAA 3RZWC 4KLMA 1HTQA 1NENB 1VQZA 3AU2A 3VUWA 5JHBA 4QIWF 3U9IA 3MR5A 2G0AA 3VTVA 3OPSA 3ZIMA 3X23A 3QN3A 4KLDA 4ENLA 2BQUA 4J9MA 3A7RA 3MR2A 1KRPA 4DXGA 1KLGD 1NHPA 3QYPA 2FUG1 1EC8A 2Y1JA 1H38A 4W9JA 2N1WA 3Q8PB 9ICGA 5KFOA 3RBDA 1TK5A 3TAQA 3UMCA 5JTIA 1TKDA 4JLCA 4RGNA 1IIPA 4IRCA 3R2IA 3SHQA 3AM9A 1RZTA 3UJSA 2I0KA 3GE3C 3ZXVA 1X40A 2WXFA 3DEDA 2DW6A 2FIFA 2L5YA 2DZJA 2QEJC 5JCNA 2AH5A 1X42A 4RQMA 2GBNA 3ML8A 1XCTL 1E0YA 2R8HA 4YSXB 4LVSA 2J6SA 4FHKA 4LCDE 1SE4A 4R63A 3PHXB 3QJZA 1D5XC 2LYHA 3ICXA 3DGBA 4MEYA 2ZUCA 9ICRA 8ICSA 4Y2PA 4YXMA 4KZCA 1P7EA 5EWEA 3R25A 3C1YA 3LXFA 3L16A 3VH3B 3WCQA 1FHUA 1PVRA 2KFZA 2CHZA 2KO3A 4GDKB 3M9NB 4A35A 2NO4A 3EW9A 1TY2A 1NKBA 4ECVA 9ICPA 3R7RA 3GQCA 4I2BA 3R7QA 1GESA 1PK3A 2IOFK 5KFSA 5DG7A 4R3DA 2KVZA 2Y3SA 2K39A 1V5OA 3N4MB 3ED5A 7ICRA 1CI4A 2DQNB 2HMXA 3KZIU 1WX8A 2KP7A 1Q1RA 2Q4TA 3ZW3A 4ED1A 1QILA 3QAQA 4K3CA 4DHZB 5AM0A 2D3AA 1C78A 3VQIA 3BJSA 4HCHA 3RRAA 4YR0A 4XRHA 1T3QA 4UB1A 5KT2A 1TKYA 1GRGA 2K8CB 9ICSA 2KMDA 3SN0A 5AI6A 3C1ZA 1KTKA 3KUCB 2UU7A 2XGQA 2PIAA 7ICLA 2NMQA 4R8UB 1NJWA 2KD1A 5KG3A 5C3JB 2GGGA 8ICGA 1BPEA 3B9JA 4J9LA 4HVBA 3N4FA 2GBRA 1QOBA 2RDJA 2J4XA 3RJJA 3RD2A 3U4EG 2BC1A 2XH2A 3MC9A 5EBKA 4HCLA 5DB9A 1MUCA 2YX8A 4M9NA 2FPLA 2XI9A 5GMVA 3ZVHA 1M6YA 2KDMA 4RZRA 2KE7A 5ALEA 4RQ3A 4B9VA 1T0SC 2G4SA 3O0HA 1AWDA 2BPSA 2BKEA 2REXA 5HI1A 2FCMA 1J0GA 3RB4A 4F8RA 4M00A 3T6CA 5IIIA 4JB1A 3H8HA 4G7FA 2KJ9A 2EQ7A 4NXZA 2W9CB 3RITA 3H8SA 1U48A 3H7PB 1BZLA 2EZZA 1GUAB 4EEKA 2EZYA 3S6JA 3NVYA 2ONQA 2OXOA 3W1SA 2KN7A 1ZXIA 4HAIA 2KXJA 3ZDMC 4UAVA 2JXJA 5J2BA 2CKHB 5JXVA 4OO1J 2ZADA 1XPYA 1U4AA 5C2TB 2JEIA 4DF4A 1RYJA 3EA6A 5D79A 1KKRA 2HJ1A 1ET9A 3Q8SB 4O3PA 4ED8A 4ZH4A 5AM2A 3Q8LA 2KTRA 2MWSB 4RGTA 1G6JA 4BCAA 1SJCA 2ZNVC 1X2GA 3HW2A 1FD6A 1E8WA 1GC6A 3HWTA 3RZFA 1Q1OA 4RNNA 2SEBD 3ENEA 4U7CA 1FFVC 3MDCA 4C8MA 4PPXA 2HNEA 4LJXA 1FIQA 5GTIU 4FJVB 1UNSA 3EEZA 1Z4NA 4ZRQA 2MQJA 1T0RC 3EPIA 2AGQA 2BVFA 3SQIA 3QUCA 2C28A 4ZRPA 4E0DA 2PMZC 1TVAA 3UXNA 4JK1A 2BB5A 2WHIA 3BQ1A 4B9UA 1WMHA 2JY6A 2JEJA 2KJ8A 3C2LA 3RUIB 2K8HA 3RFAA 3DHGC 2MSNA 2NRTA 3IAM1 2BDUA 1NJXA 2I2YA 2VANA 1EXNA 2FBWB 3P63A 1YZ7A 1RYUA 1X1MA 2MBQA 5L6FA 2WF6A 1MQ2A 5FS6A 5IILA 8ICZA 2J53A 2V0GA 4DXKA 4WWMA 3AL0B 3A7UA 5F9NA 4P0QA 4H4QA 3OJ3A 4YWOA 4OJPA 4IQVA 2F2AB 5BYRA 4JN7A 2W82A 1XDIA 2DZKA 2GQUA 2F76X 4RT2A 4K2SA 1T3QC 1T0QC 7ICQA 1N60A 4W9HA 1M94A 2AU0A 4XX5A 4BX9C 4RNOA 3WAPA 4LNOA 4KLOA 5FXEA 5HHZA 2OAIA 2PE6B 2XBBC 5J0SA 1ZD3A 1MOKA 2H3FA 1SJBA 2C2RA 4F91B 2IJ0A 1V59A 2AQ3B 2L3ZA 4Z6FA 3DCGA 2QKNA 2YVFA 5HR7A 2DHZA 2GB1A 1IBXA 3R1ZA 3B1LX 5J2FA 3ETRA 5ALPA 3R8BA 5IIJA 1R4NB 4UB4A 1NKCA 3BVZA 4IDIA 4PT5A 2FYMA 5JCKA 3B97A 2LMRA 2C3DA 4JL9A 3V3XA 3PZPA 2FE8A 4Q43A 1BPZA 4IM2A 5AM1A 3N6HA 3NTUA 7ICIA 2ZXHA 1WX9A 2WQYB 4M0XA 1VZ6A 2QILA 4OW0A 4DWFA 3NZUA 4IS7A 1QOAA 3W1SC 2ZPYA 1QLTA 1ZXIC 2A3VA 3APCA 5KFPA 3Q8CA 2NRVA 3V7LA 3MGHA 3U8ZA 1L7PA 2ATLA 4WAAA 4EEWA 5JH5C 5I1VA 2ZIWA 7ICVA 4ZRIA 3NS1A 4YMMA 3R10A 3RI7C 3K1RB 4UBBA 2FPKA 4O9MA 3CYJA 2K60A 1KJTA 4EYHB 3IC9A 2HHTA 1F3PA 3WANA 1S0VA 1ZKHA 2NPTB 3MABA 1NI3A 1V38A 4RM9A 3ZTCA 3U7ZA 1XS2A 3A4SC 2VFUA 1ZOLA 3TQ1A 2NBWB 4B9SA 2JXXA 4ECXA 4EE2A 3KHRA 5DBBA 3Q8EA 4HXDA 1ZQPA 4APNA 4C8OA 3VC5A 3ZNZB 1F0XA 3BS7A 2YVCA 5KFCA 4Y2TA 1YN4A 4F2SA 1XEEA 4LZDA 1CRXA 3RNMA 5ALDA 3KHLA 1MRAA 2BS2B 4FDCB 2PMQA 3OLMD 2RP5A 2W55A 5J2KA 2EKEC 4QNLA 2TPRA 2WOIA 2L0TA 2ZTEA 3DBLI 3SFDB 4C4VA 3L3FX 5AZHA 2XH0A 2MP2A 4GXKA 5DB8A 4YWSA 2O6VD 3V6KA 2PGEA 1A6SA 4JWSC 2PLIA 4P2HA 4PK1A 4QWBA 5AI4A 5KFEA 5KG6A 3PRZA 4AOFA 4HDOA 3RYTA 4I2CA 3N6JA 3EUB2 2OFJA 1LQBA 1ZMCA 2EMSA 3GIKA 1F0MA 5KFZA 1WE6A 3WA0A 4PZFA 4MKSA 2FLLA 2KMAA 3ZI4A 5H8YE 3AE4B 5J0RA 4YTMB 5AK5A 5KFLA 4ECZA 4NPNA 3FM9A 3C0RB 3DVNV 3E56A 4E5TA 2IO0B 2RABA 1WZ0A 3LXDA 5E6OA 3RRGA 4CDGA 3D9XA 3PNCA 2CJNA 5AUIA 2ZUBA 3F2DA 3V61A 2A8XA 4QZHA 4C8LA 4A3OA 4LNKA 2HHXA 3QEBZ 3BQ7A 3OAWA 2G09A 3P2BA 1ZY8A 1CUKA 3KVFB 1JW9D 1XWLA 4RQ1A 4JWUC 1WWVA 2RLTA 3F5AA 4H4PA 1BNPA 2W54A 2RMMA 1WJUA 3BINA 1AROP 2GDQA 1SWWA 2K8BA 2R2QA 4MF8A 2LGSA 5DLGA 5IIOA 2HBLA 4KGSA 5J2CA 3A0BU 5J2JA 5AZGA 1FCLA 3CF6E 2K3UA 5HQXA 1BWCA 2KK0A 4KN4A 4TSSA 3A1QA 4CE6A 3RO6A 4RUAA 2L0FA 2GQTA 3V4BA 1GNUA 4E4UA 2R61A 3TEXA 4K1RB 3WKDA 4RQ0A 1O03A 3SD7A 3VVWB 3DDMA 3IHQB 2ZG6A 5J0YA 2C3CA 3U4FA 2PA6A 5GRTA 3PZDA 4W9IA 4CYEA 1GPXA 1GETA 4TUSA 3LADA 2B0CA 3JPTA 1JWMD 5J8YC 2BVHA 1MFWA 1EC7A 2E3TA 3JPRA 2QJLA 3P4SB 3BYYB 1EF5A 3MC8A 4GGBA 1Q5WB 3UXKA 5LXHA 2ZCBA 4KITB 2WXPA 3OSNA 3SZ2A 5J0UA 4LJPB 1V80A 1SL0A 3HUIA 3DOWA 4IW0A 5BOEA 2KZRA 2ACZB 2R8KA 1S0NA 1L0XB 2CHWA 4GFJA 1STEA 1J8CA 3GDXA 4M9JA 4Z6DA 5J0OA 2J0JA 4TQSA 3AE3B 1MBBA 1SKRA 1Q3VA 3P4RB 2CDUA 4H2AA 5HG2A 2WAQF 2MA9B 3T5HA 4J9QA 2Y0SC 3DK4A 3H4KA 1VJ5A 4P4OA 4DLEA 9ICQA 1ZQZA 4PGXA 3LVWA 3OJSA 2KTQA 2DF4B 1CEZA 1LV5A 1V1OA 4DNAA 1F5SA 4F72A 2XGZA 1ZUD2 2QHOA 4KLFA 3D32A 1GRFA 3MC0B 1QQ6A 1RQNA 1ZQYA 2EDUA 1K50A 4A8EA 4GYPC 5D7GA 2DWQA 3PM9A 4EYIB 1ZJMA 1L4DB 2HHWA 2YY6A 1ZQEA 4KT2A 2EAOA 1LXDA 1IYFA 2KIWA 4PZOA 2BYVE 1TS5A 3HVZA 4YWGG 4BKSA 1TAQA 3KJMA 1NK5A 3B9JB 1UQVA 1ONFA 2D10A 3AECB 4C00A 2KC2A 2D3BA 1BUIC 1UBIA 1M6IA 4ACOA 5CHFA 1SEBD 5ALWA 4KX5A 1LGRA 5AE1A 4J9RA 5CB1A 4FS2A 3ZVHB 4M52A 2LVOA 2ZPNA 2WXMA 2HHUA 1C77A 2DPIA 2WF8A 1V6EA 2YMLA 2W8LA 3UPQA 4FS1A 2K5PA 4BAXA 3M9MB 2WHEA 2X50A 3HSUA 1ZDLA 2WXKA 2M17A 2AJQA 7ICHA 2E5SA 2KV2A 4DQRA 1NK9A 3PQBA 2WXNA 4PGQA 4QZDA 5AM5A 3PO5A 3WK7A 1PVPA 2JPHA 2KHQA 7ICUA 2R9ZA 3LAEA 2L52A 4DQOC 2HCFA 1NHRA 2V4LA 3PLUA 3EPGA 4B6JA 4M9GA 3Q8FA 5B5EU 3SJNA 1C7YA 5DDYA 4DL2A 1WX7A 5AE2A 5A0LA 4FI4A 1XO1A 5DBAA 3F5EA 2L76A 1BKHA 2Y4GA 4MFFA 1XLPA 1NZPA 3UQ0A 2WOWA 1D6EC 3M9OB 2KEYA 2LPEA 1UA1A 1BPXA 2RSUA 2A1JB 2NVKX 3GV5B 3RNFC 2I5QA 1T3NA 3OC4A 3UMGA 2WFAA 3GV8B 1WWUA 4RH6A 1SWVA 3ZDAA 1ZOYB 3MHZA 1JWAD 4FO6A 5BYQA 1DGJA 3H8WA 2KDFB 3TEYA 1ELSA 1UUPA 1WR1A 4YXDB 1TKEA 2DLBA 2UVUA 4K4HA 3A9KB 2KQ7A 3O65B 4YFKA 8ICVA 2F3NA 4C8KA 2NBVB 4ICUA 4WJNA 3PX6A 2MEKA 3MSYA 4GDKA 1ZRNA 3DK8A 3TJPA 2QJMA 2UUVA 4JPSA 1FXTB 3DBHI 1QLUA 8ICTA 3GOEA 4O3SA 5KT6A 1PUZA 4NL9C 2JVCA 4JGHB 4GXBA 4HYRA 3S5SA 1X9MA 1SSNA 1E5WA 5ALMA 3AXCA 1UELA 2HI0A 3L5KA 4DLGA 3GZFA 1Q46A 4P0QB 4DHJD 2YVJA 4RQ4A 2ONEA 4LA1A 5I1WA 3PRPB 5ALSA 5KFFA 4YMNA 2XY5A 4QZAA 5HMRA 2K8CA 4IR9A 3H8MA 2AGPA 2WGSA 3GV7B 2M19A 2NTTA 5KNIA 2JRZA 4R8UA 3BY4B 3VCNA 1DXSA 4M0WA 8ICUA 1IG6A 1V85A 2G08A 3OHAA 4DL5A 4FBTA 1NNLA 5KG7A 1V2YA 1WIAA 2BQQA 2JF5A 2RDBC 4NLZA 2BS3B 3QA8A 5J2DA 2BPFA 3U26A 4K4IA 3E0FA 2Z59B 5E6PA 4M9HA 2PU1A 3RJFA 2X8HA 4EC3A 4IL6U 1GRHA 4AJYB 3ETRB 5ALGA 3AQEA 5ALOA 2R2OA 4F1SA 5BO4B 4C8NA 4LNIA 4EM4A 2BCQA 4RPZA 4I2HA 2JGAA 2R18A 5IIKA 4PS8A 3H0MB 2W9CA 1LB2B 2PTYA 4DL3A 5KFRA 2W9AA 5EOZA 1NVID 3ISCA 8ICJA 4DSEA 3B0XA 1UD7A 1NYRA 3EJEB 4EM3A 1WSPA 3AU4A 4BZAA 2Z8LA 3FW8A 3MBYA 2VA2A 3RNEC 3CB3A 4PHDA 4QZBA 4E4FA 4WQMA 3TWBA 2AL1A 2ZIWB 5AK3A 1AQ6A 1CQVA 5BMIA 4DQIA 3UQ2A 4ECRA 1SV4A 2N0SB 4KTQA 1MHHE 2N7JA 1KW4A 4F5RA 4GXIA 5L95C 3OJUA 2K6DB 1ESFA 2N9XA 4FULA 3NFUA 3PGEA 2K89A 2VIXA 4U6PA 3PLVA 1TFRA 4LZGA 2PODA 2MRLA 3C2MA 2CU1A 3J9CA 3I99A 2MJ3A 4PZNA 4RNAA 2AL2B 1HE8A 3LVVA 2DYMA 1AHUA 1V5TA 1GXFA 3AB5A 2JYEA 4B95A 4C80A 1WH3A 3L54A 1P98A 4ZDVA 4RU9A 4QWAA 4GMVA 3GC2A 4ECYA 3L0WB 4DBGA 4IUMB 5G55A 3AEBB 3PW4A 3UF8A 3RR1A 4TUQA 1D9FA 3CK5A 1W1QA 9ICNA 5FP0A 3ML9A 1YN3A 3ONNA 2DNFA 4IHCA 3VFKA 3SU8X 4DYEA 1TE2A 4FZMA 4PWBA 3OZMA 4DS5A 3N4EA 1NKEA 4QAYA 5ALIA 3GE8C 3T3OA 1NELA 2XY7A 2UVRA 1U45A 4GRTA 3L13A 3GP7A 2PMVA 4H19A 4BDPA 4I2AA 4DDGD 2JYTA 4G50A 1SJED 2INNE 4J9NA 2P3ZA 5EE3A 2C60A 1Q1WA 4QIWC 5EE9A 4PGYA 1SZPA 3BZKA 2I38A 3AU5A 4IM3A 4W9KA 1PGAA 4NJ8A 1L5UA 2CU3A 2GBJA 2N9PC 3K9OB 2WX1A 1JWUD 2IO3B 2GR1A 2GOWA 3QUQA 2WU5B 1D3ZA 3ZD8A 3TL5A 2I1KA 3BQTA 5KAFU 3I9V1 2CFYA 4P4PA 4UAYA 1WF9A 2PKEA 4DFJA 4MELA 4IL0A 4JMUA 3R3MA 2HJ8A 5IOIA 4MHVA 1E9MA 2IMWP 3P4PB 4BKGA 3ZGZA 2AXRA 3RRHA 1TJEA 3B2FA 2KWCA 4HPNA 2PPGA 3AE7B 1C79A 2JQRB 1QSSA 2GH1A 2JMGA 4IZGA 1N5WC 2KQ4X 1MA7A 3UMBA 1X9SA 2ASLA 2FCSA 1JQ4A 4ARCA 1NHQA 3BQ0A 3HKZC 3H4DA 3DQ0A 2NVUI 2ZIVB 4GSWA 4ZCWA 2P88A 3A1QB 2OZTA 1TZOA 1ZD4A 2GGHA 4HJKA 2OQYA 2AWTA 2OZ8A 4NQKE 3SFEB 1SGGA 2V1YA 2Q85A 3ECIA 3V62A 3Q3NC 5AI5A 3QU4A 2NQWA 3AE5B 3EFUA 2ASJA 2DUYA 4JV1A 1SJHD 2PU0A 2JHDA 3URYA 5FJTA 4OVUA 1I35A 2MLBA 4DSKA 2CS4A 4KLLA 3VR8B 4EZ9A 1C4CA 2M0NA 1S9FA 4RMAA 4HJGE 5CR0A 5DB7A 2AYOB 3MZNA 1QQ7A 3AEDB 2RR9A 4CNQA 2KC1A 4NLKA 4FN2A 1FNUA 3AE8B 4K7WA 5B66U 4DCCA 5AKZA 2E8NA 3E2EA 4EZJA 1YX6B 3ZXRA 1WGDA 2GWSA 2Y3AA 4EFOA 1E8HA 2HBKA 2FUHB 4MSMB 4PS3A 1OW5A 2D8CA 2NS5A 5H92C 1E0ZA 2PCEA 3V3WA 1N63C 1WYGA 3PZ7A 1ZQRA 4W9LA 4AP9A 1SZHA 3AULA 4CQNA 3T8MA 2L1AA 1A76A 4YQWA 3PO0A 2MHJA 1I4GA 2NTSA 3JW0X 5AKIA 3H40A 3NG0A 3TWAA 4G0NB 4FBJB 1J19A 2DW7A 4FE3A 1NYQA 2KOXA 5JU5A 2V3PA 1FMAD 4UB3A 5D3DA 5IO9A 4BOZB 1JXEA 4DOCA 2PP0A 3CXBA 4YG2A 4TMAB 2LYBA 2HSZA 1UBQA 2POZA 2W7OA 3BVGA 3DG3A 5G5GA 1W1SA 3NVWB 3BVMA 5AM3A 5EWFA 1JCTA 3IJLA 2GSHA 2Y08A 2DFLA 4ED0A 3KTQA 5L1LA 2ZZ0A 2WPEA 1ZQDA 4HWIB 2JR5A 4KZ0A 4J57A 4DFKA 2D07B 3AUOA 2ZVNA 1VDVA 1IUEA 4KV2A 1ZQTA 2AQ4A 5CJ7A 2AGOA 3RJGA 1MHXA 2KQSA 2G06A 3AEEB 9ICIA 4LNNA 4H4YA 1QKZA 5FR3A 3EWAA 2W9BB 3WK9A 4RFBA 3O13A 2H3VA 3TFSA 1P7DA 1AOGA 4FJYA 5BOLA 3QZ7A 4UB8U 5HMMA 1WE7A 2FIDA 4KLSA 1XT9B 2PP3A 4GISA 2ISPA 4OJOA 3K75D 4O0IA 2HBJA 2IBIB 3T9LA 2C7MB 2QJNA 2PPHA 5DPWA 1E8FA 1TK0A 1Z2MA 2LI5A 2IPKD 4K7SA 1XSPA 2INCC 1F1HA 2VA3A 1PFDA 4BVUC 3DESA 2QMTA 3UXLA 2BHNA 4Y2JA 1K4QA 2YVGA 2HBMA 1X66A 2EQ9A 3PS6A 1FFVA 2KHWB 4A6QA 3RH4A 2WDTB 4QZ9A 2HXUA 1QQRA 5HHIA 3ZLGA 2JZBA 4F5PA 4MLAA 3HKZF 2IOHA 2MBBB 3TEZA 4QZCA 4JWNA 1VJKA 1MDLA 4MH0E 2BKFA 3IHPC 2ZC8A 4HYKA 2INDC 4MH8A 2JZPA 3RN9C 1N62A 1TZZA 2PFNA 3OTQA 3TADC 8ICYA 1YD8U 2WDQB 3TMPB 2MUTB 1JRUA 3CT2A 4L1BA 3JW7A 2W04A 2JRIB 2HTME 3UCCA 4L23A 5TR3A 2ZJDA 2RDGA 4BBNF 2QB0B 2TSSA 5G2NA 3MTNB 3PVXA 4B0MA 2WXIA 1SJDA 1WVEA 1ZD2P 3JYUA 5J17A 1ZD5A 3TI0A 1TIFA 1GO3F 2BYFA 1N6ZA 1K1SA 2DX5B 4LDTB 2VFTA 5FJUA 4Q8FA 2NBUA 4H4SA 4DHJB 4MFAA 4BWMA 4G11A 1P0RA 1DNCA 2WBAA 3FV9A 3C21A 1Q8KA 4ROPA 3UQAA 5AK6A 4MF2A 4A9AA 1OGWA 4MGKE 2G4DB 4BFRA 2AQ0A 4YMOA 1AN8A 2UYZB 2PP1A 1ED1A 2G45B 4M0WB 2L83A 2FI1A 1L0VB 3HK0A 1JWBD 2H5XA 4XWWA 3TCSA 2IDYA 1SE3A 2ZJAA 3M62B 1FHVA 3WAOA 4BV6A 5KFMA 2KX3A 1NBFC 2PTXA 2CXYA 2LRUA 2J0MA 2JH1A 4EMWA 3FDSA 5BYSA 2NPXA 3D46A 1QT9A 3UXPA 3CW2C 5D94A 4XDCA 4B9KA 2A5UA 1ZQNA 1I4PA 2BPCA 5KFVA 1EO6A 3APFA 3SN1A 1BPYA 1W6TA 1KD0A 2N7EA 1WGRA 2FKPA 1KL9A 4EENA 1WI0A 2I1QA 3TFRA 2K0PA 4KGTA 4EQXA 1F2RC 2K6QA 9ICCA 4M04A 3IDWA 5JRBA 3EYZA 2KKVA 4M47A 3W8WA 3BK2A 3NRWA 2H89B 3ZDCA 3CSFA 4EOYA 2N4FA 4ZA0A 2A1JA 2MA1A 1OXJA 2F1HA 4J9PA 4J9SA 1EF1A 1PQSA 1HQRD 4W9FA 2MH7A 5K8EA 5ADZA 4DXFA 4E3CA 1COKA 4QJFB 5IIMA 1FRRA 2CHXA 2JSVX 3RFZB 3NVZB 1GRAA 2GR2A 3FCPA 1BT0A 2AHOB 3H4BA 3NZGA 2KACA 3MGVA 2F44A 3BYTB 4XWTA 1RM6C 2WB1C 2WP6A 2A4ZA 2XO7A 4O5KA 3A9KA 2PVOD 1L7YA 2FMQA 3EAOA 2H88B 4Q8EA 2OQHA 2LHEA 2KSOB 1ZGUB 3RJKA 3EF6A 3AI5A 4LIIA 2QDDA 1N62C 3PR5B 2F5ZA 3M6ZA 2E1EA 5J2IA 1T4GA 4D2KA 3RJHA 3DBHB 3IXSA 1E8YA 3EC8A 2PGWA 2DBYA 2P35A 2GO7A 3D2SA 1PK1A 4LTUA 4WJPA 1TKKA 3Q3FA 5KVIA 1AYFA 1JROA 5AI0A 2GR0A 4UB6U 4H4UA 2KOBA 1RDFA 1UT8A 2BYTA 1WGYA 5KFWA 2PXIA 4MT5A 4CGZA 2P6UA 4BJQA 2HHQA 4ZRKA 2OKTA 4YCXA 2D6FC 1ENFA 3KLSX 4QZFA 1SKWA 3WKBA 5D3IB 1E90A 1V81A 1ZQQA 5KFJA 3UGVA 1ZXHA 3Q69A 4FZNA 3PV8A 4GXJA 4S17A 4UARA 3W5UB 4Q2JA 3BIID 2G07A 2N9KA 4Y2YA 4OVZA 1EU4A 1RFAA 2MBOA 5DDMA 1EBGA 4KLIA 1YOVB 2Q4WA 4XZ4A 5JHAA 4H83A 2V3SA 2KJ6A 5DBCA 2GGIA 5AKGA 3C5GA 5J2GA 3TKAA 2R8GA 4GN1A 4E71A 3GY1A 8ICQA 4URKA 1H2IA 3NO1A 2C2DA 1OFFA 2PLSA 2R2ZA 2IZVB 1MDRA 2AKMA 3PO4A 4XDDA 3DFYA 3SDLC 4HPPA 5GXGB 2ZJ5A 4ZHOA 4MEXA 2BCPA 2PFOA 3I28A 4EKUA 4ASWC 5JCLA 5KFUA 1L7MA 2E5AA 2MNRA 3F53A 3OHBA 1TS3A 4DNSA 1H8CA 2XEWA 5DG9A 4WURA 1V97A 3TW9A 2NR2A 3PG6A 2XCAA 1DOXA 4HNCA 2LVPA 2K25A 3UJ2A 2V6OA 4JV0A 1MI0A 1WJNA 4GR1A 4H4VA 4DHGA 4RQ6A 3AE2B 9ICVA 5J8YA 1KBUA 2WNMA 2DKXA 3QU9A 3QFAA 2AL2A 1TS2A 2GL5A 3THUA 1N48A 2GOLA 2LI6A 1WXSA 2WAQC 2K8AA 1SE9A 1W1LA 1HXYD 2IGDA 3IP4B 4KLHA 4EX6A 1ZQOA 1STZA 3DH9A 2HDOA 4NJCA 2VFSA 1NK7A 4USAA 3PV1A 3BSMA 4P4MA 4IC7B 3W5VB 2GGJA 4II2B 2WWZA 3RTVA 2PSNA 4KLGA 3T5LA 4XGAB 4QZGA 2QSDA 4RGMA 1B0XA 3AQFA 4NWIA 1YT3A 2GLEA 2WF7A 2RPQA 3KWVA 2WB1F 3LYYA 1RYRA 2BC0A 5ALNA 4Y2SA 2O6VA 3PX4A 1KFSA 3P42A 2EQYA 5CTRC 2H3ZA 1J7AA 4OJ5A 1EWCA 2KJHB 4DHZE 1N2XA 2BGFA 2PTLA 1OJTA 3I4KA 3AMZA 1T6BX 2XK5B 1RFKA 2DZMA 3EGRA 3L5OA 5L1KA 3B2GA 3CMMB 2HOQA 1FPYA 2L7RA 3PT2B 3FVDA 3HX0A 4DL6A 2HZGA 3MQTA 4EEYA 2ZUDA 2W7PA 4NNJB 4GYPA 4EQSA 4EQRA 5KFTA 1ZR6A 4Y2XA 4HRSA 4MFCA 3KOOA 1L7OA 1UCVA 4DOBA 2M4NA 2KKPA 4IWQA 4FX9A 5G5GB 4FADA 3D2QA 1WXAA 4ANWA 1GAQB 4L2YA 4XA5A 4CF3A 4XC2A 1ECQA 3SEIA 1FEBA 1GG3A 1MQ3A 4IQUA 1RVKA 5FMHA 3DGZA 5KTQA 1ZQSA 4FZLA 4ECQA 1ZE3D 2K22A 3SI8A 4KX3A 3FXGA 2YEPF 3ZDEA 1EBHA 3PWIA 3N32A 1GB4A 3EZ5A 1HUOA 3W8ZA 2F1JA 3D2NA 3GS2A 1J2MA 3C19A 1X2HA 2BW2A 5KT3A 4DOAA 4OALA 4RPXA 1XQQA 4FLHA 1R0MA 4KLTA 2LHTA 1SIFA 2W8KA 2RD0A 2OLAA 3G6VA 3O0FA 3GIIA 2LD9A 3JSVB 1PGBA 2P8BA 4AQ7A 3SQSA 3I6TA 1QQ5A 3C8YA 4PVHA 2ZIVA 5TSSA 3TIXA 4C56C 4RM8A 4UDUC 5FXFA 4KMOB 3DJGX 4X57B 3UIPB 2EZXA 3SN4A 1GRBA 2OOBB 5FS7A 2PKOA 4HLEA 4UAUA 3D2DA 3GD3A 1FNVA 3CGCA 1J97A 3GIMA 1KRHA 4TUUA 2PTWA 3I63C 1R6WA 3VFCA 4B9NA 3RB3A 4TVYA 1KEJA 1V8CA 1NU5A 8ICNA 2JZBB 3MY9A 2XICA 1WM2A 3OGUA 2N1VA 4OHJA 4DXAB 4NJ6A 2YAUA 4EBCA 8ICCA 1RM6B 1RLFA 3ZDBA 1S77D 1P43A 4QW8A 1Z5SB 1TAMA 3V6HA 1HZ6A 3VTUA 5KFKA 2BQRA 5FS9A 3C28A 2P6RA 4YP3A 2OEHA 4IRDA 1MJDA 2KLGA 4BBYA 1E10A 3ETLA 4F4XA 5CHVC 3I6EA 2I9GA 3NRZB 4NL9A 1DGSA 7ICGA 1WJ6A 5FXDA 3KZXA 2KTFA 3M63B 1ISNA 1WGGA 4TQRA 2OH2A 3QU7A 5L1JA 5DKWA 1V86A 4MDKE 2VKQA 2O2VB 5C5JA 1ZK7A 3T9PA 3FAHA 4ZYNA 2N1RA 1ZMDA 1EM7A 2LUMA 9ICWA 3L08A 4IOIE 5HHHA 1ZQHA 9ICLA 4NLCA 3MFHA 1XLNA 4Z6CA 5JRTA 3VCBA 5FXPA 3LYSA 5DLFA 4MM3B 3N7PD 2JEFA 5FJOA 7ICNA 4HCNB 2YEPB 5DGAA 3PW2A 3MUCA 3NVWA 3FILB 4M6UA 2R8DA 5DQIA 5BOMA 3VUXA 2H3IA 4B9MA 8ICIA 2WX0A 3UJEA 1I7HA 2G9HD 1RXWA 2KK8A 4ECTA 3DBRB 1AW7A 3S1CA 2J52A 4F93B 4BUGA 4BXOA 4OVVA 2RDIA 1TS4A 4KLEA 4TQ0A 2BWES 2QIEB 2WXJA 2GR3A 4H4ZA 5CA7A 3UIOB 2LGXA 2W9BA 3ENLA 1X9WA 2UVWA 1D8YA 2WPFA 1ZP0B 2IHMA 3KWLA 4NQLB 1HSKA 1S76D 1FNWA 2MJDA 1D4BA 1F8WA 4Z1YA 3M8RA 4PYZA 4F5OA 1XSNA 3D2JA 4BKSD 2CHRA 3AU6A 1ZDXA 2BBCA 1GJZA 1CK1A 4WQOB 1VD2A 2ES6A 5J0XA 3Q6JA 3T8QA 1ZQVA 1LVHA 1QLBB 1WRIA 4I2EA 1JOAA 3NOBA 1SE2A 5KFGA 3Q6BA 3RT3B 1F77A 2PVGC 3PY8A 4RCOA 5E6NA 2G5HB 4AWJA 3DERA 2DPJA 1UH6A 2BVCA 3TX1A 4RQ2A 3QPEA 2I1JA 1XXGA 1F0ZA 3T5KA 5IAAC 5J0PA 2BR0A 1UPHA 9ICBA 4EBDA 2KT7A 4C7YA 1KCZA 3MP9A 5AHXA 3IK4A 2H3QA 8ICAA 3U30A 4GIRA 5FK9C 1SV0C 3DBSA 4DF8A 1L2NA 2WOVA 2XGPA 3FW9A 1W1JA 4IRKA 2IGGA 3NJTA 4IM0A 4J56A 4F71A 1GB1A 1FEHA 4LJOB 3RGTA 4I2JA 2MUTA 3GZNB 4DEZA 3WKEA 2KANA 3F2BA 2W43A 4WAFA 1Q3UA 3P4QB 2QB0A 2BF8B 1KOTA 2LGYA 3CRXA 3H70A 4BKTA 1PVQA 1ZQCA 1PK1B 4J3ZA 2BWFA 3CAWA 3N28A 5KT5A 3TQPA 3QLDA 1QF6A 1NI2A 4UBCA 3Q14C 4ICVA 3PMNA 3M6KA 4RT3A 4I2IA 4UAZA 1XS9D 3F2CA 2GBKA 1DZNA 4PVKA 4EX7A 3KFUF 3KYCD 5HKHA 1I19A 2P4PA 1IV8A 4CHKA 1FFUC 2PW9A 3ZNGC 2HHSA 2M8SA 3HT3A 3MHSD 4DL4A 3C5FA 1XF5L 2EANA 4ECUA 4GC7A 4WJOA 5ER0A 2P66A 2KFJA 3P93A 3TARA 3EKGA 9ICXA 1JXLA 3R2TA 5KHOA 3RPFC 5EE1A 1XLQA 3WALA 1N56A 3A4RA 2Y9TA 3N20C 5KFAA 1W1KA 3DHIC 3JPSA 7ICTA 2E6XA 2LJ5A 1SXDA 2XN9C 4H2HA 3WK4A 2AQ2B 1QH9A 2HVIA 3NXLA 5GTHU 5IA7A 2AX5A 1WXMA 1QOGA 1LKYA 5KT7A 1VAOA 2E8MA 1UXYA 1B9RA 3GSYA 2WDWA 4GOCA 2HQMA 3PSPA 2YQEA 5KFIA 5KL1B 1DOIA 2A19A 4HPMB 4JN8A 2QB1A 1WG8A 2MBEA 3SMVA 2EH9A 3NZSA 1K53A 5C1ZA 3K1GA 4K1WA 7ICMA 1DK3A 2V9WA 2HHVA 1GOZA 5G5HB 4I29A 2F77X 1N5WA 2KYWA 2WF9A 2YMMA 2XNAC 3SR6B 3MFGA 3L4PA 4FFDA 3AV8A 3V6CB 3QZ8A 4YSYB 3ZUNA 3OWEB 2MRPA 3R11A 1GC7A 4GLXA 4NV0A 3GFKB 3S47A 3RAQA 1LPFA 3VCCA 3LB8A 2KHVA 4NAWB 5EDSA 1P48A 3NVZA 3JZUA 3ZRFA 4M9LA 4O95A 1L5PA 1TT5B 2ZW1A 4KSKC 3Q8AA 3PRMB 1P1AA 2W3RA 1KKOA 2X8GA 2C2EA 1OQQA 4DFMA 4CO7A 2AXTU 2ZJ8A 3Q4DA 4GB9A 3QK0A 2V3BA 4IQTA 2K9XA 2VZKD 2KLCA 3SEBA 2KSOA 2D11A 2VAOA 2BVGA 3PHWB 3QX7A 2NYVA 2O56A 3VC6A 1MO9A 4O5EA 2PI5A 4WWNA 5KG5A 3RNCC 2CR5A 2D2QA 1NDDA 5FKAC 3FG2P 2O3GA 2R8IA 1BVSA 1KN5A 3RB0A 1WUDA 1D9DA 1BGXT 4P1CC 3HPFA 5F9LA 2LXCA 9ICUA 2PI4A 4F4KA 4ANVA 1N63A 4GU2A 2D5GA 2O6VB 1L6VA 1OEPA 1Z1BA 1TYPA 1KN0A 1TV9A 1WXVA 1F44A 1Z1VA 3N97B 4WJQA 1UGJA 3RMKC 3KQ4A 1WZ3A 3QU2A 3HILA 2W3SA 1KLUD 2BB6A 2C9WB 2R8JA 4GC6A 3J81j 4AUQC 4CRXA 4GLSC 5DPSA 3C2KA 3FKYA 2OM6A 5HFYA 2KFKB 2OZ3A 4I6NB 2PJHA 4AYBC 1A70A 1XSLA 5ALXA 4N58A 1F9CA 1XANA 4UB2A 1GSNA 1XU4A 2IY1B 5ALYA 1D5ZC 3IT6B 2C7NB 2LM4A 2V4RA 2KIVA 1VZ8A 4F4ZA 9ICMA 1SGHA 2VH2A 1L3SA 4MACA 5E79U 3SAFA 3SAGA 3AEFB 2IO2B 1EUVB 2LJIA 2LYAA 3S2AA 1E7VA 1W1RA 3TOYA 1L8PA 1MSWD 1YMHE 1YQ4B 2K4EA 1KSPA 4DSIA 3D2HA 4B9LA 1K1QA 3Q8BA 3I57A 2KD0A 4N6EB 4I6PA 4EMJA 5TISU 3RJ8A 1BPDA 2JWZA 2FMPA 2WU2B 3PTFC 3TTEA 4R65A 3LLBA 4NM1A 1QTMA 4M6WB 2F1IA 1DXLA 3QUTA 2IYDB 4ED7A 2LWPA 5DPTA 1DK2A 1F2RI 8ICPA 3LB8C 2J0KA 4HEA1 2VH1A 4YR2A 5DQGA 1VCBA 1XNSA 8ICOA 2LEKA 3HP6A 3NVVB 3TJIA 3GU3A 4HPLB 2KWDA 2VRRB 4O3NA 3D6JA 5AICA 3W1YA 2FNJB 2J6UA 1C20A 2KAJA 4BBNC 3N30A 1JEHA 2Y3RA 2P13A 6ENLA 2QKQA 4CCHA 1KLVA 3HPOA 5FS8A 3AN1A 1TYTA 4DFPA 4JDRA 3VTWA 3KHGA 4IWOA 4DK5A 4IP5A 4NLGA 1ET6A 1S0OA 5DCNA 1W1MA 4R64A 2MBRA 3TADA 5ALHA 2WP5A 3EHVA 4C4RA 1ZQUA 2BCVA 3KH0A 4P16A 5L1MA 2I6XA 5HHDG 3ZLZA 4REZA 1AHVA 4PHAA 1QLNA 2LFIA 1URJA 4NM2A 1T94A 1SB3C 5HR6A 4YXJA 3WU2U 3VC8A 3AEVA 2G3QB 4TVWA 3M7DA 3QU5A 3ISDA 2KDIA 3AE1B 4PVEA 4QZEA 3S1DA 2OVLA 1ACCA 5J04A 3BQ2A 1X6IA 2DYOA 2XK5A 4I27A 3S1FA 1SIJA 1ZKQA 1NEKB 2ZCCA 3PW0A 2CPRA 4UB5A 3C0PA 3WAMA 3PK7A 4MJSB 1SL2A 1W1OA 4F50A 3NGDA 1TGZB 1YJJA 2L00B 3PW5A 2M0AA 2MW5A 4W9DA 4YVZA 3Q8RB 3G6YA 3RH6A 2ZEQA 5IINA 2C5LC 2IGHA 3RCZA 2K8BB 4KVGB 5LXIB 4IC9A 1MN8A 1PYWD 5ALRA 1NPXA 2XSXA 5IDZA 2IBKA 1TTNA 1SKSA 3N1YC 3DBRI 4FXCA 4BXOB 5H2FU 1PDXA 1XD3B 2CN1A 4EELA 4ITKA 1ZJNA 9ICOA 3RULA 7ICJA 2D3CA 3E9SA 1JUDA 1VLBA 1FXIA 2L8JA 4XLOA 1E9IA 3OTRA 3QFBA 5AM4A 2W9MA 3H12A 2KZMA 3SQPA 2JK6A 3P0WA 3QQ8B 2EQ8A 3OSPA 2AEHA 5I4DA 3H8AA 3ZJUA 1IXRA 4AYBF 3JSVA 5JCMA 4EMIA 3K9PB 4YTPB 2L05A 3H7VA 4I2DA 3OW1A 3FW7A 4JWMA 2P3HA 2Z0DB 4PH5A 4KWSA 1JRPA 3DV9A 2LMCA 5FJPA 3A9JB 3FJ4A 1NK4A 1FCCC 1KLNA 1V1PB 5ALJA 3L10B 4ZOHC 4RPYA 2MUCA 5KVHA 2UUUA 3Q8KA 3RNBC 5EE0A 1KFYB 1ZQFA 3MC1A 3C29A 1QCKA 2HE7A 4GDLA 5AKXA 4UD8A 1WCNA 4W9CA 1O08A 5JZEB 5U25A 4RQ5A 5AEKB 5ALFA 1SXEA 1UHUA 3BDPA 4F4YA 7ICEA 2Q5WD 4M8MA 1YQZA 1E8GA 2P0IA 2UVVA 4KEMA 3QC8B 2OWOA 5AK4A 3MR6A 3PW7A 1Y56A 4O1NA 1WUFA 2Y1IA 1ZQWA 1FEZA 4A20A 5FJRA 3GZNI 4RQNA 4NY8A 4FHJA 4HROA 3TAPA 2FMSA 3EJDB 3IT4B 5ALVA 3NRZA 4F5QA 1HIWA 1L3UA 1FRDA 1F9JA 1M4VA 1XO3A 2LZ6A 3P3BA 2W03A 3I1YA 7ICKA 4QW9A 1KF6B 3R66C 2XC9A 4F2RA 5AIAA 4HK2A 2BQ3A 9ICJA 2W9NA 5AI8A 3RF9A 2O2VA 4DFDA 4LLGM 3IG3A 3TUOA 3E58A 1VR9A 3OPXA 3TJ4A 3H7IA 4KLQA 4B0EA 4Z6EA 5J2AA 2OJWA 3H0RB 4AP4C 2PTZA 3TACB 3L8KA 5KG4A 1FXAA 3LDAA 1PUTA 4QWDA 4B9TA 4MM3A 1S5LU 3ZNHB 2FCQA 1FEAA 3N3KB 1NJZA 2KNJA 3DDCB 2JH7A 3BS5B 4PYTA 4KKJA 4DQPA 2KVRA 4MEMA 3FILA 4DO9A 3M8SA 1S97A 2XVTA 1P7FA 4IKGA 1WRDB 5J0WA 8ICHA 4ANXA 4JAYA 4BOSC 2V3AA 4Y2UA 3P1MA 2GH5A 3NASA 3BW7A 4RF0A 3VHTC 1L8LA 4CF5A 1DIQA 2IOFA 1DRGA 2OHFA 2IHNA 3R0KA 1V9JA 3IN5A 2RK5A 1RXVA 1LKYB 2CRXA 9ICKA 2A1AA 1UF0A 8ICRA 1WWTA 2FCNA 3KHHA 3NY5A 1N61A 5ALKA 8ICFA 2DENB 2SAKA 4NJ7A 1IYXA 4GFIA 2YVSA 5KT4A 3RJIA 8ICBA 3B08A 3TBLD 1Z19A 3UQBA 4H4TA 3APDA 1GV4A 5KG2A 1CMXB 1EWYC 3I3TB 1BXTA 2ZIXB 3DFHA 1Z4OA 2D3DA 3U2SC 3IV6A 3MWCA 4OD0A 4DSJA 1C1YB 5J0QA 1HEZE 1ECWA 4ED6A 4P1BC 5DPRA 5J18A 4HCPB 1D7YA 1I4QA 4O3QA 2M56B 3PZ8A 4DL7A 2LUEA 4NY0A 3DK9A 4KLUA 3KUMA 1V49A 2IA6A 3MGIA 4H4XA 2HD5B 3BZCA 1IP9A 3LJ3A 1TZ1A 4PHPA 3ZNID 4WIPA 4B6WA 1PDYA 1H6VA 2ESEA 3CGDA 4UASA 4EQWA 4H4WA 2KN5A 2VZKB 1I4XA 1ROEA 4FJZA 4WWOA 2OX4A 4MGGA 2GI9A 5C23A 1J7BA 2AKZA 3CYMA 3W8XA 1Y88A 1JPDX 3JVZX 1S7MA 1JPMA 4F7ZA 1WUEA 4EZ6A 2V4QA 2RQ5A 1QOFA 4JE3B 1SJAA 2EAMA 5CHWA 1ZQIA 4K3BA 4EZKA 1JIHA 5CHGA 2RGFA 1BQGA 2M9NA 3N1ZC 3T3NA 1D8BA 1SB3B 1YEYA 1DOYA 2G1EA 4IL2A 2KVCA 2ZXIA 2KN4A 1NOMA 3ALRA 2BT6A 2IY0B 1MG4A 4JHMA 2YMQA 2ZIUA 3CSTA 1TAUA 3JVAA 3VXWA 2NRWA 4K7UA 4WH4A 1IGDA 2ZZCA 4IR1A 1A5RA 5L1IA 8ICEA 1ZPSA 2RPVA 8ICMA 5KG1A 9ICFA 5AI9A 3TSSA 2K4PA 4C4SA 1JMSA 3ZDDA 4JX1C 2W11A 3LWMA 1WGHA 3TANA 1Z3EB 5KHQA 3V72A 4K8GA 5CEHA 1AHZA 1JDFA 1AARA 1DOQA 3RJAA 1RRBA 3I76A 4KLJA 1K8RB 2J7QB 4F8CB 4KIKB 2PEAA 2HOFA 1XCQL 1BPBA 2J3NA 1TE6A 2OPJA 3DDHA 3RB6A 3ORYA 2LBOA 1C4PA 3PFRA 3ZRCA 3H9DA 1ZQJA 3UJFA 3EUB3 1UZXB 4KDLB 1N61C 5KFXA 2K1FA 2B76B 5KFHA 4I28A 1Z00B 2RDHA 5G5HA 3SR6A 1TK8A 3ZLFA 4HN8A 4KMUA 4M0AA 3FC4A 1QSYA 2NRZA 4M01A 1NHSA 3S1EA 2ON8A 2HOIA 3THVA 2WXGA 1C76A 2HDEA 1E6EB 4G3XB 1KQQA 3IFWB 4NAMA 4IQWA 1SF0A 3QEAZ 3PR4A 3SD5A 4JB3A 3DHHC 1WVFA 2VFRA 1ZQXA 4HG0A 4NAWA 3UCDA 2JX5A 1J2NA 1KM7A 2LKYA 1OQRA 2KKCA 2KNBA 2DAFA 4ZOHB 3IBEA 2RRDA 3DIPA 1ZQ1C 2O6KA 4OJ6A 1HUZA 3QHTA 4NZLB 1JI7A 2WXQA 4K81A 1EC9A 1T7PA 2WDVB 4HDQA 5L6GA 5EWGA 2BDPA 4J1OA 1ONEA 3KYDD 1SXTA 3II4A 2HW3A 2YTUA 1JX4A 1U4BA 4WJ3B 3V6EB 4PWCA 3URHA 2JRHA 1S3SG 4P0PB 2WXOA 3KKAA 4R66A 1UT5A 2N7DA 3HM6X 5BMGA 5IKCM 5AWVA 1IM4A 2Y5BB 1HA5A 3ZTDA 3QE9Y 4YSZB 2LGDA 4I2GA 4KGRA 3Q3OC 1BMLC 3UM9A 2F8LA 3QUBA 1ZQKA 2QAEA 1NZBA 2X38A 1XC9A 5KFQA 1R4MB 2Z0EB 2FJ6A 1VZ7A 4YT0B 5T14A 1WY8A 1HEKA 2ZVOA 1LVLA 1YZ6A 2YMPA 3V60A 4C0ZA 3SENA 2KZ3A 5IP4D 1ZX9A 5KFBA 3GILA 2BS4B 4Y2QA 4HKQA 2DGZA 4MSQB 4ECWA 4ECSA 4UAWA 4ICAA 3V05A 3FYYA 3GRTA 3WK5A 3LDZE 2WDRB 3ZQ4A 2QARB 3ES7A 8ICLA 1L6NA 2KFKA 3WKAA 2PE9A 5HNKA 2XCPA 1MVKA 3SBFA 2X8XX 3WKCA 4G3IA 2PMZF 2C7HA 1WM3A 3U52E 1FM0D 2JV3A 3V5CA 1OEYA 4YD2A 2EXRA 3HHMA 2WTFA 4DSLA 1YX5B 3EECA 4DSFA 3WK6A 1JALA 1NDAA 2PLPA 1N60C 1ZDVA 3RNAC 4IP4A 2V4IB 3GIJA 3G6XA 1EU3A 4KKIA 4A3RA 4P6VF 1XLOA 3JPOA 4YD1A 5BOFA 2WF5A 2KDEB 4H4RA 4NLNA 3MR3A 1YJIA 3JPQA 2ZTCA 1COOA 5D49A 2LASA 3VUYA 3ZD9A 3DWGC 5EU9A 4F4RA 1NK6A 1WXQA 4C7ZA 2K4HA 4M6WA 3WK8A 5D4BA 3VRBB 3AE9B 1PGXA 2GRTA 2X8CA 4PS7A 2L32A
chains in the Genus database with same CATH topology
2E6XA 2XN9C 5H92C 1E0ZA 4BC9A 2AQ2B 1WYGA 1K52A 2SEBD 3PZ7A 1N63C 1N5XA 1FFVC 2AX5A 4GDLB 3NVVA 1QOGA 4CQNA 3GSYA 2L1AA 1VAOA 3PO0A 1FIQA 4US9A 1I4GA 2NTSA 1UNSA 1B9RA 1UXYA 3R07C 2WDWA 4ZRQA 1DOIA 2KMMA 3NUHB 2BVFA 4ZRPA 1NYQA 2V3PA 2BB5A 4P16A 1FMAD 1K53A 5D3DA 1GOZA 5G5HB 2Y5CA 4TMAB 1N5WA 2XNAC 4N59A 4RGOS 3N9YC 3SR6B 3MFGA 3JS8A 3IAM1 5LNK1 3L4PA 3AV8A 3VR9B 2I2YA 3W9CB 3BVGA 4YSYB 5G5GA 2FBWB 1W1SA 3BVMA 3OWEB 3P63A 2VFVA 3NVWB 5L6FA 2J53A 2Y08A 2V0GA 4WWMA 2ICIA 5AUKA 3A7UA 2MJEA 4NAWB 3NVZA 4US8A 4A8XC 4O95A 1VDVA 1IUEA 1L5PA 4OZCA 2ZW1A 5BYRA 1MHXA 2W82A 3AEEB 3ZYYX 4BC7A 2IPIA 3Q8AA 2GQUA 1QKZA 5FR3A 2W3RA 1WGKA 2ZW0A 4RFBA 1T3QC 3AEGB 1OQQA 1N60A 3O13A 5E6JA 5FXEA 4LK0M 5HHZA 2K9XA 2OAIA 1FFUA 2VZKD 3SEBA 1LO5D 2VAOA 2BVGA 2IJ0A 2AQ3B 3TSJA 2QKNA 2GB1A 1IBXA 5FKAC 1E8FA 2O3GA 3ETRA 2IPKD 3ZJVA 3R8BA 1PFDA 4IDIA 3BVZA 4PT5A 2Y5PA 1I4RA 2QMTA 5BMHA 3V3XA 4ML8A 2FE8A 1N63A 2EELA 2D5GA 1FFVA 1L6VA 4A6QA 2WQYB 1QQRA 1VZ6A 2QILA 3AH7A 4OW0A 4MLAA 3HRDD 3TEZA 1UGJA 1QOAA 1VJKA 1QLTA 1ZXIC 3KQ4A 1TY0A 3Q8CA 4MH8A 2BB6A 2W3SA 1KLUD 2JZPA 1N62A 2WDQB 5I1VA 3IAS1 4L1BA 2AQ1B 2HTME 3NS1A 4GLSC 5HFYA 4L23A 1V1PA 2RDGA 2TSSA 4B0MA 2WXIA 1A70A 1WVEA 4N58A 2VFTA 1D5ZC 1NI3A 3IT6B 1MPEA 3U7ZA 1VZ8A 2VFUA 4MACA 3CWIA 3BZDB 3AEFB 2LJIA 1YN5A 4EE2A 3Q8EA 2WXRA 4A9AA 4PVJA 1W1RA 1F0XA 3NVYB 1YQ4B 1YMHE 1AN8A 4ARIA 1YN4A 3UI3A 1XEEA 4TQ1A 3D2HA 2L83A 3Q8BA 1YNTE 3I57A 4N6EB 1L0VB 1JWBD 2BS2B 3RJ8A 4XWWA 2WU2B 2W55A 3LLBA 2IDYA 1SE3A 3SFDB 1F2RI 3LB8C 1YQ3B 1HZ5A 4JWSC 4HEA1 2PLIA 5BYSA 2LEKA 1QT9A 3NVVB 4XDCA 1FIQB 1DIIA 2KWDA 1I4PA 1RWSA 2KAJA 3EUB2 2Y3RA 2P13A 2GRIA 3AEAB 4PZFA 3AN1A 3CIRB 5H8YE 3AE4B 4YTMB 1ET6A 2K0PA 3E56A 1TYGB 1W1MA 4KGTA 2MBRA 1F2RC 1CZPA 5HHDG 3W8WA 1Q10A 3BK2A 2H89B 2CJNA 4REZA 5AUIA 1AHVA 2LFIA 1HQRD 3BWUD 1SB3C 2MH7A 5ADZA 1SBBB 4DXFA 2INPE 5K8EA 1FRRA 3RFZB 2JSVX 3NVZB 4TVWA 4PVEA 3S1DA 3AE1B 3ZJTA 3TSHA 1ACCA 2KACA 2DYOA 2N9LA 3S1FA 1SIJA 1JW9D 2OEDA 1NEKB 3BYTB 4JWUC 4XWTA 3HRDC 1RM6C 2W54A 2RMMA 2EKIA 1L4ZB 2PVOD 3C0PA 2H88B 3VRAB 2LHEA 1W1OA 4KGSA 1YJJA 1N62C 1FCLA 2M0AA 2K3UA 5HQXA 4D2KA 4KX6B 4TSSA 3IXSA 2DBYA 2IGHA 1IBXB 2GQTA 2R61A 3TEXA 2WLBA 4LTUA 2BTEA 1PYWD 1AYFA 1JROA 4FXCA 1GPXA 1PDXA 1JWMD 4ITKA 2WS3B 2BVHA 2BYTA 2E3TA 2QJLA 3E9SA 3P4SB 1VLBA 1FXIA 4MT5A 3BYYB 4XLOA 3NZ3A 1JMLA 1ENFA 3KLSX 2WXPA 5I4DA 3HUIA 5D3IB 4A55A 3ZJUA 3AE6B 1UWMA 2ACZB 4YTPB 1L0XB 2JWUA 1ZXHA 3Q69A 1STEA 3FW7A 3TEWA 2P3HA 3MJ5A 3W5UB 3NS1B 1JRPA 4Q2JA 3BIID 2LMCA 2N9KA 1FCCC 1EU4A 1V1PB 3AE3B 4OVZA 2UUUA 4ZOHC 1MBBA 1JCKB 5EE0A 3P4RB 2WXLA 1C9FA 1KFYB 4H2AA 5HG2A 2Q4WA 4UD8A 1E7PB 1V1OA 1OFFA 2PLSA 2R2ZA 1ZUD2 2Q5WD 4XDDA 3MC0B 3GB1A 1K50A 5GXGB 5D7GA 2DWQA 3PM9A 1E8GA 1L4DB 1L6UA 4ZHOA 1TS5A 1I4HA 1VRAB 1Y56A 3HVZA 4YWGG 4O1NA 3KJMA 3B9JB 2E5AA 3AECB 1TS3A 1BUIC 5T8IA 4HROA 4DNSA 1SEBD 3IT4B 3NRZA 1V97A 4WURA 5AE1A 1FRDA 1M4VA 1XO3A 1DOXA 4ZYSA 2WXMA 1KF6B 1C77A 2K5PA 4A90A 1MI0A 3HSUA 4YTNB 3AE2B 2WXKA 2WNMA 4LLGM 3TUOA 1VR9A 3PQBA 1TS2A 2WXNA 4B0EA 5AE3A 1DYQA 3LAEA 4RF1A 2L52A 4DQOC 1W1LA 1FXAA 1HXYD 2IGDA 1PUTA 3Q8FA 2J42A 4NJCA 3FWAA 4PYTA 5AE2A 2VFSA 4KKJA 1K51A 2Y4GA 4USAA 3FILA 3W5VB 1MBTA 1XLPA 1P7FA 1D6EC 4IKGA 2QSDA 4RGMA 4JAYA 2CJOA 3LYYA 3KWVA 3P1MA 2QPMA 3P42A 3BW7A 4RF0A 4XE0A 1J7AA 1DIQA 1EWCA 2OHFA 4RH6A 1ZOYB 1L0YB 2PTLA 3AMZA 1JWAD 1T6BX 3MHZA 2RK5A 1RFKA 5BYQA 1WWTA 2WXHA 3ABVB 1DGJA 3EGRA 1N61A 3TEYA 2SAKA 1UUPA 3B2GA 4YXDB 2YVSA 1J7CA 1TKEA 2DLBA 1R7SA 1D5MC 1EWYC 3W2DA 1BXTA 1ZR6A 2MEKA 4HRSA 1KH0A 4OZAA 3U2SC 2UUVA 4JPSA 1T5XD 1QLUA 3VTEA 1HEZE 5G5GB 1JWSD 1GAQB 4L2YA 1SSNA 1I4QA 2M56B 3PZ8A 1UWXA 1ZE3D 2K22A 5I1WA 2YEPF 1FO4A 1GB4A 5HMRA 3W8ZA 3GS2A 2JXTA 1X2HA 2BW2A 4OALA 2M19A 2NTTA 4WIPA 4OZBA 1TKGA 2VZKB 1I4XA 1ROEA 4M0WA 2LGIA 2GI9A 1J7BA 3DWMA 1PGBA 3BK1A 5MPOA 2BS3B 4AQ7A 3C8YA 4PVHA 3W8XA 5TSSA 4C56C 4EC3A 4UDUC 5FXFA 4JE3B 1QOFA 3ETRB 2JU6X 4ZHPA 2WP9B 2PKOA 3D2DA 3HVDA 3T3NA 1FNVA 1SB3B 1DOYA 2G1EA 1IGCA 1KRHA 2KN4A 2BT6A 3POPA 4TVYA 1V8CA 1CJEA 1NVID 4WH4A 4OHJA 1IGDA 1NYRA 1RM6B 1WSPA 3FW8A 2Z8LA 1C4AA 1ZPSA 2V3NA 1HZ6A 2RPVA 4WQMA 3TSSA 4JX1C 4J3OD 4AS1A 1CQVA 5BMIA 4BBYA 2LHDA 1B1ZA 2N0SB 1E10A 1MHHE 1AHZA 2N7JA 4HKZE 3A7AA 3NRZB 3RJAA 1NENB 1ESFA 1VQZA 5FXDA 1XCQL 1C4PA 3I99A 3J9CA 3EUB3 3FAHA 1N61C 2MJ3A 4RNAA 3A7RA 1AHUA 2B76B 2DYMA 1EM7A 1KLGD 2LUMA 4DXGA 4IOIE 3AB5A 2RDHA 2FUG1 5G5HA 2JYEA 4C80A 3SR6A 1XLNA 5FXPA 4MM3B 4RGNA 3FC4A 3AEBB 3R2IA 3AM9A 2ON8A 2YEPB 3S1EA 3NVWA 2WXGA 1C76A 2HDEA 1E6EB 3FILB 2I0KA 1W1QA 2WXFA 4NAMA 2R8DA 3DEDA 1SF0A 2VFRA 1YN3A 4HG0A 1I7HA 1WVFA 2G9HD 2QEJC 1AW7A 4PWBA 2J52A 2JX5A 3S1CA 1OQRA 1E0YA 4ZOHB 1XCTL 1TS4A 3T3OA 4YSXB 4TQ0A 2QIEB 2WXJA 4NZLB 2WXQA 3GP7A 1SE4A 2PMVA 2WDVB 1D5XC 5L6GA 2JYTA 1SJED 1ZP0B 2INNE 1SXTA 3KWLA 1HSKA 1FNWA 2MJDA 5EE3A 1D4BA 1P7EA 5EE9A 4PWCA 3D2JA 2I38A 3LXFA 2WXOA 3WCQA 5BMGA 1PGAA 1ZDXA 2BBCA 5AWVA 1CK1A 1HA5A 2CU3A 4GDKB 1TY2A 4YSZB 4KGRA 1JWUD 1BMLC 1QLBB 1WRIA 2WU5B 4R3DA 2Y3SA 1SE2A 3I9V1 1F77A 2PVGC 2X38A 4RCOA 3TX1A 1VZ7A 1F0ZA 1XXGA 1QILA 4YT0B 1C78A 3VQIA 4C7YA 1E9MA 3MP9A 3P4PB 3ZGZA 2AXRA 1T3QA 1TKYA 5FK9C 1TJEA 3B2FA 3AE7B 1C79A 2BS4B 1KTKA 2JQRB 4HKQA 3FW9A 1N5WC 2PIAA 2NMQA 2KQ4X 1W1JA 2IGGA 5C3JB 1GB1A 1FEHA 3V05A 1JQ4A 3B9JA 4ARCA 2WDRB 1QOBA 2J4XA 3U4EG 3ZQ4A 3DQ0A 4WAFA 3P4QB 1MVKA 2KDMA 1TZOA 3U52E 1FM0D 3SFEB 1AWDA 1QF6A 2EXRA 5HI1A 2Q85A 1JALA 2NQWA 4JB1A 3AE5B 2PLPA 3H8HA 1N60C 1DZNA 1SJHD 1ZDVA 4PVKA 2V4IB 3URYA 1I19A 1EU3A 4KKIA 2P4PA 1FFUC 3VR8B 2ONQA 3NVYA 1C4CA 4P6VF 1XLOA 3W1SA 1ZXIA 2PW9A 4HJGE 5JXVA 1XF5L 1YJIA 3AEDB 1RYJA 3EA6A 5C2TB 5D79A 3R2TA 3RPFC 1FNUA 3DWGC 3AE8B 5EE1A 1ET9A 1WXQA 1XLQA 1W1KA 4C7ZA 4BCAA 4RGTA 1X2GA 3VRBB 2Y3AA 1E8HA 3AE9B 1PGXA 1FD6A 2L32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H92 C;  1E0Z A;  4BC9 A;  1N63 C;  1WYG A;  1N5X A;  1FFV C;  2AX5 A;  3NVV A;  1QOG A;  3GSY A;  1VAO A;  3PO0 A;  1FIQ A;  4US9 A;  1B9R A;  1UXY A;  3R07 C;  1DOI A;  2KMM A;  2BVF A;  1NYQ A;  1FMA D;  5G5H B;  2Y5C A;  1N5W A;  4N59 A;  3SR6 B;  3JS8 A;  3L4P A;  3AV8 A;  3VR9 B;  3W9C B;  4YSY B;  5G5G A;  2FBW B;  1W1S A;  3P63 A;  3NVW B;  2VFV A;  4WWM A;  5AUK A;  3A7U A;  2MJE A;  3NVZ A;  4US8 A;  4O95 A;  1VDV A;  1IUE A;  1L5P A;  3ZYY X;  4BC7 A;  3AEE B;  2GQU A;  2W3R A;  1WGK A;  1T3Q C;  3AEG B;  1OQQ A;  1N60 A;  5FXE A;  5HHZ A;  2K9X A;  2OAI A;  1FFU A;  2VAO A;  2BVG A;  3TSJ A;  2QKN A;  1E8F A;  2O3G A;  3ETR A;  1PFD A;  4IDI A;  4ML8 A;  1N63 A;  1FFV A;  1L6V A;  2WQY B;  3AH7 A;  4MLA A;  3HRD D;  1QOA A;  1VJK A;  1QLT A;  1ZXI C;  2W3S A;  1N62 A;  2WDQ B;  2HTM E;  3NS1 A;  1A70 A;  1WVE A;  4N58 A;  2VFT A;  1NI3 A;  2VFU A;  3CWI A;  3AEF B;  4A9A A;  4PVJ A;  1W1R A;  1F0X A;  3NVY B;  1YQ4 B;  3D2H A;  2L83 A;  4N6E B;  1L0V B;  1JWB D;  2BS2 B;  2WU2 B;  2W55 A;  3LLB A;  3SFD B;  3LB8 C;  1YQ3 B;  4JWS C;  2PLI A;  2LEK A;  1QT9 A;  3NVV B;  1FIQ B;  1DII A;  1RWS A;  2KAJ A;  3EUB 2;  2P13 A;  3AEA B;  4PZF A;  3AN1 A;  3CIR B;  5H8Y E;  3AE4 B;  4YTM B;  1W1M A;  1TYG B;  2MBR A;  1CZP A;  3W8W A;  2H89 B;  2CJN A;  5AUI A;  1AHV A;  1SB3 C;  2MH7 A;  5ADZ A;  1FRR A;  3NVZ B;  4TVW A;  4PVE A;  3S1D A;  3AE1 B;  3TSH A;  3S1F A;  1SIJ A;  1JW9 D;  4JWU C;  1NEK B;  3HRD C;  1RM6 C;  2W54 A;  2EKI A;  2PVO D;  3C0P A;  2H88 B;  3VRA B;  1W1O A;  1YJJ A;  1N62 C;  5HQX A;  4KX6 B;  2DBY A;  2GQT A;  2WLB A;  4LTU A;  1AYF A;  1JRO A;  4FXC A;  1GPX A;  1PDX A;  4ITK A;  2WS3 B;  2BVH A;  2E3T A;  2QJL A;  3P4S B;  4XLO A;  1VLB A;  1FXI A;  3HUI A;  3AE6 B;  1UWM A;  2ACZ B;  4YTP B;  3FW7 A;  2P3H A;  3W5U B;  3NS1 B;  1JRP A;  3BII D;  3AE3 B;  4ZOH C;  1MBB A;  5EE0 A;  3P4R B;  1KFY B;  2Q4W A;  4UD8 A;  1E7P B;  1OFF A;  2PLS A;  2R2Z A;  1ZUD 2;  2Q5W D;  5GXG B;  2DWQ A;  3PM9 A;  1E8G A;  1L6U A;  4ZHO A;  3HVZ A;  3KJM A;  3B9J B;  2E5A A;  3AEC B;  4DNS A;  4HRO A;  3NRZ A;  1V97 A;  5AE1 A;  1FRD A;  1XO3 A;  1DOX A;  1KF6 B;  2K5P A;  4YTN B;  3AE2 B;  5AE3 A;  3LAE A;  2L52 A;  1W1L A;  1FXA A;  1PUT A;  5AE2 A;  3FWA A;  4PYT A;  2VFS A;  4USA A;  3W5V B;  1MBT A;  1XLP A;  4JAY A;  2CJO A;  3P1M A;  2QPM A;  3BW7 A;  1J7A A;  1DIQ A;  2OHF A;  1ZOY B;  3AMZ A;  1JWA D;  2RK5 A;  1RFK A;  1WWT A;  3ABV B;  1DGJ A;  1N61 A;  3B2G A;  4YXD B;  2YVS A;  1J7C A;  1TKE A;  1R7S A;  1EWY C;  1ZR6 A;  4HRS A;  1QLU A;  3VTE A;  5G5G B;  1GAQ B;  2M56 B;  2K22 A;  1FO4 A;  5HMR A;  3W8Z A;  1X2H A;  4OAL A;  2M19 A;  1TKG A;  1ROE A;  1J7B A;  3DWM A;  5MPO A;  2BS3 B;  4PVH A;  3W8X A;  4EC3 A;  5FXF A;  1QOF A;  3ETR B;  4ZHP A;  2WP9 B;  2PKO A;  3D2D A;  1SB3 B;  1DOY A;  2G1E A;  1KRH A;  2BT6 A;  4TVY A;  1V8C A;  1CJE A;  1NVI D;  1NYR A;  1RM6 B;  3FW8 A;  4WQM A;  4JX1 C;  4BBY A;  1E10 A;  2N0S B;  3A7A A;  1AHZ A;  3NRZ B;  1NEN B;  1VQZ A;  5FXD A;  3I99 A;  3EUB 3;  3FAH A;  1N61 C;  2MJ3 A;  3A7R A;  1AHU A;  2B76 B;  3AB5 A;  5G5H A;  4C80 A;  3SR6 A;  1XLN A;  5FXP A;  3FC4 A;  3AEB B;  3AM9 A;  3S1E A;  3NVW A;  2I0K A;  1E6E B;  3DED A;  1W1Q A;  2R8D A;  1SF0 A;  2VFR A;  4HG0 A;  1I7H A;  1WVF A;  4PWB A;  3S1C A;  2JX5 A;  1OQR A;  1E0Y A;  4ZOH B;  4YSX B;  2QIE B;  2WDV B;  1ZP0 B;  3KWL A;  1HSK A;  2MJD A;  5EE3 A;  5EE9 A;  4PWC A;  3D2J A;  3LXF A;  3WCQ A;  2CU3 A;  4YSZ B;  1QLB B;  1WRI A;  2WU5 B;  2PVG C;  3TX1 A;  1F0Z A;  4YT0 B;  4C7Y A;  3P4P B;  1E9M A;  2AXR A;  1T3Q A;  1TKY A;  1TJE A;  3B2F A;  3AE7 B;  2JQR B;  2BS4 B;  3FW9 A;  1N5W C;  2PIA A;  1W1J A;  5C3J B;  1JQ4 A;  3B9J A;  2WDR B;  1QOB A;  3DQ0 A;  3P4Q B;  1FM0 D;  3SFE B;  1AWD A;  1QF6 A;  2EXR A;  2Q85 A;  1JAL A;  2NQW A;  4JB1 A;  3AE5 B;  1N60 C;  1DZN A;  4PVK A;  1I19 A;  2P4P A;  1FFU C;  3VR8 B;  3NVY A;  4P6V F;  1XLO A;  1ZXI A;  1YJI A;  3AED B;  1RYJ A;  5C2T B;  5D79 A;  3RPF C;  3DWG C;  3AE8 B;  5EE1 A;  1XLQ A;  1WXQ A;  1W1K A;  4C7Z A;  4BCA A;  1X2G A;  3VRB B;  1E8H A;  3AE9 B; 
#chains in the Genus database with same CATH topology
 4BC9 A;  1K52 A;  2EQ6 A;  1N5X A;  3SV4 A;  4GDL B;  3NVV A;  3MFI A;  2NV3 A;  2NO5 A;  4US9 A;  1PDZ A;  5J2E A;  3R07 C;  4J03 A;  4E8G A;  4HCD A;  2KFN A;  3JPP A;  5MPO A;  1RPL A;  2BPG A;  2KMM A;  3NUH B;  3UJR A;  3QNM A;  5DQH A;  3Q2A C;  1SV0 A;  1C3T A;  3H1U A;  5JUM A;  3IRU A;  1GRT A;  2Y5C A;  1YQB A;  3N7R C;  4N59 A;  3N9Y C;  3ALB A;  4RGO S;  2E8P A;  3KKA C;  3JS8 A;  5LNK 1;  3ONS A;  4DDI D;  3VR9 B;  3PSF A;  4E74 A;  4X2P A;  3W9C B;  4UAT A;  1Q0W B;  2VFV A;  2JZZ A;  1RQL A;  3SAH A;  3LWL A;  3Q3J A;  9ICE A;  4II3 B;  5TR5 A;  1OUQ A;  2OJR A;  2ICI A;  5AUK A;  3DVG X;  2BCR A;  2MJE A;  4G8T A;  2I5H A;  5K4L A;  4US8 A;  4A8X C;  3T5J A;  5KFD A;  4OZC A;  5DG8 A;  3ZYY X;  4O3M A;  9ICH A;  2N9E B;  4BC7 A;  2IPI A;  4ADW A;  1WGK A;  2Z7J A;  2ZW0 A;  5CX3 A;  3T79 A;  3AEG B;  2OYY A;  3DJJ A;  5AIB A;  5CWR A;  1NJY A;  5AZF A;  5E6J A;  4I6L B;  4LK0 M;  2YB1 A;  1FFU A;  2JUO A;  2ODG A;  4J6I A;  2KVS A;  4MJS A;  3U7D A;  1X9X A;  2E1F A;  1LO5 D;  4C4T A;  1XO0 A;  5D46 A;  3PML A;  1E7U A;  1TBE A;  3DG7 A;  1B43 A;  3PSI A;  4W9E A;  3KUD B;  3TSJ A;  2XY6 A;  4DX3 A;  1HJP A;  1EBD A;  4JV2 A;  2KG5 A;  5ALT A;  5ALQ A;  1K5O A;  5J29 A;  3R9K A;  1B4F A;  4J9O A;  3RH5 A;  4RQ7 A;  1RAX A;  2LXA A;  3ZJV A;  4Q44 A;  1I4R A;  4RQ8 A;  2Y5P A;  5BMH A;  2JEG A;  1RG6 A;  2RDX A;  3K1Z A;  4ML8 A;  2EEL A;  1B22 A;  3WIM A;  2NRX A;  3N7S C;  1A77 A;  3QX1 A;  1YIW A;  3DEQ A;  2PS2 A;  2PFP A;  5ENL A;  1S10 A;  3AH7 A;  3VA8 A;  3TCA A;  2E8O A;  2VJ5 A;  2ZTD A;  3HRD D;  5C0Y A;  5FR6 A;  2K4I A;  4UW9 A;  4E6M A;  4F92 B;  3H8J A;  1TY0 A;  4K8D A;  3Q45 A;  9ICA A;  2HXT A;  4JQW C;  5AKL A;  3GO2 A;  5J2H A;  2DAJ A;  3IAS 1;  3T3F A;  3RAX A;  2B21 A;  4PHE A;  2AQ1 B;  3VAW A;  1ZQG A;  2EAP A;  3RNG C;  2OO6 A;  4Q45 A;  3A9J A;  4HNL A;  7ENL A;  1V1P A;  3QAR A;  5JCI A;  4KSL C;  1KFD A;  1U47 A;  4OCZ A;  1OQY A;  3NUQ A;  2HTH A;  4K7Z A;  2KWV B;  4DWI A;  4YL8 A;  3K4G A;  2VJ4 A;  2WPC A;  1MPE A;  3V5F A;  2JT4 B;  4JIO U;  5D6J B;  3CWI A;  3BZD B;  1YN5 A;  3QWZ B;  4BWJ A;  2WXR A;  4TUP A;  1E8Z A;  2KWU B;  2MSE D;  4PVJ A;  3NVY B;  2DYB A;  4BUR A;  4DS4 A;  4NLB A;  4ARI A;  3UI3 A;  4TQ1 A;  2PFQ A;  2KJ5 A;  1YNT E;  3DEE A;  1NK0 A;  4IWP A;  1V9P A;  1UGM A;  2NQL A;  3EFC A;  2P8C A;  4J9K A;  5F3X B;  3UXO A;  2KTR B;  3VDG A;  2JZ3 B;  4TKN A;  4WWP A;  1H4R A;  2QGY A;  4KPL A;  1YQ3 B;  1HZ5 A;  3IG5 A;  4ED3 A;  4S0R A;  2HVH A;  3JPN A;  1OEY J;  4EUT A;  4UQG A;  3DVG Y;  4MGY E;  5LLI A;  1FIQ B;  2LVQ A;  1DII A;  1RWS A;  2Q0Z X;  3MKC A;  1WCL A;  3IJI A;  2ZIU B;  2GRI A;  3AEA B;  3HM3 A;  2GQW A;  4M8N A;  3VDZ A;  1WMH B;  2QDF A;  3CIR B;  3B0A A;  1F52 A;  3OZY A;  4Y2V A;  5HML A;  3BS5 A;  8ICX A;  1TYG B;  4M02 A;  4QWE A;  1QZE A;  1WR6 E;  4GGH A;  3IM1 A;  4O3O A;  1QSL A;  1CZP A;  1Q10 A;  1KTQ A;  1OTR B;  2VA8 A;  2ISO A;  3EJB B;  1U9L A;  3KW5 B;  4MGI E;  2KIC A;  1LM8 B;  4QZI A;  4LDT D;  4AJW A;  3H0L B;  3BWU D;  1U49 A;  2YQU A;  2BGW A;  1SBB B;  3KD3 A;  2INP E;  2YB4 A;  3ZO5 B;  4M2Y A;  3SSZ A;  1D8L A;  3ZJT A;  3TSH A;  5AKJ A;  4EBE A;  2N9L A;  3HRD C;  2OED A;  3A33 B;  5ALL A;  5DGB A;  4O5C A;  2AL6 A;  2EKI A;  4XQ8 A;  1L4Z B;  1MNS A;  3KBB A;  1ZRM A;  3VRA B;  1GER A;  2FE9 A;  3C23 A;  4PL2 A;  1ZW7 A;  4FBU A;  5IN7 A;  3CGE A;  4QZ8 A;  2ZIX A;  4DN1 A;  2B3A A;  2Y0S F;  4FA6 A;  3KLJ A;  4KX6 B;  3FYH A;  3IG8 A;  4I2F A;  1IBX B;  4KDI C;  2WLB A;  2BTE A;  8ICW A;  2M0X A;  4XUS A;  1S0M A;  3M3J A;  1L3V A;  1R4N I;  3I5J C;  2ZNV B;  4Y2R A;  2WS3 B;  4ZRJ A;  5BPC A;  3H6N A;  3A0H U;  4RUC A;  1HTO A;  3V7K A;  2J6T A;  3H7P A;  1PZN A;  3V6J A;  2QC8 A;  3V7J A;  3NZ3 A;  3GD4 A;  1JML A;  2DZI A;  1WYW B;  5ALZ A;  4A55 A;  3AE6 B;  1UWM A;  2GGE A;  1IPG A;  5TZV A;  3ZKJ C;  3QTP A;  2JWU A;  2AAQ A;  1JN3 A;  1MG8 A;  3QKE A;  1T8E A;  5AKK A;  4LNF A;  3TEW A;  3RR7 A;  3MJ5 A;  4KPR A;  3NS1 B;  5ALU A;  3DG6 A;  2B6G A;  2MCN B;  5AKE A;  4N9F 4;  4A3P A;  3HJE A;  8ICK A;  1JCK B;  5U1O A;  2ASD A;  4Z17 A;  2FPM A;  2WXL A;  1C9F A;  3UGB B;  1KDH A;  4FP1 A;  2BCU A;  5L9X A;  2MX2 A;  1R4M I;  3HW8 A;  1L3T A;  4ELV A;  4H1Z A;  1E7P B;  2MAX A;  5DB6 A;  3VH4 B;  2QDE A;  2QQ6 A;  7ICP A;  4QWC A;  4X5V A;  4IG7 B;  1E8X A;  3B0Y A;  1ZQM A;  2GMI C;  3GB1 A;  2NCN A;  4GIB A;  4W9G A;  1LFD A;  1ZQB A;  1L6U A;  1KKX A;  2KDB A;  2DL0 A;  3QCA A;  1T0Y A;  4ACF A;  4TV3 A;  1VRA B;  1ZYQ A;  1I4H A;  3DGH A;  3CP8 A;  4DWD A;  3M1Y A;  1X2I A;  2KJR A;  5T8I A;  3X0W A;  7ICS A;  1I42 A;  2OCE A;  4C4V B;  2BZF A;  4ELT A;  2ZZP B;  2BYE A;  2EMT A;  4ZYS A;  2MP2 B;  4EZL A;  4RNM A;  2FDR A;  4OJL A;  4KIK A;  4A6G A;  2RHF A;  4A90 A;  4ANU A;  1L8O A;  4YTN B;  3RR8 A;  2XH4 A;  1KFT A;  1FEC A;  3PWG A;  5KFN A;  4ELU A;  3KUZ A;  3MJW A;  3PVL A;  5AE3 A;  2KZZ A;  4DQS A;  2FLP A;  4MMW A;  1Z00 A;  3ZLH A;  1DYQ A;  2ZZB A;  4NEW A;  4RF1 A;  3PST A;  2XID A;  2Y9U A;  4EWJ A;  2ALZ A;  2BCS A;  4GME A;  2J42 A;  3FWA A;  3ES8 A;  1UA0 A;  1NK8 A;  1K51 A;  2GBM A;  4JUZ A;  3EAN A;  1MBT A;  3Q8M A;  2D3G A;  3SV3 A;  2G5I B;  2LRW A;  3ISB A;  3ZVV A;  2CJO A;  5KL8 B;  3Q8Q B;  4ED2 A;  2QPM A;  2WYQ A;  3OJ4 B;  2MBH A;  2QVH A;  3QIJ A;  1SL1 A;  4XE0 A;  1S8O A;  2ASQ A;  3BOX A;  1MC8 A;  3ZDT A;  1L0Y B;  3PSE B;  2IO1 B;  2F8K A;  5KAI U;  3HIZ A;  2WXH A;  3RJE A;  3ABV B;  3L17 A;  5KG0 A;  5CP2 A;  3DVN U;  3RBE A;  2X99 A;  3CGB A;  3Q3M C;  4IT1 A;  1J7C A;  2FLN A;  2KMC A;  1R7S A;  1D5M C;  3H7S A;  1RYS A;  2BKR B;  3CXO A;  3W2D A;  4P0P A;  3IJQ A;  3NHE B;  9ICT A;  5L83 A;  3QXG A;  4DQQ A;  1ZQL A;  2OG9 A;  1KH0 A;  4OZA A;  1ZQA A;  3OG5 A;  1T5X D;  3VTE A;  2W0H A;  2QJJ A;  3R0U A;  1JWS D;  4NEV A;  4P7I A;  4F4W A;  2NPT A;  5J2R A;  2C22 A;  3SYZ A;  1UWX A;  3N1X C;  3RCY A;  4F5N A;  4YR3 A;  2KX0 A;  3T4W A;  5HP4 A;  3BJY A;  5AKY A;  3M95 A;  3PPA A;  1FO4 A;  3UIN B;  3GRS A;  5AKH A;  2LM1 A;  4BGD A;  2JXT A;  4K4G A;  3ZVI A;  4PL1 A;  4YN4 A;  2AL3 A;  5J0T A;  1P3Q U;  4OZB A;  1TKG A;  4PJ0 U;  2M1M A;  4TUR A;  4F3O A;  1WFY A;  2LGI A;  2YLM A;  4H50 A;  3DWM A;  3OP2 A;  1DTN A;  3BK1 A;  2QAR A;  3PRE A;  7ICF A;  1BNO A;  1YJ1 A;  1GEU A;  4JQ9 A;  4G9B A;  7ICO A;  5CRX A;  3DBL B;  2MU2 A;  4KN7 A;  1S1Q B;  3NS8 A;  4XYC A;  2XH7 A;  1A0P A;  5KFY A;  2JU6 X;  4ZHP A;  3IVF A;  2WP9 B;  2QLT A;  3HVD A;  1GRE A;  3LK9 A;  1IGC A;  4CF4 A;  3DQV A;  4GGQ A;  3POP A;  2GLS A;  3DPD A;  3STP A;  4MGZ E;  2YN4 A;  1CJE A;  1P9D U;  4PYU A;  2UWQ A;  5D2M B;  1XHC A;  3GD6 A;  3CNH A;  1C4A A;  1Y8R C;  4O3R A;  2V3N A;  2V9H A;  2QCZ A;  3PX0 A;  2FAZ A;  4AS1 A;  4J3O D;  1L7N A;  3D47 A;  2DKZ A;  2LHD A;  1B1Z A;  4GIV A;  1ZET A;  3A7A A;  4HKZ E;  1X6J A;  1WJ4 A;  3MDA A;  3RZW C;  4KLM A;  1HTQ A;  1NEN B;  1VQZ A;  3AU2 A;  3VUW A;  5JHB A;  4QIW F;  3U9I A;  3MR5 A;  2G0A A;  3VTV A;  3OPS A;  3ZIM A;  3X23 A;  3QN3 A;  4KLD A;  4ENL A;  2BQU A;  4J9M A;  3A7R A;  3MR2 A;  1KRP A;  4DXG A;  1KLG D;  1NHP A;  3QYP A;  2FUG 1;  1EC8 A;  2Y1J A;  1H38 A;  4W9J A;  2N1W A;  3Q8P B;  9ICG A;  5KFO A;  3RBD A;  1TK5 A;  3TAQ A;  3UMC A;  5JTI A;  1TKD A;  4JLC A;  4RGN A;  1IIP A;  4IRC A;  3R2I A;  3SHQ A;  3AM9 A;  1RZT A;  3UJS A;  2I0K A;  3GE3 C;  3ZXV A;  1X40 A;  2WXF A;  3DED A;  2DW6 A;  2FIF A;  2L5Y A;  2DZJ A;  2QEJ C;  5JCN A;  2AH5 A;  1X42 A;  4RQM A;  2GBN A;  3ML8 A;  1XCT L;  1E0Y A;  2R8H A;  4YSX B;  4LVS A;  2J6S A;  4FHK A;  4LCD E;  1SE4 A;  4R63 A;  3PHX B;  3QJZ A;  1D5X C;  2LYH A;  3ICX A;  3DGB A;  4MEY A;  2ZUC A;  9ICR A;  8ICS A;  4Y2P A;  4YXM A;  4KZC A;  1P7E A;  5EWE A;  3R25 A;  3C1Y A;  3LXF A;  3L16 A;  3VH3 B;  3WCQ A;  1FHU A;  1PVR A;  2KFZ A;  2CHZ A;  2KO3 A;  4GDK B;  3M9N B;  4A35 A;  2NO4 A;  3EW9 A;  1TY2 A;  1NKB A;  4ECV A;  9ICP A;  3R7R A;  3GQC A;  4I2B A;  3R7Q A;  1GES A;  1PK3 A;  2IOF K;  5KFS A;  5DG7 A;  4R3D A;  2KVZ A;  2Y3S A;  2K39 A;  1V5O A;  3N4M B;  3ED5 A;  7ICR A;  1CI4 A;  2DQN B;  2HMX A;  3KZI U;  1WX8 A;  2KP7 A;  1Q1R A;  2Q4T A;  3ZW3 A;  4ED1 A;  1QIL A;  3QAQ A;  4K3C A;  4DHZ B;  5AM0 A;  2D3A A;  1C78 A;  3VQI A;  3BJS A;  4HCH A;  3RRA A;  4YR0 A;  4XRH A;  1T3Q A;  4UB1 A;  5KT2 A;  1TKY A;  1GRG A;  2K8C B;  9ICS A;  2KMD A;  3SN0 A;  5AI6 A;  3C1Z A;  1KTK A;  3KUC B;  2UU7 A;  2XGQ A;  2PIA A;  7ICL A;  2NMQ A;  4R8U B;  1NJW A;  2KD1 A;  5KG3 A;  5C3J B;  2GGG A;  8ICG A;  1BPE A;  3B9J A;  4J9L A;  4HVB A;  3N4F A;  2GBR A;  1QOB A;  2RDJ A;  2J4X A;  3RJJ A;  3RD2 A;  3U4E G;  2BC1 A;  2XH2 A;  3MC9 A;  5EBK A;  4HCL A;  5DB9 A;  1MUC A;  2YX8 A;  4M9N A;  2FPL A;  2XI9 A;  5GMV A;  3ZVH A;  1M6Y A;  2KDM A;  4RZR A;  2KE7 A;  5ALE A;  4RQ3 A;  4B9V A;  1T0S C;  2G4S A;  3O0H A;  1AWD A;  2BPS A;  2BKE A;  2REX A;  5HI1 A;  2FCM A;  1J0G A;  3RB4 A;  4F8R A;  4M00 A;  3T6C A;  5III A;  4JB1 A;  3H8H A;  4G7F A;  2KJ9 A;  2EQ7 A;  4NXZ A;  2W9C B;  3RIT A;  3H8S A;  1U48 A;  3H7P B;  1BZL A;  2EZZ A;  1GUA B;  4EEK A;  2EZY A;  3S6J A;  3NVY A;  2ONQ A;  2OXO A;  3W1S A;  2KN7 A;  1ZXI A;  4HAI A;  2KXJ A;  3ZDM C;  4UAV A;  2JXJ A;  5J2B A;  2CKH B;  5JXV A;  4OO1 J;  2ZAD A;  1XPY A;  1U4A A;  5C2T B;  2JEI A;  4DF4 A;  1RYJ A;  3EA6 A;  5D79 A;  1KKR A;  2HJ1 A;  1ET9 A;  3Q8S B;  4O3P A;  4ED8 A;  4ZH4 A;  5AM2 A;  3Q8L A;  2KTR A;  2MWS B;  4RGT A;  1G6J A;  4BCA A;  1SJC A;  2ZNV C;  1X2G A;  3HW2 A;  1FD6 A;  1E8W A;  1GC6 A;  3HWT A;  3RZF A;  1Q1O A;  4RNN A;  2SEB D;  3ENE A;  4U7C A;  1FFV C;  3MDC A;  4C8M A;  4PPX A;  2HNE A;  4LJX A;  1FIQ A;  5GTI U;  4FJV B;  1UNS A;  3EEZ A;  1Z4N A;  4ZRQ A;  2MQJ A;  1T0R C;  3EPI A;  2AGQ A;  2BVF A;  3SQI A;  3QUC A;  2C28 A;  4ZRP A;  4E0D A;  2PMZ C;  1TVA A;  3UXN A;  4JK1 A;  2BB5 A;  2WHI A;  3BQ1 A;  4B9U A;  1WMH A;  2JY6 A;  2JEJ A;  2KJ8 A;  3C2L A;  3RUI B;  2K8H A;  3RFA A;  3DHG C;  2MSN A;  2NRT A;  3IAM 1;  2BDU A;  1NJX A;  2I2Y A;  2VAN A;  1EXN A;  2FBW B;  3P63 A;  1YZ7 A;  1RYU A;  1X1M A;  2MBQ A;  5L6F A;  2WF6 A;  1MQ2 A;  5FS6 A;  5IIL A;  8ICZ A;  2J53 A;  2V0G A;  4DXK A;  4WWM A;  3AL0 B;  3A7U A;  5F9N A;  4P0Q A;  4H4Q A;  3OJ3 A;  4YWO A;  4OJP A;  4IQV A;  2F2A B;  5BYR A;  4JN7 A;  2W82 A;  1XDI A;  2DZK A;  2GQU A;  2F76 X;  4RT2 A;  4K2S A;  1T3Q C;  1T0Q C;  7ICQ A;  1N60 A;  4W9H A;  1M94 A;  2AU0 A;  4XX5 A;  4BX9 C;  4RNO A;  3WAP A;  4LNO A;  4KLO A;  5FXE A;  5HHZ A;  2OAI A;  2PE6 B;  2XBB C;  5J0S A;  1ZD3 A;  1MOK A;  2H3F A;  1SJB A;  2C2R A;  4F91 B;  2IJ0 A;  1V59 A;  2AQ3 B;  2L3Z A;  4Z6F A;  3DCG A;  2QKN A;  2YVF A;  5HR7 A;  2DHZ A;  2GB1 A;  1IBX A;  3R1Z A;  3B1L X;  5J2F A;  3ETR A;  5ALP A;  3R8B A;  5IIJ A;  1R4N B;  4UB4 A;  1NKC A;  3BVZ A;  4IDI A;  4PT5 A;  2FYM A;  5JCK A;  3B97 A;  2LMR A;  2C3D A;  4JL9 A;  3V3X A;  3PZP A;  2FE8 A;  4Q43 A;  1BPZ A;  4IM2 A;  5AM1 A;  3N6H A;  3NTU A;  7ICI A;  2ZXH A;  1WX9 A;  2WQY B;  4M0X A;  1VZ6 A;  2QIL A;  4OW0 A;  4DWF A;  3NZU A;  4IS7 A;  1QOA A;  3W1S C;  2ZPY A;  1QLT A;  1ZXI C;  2A3V A;  3APC A;  5KFP A;  3Q8C A;  2NRV A;  3V7L A;  3MGH A;  3U8Z A;  1L7P A;  2ATL A;  4WAA A;  4EEW A;  5JH5 C;  5I1V A;  2ZIW A;  7ICV A;  4ZRI A;  3NS1 A;  4YMM A;  3R10 A;  3RI7 C;  3K1R B;  4UBB A;  2FPK A;  4O9M A;  3CYJ A;  2K60 A;  1KJT A;  4EYH B;  3IC9 A;  2HHT A;  1F3P A;  3WAN A;  1S0V A;  1ZKH A;  2NPT B;  3MAB A;  1NI3 A;  1V38 A;  4RM9 A;  3ZTC A;  3U7Z A;  1XS2 A;  3A4S C;  2VFU A;  1ZOL A;  3TQ1 A;  2NBW B;  4B9S A;  2JXX A;  4ECX A;  4EE2 A;  3KHR A;  5DBB A;  3Q8E A;  4HXD A;  1ZQP A;  4APN A;  4C8O A;  3VC5 A;  3ZNZ B;  1F0X A;  3BS7 A;  2YVC A;  5KFC A;  4Y2T A;  1YN4 A;  4F2S A;  1XEE A;  4LZD A;  1CRX A;  3RNM A;  5ALD A;  3KHL A;  1MRA A;  2BS2 B;  4FDC B;  2PMQ A;  3OLM D;  2RP5 A;  2W55 A;  5J2K A;  2EKE C;  4QNL A;  2TPR A;  2WOI A;  2L0T A;  2ZTE A;  3DBL I;  3SFD B;  4C4V A;  3L3F X;  5AZH A;  2XH0 A;  2MP2 A;  4GXK A;  5DB8 A;  4YWS A;  2O6V D;  3V6K A;  2PGE A;  1A6S A;  4JWS C;  2PLI A;  4P2H A;  4PK1 A;  4QWB A;  5AI4 A;  5KFE A;  5KG6 A;  3PRZ A;  4AOF A;  4HDO A;  3RYT A;  4I2C A;  3N6J A;  3EUB 2;  2OFJ A;  1LQB A;  1ZMC A;  2EMS A;  3GIK A;  1F0M A;  5KFZ A;  1WE6 A;  3WA0 A;  4PZF A;  4MKS A;  2FLL A;  2KMA A;  3ZI4 A;  5H8Y E;  3AE4 B;  5J0R A;  4YTM B;  5AK5 A;  5KFL A;  4ECZ A;  4NPN A;  3FM9 A;  3C0R B;  3DVN V;  3E56 A;  4E5T A;  2IO0 B;  2RAB A;  1WZ0 A;  3LXD A;  5E6O A;  3RRG A;  4CDG A;  3D9X A;  3PNC A;  2CJN A;  5AUI A;  2ZUB A;  3F2D A;  3V61 A;  2A8X A;  4QZH A;  4C8L A;  4A3O A;  4LNK A;  2HHX A;  3QEB Z;  3BQ7 A;  3OAW A;  2G09 A;  3P2B A;  1ZY8 A;  1CUK A;  3KVF B;  1JW9 D;  1XWL A;  4RQ1 A;  4JWU C;  1WWV A;  2RLT A;  3F5A A;  4H4P A;  1BNP A;  2W54 A;  2RMM A;  1WJU A;  3BIN A;  1ARO P;  2GDQ A;  1SWW A;  2K8B A;  2R2Q A;  4MF8 A;  2LGS A;  5DLG A;  5IIO A;  2HBL A;  4KGS A;  5J2C A;  3A0B U;  5J2J A;  5AZG A;  1FCL A;  3CF6 E;  2K3U A;  5HQX A;  1BWC A;  2KK0 A;  4KN4 A;  4TSS A;  3A1Q A;  4CE6 A;  3RO6 A;  4RUA A;  2L0F A;  2GQT A;  3V4B A;  1GNU A;  4E4U A;  2R61 A;  3TEX A;  4K1R B;  3WKD A;  4RQ0 A;  1O03 A;  3SD7 A;  3VVW B;  3DDM A;  3IHQ B;  2ZG6 A;  5J0Y A;  2C3C A;  3U4F A;  2PA6 A;  5GRT A;  3PZD A;  4W9I A;  4CYE A;  1GPX A;  1GET A;  4TUS A;  3LAD A;  2B0C A;  3JPT A;  1JWM D;  5J8Y C;  2BVH A;  1MFW A;  1EC7 A;  2E3T A;  3JPR A;  2QJL A;  3P4S B;  3BYY B;  1EF5 A;  3MC8 A;  4GGB A;  1Q5W B;  3UXK A;  5LXH A;  2ZCB A;  4KIT B;  2WXP A;  3OSN A;  3SZ2 A;  5J0U A;  4LJP B;  1V80 A;  1SL0 A;  3HUI A;  3DOW A;  4IW0 A;  5BOE A;  2KZR A;  2ACZ B;  2R8K A;  1S0N A;  1L0X B;  2CHW A;  4GFJ A;  1STE A;  1J8C A;  3GDX A;  4M9J A;  4Z6D A;  5J0O A;  2J0J A;  4TQS A;  3AE3 B;  1MBB A;  1SKR A;  1Q3V A;  3P4R B;  2CDU A;  4H2A A;  5HG2 A;  2WAQ F;  2MA9 B;  3T5H A;  4J9Q A;  2Y0S C;  3DK4 A;  3H4K A;  1VJ5 A;  4P4O A;  4DLE A;  9ICQ A;  1ZQZ A;  4PGX A;  3LVW A;  3OJS A;  2KTQ A;  2DF4 B;  1CEZ A;  1LV5 A;  1V1O A;  4DNA A;  1F5S A;  4F72 A;  2XGZ A;  1ZUD 2;  2QHO A;  4KLF A;  3D32 A;  1GRF A;  3MC0 B;  1QQ6 A;  1RQN A;  1ZQY A;  2EDU A;  1K50 A;  4A8E A;  4GYP C;  5D7G A;  2DWQ A;  3PM9 A;  4EYI B;  1ZJM A;  1L4D B;  2HHW A;  2YY6 A;  1ZQE A;  4KT2 A;  2EAO A;  1LXD A;  1IYF A;  2KIW A;  4PZO A;  2BYV E;  1TS5 A;  3HVZ A;  4YWG G;  4BKS A;  1TAQ A;  3KJM A;  1NK5 A;  3B9J B;  1UQV A;  1ONF A;  2D10 A;  3AEC B;  4C00 A;  2KC2 A;  2D3B A;  1BUI C;  1UBI A;  1M6I A;  4ACO A;  5CHF A;  1SEB D;  5ALW A;  4KX5 A;  1LGR A;  5AE1 A;  4J9R A;  5CB1 A;  4FS2 A;  3ZVH B;  4M52 A;  2LVO A;  2ZPN A;  2WXM A;  2HHU A;  1C77 A;  2DPI A;  2WF8 A;  1V6E A;  2YML A;  2W8L A;  3UPQ A;  4FS1 A;  2K5P A;  4BAX A;  3M9M B;  2WHE A;  2X50 A;  3HSU A;  1ZDL A;  2WXK A;  2M17 A;  2AJQ A;  7ICH A;  2E5S A;  2KV2 A;  4DQR A;  1NK9 A;  3PQB A;  2WXN A;  4PGQ A;  4QZD A;  5AM5 A;  3PO5 A;  3WK7 A;  1PVP A;  2JPH A;  2KHQ A;  7ICU A;  2R9Z A;  3LAE A;  2L52 A;  4DQO C;  2HCF A;  1NHR A;  2V4L A;  3PLU A;  3EPG A;  4B6J A;  4M9G A;  3Q8F A;  5B5E U;  3SJN A;  1C7Y A;  5DDY A;  4DL2 A;  1WX7 A;  5AE2 A;  5A0L A;  4FI4 A;  1XO1 A;  5DBA A;  3F5E A;  2L76 A;  1BKH A;  2Y4G A;  4MFF A;  1XLP A;  1NZP A;  3UQ0 A;  2WOW A;  1D6E C;  3M9O B;  2KEY A;  2LPE A;  1UA1 A;  1BPX A;  2RSU A;  2A1J B;  2NVK X;  3GV5 B;  3RNF C;  2I5Q A;  1T3N A;  3OC4 A;  3UMG A;  2WFA A;  3GV8 B;  1WWU A;  4RH6 A;  1SWV A;  3ZDA A;  1ZOY B;  3MHZ A;  1JWA D;  4FO6 A;  5BYQ A;  1DGJ A;  3H8W A;  2KDF B;  3TEY A;  1ELS A;  1UUP A;  1WR1 A;  4YXD B;  1TKE A;  2DLB A;  2UVU A;  4K4H A;  3A9K B;  2KQ7 A;  3O65 B;  4YFK A;  8ICV A;  2F3N A;  4C8K A;  2NBV B;  4ICU A;  4WJN A;  3PX6 A;  2MEK A;  3MSY A;  4GDK A;  1ZRN A;  3DK8 A;  3TJP A;  2QJM A;  2UUV A;  4JPS A;  1FXT B;  3DBH I;  1QLU A;  8ICT A;  3GOE A;  4O3S A;  5KT6 A;  1PUZ A;  4NL9 C;  2JVC A;  4JGH B;  4GXB A;  4HYR A;  3S5S A;  1X9M A;  1SSN A;  1E5W A;  5ALM A;  3AXC A;  1UEL A;  2HI0 A;  3L5K A;  4DLG A;  3GZF A;  1Q46 A;  4P0Q B;  4DHJ D;  2YVJ A;  4RQ4 A;  2ONE A;  4LA1 A;  5I1W A;  3PRP B;  5ALS A;  5KFF A;  4YMN A;  2XY5 A;  4QZA A;  5HMR A;  2K8C A;  4IR9 A;  3H8M A;  2AGP A;  2WGS A;  3GV7 B;  2M19 A;  2NTT A;  5KNI A;  2JRZ A;  4R8U A;  3BY4 B;  3VCN A;  1DXS A;  4M0W A;  8ICU A;  1IG6 A;  1V85 A;  2G08 A;  3OHA A;  4DL5 A;  4FBT A;  1NNL A;  5KG7 A;  1V2Y A;  1WIA A;  2BQQ A;  2JF5 A;  2RDB C;  4NLZ A;  2BS3 B;  3QA8 A;  5J2D A;  2BPF A;  3U26 A;  4K4I A;  3E0F A;  2Z59 B;  5E6P A;  4M9H A;  2PU1 A;  3RJF A;  2X8H A;  4EC3 A;  4IL6 U;  1GRH A;  4AJY B;  3ETR B;  5ALG A;  3AQE A;  5ALO A;  2R2O A;  4F1S A;  5BO4 B;  4C8N A;  4LNI A;  4EM4 A;  2BCQ A;  4RPZ A;  4I2H A;  2JGA A;  2R18 A;  5IIK A;  4PS8 A;  3H0M B;  2W9C A;  1LB2 B;  2PTY A;  4DL3 A;  5KFR A;  2W9A A;  5EOZ A;  1NVI D;  3ISC A;  8ICJ A;  4DSE A;  3B0X A;  1UD7 A;  1NYR A;  3EJE B;  4EM3 A;  1WSP A;  3AU4 A;  4BZA A;  2Z8L A;  3FW8 A;  3MBY A;  2VA2 A;  3RNE C;  3CB3 A;  4PHD A;  4QZB A;  4E4F A;  4WQM A;  3TWB A;  2AL1 A;  2ZIW B;  5AK3 A;  1AQ6 A;  1CQV A;  5BMI A;  4DQI A;  3UQ2 A;  4ECR A;  1SV4 A;  2N0S B;  4KTQ A;  1MHH E;  2N7J A;  1KW4 A;  4F5R A;  4GXI A;  5L95 C;  3OJU A;  2K6D B;  1ESF A;  2N9X A;  4FUL A;  3NFU A;  3PGE A;  2K89 A;  2VIX A;  4U6P A;  3PLV A;  1TFR A;  4LZG A;  2POD A;  2MRL A;  3C2M A;  2CU1 A;  3J9C A;  3I99 A;  2MJ3 A;  4PZN A;  4RNA A;  2AL2 B;  1HE8 A;  3LVV A;  2DYM A;  1AHU A;  1V5T A;  1GXF A;  3AB5 A;  2JYE A;  4B95 A;  4C80 A;  1WH3 A;  3L54 A;  1P98 A;  4ZDV A;  4RU9 A;  4QWA A;  4GMV A;  3GC2 A;  4ECY A;  3L0W B;  4DBG A;  4IUM B;  5G55 A;  3AEB B;  3PW4 A;  3UF8 A;  3RR1 A;  4TUQ A;  1D9F A;  3CK5 A;  1W1Q A;  9ICN A;  5FP0 A;  3ML9 A;  1YN3 A;  3ONN A;  2DNF A;  4IHC A;  3VFK A;  3SU8 X;  4DYE A;  1TE2 A;  4FZM A;  4PWB A;  3OZM A;  4DS5 A;  3N4E A;  1NKE A;  4QAY A;  5ALI A;  3GE8 C;  3T3O A;  1NEL A;  2XY7 A;  2UVR A;  1U45 A;  4GRT A;  3L13 A;  3GP7 A;  2PMV A;  4H19 A;  4BDP A;  4I2A A;  4DDG D;  2JYT A;  4G50 A;  1SJE D;  2INN E;  4J9N A;  2P3Z A;  5EE3 A;  2C60 A;  1Q1W A;  4QIW C;  5EE9 A;  4PGY A;  1SZP A;  3BZK A;  2I38 A;  3AU5 A;  4IM3 A;  4W9K A;  1PGA A;  4NJ8 A;  1L5U A;  2CU3 A;  2GBJ A;  2N9P C;  3K9O B;  2WX1 A;  1JWU D;  2IO3 B;  2GR1 A;  2GOW A;  3QUQ A;  2WU5 B;  1D3Z A;  3ZD8 A;  3TL5 A;  2I1K A;  3BQT A;  5KAF U;  3I9V 1;  2CFY A;  4P4P A;  4UAY A;  1WF9 A;  2PKE A;  4DFJ A;  4MEL A;  4IL0 A;  4JMU A;  3R3M A;  2HJ8 A;  5IOI A;  4MHV A;  1E9M A;  2IMW P;  3P4P B;  4BKG A;  3ZGZ A;  2AXR A;  3RRH A;  1TJE A;  3B2F A;  2KWC A;  4HPN A;  2PPG A;  3AE7 B;  1C79 A;  2JQR B;  1QSS A;  2GH1 A;  2JMG A;  4IZG A;  1N5W C;  2KQ4 X;  1MA7 A;  3UMB A;  1X9S A;  2ASL A;  2FCS A;  1JQ4 A;  4ARC A;  1NHQ A;  3BQ0 A;  3HKZ C;  3H4D A;  3DQ0 A;  2NVU I;  2ZIV B;  4GSW A;  4ZCW A;  2P88 A;  3A1Q B;  2OZT A;  1TZO A;  1ZD4 A;  2GGH A;  4HJK A;  2OQY A;  2AWT A;  2OZ8 A;  4NQK E;  3SFE B;  1SGG A;  2V1Y A;  2Q85 A;  3ECI A;  3V62 A;  3Q3N C;  5AI5 A;  3QU4 A;  2NQW A;  3AE5 B;  3EFU A;  2ASJ A;  2DUY A;  4JV1 A;  1SJH D;  2PU0 A;  2JHD A;  3URY A;  5FJT A;  4OVU A;  1I35 A;  2MLB A;  4DSK A;  2CS4 A;  4KLL A;  3VR8 B;  4EZ9 A;  1C4C A;  2M0N A;  1S9F A;  4RMA A;  4HJG E;  5CR0 A;  5DB7 A;  2AYO B;  3MZN A;  1QQ7 A;  3AED B;  2RR9 A;  4CNQ A;  2KC1 A;  4NLK A;  4FN2 A;  1FNU A;  3AE8 B;  4K7W A;  5B66 U;  4DCC A;  5AKZ A;  2E8N A;  3E2E A;  4EZJ A;  1YX6 B;  3ZXR A;  1WGD A;  2GWS A;  2Y3A A;  4EFO A;  1E8H A;  2HBK A;  2FUH B;  4MSM B;  4PS3 A;  1OW5 A;  2D8C A;  2NS5 A;  5H92 C;  1E0Z A;  2PCE A;  3V3W A;  1N63 C;  1WYG A;  3PZ7 A;  1ZQR A;  4W9L A;  4AP9 A;  1SZH A;  3AUL A;  4CQN A;  3T8M A;  2L1A A;  1A76 A;  4YQW A;  3PO0 A;  2MHJ A;  1I4G A;  2NTS A;  3JW0 X;  5AKI A;  3H40 A;  3NG0 A;  3TWA A;  4G0N B;  4FBJ B;  1J19 A;  2DW7 A;  4FE3 A;  1NYQ A;  2KOX A;  5JU5 A;  2V3P A;  1FMA D;  4UB3 A;  5D3D A;  5IO9 A;  4BOZ B;  1JXE A;  4DOC A;  2PP0 A;  3CXB A;  4YG2 A;  4TMA B;  2LYB A;  2HSZ A;  1UBQ A;  2POZ A;  2W7O A;  3BVG A;  3DG3 A;  5G5G A;  1W1S A;  3NVW B;  3BVM A;  5AM3 A;  5EWF A;  1JCT A;  3IJL A;  2GSH A;  2Y08 A;  2DFL A;  4ED0 A;  3KTQ A;  5L1L A;  2ZZ0 A;  2WPE A;  1ZQD A;  4HWI B;  2JR5 A;  4KZ0 A;  4J57 A;  4DFK A;  2D07 B;  3AUO A;  2ZVN A;  1VDV A;  1IUE A;  4KV2 A;  1ZQT A;  2AQ4 A;  5CJ7 A;  2AGO A;  3RJG A;  1MHX A;  2KQS A;  2G06 A;  3AEE B;  9ICI A;  4LNN A;  4H4Y A;  1QKZ A;  5FR3 A;  3EWA A;  2W9B B;  3WK9 A;  4RFB A;  3O13 A;  2H3V A;  3TFS A;  1P7D A;  1AOG A;  4FJY A;  5BOL A;  3QZ7 A;  4UB8 U;  5HMM A;  1WE7 A;  2FID A;  4KLS A;  1XT9 B;  2PP3 A;  4GIS A;  2ISP A;  4OJO A;  3K75 D;  4O0I A;  2HBJ A;  2IBI B;  3T9L A;  2C7M B;  2QJN A;  2PPH A;  5DPW A;  1E8F A;  1TK0 A;  1Z2M A;  2LI5 A;  2IPK D;  4K7S A;  1XSP A;  2INC C;  1F1H A;  2VA3 A;  1PFD A;  4BVU C;  3DES A;  2QMT A;  3UXL A;  2BHN A;  4Y2J A;  1K4Q A;  2YVG A;  2HBM A;  1X66 A;  2EQ9 A;  3PS6 A;  1FFV A;  2KHW B;  4A6Q A;  3RH4 A;  2WDT B;  4QZ9 A;  2HXU A;  1QQR A;  5HHI A;  3ZLG A;  2JZB A;  4F5P A;  4MLA A;  3HKZ F;  2IOH A;  2MBB B;  3TEZ A;  4QZC A;  4JWN A;  1VJK A;  1MDL A;  4MH0 E;  2BKF A;  3IHP C;  2ZC8 A;  4HYK A;  2IND C;  4MH8 A;  2JZP A;  3RN9 C;  1N62 A;  1TZZ A;  2PFN A;  3OTQ A;  3TAD C;  8ICY A;  1YD8 U;  2WDQ B;  3TMP B;  2MUT B;  1JRU A;  3CT2 A;  4L1B A;  3JW7 A;  2W04 A;  2JRI B;  2HTM E;  3UCC A;  4L23 A;  5TR3 A;  2ZJD A;  2RDG A;  4BBN F;  2QB0 B;  2TSS A;  5G2N A;  3MTN B;  3PVX A;  4B0M A;  2WXI A;  1SJD A;  1WVE A;  1ZD2 P;  3JYU A;  5J17 A;  1ZD5 A;  3TI0 A;  1TIF A;  1GO3 F;  2BYF A;  1N6Z A;  1K1S A;  2DX5 B;  4LDT B;  2VFT A;  5FJU A;  4Q8F A;  2NBU A;  4H4S A;  4DHJ B;  4MFA A;  4BWM A;  4G11 A;  1P0R A;  1DNC A;  2WBA A;  3FV9 A;  3C21 A;  1Q8K A;  4ROP A;  3UQA A;  5AK6 A;  4MF2 A;  4A9A A;  1OGW A;  4MGK E;  2G4D B;  4BFR A;  2AQ0 A;  4YMO A;  1AN8 A;  2UYZ B;  2PP1 A;  1ED1 A;  2G45 B;  4M0W B;  2L83 A;  2FI1 A;  1L0V B;  3HK0 A;  1JWB D;  2H5X A;  4XWW A;  3TCS A;  2IDY A;  1SE3 A;  2ZJA A;  3M62 B;  1FHV A;  3WAO A;  4BV6 A;  5KFM A;  2KX3 A;  1NBF C;  2PTX A;  2CXY A;  2LRU A;  2J0M A;  2JH1 A;  4EMW A;  3FDS A;  5BYS A;  2NPX A;  3D46 A;  1QT9 A;  3UXP A;  3CW2 C;  5D94 A;  4XDC A;  4B9K A;  2A5U A;  1ZQN A;  1I4P A;  2BPC A;  5KFV A;  1EO6 A;  3APF A;  3SN1 A;  1BPY A;  1W6T A;  1KD0 A;  2N7E A;  1WGR A;  2FKP A;  1KL9 A;  4EEN A;  1WI0 A;  2I1Q A;  3TFR A;  2K0P A;  4KGT A;  4EQX A;  1F2R C;  2K6Q A;  9ICC A;  4M04 A;  3IDW A;  5JRB A;  3EYZ A;  2KKV A;  4M47 A;  3W8W A;  3BK2 A;  3NRW A;  2H89 B;  3ZDC A;  3CSF A;  4EOY A;  2N4F A;  4ZA0 A;  2A1J A;  2MA1 A;  1OXJ A;  2F1H A;  4J9P A;  4J9S A;  1EF1 A;  1PQS A;  1HQR D;  4W9F A;  2MH7 A;  5K8E A;  5ADZ A;  4DXF A;  4E3C A;  1COK A;  4QJF B;  5IIM A;  1FRR A;  2CHX A;  2JSV X;  3RFZ B;  3NVZ B;  1GRA A;  2GR2 A;  3FCP A;  1BT0 A;  2AHO B;  3H4B A;  3NZG A;  2KAC A;  3MGV A;  2F44 A;  3BYT B;  4XWT A;  1RM6 C;  2WB1 C;  2WP6 A;  2A4Z A;  2XO7 A;  4O5K A;  3A9K A;  2PVO D;  1L7Y A;  2FMQ A;  3EAO A;  2H88 B;  4Q8E A;  2OQH A;  2LHE A;  2KSO B;  1ZGU B;  3RJK A;  3EF6 A;  3AI5 A;  4LII A;  2QDD A;  1N62 C;  3PR5 B;  2F5Z A;  3M6Z A;  2E1E A;  5J2I A;  1T4G A;  4D2K A;  3RJH A;  3DBH B;  3IXS A;  1E8Y A;  3EC8 A;  2PGW A;  2DBY A;  2P35 A;  2GO7 A;  3D2S A;  1PK1 A;  4LTU A;  4WJP A;  1TKK A;  3Q3F A;  5KVI A;  1AYF A;  1JRO A;  5AI0 A;  2GR0 A;  4UB6 U;  4H4U A;  2KOB A;  1RDF A;  1UT8 A;  2BYT A;  1WGY A;  5KFW A;  2PXI A;  4MT5 A;  4CGZ A;  2P6U A;  4BJQ A;  2HHQ A;  4ZRK A;  2OKT A;  4YCX A;  2D6F C;  1ENF A;  3KLS X;  4QZF A;  1SKW A;  3WKB A;  5D3I B;  1E90 A;  1V81 A;  1ZQQ A;  5KFJ A;  3UGV A;  1ZXH A;  3Q69 A;  4FZN A;  3PV8 A;  4GXJ A;  4S17 A;  4UAR A;  3W5U B;  4Q2J A;  3BII D;  2G07 A;  2N9K A;  4Y2Y A;  4OVZ A;  1EU4 A;  1RFA A;  2MBO A;  5DDM A;  1EBG A;  4KLI A;  1YOV B;  2Q4W A;  4XZ4 A;  5JHA A;  4H83 A;  2V3S A;  2KJ6 A;  5DBC A;  2GGI A;  5AKG A;  3C5G A;  5J2G A;  3TKA A;  2R8G A;  4GN1 A;  4E71 A;  3GY1 A;  8ICQ A;  4URK A;  1H2I A;  3NO1 A;  2C2D A;  1OFF A;  2PLS A;  2R2Z A;  2IZV B;  1MDR A;  2AKM A;  3PO4 A;  4XDD A;  3DFY A;  3SDL C;  4HPP A;  5GXG B;  2ZJ5 A;  4ZHO A;  4MEX A;  2BCP A;  2PFO A;  3I28 A;  4EKU A;  4ASW C;  5JCL A;  5KFU A;  1L7M A;  2E5A A;  2MNR A;  3F53 A;  3OHB A;  1TS3 A;  4DNS A;  1H8C A;  2XEW A;  5DG9 A;  4WUR A;  1V97 A;  3TW9 A;  2NR2 A;  3PG6 A;  2XCA A;  1DOX A;  4HNC A;  2LVP A;  2K25 A;  3UJ2 A;  2V6O A;  4JV0 A;  1MI0 A;  1WJN A;  4GR1 A;  4H4V A;  4DHG A;  4RQ6 A;  3AE2 B;  9ICV A;  5J8Y A;  1KBU A;  2WNM A;  2DKX A;  3QU9 A;  3QFA A;  2AL2 A;  1TS2 A;  2GL5 A;  3THU A;  1N48 A;  2GOL A;  2LI6 A;  1WXS A;  2WAQ C;  2K8A A;  1SE9 A;  1W1L A;  1HXY D;  2IGD A;  3IP4 B;  4KLH A;  4EX6 A;  1ZQO A;  1STZ A;  3DH9 A;  2HDO A;  4NJC A;  2VFS A;  1NK7 A;  4USA A;  3PV1 A;  3BSM A;  4P4M A;  4IC7 B;  3W5V B;  2GGJ A;  4II2 B;  2WWZ A;  3RTV A;  2PSN A;  4KLG A;  3T5L A;  4XGA B;  4QZG A;  2QSD A;  4RGM A;  1B0X A;  3AQF A;  4NWI A;  1YT3 A;  2GLE A;  2WF7 A;  2RPQ A;  3KWV A;  2WB1 F;  3LYY A;  1RYR A;  2BC0 A;  5ALN A;  4Y2S A;  2O6V A;  3PX4 A;  1KFS A;  3P42 A;  2EQY A;  5CTR C;  2H3Z A;  1J7A A;  4OJ5 A;  1EWC A;  2KJH B;  4DHZ E;  1N2X A;  2BGF A;  2PTL A;  1OJT A;  3I4K A;  3AMZ A;  1T6B X;  2XK5 B;  1RFK A;  2DZM A;  3EGR A;  3L5O A;  5L1K A;  3B2G A;  3CMM B;  2HOQ A;  1FPY A;  2L7R A;  3PT2 B;  3FVD A;  3HX0 A;  4DL6 A;  2HZG A;  3MQT A;  4EEY A;  2ZUD A;  2W7P A;  4NNJ B;  4GYP A;  4EQS A;  4EQR A;  5KFT A;  1ZR6 A;  4Y2X A;  4HRS A;  4MFC A;  3KOO A;  1L7O A;  1UCV A;  4DOB A;  2M4N A;  2KKP A;  4IWQ A;  4FX9 A;  5G5G B;  4FAD A;  3D2Q A;  1WXA A;  4ANW A;  1GAQ B;  4L2Y A;  4XA5 A;  4CF3 A;  4XC2 A;  1ECQ A;  3SEI A;  1FEB A;  1GG3 A;  1MQ3 A;  4IQU A;  1RVK A;  5FMH A;  3DGZ A;  5KTQ A;  1ZQS A;  4FZL A;  4ECQ A;  1ZE3 D;  2K22 A;  3SI8 A;  4KX3 A;  3FXG A;  2YEP F;  3ZDE A;  1EBH A;  3PWI A;  3N32 A;  1GB4 A;  3EZ5 A;  1HUO A;  3W8Z A;  2F1J A;  3D2N A;  3GS2 A;  1J2M A;  3C19 A;  1X2H A;  2BW2 A;  5KT3 A;  4DOA A;  4OAL A;  4RPX A;  1XQQ A;  4FLH A;  1R0M A;  4KLT A;  2LHT A;  1SIF A;  2W8K A;  2RD0 A;  2OLA A;  3G6V A;  3O0F A;  3GII A;  2LD9 A;  3JSV B;  1PGB A;  2P8B A;  4AQ7 A;  3SQS A;  3I6T A;  1QQ5 A;  3C8Y A;  4PVH A;  2ZIV A;  5TSS A;  3TIX A;  4C56 C;  4RM8 A;  4UDU C;  5FXF A;  4KMO B;  3DJG X;  4X57 B;  3UIP B;  2EZX A;  3SN4 A;  1GRB A;  2OOB B;  5FS7 A;  2PKO A;  4HLE A;  4UAU A;  3D2D A;  3GD3 A;  1FNV A;  3CGC A;  1J97 A;  3GIM A;  1KRH A;  4TUU A;  2PTW A;  3I63 C;  1R6W A;  3VFC A;  4B9N A;  3RB3 A;  4TVY A;  1KEJ A;  1V8C A;  1NU5 A;  8ICN A;  2JZB B;  3MY9 A;  2XIC A;  1WM2 A;  3OGU A;  2N1V A;  4OHJ A;  4DXA B;  4NJ6 A;  2YAU A;  4EBC A;  8ICC A;  1RM6 B;  1RLF A;  3ZDB A;  1S77 D;  1P43 A;  4QW8 A;  1Z5S B;  1TAM A;  3V6H A;  1HZ6 A;  3VTU A;  5KFK A;  2BQR A;  5FS9 A;  3C28 A;  2P6R A;  4YP3 A;  2OEH A;  4IRD A;  1MJD A;  2KLG A;  4BBY A;  1E10 A;  3ETL A;  4F4X A;  5CHV C;  3I6E A;  2I9G A;  3NRZ B;  4NL9 A;  1DGS A;  7ICG A;  1WJ6 A;  5FXD A;  3KZX A;  2KTF A;  3M63 B;  1ISN A;  1WGG A;  4TQR A;  2OH2 A;  3QU7 A;  5L1J A;  5DKW A;  1V86 A;  4MDK E;  2VKQ A;  2O2V B;  5C5J A;  1ZK7 A;  3T9P A;  3FAH A;  4ZYN A;  2N1R A;  1ZMD A;  1EM7 A;  2LUM A;  9ICW A;  3L08 A;  4IOI E;  5HHH A;  1ZQH A;  9ICL A;  4NLC A;  3MFH A;  1XLN A;  4Z6C A;  5JRT A;  3VCB A;  5FXP A;  3LYS A;  5DLF A;  4MM3 B;  3N7P D;  2JEF A;  5FJO A;  7ICN A;  4HCN B;  2YEP B;  5DGA A;  3PW2 A;  3MUC A;  3NVW A;  3FIL B;  4M6U A;  2R8D A;  5DQI A;  5BOM A;  3VUX A;  2H3I A;  4B9M A;  8ICI A;  2WX0 A;  3UJE A;  1I7H A;  2G9H D;  1RXW A;  2KK8 A;  4ECT A;  3DBR B;  1AW7 A;  3S1C A;  2J52 A;  4F93 B;  4BUG A;  4BXO A;  4OVV A;  2RDI A;  1TS4 A;  4KLE A;  4TQ0 A;  2BWE S;  2QIE B;  2WXJ A;  2GR3 A;  4H4Z A;  5CA7 A;  3UIO B;  2LGX A;  2W9B A;  3ENL A;  1X9W A;  2UVW A;  1D8Y A;  2WPF A;  1ZP0 B;  2IHM A;  3KWL A;  4NQL B;  1HSK A;  1S76 D;  1FNW A;  2MJD A;  1D4B A;  1F8W A;  4Z1Y A;  3M8R A;  4PYZ A;  4F5O A;  1XSN A;  3D2J A;  4BKS D;  2CHR A;  3AU6 A;  1ZDX A;  2BBC A;  1GJZ A;  1CK1 A;  4WQO B;  1VD2 A;  2ES6 A;  5J0X A;  3Q6J A;  3T8Q A;  1ZQV A;  1LVH A;  1QLB B;  1WRI A;  4I2E A;  1JOA A;  3NOB A;  1SE2 A;  5KFG A;  3Q6B A;  3RT3 B;  1F77 A;  2PVG C;  3PY8 A;  4RCO A;  5E6N A;  2G5H B;  4AWJ A;  3DER A;  2DPJ A;  1UH6 A;  2BVC A;  3TX1 A;  4RQ2 A;  3QPE A;  2I1J A;  1XXG A;  1F0Z A;  3T5K A;  5IAA C;  5J0P A;  2BR0 A;  1UPH A;  9ICB A;  4EBD A;  2KT7 A;  4C7Y A;  1KCZ A;  3MP9 A;  5AHX A;  3IK4 A;  2H3Q A;  8ICA A;  3U30 A;  4GIR A;  5FK9 C;  1SV0 C;  3DBS A;  4DF8 A;  1L2N A;  2WOV A;  2XGP A;  3FW9 A;  1W1J A;  4IRK A;  2IGG A;  3NJT A;  4IM0 A;  4J56 A;  4F71 A;  1GB1 A;  1FEH A;  4LJO B;  3RGT A;  4I2J A;  2MUT A;  3GZN B;  4DEZ A;  3WKE A;  2KAN A;  3F2B A;  2W43 A;  4WAF A;  1Q3U A;  3P4Q B;  2QB0 A;  2BF8 B;  1KOT A;  2LGY A;  3CRX A;  3H70 A;  4BKT A;  1PVQ A;  1ZQC A;  1PK1 B;  4J3Z A;  2BWF A;  3CAW A;  3N28 A;  5KT5 A;  3TQP A;  3QLD A;  1QF6 A;  1NI2 A;  4UBC A;  3Q14 C;  4ICV A;  3PMN A;  3M6K A;  4RT3 A;  4I2I A;  4UAZ A;  1XS9 D;  3F2C A;  2GBK A;  1DZN A;  4PVK A;  4EX7 A;  3KFU F;  3KYC D;  5HKH A;  1I19 A;  2P4P A;  1IV8 A;  4CHK A;  1FFU C;  2PW9 A;  3ZNG C;  2HHS A;  2M8S A;  3HT3 A;  3MHS D;  4DL4 A;  3C5F A;  1XF5 L;  2EAN A;  4ECU A;  4GC7 A;  4WJO A;  5ER0 A;  2P66 A;  2KFJ A;  3P93 A;  3TAR A;  3EKG A;  9ICX A;  1JXL A;  3R2T A;  5KHO A;  3RPF C;  5EE1 A;  1XLQ A;  3WAL A;  1N56 A;  3A4R A;  2Y9T A;  3N20 C;  5KFA A;  1W1K A;  3DHI C;  3JPS A;  7ICT A;  2E6X A;  2LJ5 A;  1SXD A;  2XN9 C;  4H2H A;  3WK4 A;  2AQ2 B;  1QH9 A;  2HVI A;  3NXL A;  5GTH U;  5IA7 A;  2AX5 A;  1WXM A;  1QOG A;  1LKY A;  5KT7 A;  1VAO A;  2E8M A;  1UXY A;  1B9R A;  3GSY A;  2WDW A;  4GOC A;  2HQM A;  3PSP A;  2YQE A;  5KFI A;  5KL1 B;  1DOI A;  2A19 A;  4HPM B;  4JN8 A;  2QB1 A;  1WG8 A;  2MBE A;  3SMV A;  2EH9 A;  3NZS A;  1K53 A;  5C1Z A;  3K1G A;  4K1W A;  7ICM A;  1DK3 A;  2V9W A;  2HHV A;  1GOZ A;  5G5H B;  4I29 A;  2F77 X;  1N5W A;  2KYW A;  2WF9 A;  2YMM A;  2XNA C;  3SR6 B;  3MFG A;  3L4P A;  4FFD A;  3AV8 A;  3V6C B;  3QZ8 A;  4YSY B;  3ZUN A;  3OWE B;  2MRP A;  3R11 A;  1GC7 A;  4GLX A;  4NV0 A;  3GFK B;  3S47 A;  3RAQ A;  1LPF A;  3VCC A;  3LB8 A;  2KHV A;  4NAW B;  5EDS A;  1P48 A;  3NVZ A;  3JZU A;  3ZRF A;  4M9L A;  4O95 A;  1L5P A;  1TT5 B;  2ZW1 A;  4KSK C;  3Q8A A;  3PRM B;  1P1A A;  2W3R A;  1KKO A;  2X8G A;  2C2E A;  1OQQ A;  4DFM A;  4CO7 A;  2AXT U;  2ZJ8 A;  3Q4D A;  4GB9 A;  3QK0 A;  2V3B A;  4IQT A;  2K9X A;  2VZK D;  2KLC A;  3SEB A;  2KSO A;  2D11 A;  2VAO A;  2BVG A;  3PHW B;  3QX7 A;  2NYV A;  2O56 A;  3VC6 A;  1MO9 A;  4O5E A;  2PI5 A;  4WWN A;  5KG5 A;  3RNC C;  2CR5 A;  2D2Q A;  1NDD A;  5FKA C;  3FG2 P;  2O3G A;  2R8I A;  1BVS A;  1KN5 A;  3RB0 A;  1WUD A;  1D9D A;  1BGX T;  4P1C C;  3HPF A;  5F9L A;  2LXC A;  9ICU A;  2PI4 A;  4F4K A;  4ANV A;  1N63 A;  4GU2 A;  2D5G A;  2O6V B;  1L6V A;  1OEP A;  1Z1B A;  1TYP A;  1KN0 A;  1TV9 A;  1WXV A;  1F44 A;  1Z1V A;  3N97 B;  4WJQ A;  1UGJ A;  3RMK C;  3KQ4 A;  1WZ3 A;  3QU2 A;  3HIL A;  2W3S A;  1KLU D;  2BB6 A;  2C9W B;  2R8J A;  4GC6 A;  3J81 j;  4AUQ C;  4CRX A;  4GLS C;  5DPS A;  3C2K A;  3FKY A;  2OM6 A;  5HFY A;  2KFK B;  2OZ3 A;  4I6N B;  2PJH A;  4AYB C;  1A70 A;  1XSL A;  5ALX A;  4N58 A;  1F9C A;  1XAN A;  4UB2 A;  1GSN A;  1XU4 A;  2IY1 B;  5ALY A;  1D5Z C;  3IT6 B;  2C7N B;  2LM4 A;  2V4R A;  2KIV A;  1VZ8 A;  4F4Z A;  9ICM A;  1SGH A;  2VH2 A;  1L3S A;  4MAC A;  5E79 U;  3SAF A;  3SAG A;  3AEF B;  2IO2 B;  1EUV B;  2LJI A;  2LYA A;  3S2A A;  1E7V A;  1W1R A;  3TOY A;  1L8P A;  1MSW D;  1YMH E;  1YQ4 B;  2K4E A;  1KSP A;  4DSI A;  3D2H A;  4B9L A;  1K1Q A;  3Q8B A;  3I57 A;  2KD0 A;  4N6E B;  4I6P A;  4EMJ A;  5TIS U;  3RJ8 A;  1BPD A;  2JWZ A;  2FMP A;  2WU2 B;  3PTF C;  3TTE A;  4R65 A;  3LLB A;  4NM1 A;  1QTM A;  4M6W B;  2F1I A;  1DXL A;  3QUT A;  2IYD B;  4ED7 A;  2LWP A;  5DPT A;  1DK2 A;  1F2R I;  8ICP A;  3LB8 C;  2J0K A;  4HEA 1;  2VH1 A;  4YR2 A;  5DQG A;  1VCB A;  1XNS A;  8ICO A;  2LEK A;  3HP6 A;  3NVV B;  3TJI A;  3GU3 A;  4HPL B;  2KWD A;  2VRR B;  4O3N A;  3D6J A;  5AIC A;  3W1Y A;  2FNJ B;  2J6U A;  1C20 A;  2KAJ A;  4BBN C;  3N30 A;  1JEH A;  2Y3R A;  2P13 A;  6ENL A;  2QKQ A;  4CCH A;  1KLV A;  3HPO A;  5FS8 A;  3AN1 A;  1TYT A;  4DFP A;  4JDR A;  3VTW A;  3KHG A;  4IWO A;  4DK5 A;  4IP5 A;  4NLG A;  1ET6 A;  1S0O A;  5DCN A;  1W1M A;  4R64 A;  2MBR A;  3TAD A;  5ALH A;  2WP5 A;  3EHV A;  4C4R A;  1ZQU A;  2BCV A;  3KH0 A;  4P16 A;  5L1M A;  2I6X A;  5HHD G;  3ZLZ A;  4REZ A;  1AHV A;  4PHA A;  1QLN A;  2LFI A;  1URJ A;  4NM2 A;  1T94 A;  1SB3 C;  5HR6 A;  4YXJ A;  3WU2 U;  3VC8 A;  3AEV A;  2G3Q B;  4TVW A;  3M7D A;  3QU5 A;  3ISD A;  2KDI A;  3AE1 B;  4PVE A;  4QZE A;  3S1D A;  2OVL A;  1ACC A;  5J04 A;  3BQ2 A;  1X6I A;  2DYO A;  2XK5 A;  4I27 A;  3S1F A;  1SIJ A;  1ZKQ A;  1NEK B;  2ZCC A;  3PW0 A;  2CPR A;  4UB5 A;  3C0P A;  3WAM A;  3PK7 A;  4MJS B;  1SL2 A;  1W1O A;  4F50 A;  3NGD A;  1TGZ B;  1YJJ A;  2L00 B;  3PW5 A;  2M0A A;  2MW5 A;  4W9D A;  4YVZ A;  3Q8R B;  3G6Y A;  3RH6 A;  2ZEQ A;  5IIN A;  2C5L C;  2IGH A;  3RCZ A;  2K8B B;  4KVG B;  5LXI B;  4IC9 A;  1MN8 A;  1PYW D;  5ALR A;  1NPX A;  2XSX A;  5IDZ A;  2IBK A;  1TTN A;  1SKS A;  3N1Y C;  3DBR I;  4FXC A;  4BXO B;  5H2F U;  1PDX A;  1XD3 B;  2CN1 A;  4EEL A;  4ITK A;  1ZJN A;  9ICO A;  3RUL A;  7ICJ A;  2D3C A;  3E9S A;  1JUD A;  1VLB A;  1FXI A;  2L8J A;  4XLO A;  1E9I A;  3OTR A;  3QFB A;  5AM4 A;  2W9M A;  3H12 A;  2KZM A;  3SQP A;  2JK6 A;  3P0W A;  3QQ8 B;  2EQ8 A;  3OSP A;  2AEH A;  5I4D A;  3H8A A;  3ZJU A;  1IXR A;  4AYB F;  3JSV A;  5JCM A;  4EMI A;  3K9P B;  4YTP B;  2L05 A;  3H7V A;  4I2D A;  3OW1 A;  3FW7 A;  4JWM A;  2P3H A;  2Z0D B;  4PH5 A;  4KWS A;  1JRP A;  3DV9 A;  2LMC A;  5FJP A;  3A9J B;  3FJ4 A;  1NK4 A;  1FCC C;  1KLN A;  1V1P B;  5ALJ A;  3L10 B;  4ZOH C;  4RPY A;  2MUC A;  5KVH A;  2UUU A;  3Q8K A;  3RNB C;  5EE0 A;  1KFY B;  1ZQF A;  3MC1 A;  3C29 A;  1QCK A;  2HE7 A;  4GDL A;  5AKX A;  4UD8 A;  1WCN A;  4W9C A;  1O08 A;  5JZE B;  5U25 A;  4RQ5 A;  5AEK B;  5ALF A;  1SXE A;  1UHU A;  3BDP A;  4F4Y A;  7ICE A;  2Q5W D;  4M8M A;  1YQZ A;  1E8G A;  2P0I A;  2UVV A;  4KEM A;  3QC8 B;  2OWO A;  5AK4 A;  3MR6 A;  3PW7 A;  1Y56 A;  4O1N A;  1WUF A;  2Y1I A;  1ZQW A;  1FEZ A;  4A20 A;  5FJR A;  3GZN I;  4RQN A;  4NY8 A;  4FHJ A;  4HRO A;  3TAP A;  2FMS A;  3EJD B;  3IT4 B;  5ALV A;  3NRZ A;  4F5Q A;  1HIW A;  1L3U A;  1FRD A;  1F9J A;  1M4V A;  1XO3 A;  2LZ6 A;  3P3B A;  2W03 A;  3I1Y A;  7ICK A;  4QW9 A;  1KF6 B;  3R66 C;  2XC9 A;  4F2R A;  5AIA A;  4HK2 A;  2BQ3 A;  9ICJ A;  2W9N A;  5AI8 A;  3RF9 A;  2O2V A;  4DFD A;  4LLG M;  3IG3 A;  3TUO A;  3E58 A;  1VR9 A;  3OPX A;  3TJ4 A;  3H7I A;  4KLQ A;  4B0E A;  4Z6E A;  5J2A A;  2OJW A;  3H0R B;  4AP4 C;  2PTZ A;  3TAC B;  3L8K A;  5KG4 A;  1FXA A;  3LDA A;  1PUT A;  4QWD A;  4B9T A;  4MM3 A;  1S5L U;  3ZNH B;  2FCQ A;  1FEA A;  3N3K B;  1NJZ A;  2KNJ A;  3DDC B;  2JH7 A;  3BS5 B;  4PYT A;  4KKJ A;  4DQP A;  2KVR A;  4MEM A;  3FIL A;  4DO9 A;  3M8S A;  1S97 A;  2XVT A;  1P7F A;  4IKG A;  1WRD B;  5J0W A;  8ICH A;  4ANX A;  4JAY A;  4BOS C;  2V3A A;  4Y2U A;  3P1M A;  2GH5 A;  3NAS A;  3BW7 A;  4RF0 A;  3VHT C;  1L8L A;  4CF5 A;  1DIQ A;  2IOF A;  1DRG A;  2OHF A;  2IHN A;  3R0K A;  1V9J A;  3IN5 A;  2RK5 A;  1RXV A;  1LKY B;  2CRX A;  9ICK A;  2A1A A;  1UF0 A;  8ICR A;  1WWT A;  2FCN A;  3KHH A;  3NY5 A;  1N61 A;  5ALK A;  8ICF A;  2DEN B;  2SAK A;  4NJ7 A;  1IYX A;  4GFI A;  2YVS A;  5KT4 A;  3RJI A;  8ICB A;  3B08 A;  3TBL D;  1Z19 A;  3UQB A;  4H4T A;  3APD A;  1GV4 A;  5KG2 A;  1CMX B;  1EWY C;  3I3T B;  1BXT A;  2ZIX B;  3DFH A;  1Z4O A;  2D3D A;  3U2S C;  3IV6 A;  3MWC A;  4OD0 A;  4DSJ A;  1C1Y B;  5J0Q A;  1HEZ E;  1ECW A;  4ED6 A;  4P1B C;  5DPR A;  5J18 A;  4HCP B;  1D7Y A;  1I4Q A;  4O3Q A;  2M56 B;  3PZ8 A;  4DL7 A;  2LUE A;  4NY0 A;  3DK9 A;  4KLU A;  3KUM A;  1V49 A;  2IA6 A;  3MGI A;  4H4X A;  2HD5 B;  3BZC A;  1IP9 A;  3LJ3 A;  1TZ1 A;  4PHP A;  3ZNI D;  4WIP A;  4B6W A;  1PDY A;  1H6V A;  2ESE A;  3CGD A;  4UAS A;  4EQW A;  4H4W A;  2KN5 A;  2VZK B;  1I4X A;  1ROE A;  4FJZ A;  4WWO A;  2OX4 A;  4MGG A;  2GI9 A;  5C23 A;  1J7B A;  2AKZ A;  3CYM A;  3W8X A;  1Y88 A;  1JPD X;  3JVZ X;  1S7M A;  1JPM A;  4F7Z A;  1WUE A;  4EZ6 A;  2V4Q A;  2RQ5 A;  1QOF A;  4JE3 B;  1SJA A;  2EAM A;  5CHW A;  1ZQI A;  4K3B A;  4EZK A;  1JIH A;  5CHG A;  2RGF A;  1BQG A;  2M9N A;  3N1Z C;  3T3N A;  1D8B A;  1SB3 B;  1YEY A;  1DOY A;  2G1E A;  4IL2 A;  2KVC A;  2ZXI A;  2KN4 A;  1NOM A;  3ALR A;  2BT6 A;  2IY0 B;  1MG4 A;  4JHM A;  2YMQ A;  2ZIU A;  3CST A;  1TAU A;  3JVA A;  3VXW A;  2NRW A;  4K7U A;  4WH4 A;  1IGD A;  2ZZC A;  4IR1 A;  1A5R A;  5L1I A;  8ICE A;  1ZPS A;  2RPV A;  8ICM A;  5KG1 A;  9ICF A;  5AI9 A;  3TSS A;  2K4P A;  4C4S A;  1JMS A;  3ZDD A;  4JX1 C;  2W11 A;  3LWM A;  1WGH A;  3TAN A;  1Z3E B;  5KHQ A;  3V72 A;  4K8G A;  5CEH A;  1AHZ A;  1JDF A;  1AAR A;  1DOQ A;  3RJA A;  1RRB A;  3I76 A;  4KLJ A;  1K8R B;  2J7Q B;  4F8C B;  4KIK B;  2PEA A;  2HOF A;  1XCQ L;  1BPB A;  2J3N A;  1TE6 A;  2OPJ A;  3DDH A;  3RB6 A;  3ORY A;  2LBO A;  1C4P A;  3PFR A;  3ZRC A;  3H9D A;  1ZQJ A;  3UJF A;  3EUB 3;  1UZX B;  4KDL B;  1N61 C;  5KFX A;  2K1F A;  2B76 B;  5KFH A;  4I28 A;  1Z00 B;  2RDH A;  5G5H A;  3SR6 A;  1TK8 A;  3ZLF A;  4HN8 A;  4KMU A;  4M0A A;  3FC4 A;  1QSY A;  2NRZ A;  4M01 A;  1NHS A;  3S1E A;  2ON8 A;  2HOI A;  3THV A;  2WXG A;  1C76 A;  2HDE A;  1E6E B;  4G3X B;  1KQQ A;  3IFW B;  4NAM A;  4IQW A;  1SF0 A;  3QEA Z;  3PR4 A;  3SD5 A;  4JB3 A;  3DHH C;  1WVF A;  2VFR A;  1ZQX A;  4HG0 A;  4NAW A;  3UCD A;  2JX5 A;  1J2N A;  1KM7 A;  2LKY A;  1OQR A;  2KKC A;  2KNB A;  2DAF A;  4ZOH B;  3IBE A;  2RRD A;  3DIP A;  1ZQ1 C;  2O6K A;  4OJ6 A;  1HUZ A;  3QHT A;  4NZL B;  1JI7 A;  2WXQ A;  4K81 A;  1EC9 A;  1T7P A;  2WDV B;  4HDQ A;  5L6G A;  5EWG A;  2BDP A;  4J1O A;  1ONE A;  3KYD D;  1SXT A;  3II4 A;  2HW3 A;  2YTU A;  1JX4 A;  1U4B A;  4WJ3 B;  3V6E B;  4PWC A;  3URH A;  2JRH A;  1S3S G;  4P0P B;  2WXO A;  3KKA A;  4R66 A;  1UT5 A;  2N7D A;  3HM6 X;  5BMG A;  5IKC M;  5AWV A;  1IM4 A;  2Y5B B;  1HA5 A;  3ZTD A;  3QE9 Y;  4YSZ B;  2LGD A;  4I2G A;  4KGR A;  3Q3O C;  1BML C;  3UM9 A;  2F8L A;  3QUB A;  1ZQK A;  2QAE A;  1NZB A;  2X38 A;  1XC9 A;  5KFQ A;  1R4M B;  2Z0E B;  2FJ6 A;  1VZ7 A;  4YT0 B;  5T14 A;  1WY8 A;  1HEK A;  2ZVO A;  1LVL A;  1YZ6 A;  2YMP A;  3V60 A;  4C0Z A;  3SEN A;  2KZ3 A;  5IP4 D;  1ZX9 A;  5KFB A;  3GIL A;  2BS4 B;  4Y2Q A;  4HKQ A;  2DGZ A;  4MSQ B;  4ECW A;  4ECS A;  4UAW A;  4ICA A;  3V05 A;  3FYY A;  3GRT A;  3WK5 A;  3LDZ E;  2WDR B;  3ZQ4 A;  2QAR B;  3ES7 A;  8ICL A;  1L6N A;  2KFK A;  3WKA A;  2PE9 A;  5HNK A;  2XCP A;  1MVK A;  3SBF A;  2X8X X;  3WKC A;  4G3I A;  2PMZ F;  2C7H A;  1WM3 A;  3U52 E;  1FM0 D;  2JV3 A;  3V5C A;  1OEY A;  4YD2 A;  2EXR A;  3HHM A;  2WTF A;  4DSL A;  1YX5 B;  3EEC A;  4DSF A;  3WK6 A;  1JAL A;  1NDA A;  2PLP A;  1N60 C;  1ZDV A;  3RNA C;  4IP4 A;  2V4I B;  3GIJ A;  3G6X A;  1EU3 A;  4KKI A;  4A3R A;  4P6V F;  1XLO A;  3JPO A;  4YD1 A;  5BOF A;  2WF5 A;  2KDE B;  4H4R A;  4NLN A;  3MR3 A;  1YJI A;  3JPQ A;  2ZTC A;  1COO A;  5D49 A;  2LAS A;  3VUY A;  3ZD9 A;  3DWG C;  5EU9 A;  4F4R A;  1NK6 A;  1WXQ A;  4C7Z A;  2K4H A;  4M6W A;  3WK8 A;  5D4B A;  3VRB B;  3AE9 B;  1PGX A;  2GRT A;  2X8C A;  4PS7 A;  2L32 A; 
#chains in the Genus database with same CATH homology
 2E6X A;  2XN9 C;  5H92 C;  1E0Z A;  4BC9 A;  2AQ2 B;  1WYG A;  1K52 A;  2SEB D;  3PZ7 A;  1N63 C;  1N5X A;  1FFV C;  2AX5 A;  4GDL B;  3NVV A;  1QOG A;  4CQN A;  3GSY A;  2L1A A;  1VAO A;  3PO0 A;  1FIQ A;  4US9 A;  1I4G A;  2NTS A;  1UNS A;  1B9R A;  1UXY A;  3R07 C;  2WDW A;  4ZRQ A;  1DOI A;  2KMM A;  3NUH B;  2BVF A;  4ZRP A;  1NYQ A;  2V3P A;  2BB5 A;  4P16 A;  1FMA D;  1K53 A;  5D3D A;  1GOZ A;  5G5H B;  2Y5C A;  4TMA B;  1N5W A;  2XNA C;  4N59 A;  4RGO S;  3N9Y C;  3SR6 B;  3MFG A;  3JS8 A;  3IAM 1;  5LNK 1;  3L4P A;  3AV8 A;  3VR9 B;  2I2Y A;  3W9C B;  3BVG A;  4YSY B;  5G5G A;  2FBW B;  1W1S A;  3BVM A;  3OWE B;  3P63 A;  2VFV A;  3NVW B;  5L6F A;  2J53 A;  2Y08 A;  2V0G A;  4WWM A;  2ICI A;  5AUK A;  3A7U A;  2MJE A;  4NAW B;  3NVZ A;  4US8 A;  4A8X C;  4O95 A;  1VDV A;  1IUE A;  1L5P A;  4OZC A;  2ZW1 A;  5BYR A;  1MHX A;  2W82 A;  3AEE B;  3ZYY X;  4BC7 A;  2IPI A;  3Q8A A;  2GQU A;  1QKZ A;  5FR3 A;  2W3R A;  1WGK A;  2ZW0 A;  4RFB A;  1T3Q C;  3AEG B;  1OQQ A;  1N60 A;  3O13 A;  5E6J A;  5FXE A;  4LK0 M;  5HHZ A;  2K9X A;  2OAI A;  1FFU A;  2VZK D;  3SEB A;  1LO5 D;  2VAO A;  2BVG A;  2IJ0 A;  2AQ3 B;  3TSJ A;  2QKN A;  2GB1 A;  1IBX A;  5FKA C;  1E8F A;  2O3G A;  3ETR A;  2IPK D;  3ZJV A;  3R8B A;  1PFD A;  4IDI A;  3BVZ A;  4PT5 A;  2Y5P A;  1I4R A;  2QMT A;  5BMH A;  3V3X A;  4ML8 A;  2FE8 A;  1N63 A;  2EEL A;  2D5G A;  1FFV A;  1L6V A;  4A6Q A;  2WQY B;  1QQR A;  1VZ6 A;  2QIL A;  3AH7 A;  4OW0 A;  4MLA A;  3HRD D;  3TEZ A;  1UGJ A;  1QOA A;  1VJK A;  1QLT A;  1ZXI C;  3KQ4 A;  1TY0 A;  3Q8C A;  4MH8 A;  2BB6 A;  2W3S A;  1KLU D;  2JZP A;  1N62 A;  2WDQ B;  5I1V A;  3IAS 1;  4L1B A;  2AQ1 B;  2HTM E;  3NS1 A;  4GLS C;  5HFY A;  4L23 A;  1V1P A;  2RDG A;  2TSS A;  4B0M A;  2WXI A;  1A70 A;  1WVE A;  4N58 A;  2VFT A;  1D5Z C;  1NI3 A;  3IT6 B;  1MPE A;  3U7Z A;  1VZ8 A;  2VFU A;  4MAC A;  3CWI A;  3BZD B;  3AEF B;  2LJI A;  1YN5 A;  4EE2 A;  3Q8E A;  2WXR A;  4A9A A;  4PVJ A;  1W1R A;  1F0X A;  3NVY B;  1YQ4 B;  1YMH E;  1AN8 A;  4ARI A;  1YN4 A;  3UI3 A;  1XEE A;  4TQ1 A;  3D2H A;  2L83 A;  3Q8B A;  1YNT E;  3I57 A;  4N6E B;  1L0V B;  1JWB D;  2BS2 B;  3RJ8 A;  4XWW A;  2WU2 B;  2W55 A;  3LLB A;  2IDY A;  1SE3 A;  3SFD B;  1F2R I;  3LB8 C;  1YQ3 B;  1HZ5 A;  4JWS C;  4HEA 1;  2PLI A;  5BYS A;  2LEK A;  1QT9 A;  3NVV B;  4XDC A;  1FIQ B;  1DII A;  2KWD A;  1I4P A;  1RWS A;  2KAJ A;  3EUB 2;  2Y3R A;  2P13 A;  2GRI A;  3AEA B;  4PZF A;  3AN1 A;  3CIR B;  5H8Y E;  3AE4 B;  4YTM B;  1ET6 A;  2K0P A;  3E56 A;  1TYG B;  1W1M A;  4KGT A;  2MBR A;  1F2R C;  1CZP A;  5HHD G;  3W8W A;  1Q10 A;  3BK2 A;  2H89 B;  2CJN A;  4REZ A;  5AUI A;  1AHV A;  2LFI A;  1HQR D;  3BWU D;  1SB3 C;  2MH7 A;  5ADZ A;  1SBB B;  4DXF A;  2INP E;  5K8E A;  1FRR A;  3RFZ B;  2JSV X;  3NVZ B;  4TVW A;  4PVE A;  3S1D A;  3AE1 B;  3ZJT A;  3TSH A;  1ACC A;  2KAC A;  2DYO A;  2N9L A;  3S1F A;  1SIJ A;  1JW9 D;  2OED A;  1NEK B;  3BYT B;  4JWU C;  4XWT A;  3HRD C;  1RM6 C;  2W54 A;  2RMM A;  2EKI A;  1L4Z B;  2PVO D;  3C0P A;  2H88 B;  3VRA B;  2LHE A;  1W1O A;  4KGS A;  1YJJ A;  1N62 C;  1FCL A;  2M0A A;  2K3U A;  5HQX A;  4D2K A;  4KX6 B;  4TSS A;  3IXS A;  2DBY A;  2IGH A;  1IBX B;  2GQT A;  2R61 A;  3TEX A;  2WLB A;  4LTU A;  2BTE A;  1PYW D;  1AYF A;  1JRO A;  4FXC A;  1GPX A;  1PDX A;  1JWM D;  4ITK A;  2WS3 B;  2BVH A;  2BYT A;  2E3T A;  2QJL A;  3E9S A;  3P4S B;  1VLB A;  1FXI A;  4MT5 A;  3BYY B;  4XLO A;  3NZ3 A;  1JML A;  1ENF A;  3KLS X;  2WXP A;  5I4D A;  3HUI A;  5D3I B;  4A55 A;  3ZJU A;  3AE6 B;  1UWM A;  2ACZ B;  4YTP B;  1L0X B;  2JWU A;  1ZXH A;  3Q69 A;  1STE A;  3FW7 A;  3TEW A;  2P3H A;  3MJ5 A;  3W5U B;  3NS1 B;  1JRP A;  4Q2J A;  3BII D;  2LMC A;  2N9K A;  1FCC C;  1EU4 A;  1V1P B;  3AE3 B;  4OVZ A;  2UUU A;  4ZOH C;  1MBB A;  1JCK B;  5EE0 A;  3P4R B;  2WXL A;  1C9F A;  1KFY B;  4H2A A;  5HG2 A;  2Q4W A;  4UD8 A;  1E7P B;  1V1O A;  1OFF A;  2PLS A;  2R2Z A;  1ZUD 2;  2Q5W D;  4XDD A;  3MC0 B;  3GB1 A;  1K50 A;  5GXG B;  5D7G A;  2DWQ A;  3PM9 A;  1E8G A;  1L4D B;  1L6U A;  4ZHO A;  1TS5 A;  1I4H A;  1VRA B;  1Y56 A;  3HVZ A;  4YWG G;  4O1N A;  3KJM A;  3B9J B;  2E5A A;  3AEC B;  1TS3 A;  1BUI C;  5T8I A;  4HRO A;  4DNS A;  1SEB D;  3IT4 B;  3NRZ A;  1V97 A;  4WUR A;  5AE1 A;  1FRD A;  1M4V A;  1XO3 A;  1DOX A;  4ZYS A;  2WXM A;  1KF6 B;  1C77 A;  2K5P A;  4A90 A;  1MI0 A;  3HSU A;  4YTN B;  3AE2 B;  2WXK A;  2WNM A;  4LLG M;  3TUO A;  1VR9 A;  3PQB A;  1TS2 A;  2WXN A;  4B0E A;  5AE3 A;  1DYQ A;  3LAE A;  4RF1 A;  2L52 A;  4DQO C;  1W1L A;  1FXA A;  1HXY D;  2IGD A;  1PUT A;  3Q8F A;  2J42 A;  4NJC A;  3FWA A;  4PYT A;  5AE2 A;  2VFS A;  4KKJ A;  1K51 A;  2Y4G A;  4USA A;  3FIL A;  3W5V B;  1MBT A;  1XLP A;  1P7F A;  1D6E C;  4IKG A;  2QSD A;  4RGM A;  4JAY A;  2CJO A;  3LYY A;  3KWV A;  3P1M A;  2QPM A;  3P42 A;  3BW7 A;  4RF0 A;  4XE0 A;  1J7A A;  1DIQ A;  1EWC A;  2OHF A;  4RH6 A;  1ZOY B;  1L0Y B;  2PTL A;  3AMZ A;  1JWA D;  1T6B X;  3MHZ A;  2RK5 A;  1RFK A;  5BYQ A;  1WWT A;  2WXH A;  3ABV B;  1DGJ A;  3EGR A;  1N61 A;  3TEY A;  2SAK A;  1UUP A;  3B2G A;  4YXD B;  2YVS A;  1J7C A;  1TKE A;  2DLB A;  1R7S A;  1D5M C;  1EWY C;  3W2D A;  1BXT A;  1ZR6 A;  2MEK A;  4HRS A;  1KH0 A;  4OZA A;  3U2S C;  2UUV A;  4JPS A;  1T5X D;  1QLU A;  3VTE A;  1HEZ E;  5G5G B;  1JWS D;  1GAQ B;  4L2Y A;  1SSN A;  1I4Q A;  2M56 B;  3PZ8 A;  1UWX A;  1ZE3 D;  2K22 A;  5I1W A;  2YEP F;  1FO4 A;  1GB4 A;  5HMR A;  3W8Z A;  3GS2 A;  2JXT A;  1X2H A;  2BW2 A;  4OAL A;  2M19 A;  2NTT A;  4WIP A;  4OZB A;  1TKG A;  2VZK B;  1I4X A;  1ROE A;  4M0W A;  2LGI A;  2GI9 A;  1J7B A;  3DWM A;  1PGB A;  3BK1 A;  5MPO A;  2BS3 B;  4AQ7 A;  3C8Y A;  4PVH A;  3W8X A;  5TSS A;  4C56 C;  4EC3 A;  4UDU C;  5FXF A;  4JE3 B;  1QOF A;  3ETR B;  2JU6 X;  4ZHP A;  2WP9 B;  2PKO A;  3D2D A;  3HVD A;  3T3N A;  1FNV A;  1SB3 B;  1DOY A;  2G1E A;  1IGC A;  1KRH A;  2KN4 A;  2BT6 A;  3POP A;  4TVY A;  1V8C A;  1CJE A;  1NVI D;  4WH4 A;  4OHJ A;  1IGD A;  1NYR A;  1RM6 B;  1WSP A;  3FW8 A;  2Z8L A;  1C4A A;  1ZPS A;  2V3N A;  1HZ6 A;  2RPV A;  4WQM A;  3TSS A;  4JX1 C;  4J3O D;  4AS1 A;  1CQV A;  5BMI A;  4BBY A;  2LHD A;  1B1Z A;  2N0S B;  1E10 A;  1MHH E;  1AHZ A;  2N7J A;  4HKZ E;  3A7A A;  3NRZ B;  3RJA A;  1NEN B;  1ESF A;  1VQZ A;  5FXD A;  1XCQ L;  1C4P A;  3I99 A;  3J9C A;  3EUB 3;  3FAH A;  1N61 C;  2MJ3 A;  4RNA A;  3A7R A;  1AHU A;  2B76 B;  2DYM A;  1EM7 A;  1KLG D;  2LUM A;  4DXG A;  4IOI E;  3AB5 A;  2RDH A;  2FUG 1;  5G5H A;  2JYE A;  4C80 A;  3SR6 A;  1XLN A;  5FXP A;  4MM3 B;  4RGN A;  3FC4 A;  3AEB B;  3R2I A;  3AM9 A;  2ON8 A;  2YEP B;  3S1E A;  3NVW A;  2WXG A;  1C76 A;  2HDE A;  1E6E B;  3FIL B;  2I0K A;  1W1Q A;  2WXF A;  4NAM A;  2R8D A;  3DED A;  1SF0 A;  2VFR A;  1YN3 A;  4HG0 A;  1I7H A;  1WVF A;  2G9H D;  2QEJ C;  1AW7 A;  4PWB A;  2J52 A;  2JX5 A;  3S1C A;  1OQR A;  1E0Y A;  4ZOH B;  1XCT L;  1TS4 A;  3T3O A;  4YSX B;  4TQ0 A;  2QIE B;  2WXJ A;  4NZL B;  2WXQ A;  3GP7 A;  1SE4 A;  2PMV A;  2WDV B;  1D5X C;  5L6G A;  2JYT A;  1SJE D;  1ZP0 B;  2INN E;  1SXT A;  3KWL A;  1HSK A;  1FNW A;  2MJD A;  5EE3 A;  1D4B A;  1P7E A;  5EE9 A;  4PWC A;  3D2J A;  2I38 A;  3LXF A;  2WXO A;  3WCQ A;  5BMG A;  1PGA A;  1ZDX A;  2BBC A;  5AWV A;  1CK1 A;  1HA5 A;  2CU3 A;  4GDK B;  1TY2 A;  4YSZ B;  4KGR A;  1JWU D;  1BML C;  1QLB B;  1WRI A;  2WU5 B;  4R3D A;  2Y3S A;  1SE2 A;  3I9V 1;  1F77 A;  2PVG C;  2X38 A;  4RCO A;  3TX1 A;  1VZ7 A;  1F0Z A;  1XXG A;  1QIL A;  4YT0 B;  1C78 A;  3VQI A;  4C7Y A;  1E9M A;  3MP9 A;  3P4P B;  3ZGZ A;  2AXR A;  1T3Q A;  1TKY A;  5FK9 C;  1TJE A;  3B2F A;  3AE7 B;  1C79 A;  2BS4 B;  1KTK A;  2JQR B;  4HKQ A;  3FW9 A;  1N5W C;  2PIA A;  2NMQ A;  2KQ4 X;  1W1J A;  2IGG A;  5C3J B;  1GB1 A;  1FEH A;  3V05 A;  1JQ4 A;  3B9J A;  4ARC A;  2WDR B;  1QOB A;  2J4X A;  3U4E G;  3ZQ4 A;  3DQ0 A;  4WAF A;  3P4Q B;  1MVK A;  2KDM A;  1TZO A;  3U52 E;  1FM0 D;  3SFE B;  1AWD A;  1QF6 A;  2EXR A;  5HI1 A;  2Q85 A;  1JAL A;  2NQW A;  4JB1 A;  3AE5 B;  2PLP A;  3H8H A;  1N60 C;  1DZN A;  1SJH D;  1ZDV A;  4PVK A;  2V4I B;  3URY A;  1I19 A;  1EU3 A;  4KKI A;  2P4P A;  1FFU C;  3VR8 B;  2ONQ A;  3NVY A;  1C4C A;  4P6V F;  1XLO A;  3W1S A;  1ZXI A;  2PW9 A;  4HJG E;  5JXV A;  1XF5 L;  1YJI A;  3AED B;  1RYJ A;  3EA6 A;  5C2T B;  5D79 A;  3R2T A;  3RPF C;  1FNU A;  3DWG C;  3AE8 B;  5EE1 A;  1ET9 A;  1WXQ A;  1XLQ A;  1W1K A;  4C7Z A;  4BCA A;  4RGT A;  1X2G A;  3VRB B;  2Y3A A;  1E8H A;  3AE9 B;  1PGX A;  1FD6 A;  2L32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...