2R8DA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin in complex with mg++ and mn++
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
78
Chain Sequence
ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
molecule keywords Hemolysin
total genus 16
structure length 78
sequence length 85
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r8dA00
2I0KA 3AMZA 1WVEA 1W1LA 4BC7A 3S1FA 2E3TA 3LLBA 5HHZA 3I99A 2VFVA 5FXPA 2VAOA 4BC9A 4OALA 3JS8A 1QLUA 2VFRA 1ZXIC 2Q4WA 3BW7A 3DEDA 3NRZB 1DIQA 1WYGA 4XLOA 2O3GA 5ADZA 5G5HB 2VFSA 2W3RA 2YVSA 1MBBA 1N61C 3S1DA 4BBYA 1RM6B 1V97A 1I19A 1T3QC 2P4PA 2MBRA 1N5WC 2EXRA 3HRDC 5AE1A 2QPMA 4PYTA 1W1JA 3AM9A 1N62C 2BVHA 4BCAA 1QLTA 2P3HA 2R8DA 1UXYA 1E8GA 1W1QA 2OAIA 4JB1A 1JROA 1N5XA 1N63C 3ETRB 3NVWB 4MLAA 5HMRA 3LAEA 2Q85A 3C0PA 3PM9A 2BVGA 1N60C 3W8WA 1E8FA 4JAYA 3S1CA 1E8HA 5AE3A 4ZOHB 3NS1B 2PLSA 5HQXA 5AE2A 2P13A 1E0YA 1JRPA 1W1MA 1AHZA 1VDVA 3S1EA 2QKNA 2W55A 3KJMA 2R2ZA 1FFVC 1ZR6A 2AXRA 4O95A 3DQ0A 2VFTA 2W3SA 1DZNA 3NVZB 2NQWA 1AHVA 3NVVB 1WVFA 4ML8A 1W1KA 2W54A 3SR6B 1FIQB 1SB3B 3NVYB 1FO4A 1F0XA 3W8ZA 3AN1A 1AHUA 2GQTA 1FFUC 2BVFA 1W1SA 5FXDA 2RK5A 3EUB3 1HSKA 5FXFA 1W1OA 2PLIA 2VFUA 3TX1A 4HG0A 5G5GB 3B9JB 1VAOA 5FXEA 2GQUA 1MBTA 1DIIA 1W1RA 3W8XA
chains in the Genus database with same CATH superfamily
2I0KA 3AMZA 5D79A 1WVEA 1W1LA 4BC7A 3PQBA 3S1FA 2E3TA 3LLBA 5HHZA 3I99A 5K8EA 2VFVA 5FXPA 2VAOA 5L6FA 4BC9A 4OALA 5I1VA 3JS8A 1QLUA 2UUUA 2VFRA 3FW8A 3D2JA 1ZXIC 2Q4WA 3BW7A 3DEDA 3NRZB 1DIQA 3VTEA 3RJ8A 3TSJA 1WYGA 4XLOA 2O3GA 5ADZA 5G5HB 2VFSA 2W3RA 2YVSA 1MBBA 1N61C 3S1DA 4BBYA 1RM6B 2IPIA 3FW9A 4DNSA 1V97A 1I19A 1T3QC 2P4PA 2MBRA 1N5WC 2EXRA 3HRDC 5AE1A 2QPMA 4PYTA 4PWCA 2WDWA 1W1JA 3AM9A 1N62C 2BVHA 4PVKA 5AWVA 3RJAA 4BCAA 1QLTA 2P3HA 2R8DA 1UXYA 1E8GA 1W1QA 2OAIA 4JB1A 1JROA 1N5XA 3D2HA 1N63C 3ETRB 3NVWB 4MLAA 4PVEA 5HMRA 3LAEA 2Q85A 3C0PA 3PM9A 2BVGA 1N60C 3W8WA 1E8FA 4JAYA 3S1CA 1E8HA 5AE3A 4ZOHB 3NS1B 2PLSA 5HQXA 5AE2A 2P13A 5L6GA 3HSUA 2UUVA 1E0YA 1JRPA 1W1MA 4PWBA 1AHZA 1VDVA 3S1EA 2QKNA 2W55A 3KJMA 2R2ZA 1FFVC 1ZR6A 2AXRA 3POPA 4O95A 3D2DA 2Y08A 3DQ0A 4UD8A 2VFTA 2W3SA 1DZNA 3NVZB 2NQWA 4PZFA 1AHVA 3NVVB 5I1WA 1WVFA 2Y3SA 4ML8A 4EC3A 1W1KA 2W54A 3SR6B 3TSHA 1FIQB 1SB3B 3NVYB 1FO4A 3FWAA 1F0XA 2Y4GA 3W8ZA 3AN1A 1AHUA 2GQTA 1FFUC 2BVFA 1W1SA 5FXDA 2RK5A 3EUB3 3GSYA 1HSKA 5FXFA 1W1OA 2PLIA 2VFUA 3TX1A 4HG0A 5G5GB 3B9JB 1VAOA 5FXEA 2GQUA 4PVHA 3FW7A 1MBTA 1DIIA 1W1RA 4PVJA 3W8XA 2Y3RA
chains in the Genus database with same CATH topology
2I0KA 3AMZA 5D79A 1WVEA 1W1LA 4BC7A 3PQBA 3S1FA 2E3TA 3LLBA 5HHZA 3I99A 5K8EA 2VFVA 5FXPA 2VAOA 5L6FA 4BC9A 4OALA 5I1VA 3JS8A 1QLUA 2UUUA 2VFRA 3FW8A 3D2JA 1ZXIC 2Q4WA 3BW7A 3DEDA 3NRZB 1DIQA 3VTEA 3RJ8A 3TSJA 1WYGA 4XLOA 2O3GA 5ADZA 5G5HB 2VFSA 2W3RA 2YVSA 1MBBA 1N61C 3S1DA 4BBYA 1RM6B 2IPIA 3FW9A 4DNSA 1V97A 1I19A 1T3QC 2P4PA 2MBRA 1N5WC 2EXRA 3HRDC 5AE1A 2QPMA 4PYTA 4PWCA 2WDWA 1W1JA 3AM9A 1N62C 2BVHA 4PVKA 5AWVA 3RJAA 4BCAA 1QLTA 2P3HA 2R8DA 1UXYA 1E8GA 1W1QA 2OAIA 4JB1A 1JROA 1N5XA 3D2HA 1N63C 3ETRB 3NVWB 4MLAA 4PVEA 5HMRA 3LAEA 2Q85A 3C0PA 3PM9A 2BVGA 1N60C 3W8WA 1E8FA 4JAYA 3S1CA 1E8HA 5AE3A 4ZOHB 3NS1B 2PLSA 5HQXA 5AE2A 2P13A 5L6GA 3HSUA 2UUVA 1E0YA 1JRPA 1W1MA 4PWBA 1AHZA 1VDVA 3S1EA 2QKNA 2W55A 3KJMA 2R2ZA 1FFVC 1ZR6A 2AXRA 3POPA 4O95A 3D2DA 2Y08A 3DQ0A 4UD8A 2VFTA 2W3SA 1DZNA 3NVZB 2NQWA 4PZFA 1AHVA 3NVVB 5I1WA 1WVFA 2Y3SA 4ML8A 4EC3A 1W1KA 2W54A 3SR6B 3TSHA 1FIQB 1SB3B 3NVYB 1FO4A 3FWAA 1F0XA 2Y4GA 3W8ZA 3AN1A 1AHUA 2GQTA 1FFUC 2BVFA 1W1SA 5FXDA 2RK5A 3EUB3 3GSYA 1HSKA 5FXFA 1W1OA 2PLIA 2VFUA 3TX1A 4HG0A 5G5GB 3B9JB 1VAOA 5FXEA 2GQUA 4PVHA 3FW7A 1MBTA 1DIIA 1W1RA 4PVJA 3W8XA 2Y3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0K A;  3AMZ A;  1WVE A;  1W1L A;  4BC7 A;  3S1F A;  2E3T A;  3LLB A;  5HHZ A;  3I99 A;  2VFV A;  5FXP A;  2VAO A;  4BC9 A;  4OAL A;  3JS8 A;  1QLU A;  2VFR A;  1ZXI C;  2Q4W A;  3BW7 A;  3DED A;  3NRZ B;  1DIQ A;  1WYG A;  4XLO A;  2O3G A;  5ADZ A;  5G5H B;  2VFS A;  2W3R A;  2YVS A;  1MBB A;  1N61 C;  3S1D A;  4BBY A;  1RM6 B;  1V97 A;  1I19 A;  1T3Q C;  2P4P A;  2MBR A;  1N5W C;  2EXR A;  3HRD C;  5AE1 A;  2QPM A;  4PYT A;  1W1J A;  3AM9 A;  1N62 C;  2BVH A;  4BCA A;  1QLT A;  2P3H A;  2R8D A;  1UXY A;  1E8G A;  1W1Q A;  2OAI A;  4JB1 A;  1JRO A;  1N5X A;  1N63 C;  3ETR B;  3NVW B;  4MLA A;  5HMR A;  3LAE A;  2Q85 A;  3C0P A;  3PM9 A;  2BVG A;  1N60 C;  3W8W A;  1E8F A;  4JAY A;  3S1C A;  1E8H A;  5AE3 A;  4ZOH B;  3NS1 B;  2PLS A;  5HQX A;  5AE2 A;  2P13 A;  1E0Y A;  1JRP A;  1W1M A;  1AHZ A;  1VDV A;  3S1E A;  2QKN A;  2W55 A;  3KJM A;  2R2Z A;  1FFV C;  1ZR6 A;  2AXR A;  4O95 A;  3DQ0 A;  2VFT A;  2W3S A;  1DZN A;  3NVZ B;  2NQW A;  1AHV A;  3NVV B;  1WVF A;  4ML8 A;  1W1K A;  2W54 A;  3SR6 B;  1FIQ B;  1SB3 B;  3NVY B;  1FO4 A;  1F0X A;  3W8Z A;  3AN1 A;  1AHU A;  2GQT A;  1FFU C;  2BVF A;  1W1S A;  5FXD A;  2RK5 A;  3EUB 3;  1HSK A;  5FXF A;  1W1O A;  2PLI A;  2VFU A;  3TX1 A;  4HG0 A;  5G5G B;  3B9J B;  1VAO A;  5FXE A;  2GQU A;  1MBT A;  1DII A;  1W1R A;  3W8X A; 
#chains in the Genus database with same CATH topology
 2I0K A;  3AMZ A;  5D79 A;  1WVE A;  1W1L A;  4BC7 A;  3PQB A;  3S1F A;  2E3T A;  3LLB A;  5HHZ A;  3I99 A;  5K8E A;  2VFV A;  5FXP A;  2VAO A;  5L6F A;  4BC9 A;  4OAL A;  5I1V A;  3JS8 A;  1QLU A;  2UUU A;  2VFR A;  3FW8 A;  3D2J A;  1ZXI C;  2Q4W A;  3BW7 A;  3DED A;  3NRZ B;  1DIQ A;  3VTE A;  3RJ8 A;  3TSJ A;  1WYG A;  4XLO A;  2O3G A;  5ADZ A;  5G5H B;  2VFS A;  2W3R A;  2YVS A;  1MBB A;  1N61 C;  3S1D A;  4BBY A;  1RM6 B;  2IPI A;  3FW9 A;  4DNS A;  1V97 A;  1I19 A;  1T3Q C;  2P4P A;  2MBR A;  1N5W C;  2EXR A;  3HRD C;  5AE1 A;  2QPM A;  4PYT A;  4PWC A;  2WDW A;  1W1J A;  3AM9 A;  1N62 C;  2BVH A;  4PVK A;  5AWV A;  3RJA A;  4BCA A;  1QLT A;  2P3H A;  2R8D A;  1UXY A;  1E8G A;  1W1Q A;  2OAI A;  4JB1 A;  1JRO A;  1N5X A;  3D2H A;  1N63 C;  3ETR B;  3NVW B;  4MLA A;  4PVE A;  5HMR A;  3LAE A;  2Q85 A;  3C0P A;  3PM9 A;  2BVG A;  1N60 C;  3W8W A;  1E8F A;  4JAY A;  3S1C A;  1E8H A;  5AE3 A;  4ZOH B;  3NS1 B;  2PLS A;  5HQX A;  5AE2 A;  2P13 A;  5L6G A;  3HSU A;  2UUV A;  1E0Y A;  1JRP A;  1W1M A;  4PWB A;  1AHZ A;  1VDV A;  3S1E A;  2QKN A;  2W55 A;  3KJM A;  2R2Z A;  1FFV C;  1ZR6 A;  2AXR A;  3POP A;  4O95 A;  3D2D A;  2Y08 A;  3DQ0 A;  4UD8 A;  2VFT A;  2W3S A;  1DZN A;  3NVZ B;  2NQW A;  4PZF A;  1AHV A;  3NVV B;  5I1W A;  1WVF A;  2Y3S A;  4ML8 A;  4EC3 A;  1W1K A;  2W54 A;  3SR6 B;  3TSH A;  1FIQ B;  1SB3 B;  3NVY B;  1FO4 A;  3FWA A;  1F0X A;  2Y4G A;  3W8Z A;  3AN1 A;  1AHU A;  2GQT A;  1FFU C;  2BVF A;  1W1S A;  5FXD A;  2RK5 A;  3EUB 3;  3GSY A;  1HSK A;  5FXF A;  1W1O A;  2PLI A;  2VFU A;  3TX1 A;  4HG0 A;  5G5G B;  3B9J B;  1VAO A;  5FXE A;  2GQU A;  4PVH A;  3FW7 A;  1MBT A;  1DII A;  1W1R A;  4PVJ A;  3W8X A;  2Y3R A; 
#chains in the Genus database with same CATH homology
 2I0K A;  3AMZ A;  5D79 A;  1WVE A;  1W1L A;  4BC7 A;  3PQB A;  3S1F A;  2E3T A;  3LLB A;  5HHZ A;  3I99 A;  5K8E A;  2VFV A;  5FXP A;  2VAO A;  5L6F A;  4BC9 A;  4OAL A;  5I1V A;  3JS8 A;  1QLU A;  2UUU A;  2VFR A;  3FW8 A;  3D2J A;  1ZXI C;  2Q4W A;  3BW7 A;  3DED A;  3NRZ B;  1DIQ A;  3VTE A;  3RJ8 A;  3TSJ A;  1WYG A;  4XLO A;  2O3G A;  5ADZ A;  5G5H B;  2VFS A;  2W3R A;  2YVS A;  1MBB A;  1N61 C;  3S1D A;  4BBY A;  1RM6 B;  2IPI A;  3FW9 A;  4DNS A;  1V97 A;  1I19 A;  1T3Q C;  2P4P A;  2MBR A;  1N5W C;  2EXR A;  3HRD C;  5AE1 A;  2QPM A;  4PYT A;  4PWC A;  2WDW A;  1W1J A;  3AM9 A;  1N62 C;  2BVH A;  4PVK A;  5AWV A;  3RJA A;  4BCA A;  1QLT A;  2P3H A;  2R8D A;  1UXY A;  1E8G A;  1W1Q A;  2OAI A;  4JB1 A;  1JRO A;  1N5X A;  3D2H A;  1N63 C;  3ETR B;  3NVW B;  4MLA A;  4PVE A;  5HMR A;  3LAE A;  2Q85 A;  3C0P A;  3PM9 A;  2BVG A;  1N60 C;  3W8W A;  1E8F A;  4JAY A;  3S1C A;  1E8H A;  5AE3 A;  4ZOH B;  3NS1 B;  2PLS A;  5HQX A;  5AE2 A;  2P13 A;  5L6G A;  3HSU A;  2UUV A;  1E0Y A;  1JRP A;  1W1M A;  4PWB A;  1AHZ A;  1VDV A;  3S1E A;  2QKN A;  2W55 A;  3KJM A;  2R2Z A;  1FFV C;  1ZR6 A;  2AXR A;  3POP A;  4O95 A;  3D2D A;  2Y08 A;  3DQ0 A;  4UD8 A;  2VFT A;  2W3S A;  1DZN A;  3NVZ B;  2NQW A;  4PZF A;  1AHV A;  3NVV B;  5I1W A;  1WVF A;  2Y3S A;  4ML8 A;  4EC3 A;  1W1K A;  2W54 A;  3SR6 B;  3TSH A;  1FIQ B;  1SB3 B;  3NVY B;  1FO4 A;  3FWA A;  1F0X A;  2Y4G A;  3W8Z A;  3AN1 A;  1AHU A;  2GQT A;  1FFU C;  2BVF A;  1W1S A;  5FXD A;  2RK5 A;  3EUB 3;  3GSY A;  1HSK A;  5FXF A;  1W1O A;  2PLI A;  2VFU A;  3TX1 A;  4HG0 A;  5G5G B;  3B9J B;  1VAO A;  5FXE A;  2GQU A;  4PVH A;  3FW7 A;  1MBT A;  1DII A;  1W1R A;  4PVJ A;  3W8X A;  2Y3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...