2R8DA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin in complex with mg++ and mn++
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
78
Chain Sequence
b'ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
total genus 16
structure length 78
sequence length 85
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r8dA00
3PM9A 1FFVC 3ETRB 3NS1B 3JS8A 3S1DA 1N5XA 1N61C 4JB1A 3DQ0A 2E3TA 3AM9A 3W8WA 1E8FA 1QLTA 2VFSA 4XLOA 1ZXIC 2RK5A 3I99A 2QPMA 2P4PA 2YVSA 1DZNA 3S1EA 1E8HA 3LLBA 5G5HB 2BVGA 4BC9A 5G5GB 1E8GA 5AE3A 3NVZB 1N63C 3NVVB 3W8ZA 3HRDC 1AHUA 1WVFA 3NVWB 4BCAA 1DIIA 2EXRA 1MBTA 2AXRA 2W3SA 5FXFA 4BBYA 3SR6B 1W1OA 3NVYB 3S1FA 1F0XA 2O3GA 3BW7A 1MBBA 2VFUA 1HSKA 2Q85A 1N5WC 5FXEA 2Q4WA 2VFTA 1N62C 1WYGA 5FXDA 1N60C 5AE1A 1FFUC 4ML8A 4BC7A 2BVHA 2MBRA 5ADZA 2VFVA 2GQUA 2P13A 1W1QA 4O95A 1AHZA 3S1CA 1ZR6A 2W54A 4JAYA 3W8XA 2R8DA 5HHZA 1E0YA 2W55A 1T3QC 1V97A 1AHVA 1I19A 2BVFA 2NQWA 1RM6B 3LAEA 1QLUA 5AE2A 1UXYA 3AMZA 1W1KA 2R2ZA 5HQXA 1SB3B 3C0PA 4ZOHB 5FXPA 4OALA 5HMRA 4HG0A 3NRZB 1VAOA 3TX1A 1WVEA 1FO4A 2OAIA 3AN1A 1W1JA 3KJMA 2PLIA 2W3RA 2GQTA 1JRPA 1JROA 1W1RA 4PYTA 2I0KA 3EUB3 2P3HA 1W1LA 2VAOA 1W1MA 1FIQB 1VDVA 2PLSA 3DEDA 3B9JB 2QKNA 1DIQA 2VFRA 1W1SA 4MLAA
chains in the Genus database with same CATH superfamily
2Y3SA 3PM9A 1FFVC 3ETRB 3NS1B 3JS8A 3S1DA 3PQBA 1N5XA 4PZFA 1N61C 4JB1A 3DQ0A 2E3TA 3AM9A 3W8WA 1E8FA 1QLTA 3D2HA 2VFSA 4PVHA 4XLOA 1ZXIC 2RK5A 4PWCA 3I99A 5I1WA 3FWAA 2QPMA 2P4PA 5L6GA 2YVSA 5I1VA 1DZNA 3S1EA 4PVJA 1E8HA 3LLBA 2UUUA 5G5HB 2BVGA 4BC9A 5G5GB 3TSHA 1E8GA 5K8EA 5AE3A 3NVZB 1N63C 3NVVB 3W8ZA 3GSYA 3HRDC 1AHUA 1WVFA 3NVWB 4BCAA 1DIIA 2EXRA 4PWBA 3TSJA 1MBTA 2AXRA 2W3SA 5FXFA 4BBYA 2Y4GA 3SR6B 1W1OA 3NVYB 3S1FA 1F0XA 2O3GA 3BW7A 1MBBA 3FW7A 3FW9A 2VFUA 1HSKA 2Q85A 3VTEA 1N5WC 5FXEA 2Q4WA 2VFTA 1N62C 1WYGA 5FXDA 1N60C 5AE1A 3RJ8A 1FFUC 4ML8A 4BC7A 2BVHA 2MBRA 5ADZA 2VFVA 4UD8A 5AWVA 2GQUA 2P13A 1W1QA 4O95A 1AHZA 2WDWA 1ZR6A 3S1CA 2W54A 4JAYA 3W8XA 2R8DA 4EC3A 5HHZA 1E0YA 2W55A 1T3QC 1V97A 2UUVA 2Y08A 1AHVA 1I19A 2BVFA 2NQWA 3HSUA 1RM6B 3LAEA 1QLUA 2IPIA 5AE2A 1UXYA 2Y3RA 3AMZA 1W1KA 2R2ZA 5HQXA 4DNSA 1SB3B 3C0PA 3D2JA 4ZOHB 5FXPA 4OALA 5HMRA 4HG0A 3NRZB 1VAOA 5D79A 3TX1A 1WVEA 3FW8A 3RJAA 1FO4A 2OAIA 3AN1A 4PVEA 1W1JA 3KJMA 2PLIA 3D2DA 2W3RA 2GQTA 1JRPA 1JROA 1W1RA 4PYTA 2I0KA 3EUB3 2P3HA 1W1LA 5L6FA 2VAOA 3POPA 4PVKA 1W1MA 1FIQB 1VDVA 2PLSA 3DEDA 3B9JB 2QKNA 1DIQA 2VFRA 1W1SA 4MLAA
chains in the Genus database with same CATH topology
2Y3SA 3PM9A 1FFVC 3ETRB 3NS1B 3JS8A 3S1DA 3PQBA 1N5XA 4PZFA 1N61C 4JB1A 3DQ0A 2E3TA 3AM9A 3W8WA 1E8FA 1QLTA 3D2HA 2VFSA 4PVHA 4XLOA 1ZXIC 2RK5A 4PWCA 3I99A 5I1WA 3FWAA 2QPMA 2P4PA 5L6GA 2YVSA 5I1VA 1DZNA 3S1EA 4PVJA 1E8HA 3LLBA 2UUUA 5G5HB 2BVGA 4BC9A 5G5GB 3TSHA 1E8GA 5K8EA 5AE3A 3NVZB 1N63C 3NVVB 3W8ZA 3GSYA 3HRDC 1AHUA 1WVFA 3NVWB 4BCAA 1DIIA 2EXRA 4PWBA 3TSJA 1MBTA 2AXRA 2W3SA 5FXFA 4BBYA 2Y4GA 3SR6B 1W1OA 3NVYB 3S1FA 1F0XA 2O3GA 3BW7A 1MBBA 3FW7A 3FW9A 2VFUA 1HSKA 2Q85A 3VTEA 1N5WC 5FXEA 2Q4WA 2VFTA 1N62C 1WYGA 5FXDA 1N60C 5AE1A 3RJ8A 1FFUC 4ML8A 4BC7A 2BVHA 2MBRA 5ADZA 2VFVA 4UD8A 5AWVA 2GQUA 2P13A 1W1QA 4O95A 1AHZA 2WDWA 1ZR6A 3S1CA 2W54A 4JAYA 3W8XA 2R8DA 4EC3A 5HHZA 1E0YA 2W55A 1T3QC 1V97A 2UUVA 2Y08A 1AHVA 1I19A 2BVFA 2NQWA 3HSUA 1RM6B 3LAEA 1QLUA 2IPIA 5AE2A 1UXYA 2Y3RA 3AMZA 1W1KA 2R2ZA 5HQXA 4DNSA 1SB3B 3C0PA 3D2JA 4ZOHB 5FXPA 4OALA 5HMRA 4HG0A 3NRZB 1VAOA 5D79A 3TX1A 1WVEA 3FW8A 3RJAA 1FO4A 2OAIA 3AN1A 4PVEA 1W1JA 3KJMA 2PLIA 3D2DA 2W3RA 2GQTA 1JRPA 1JROA 1W1RA 4PYTA 2I0KA 3EUB3 2P3HA 1W1LA 5L6FA 2VAOA 3POPA 4PVKA 1W1MA 1FIQB 1VDVA 2PLSA 3DEDA 3B9JB 2QKNA 1DIQA 2VFRA 1W1SA 4MLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM9 A;  1FFV C;  3ETR B;  3NS1 B;  3JS8 A;  3S1D A;  1N5X A;  1N61 C;  4JB1 A;  3DQ0 A;  2E3T A;  3AM9 A;  3W8W A;  1E8F A;  1QLT A;  2VFS A;  4XLO A;  1ZXI C;  2RK5 A;  3I99 A;  2QPM A;  2P4P A;  2YVS A;  1DZN A;  3S1E A;  1E8H A;  3LLB A;  5G5H B;  2BVG A;  4BC9 A;  5G5G B;  1E8G A;  5AE3 A;  3NVZ B;  1N63 C;  3NVV B;  3W8Z A;  3HRD C;  1AHU A;  1WVF A;  3NVW B;  4BCA A;  1DII A;  2EXR A;  1MBT A;  2AXR A;  2W3S A;  5FXF A;  4BBY A;  3SR6 B;  1W1O A;  3NVY B;  3S1F A;  1F0X A;  2O3G A;  3BW7 A;  1MBB A;  2VFU A;  1HSK A;  2Q85 A;  1N5W C;  5FXE A;  2Q4W A;  2VFT A;  1N62 C;  1WYG A;  5FXD A;  1N60 C;  5AE1 A;  1FFU C;  4ML8 A;  4BC7 A;  2BVH A;  2MBR A;  5ADZ A;  2VFV A;  2GQU A;  2P13 A;  1W1Q A;  4O95 A;  1AHZ A;  3S1C A;  1ZR6 A;  2W54 A;  4JAY A;  3W8X A;  2R8D A;  5HHZ A;  1E0Y A;  2W55 A;  1T3Q C;  1V97 A;  1AHV A;  1I19 A;  2BVF A;  2NQW A;  1RM6 B;  3LAE A;  1QLU A;  5AE2 A;  1UXY A;  3AMZ A;  1W1K A;  2R2Z A;  5HQX A;  1SB3 B;  3C0P A;  4ZOH B;  5FXP A;  4OAL A;  5HMR A;  4HG0 A;  3NRZ B;  1VAO A;  3TX1 A;  1WVE A;  1FO4 A;  2OAI A;  3AN1 A;  1W1J A;  3KJM A;  2PLI A;  2W3R A;  2GQT A;  1JRP A;  1JRO A;  1W1R A;  4PYT A;  2I0K A;  3EUB 3;  2P3H A;  1W1L A;  2VAO A;  1W1M A;  1FIQ B;  1VDV A;  2PLS A;  3DED A;  3B9J B;  2QKN A;  1DIQ A;  2VFR A;  1W1S A;  4MLA A; 
#chains in the Genus database with same CATH topology
 2Y3S A;  3PM9 A;  1FFV C;  3ETR B;  3NS1 B;  3JS8 A;  3S1D A;  3PQB A;  1N5X A;  4PZF A;  1N61 C;  4JB1 A;  3DQ0 A;  2E3T A;  3AM9 A;  3W8W A;  1E8F A;  1QLT A;  3D2H A;  2VFS A;  4PVH A;  4XLO A;  1ZXI C;  2RK5 A;  4PWC A;  3I99 A;  5I1W A;  3FWA A;  2QPM A;  2P4P A;  5L6G A;  2YVS A;  5I1V A;  1DZN A;  3S1E A;  4PVJ A;  1E8H A;  3LLB A;  2UUU A;  5G5H B;  2BVG A;  4BC9 A;  5G5G B;  3TSH A;  1E8G A;  5K8E A;  5AE3 A;  3NVZ B;  1N63 C;  3NVV B;  3W8Z A;  3GSY A;  3HRD C;  1AHU A;  1WVF A;  3NVW B;  4BCA A;  1DII A;  2EXR A;  4PWB A;  3TSJ A;  1MBT A;  2AXR A;  2W3S A;  5FXF A;  4BBY A;  2Y4G A;  3SR6 B;  1W1O A;  3NVY B;  3S1F A;  1F0X A;  2O3G A;  3BW7 A;  1MBB A;  3FW7 A;  3FW9 A;  2VFU A;  1HSK A;  2Q85 A;  3VTE A;  1N5W C;  5FXE A;  2Q4W A;  2VFT A;  1N62 C;  1WYG A;  5FXD A;  1N60 C;  5AE1 A;  3RJ8 A;  1FFU C;  4ML8 A;  4BC7 A;  2BVH A;  2MBR A;  5ADZ A;  2VFV A;  4UD8 A;  5AWV A;  2GQU A;  2P13 A;  1W1Q A;  4O95 A;  1AHZ A;  2WDW A;  1ZR6 A;  3S1C A;  2W54 A;  4JAY A;  3W8X A;  2R8D A;  4EC3 A;  5HHZ A;  1E0Y A;  2W55 A;  1T3Q C;  1V97 A;  2UUV A;  2Y08 A;  1AHV A;  1I19 A;  2BVF A;  2NQW A;  3HSU A;  1RM6 B;  3LAE A;  1QLU A;  2IPI A;  5AE2 A;  1UXY A;  2Y3R A;  3AMZ A;  1W1K A;  2R2Z A;  5HQX A;  4DNS A;  1SB3 B;  3C0P A;  3D2J A;  4ZOH B;  5FXP A;  4OAL A;  5HMR A;  4HG0 A;  3NRZ B;  1VAO A;  5D79 A;  3TX1 A;  1WVE A;  3FW8 A;  3RJA A;  1FO4 A;  2OAI A;  3AN1 A;  4PVE A;  1W1J A;  3KJM A;  2PLI A;  3D2D A;  2W3R A;  2GQT A;  1JRP A;  1JRO A;  1W1R A;  4PYT A;  2I0K A;  3EUB 3;  2P3H A;  1W1L A;  5L6F A;  2VAO A;  3POP A;  4PVK A;  1W1M A;  1FIQ B;  1VDV A;  2PLS A;  3DED A;  3B9J B;  2QKN A;  1DIQ A;  2VFR A;  1W1S A;  4MLA A; 
#chains in the Genus database with same CATH homology
 2Y3S A;  3PM9 A;  1FFV C;  3ETR B;  3NS1 B;  3JS8 A;  3S1D A;  3PQB A;  1N5X A;  4PZF A;  1N61 C;  4JB1 A;  3DQ0 A;  2E3T A;  3AM9 A;  3W8W A;  1E8F A;  1QLT A;  3D2H A;  2VFS A;  4PVH A;  4XLO A;  1ZXI C;  2RK5 A;  4PWC A;  3I99 A;  5I1W A;  3FWA A;  2QPM A;  2P4P A;  5L6G A;  2YVS A;  5I1V A;  1DZN A;  3S1E A;  4PVJ A;  1E8H A;  3LLB A;  2UUU A;  5G5H B;  2BVG A;  4BC9 A;  5G5G B;  3TSH A;  1E8G A;  5K8E A;  5AE3 A;  3NVZ B;  1N63 C;  3NVV B;  3W8Z A;  3GSY A;  3HRD C;  1AHU A;  1WVF A;  3NVW B;  4BCA A;  1DII A;  2EXR A;  4PWB A;  3TSJ A;  1MBT A;  2AXR A;  2W3S A;  5FXF A;  4BBY A;  2Y4G A;  3SR6 B;  1W1O A;  3NVY B;  3S1F A;  1F0X A;  2O3G A;  3BW7 A;  1MBB A;  3FW7 A;  3FW9 A;  2VFU A;  1HSK A;  2Q85 A;  3VTE A;  1N5W C;  5FXE A;  2Q4W A;  2VFT A;  1N62 C;  1WYG A;  5FXD A;  1N60 C;  5AE1 A;  3RJ8 A;  1FFU C;  4ML8 A;  4BC7 A;  2BVH A;  2MBR A;  5ADZ A;  2VFV A;  4UD8 A;  5AWV A;  2GQU A;  2P13 A;  1W1Q A;  4O95 A;  1AHZ A;  2WDW A;  1ZR6 A;  3S1C A;  2W54 A;  4JAY A;  3W8X A;  2R8D A;  4EC3 A;  5HHZ A;  1E0Y A;  2W55 A;  1T3Q C;  1V97 A;  2UUV A;  2Y08 A;  1AHV A;  1I19 A;  2BVF A;  2NQW A;  3HSU A;  1RM6 B;  3LAE A;  1QLU A;  2IPI A;  5AE2 A;  1UXY A;  2Y3R A;  3AMZ A;  1W1K A;  2R2Z A;  5HQX A;  4DNS A;  1SB3 B;  3C0P A;  3D2J A;  4ZOH B;  5FXP A;  4OAL A;  5HMR A;  4HG0 A;  3NRZ B;  1VAO A;  5D79 A;  3TX1 A;  1WVE A;  3FW8 A;  3RJA A;  1FO4 A;  2OAI A;  3AN1 A;  4PVE A;  1W1J A;  3KJM A;  2PLI A;  3D2D A;  2W3R A;  2GQT A;  1JRP A;  1JRO A;  1W1R A;  4PYT A;  2I0K A;  3EUB 3;  2P3H A;  1W1L A;  5L6F A;  2VAO A;  3POP A;  4PVK A;  1W1M A;  1FIQ B;  1VDV A;  2PLS A;  3DED A;  3B9J B;  2QKN A;  1DIQ A;  2VFR A;  1W1S A;  4MLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...