2R8DA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin in complex with mg++ and mn++
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
78
Chain Sequence
ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemolysin
publication title The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
total genus 16
structure length 78
sequence length 85
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r8dA00
4BC9A 1JRPA 3NVWB 2E3TA 3S1DA 3NS1B 3C0PA 5G5HB 2BVGA 1MBBA 1FIQB 3LLBA 1WYGA 3W8WA 3AMZA 1N62C 1WVEA 2VFUA 1FO4A 2P13A 2W55A 1AHVA 3B9JB 5HQXA 5AE3A 1ZXIC 3NRZB 1W1SA 2Q4WA 1QLTA 4PYTA 1W1MA 2QKNA 2R2ZA 3DEDA 1E8GA 1T3QC 1W1QA 1AHUA 2W3SA 1I19A 2GQUA 2W54A 4HG0A 1E0YA 2P4PA 3KJMA 3EUB3 3S1EA 2YVSA 2BVHA 1V97A 3NVZB 4BCAA 3LAEA 1W1OA 3DQ0A 1W1RA 5FXDA 2VFTA 1N60C 2Q85A 2QPMA 5AE1A 5ADZA 4XLOA 1WVFA 3PM9A 1AHZA 1MBTA 3I99A 1DZNA 1QLUA 2PLIA 5AE2A 2VFRA 2VFVA 5HMRA 2PLSA 1W1JA 3NVYB 3S1FA 3AM9A 3ETRB 1FFUC 1JROA 3HRDC 2RK5A 4JB1A 1HSKA 2I0KA 3W8XA 3AN1A 1N63C 1N5WC 2NQWA 2VAOA 2MBRA 3BW7A 3JS8A 1RM6B 1FFVC 1N5XA 2VFSA 2W3RA 4MLAA 2OAIA 4JAYA 2GQTA 5FXFA 4OALA 1DIIA 5HHZA 2BVFA 2O3GA 1DIQA 4ZOHB 5FXEA 1F0XA 3TX1A 2EXRA 3S1CA 1E8HA 1N61C 4BBYA 5FXPA 1ZR6A 2P3HA 4O95A 1E8FA 2R8DA 1W1KA 1VAOA 1SB3B 3W8ZA 4ML8A 5G5GB 3NVVB 1W1LA 4BC7A 1VDVA 1UXYA 3SR6B 2AXRA
chains in the Genus database with same CATH superfamily
4BC9A 1JRPA 3NVWB 3RJAA 2E3TA 3S1DA 2Y08A 3NS1B 3C0PA 5G5HB 2BVGA 1MBBA 4PVJA 1FIQB 3LLBA 1WYGA 3W8WA 3AMZA 1N62C 2Y4GA 1WVEA 2VFUA 5D79A 1FO4A 2P13A 2W55A 1AHVA 3B9JB 5HQXA 5AE3A 1ZXIC 3NRZB 1W1SA 2Q4WA 3POPA 1QLTA 4PYTA 4PVKA 2UUVA 1W1MA 2QKNA 2R2ZA 3DEDA 1E8GA 1T3QC 1W1QA 1AHUA 2W3SA 1I19A 2GQUA 2W54A 3D2JA 4HG0A 4PWBA 1E0YA 4UD8A 2P4PA 3KJMA 3EUB3 3S1EA 2YVSA 2BVHA 3VTEA 1V97A 3FW9A 3NVZB 4BCAA 2IPIA 4PZFA 3LAEA 1W1OA 3HSUA 3DQ0A 3PQBA 1W1RA 5FXDA 2VFTA 1N60C 2Q85A 2QPMA 5AE1A 5ADZA 4XLOA 1WVFA 3PM9A 1AHZA 1MBTA 2Y3SA 3I99A 1DZNA 1QLUA 2PLIA 5AE2A 2VFRA 5AWVA 2VFVA 5HMRA 2PLSA 1W1JA 4PVHA 3NVYB 3S1FA 3AM9A 3ETRB 1FFUC 1JROA 3HRDC 2RK5A 4JB1A 5K8EA 1HSKA 2I0KA 3W8XA 3AN1A 3RJ8A 3TSHA 1N63C 1N5WC 4DNSA 2NQWA 3D2HA 4PWCA 5I1WA 2VAOA 2WDWA 2MBRA 3FW7A 5L6FA 3TSJA 3BW7A 3JS8A 1RM6B 5I1VA 1FFVC 1N5XA 2VFSA 2W3RA 4PVEA 4MLAA 2OAIA 4EC3A 4JAYA 2GQTA 5FXFA 3FW8A 4OALA 2UUUA 1DIIA 5HHZA 2BVFA 2O3GA 3D2DA 1DIQA 3FWAA 4ZOHB 2Y3RA 5FXEA 1F0XA 3TX1A 2EXRA 3S1CA 3GSYA 1E8HA 1N61C 4BBYA 5FXPA 1ZR6A 2P3HA 4O95A 1E8FA 2R8DA 1W1KA 1VAOA 1SB3B 3W8ZA 4ML8A 5G5GB 3NVVB 1W1LA 4BC7A 1VDVA 1UXYA 3SR6B 5L6GA 2AXRA
chains in the Genus database with same CATH topology
4BC9A 1JRPA 3NVWB 3RJAA 2E3TA 3S1DA 2Y08A 3NS1B 3C0PA 5G5HB 2BVGA 1MBBA 4PVJA 1FIQB 3LLBA 1WYGA 3W8WA 3AMZA 1N62C 2Y4GA 1WVEA 2VFUA 5D79A 1FO4A 2P13A 2W55A 1AHVA 3B9JB 5HQXA 5AE3A 1ZXIC 3NRZB 1W1SA 2Q4WA 3POPA 1QLTA 4PYTA 4PVKA 2UUVA 1W1MA 2QKNA 2R2ZA 3DEDA 1E8GA 1T3QC 1W1QA 1AHUA 2W3SA 1I19A 2GQUA 2W54A 3D2JA 4HG0A 4PWBA 1E0YA 4UD8A 2P4PA 3KJMA 3EUB3 3S1EA 2YVSA 2BVHA 3VTEA 1V97A 3FW9A 3NVZB 4BCAA 2IPIA 4PZFA 3LAEA 1W1OA 3HSUA 3DQ0A 3PQBA 1W1RA 5FXDA 2VFTA 1N60C 2Q85A 2QPMA 5AE1A 5ADZA 4XLOA 1WVFA 3PM9A 1AHZA 1MBTA 2Y3SA 3I99A 1DZNA 1QLUA 2PLIA 5AE2A 2VFRA 5AWVA 2VFVA 5HMRA 2PLSA 1W1JA 4PVHA 3NVYB 3S1FA 3AM9A 3ETRB 1FFUC 1JROA 3HRDC 2RK5A 4JB1A 5K8EA 1HSKA 2I0KA 3W8XA 3AN1A 3RJ8A 3TSHA 1N63C 1N5WC 4DNSA 2NQWA 3D2HA 4PWCA 5I1WA 2VAOA 2WDWA 2MBRA 3FW7A 5L6FA 3TSJA 3BW7A 3JS8A 1RM6B 5I1VA 1FFVC 1N5XA 2VFSA 2W3RA 4PVEA 4MLAA 2OAIA 4EC3A 4JAYA 2GQTA 5FXFA 3FW8A 4OALA 2UUUA 1DIIA 5HHZA 2BVFA 2O3GA 3D2DA 1DIQA 3FWAA 4ZOHB 2Y3RA 5FXEA 1F0XA 3TX1A 2EXRA 3S1CA 3GSYA 1E8HA 1N61C 4BBYA 5FXPA 1ZR6A 2P3HA 4O95A 1E8FA 2R8DA 1W1KA 1VAOA 1SB3B 3W8ZA 4ML8A 5G5GB 3NVVB 1W1LA 4BC7A 1VDVA 1UXYA 3SR6B 5L6GA 2AXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BC9 A;  1JRP A;  3NVW B;  2E3T A;  3S1D A;  3NS1 B;  3C0P A;  5G5H B;  2BVG A;  1MBB A;  1FIQ B;  3LLB A;  1WYG A;  3W8W A;  3AMZ A;  1N62 C;  1WVE A;  2VFU A;  1FO4 A;  2P13 A;  2W55 A;  1AHV A;  3B9J B;  5HQX A;  5AE3 A;  1ZXI C;  3NRZ B;  1W1S A;  2Q4W A;  1QLT A;  4PYT A;  1W1M A;  2QKN A;  2R2Z A;  3DED A;  1E8G A;  1T3Q C;  1W1Q A;  1AHU A;  2W3S A;  1I19 A;  2GQU A;  2W54 A;  4HG0 A;  1E0Y A;  2P4P A;  3KJM A;  3EUB 3;  3S1E A;  2YVS A;  2BVH A;  1V97 A;  3NVZ B;  4BCA A;  3LAE A;  1W1O A;  3DQ0 A;  1W1R A;  5FXD A;  2VFT A;  1N60 C;  2Q85 A;  2QPM A;  5AE1 A;  5ADZ A;  4XLO A;  1WVF A;  3PM9 A;  1AHZ A;  1MBT A;  3I99 A;  1DZN A;  1QLU A;  2PLI A;  5AE2 A;  2VFR A;  2VFV A;  5HMR A;  2PLS A;  1W1J A;  3NVY B;  3S1F A;  3AM9 A;  3ETR B;  1FFU C;  1JRO A;  3HRD C;  2RK5 A;  4JB1 A;  1HSK A;  2I0K A;  3W8X A;  3AN1 A;  1N63 C;  1N5W C;  2NQW A;  2VAO A;  2MBR A;  3BW7 A;  3JS8 A;  1RM6 B;  1FFV C;  1N5X A;  2VFS A;  2W3R A;  4MLA A;  2OAI A;  4JAY A;  2GQT A;  5FXF A;  4OAL A;  1DII A;  5HHZ A;  2BVF A;  2O3G A;  1DIQ A;  4ZOH B;  5FXE A;  1F0X A;  3TX1 A;  2EXR A;  3S1C A;  1E8H A;  1N61 C;  4BBY A;  5FXP A;  1ZR6 A;  2P3H A;  4O95 A;  1E8F A;  2R8D A;  1W1K A;  1VAO A;  1SB3 B;  3W8Z A;  4ML8 A;  5G5G B;  3NVV B;  1W1L A;  4BC7 A;  1VDV A;  1UXY A;  3SR6 B;  2AXR A; 
#chains in the Genus database with same CATH topology
 4BC9 A;  1JRP A;  3NVW B;  3RJA A;  2E3T A;  3S1D A;  2Y08 A;  3NS1 B;  3C0P A;  5G5H B;  2BVG A;  1MBB A;  4PVJ A;  1FIQ B;  3LLB A;  1WYG A;  3W8W A;  3AMZ A;  1N62 C;  2Y4G A;  1WVE A;  2VFU A;  5D79 A;  1FO4 A;  2P13 A;  2W55 A;  1AHV A;  3B9J B;  5HQX A;  5AE3 A;  1ZXI C;  3NRZ B;  1W1S A;  2Q4W A;  3POP A;  1QLT A;  4PYT A;  4PVK A;  2UUV A;  1W1M A;  2QKN A;  2R2Z A;  3DED A;  1E8G A;  1T3Q C;  1W1Q A;  1AHU A;  2W3S A;  1I19 A;  2GQU A;  2W54 A;  3D2J A;  4HG0 A;  4PWB A;  1E0Y A;  4UD8 A;  2P4P A;  3KJM A;  3EUB 3;  3S1E A;  2YVS A;  2BVH A;  3VTE A;  1V97 A;  3FW9 A;  3NVZ B;  4BCA A;  2IPI A;  4PZF A;  3LAE A;  1W1O A;  3HSU A;  3DQ0 A;  3PQB A;  1W1R A;  5FXD A;  2VFT A;  1N60 C;  2Q85 A;  2QPM A;  5AE1 A;  5ADZ A;  4XLO A;  1WVF A;  3PM9 A;  1AHZ A;  1MBT A;  2Y3S A;  3I99 A;  1DZN A;  1QLU A;  2PLI A;  5AE2 A;  2VFR A;  5AWV A;  2VFV A;  5HMR A;  2PLS A;  1W1J A;  4PVH A;  3NVY B;  3S1F A;  3AM9 A;  3ETR B;  1FFU C;  1JRO A;  3HRD C;  2RK5 A;  4JB1 A;  5K8E A;  1HSK A;  2I0K A;  3W8X A;  3AN1 A;  3RJ8 A;  3TSH A;  1N63 C;  1N5W C;  4DNS A;  2NQW A;  3D2H A;  4PWC A;  5I1W A;  2VAO A;  2WDW A;  2MBR A;  3FW7 A;  5L6F A;  3TSJ A;  3BW7 A;  3JS8 A;  1RM6 B;  5I1V A;  1FFV C;  1N5X A;  2VFS A;  2W3R A;  4PVE A;  4MLA A;  2OAI A;  4EC3 A;  4JAY A;  2GQT A;  5FXF A;  3FW8 A;  4OAL A;  2UUU A;  1DII A;  5HHZ A;  2BVF A;  2O3G A;  3D2D A;  1DIQ A;  3FWA A;  4ZOH B;  2Y3R A;  5FXE A;  1F0X A;  3TX1 A;  2EXR A;  3S1C A;  3GSY A;  1E8H A;  1N61 C;  4BBY A;  5FXP A;  1ZR6 A;  2P3H A;  4O95 A;  1E8F A;  2R8D A;  1W1K A;  1VAO A;  1SB3 B;  3W8Z A;  4ML8 A;  5G5G B;  3NVV B;  1W1L A;  4BC7 A;  1VDV A;  1UXY A;  3SR6 B;  5L6G A;  2AXR A; 
#chains in the Genus database with same CATH homology
 4BC9 A;  1JRP A;  3NVW B;  3RJA A;  2E3T A;  3S1D A;  2Y08 A;  3NS1 B;  3C0P A;  5G5H B;  2BVG A;  1MBB A;  4PVJ A;  1FIQ B;  3LLB A;  1WYG A;  3W8W A;  3AMZ A;  1N62 C;  2Y4G A;  1WVE A;  2VFU A;  5D79 A;  1FO4 A;  2P13 A;  2W55 A;  1AHV A;  3B9J B;  5HQX A;  5AE3 A;  1ZXI C;  3NRZ B;  1W1S A;  2Q4W A;  3POP A;  1QLT A;  4PYT A;  4PVK A;  2UUV A;  1W1M A;  2QKN A;  2R2Z A;  3DED A;  1E8G A;  1T3Q C;  1W1Q A;  1AHU A;  2W3S A;  1I19 A;  2GQU A;  2W54 A;  3D2J A;  4HG0 A;  4PWB A;  1E0Y A;  4UD8 A;  2P4P A;  3KJM A;  3EUB 3;  3S1E A;  2YVS A;  2BVH A;  3VTE A;  1V97 A;  3FW9 A;  3NVZ B;  4BCA A;  2IPI A;  4PZF A;  3LAE A;  1W1O A;  3HSU A;  3DQ0 A;  3PQB A;  1W1R A;  5FXD A;  2VFT A;  1N60 C;  2Q85 A;  2QPM A;  5AE1 A;  5ADZ A;  4XLO A;  1WVF A;  3PM9 A;  1AHZ A;  1MBT A;  2Y3S A;  3I99 A;  1DZN A;  1QLU A;  2PLI A;  5AE2 A;  2VFR A;  5AWV A;  2VFV A;  5HMR A;  2PLS A;  1W1J A;  4PVH A;  3NVY B;  3S1F A;  3AM9 A;  3ETR B;  1FFU C;  1JRO A;  3HRD C;  2RK5 A;  4JB1 A;  5K8E A;  1HSK A;  2I0K A;  3W8X A;  3AN1 A;  3RJ8 A;  3TSH A;  1N63 C;  1N5W C;  4DNS A;  2NQW A;  3D2H A;  4PWC A;  5I1W A;  2VAO A;  2WDW A;  2MBR A;  3FW7 A;  5L6F A;  3TSJ A;  3BW7 A;  3JS8 A;  1RM6 B;  5I1V A;  1FFV C;  1N5X A;  2VFS A;  2W3R A;  4PVE A;  4MLA A;  2OAI A;  4EC3 A;  4JAY A;  2GQT A;  5FXF A;  3FW8 A;  4OAL A;  2UUU A;  1DII A;  5HHZ A;  2BVF A;  2O3G A;  3D2D A;  1DIQ A;  3FWA A;  4ZOH B;  2Y3R A;  5FXE A;  1F0X A;  3TX1 A;  2EXR A;  3S1C A;  3GSY A;  1E8H A;  1N61 C;  4BBY A;  5FXP A;  1ZR6 A;  2P3H A;  4O95 A;  1E8F A;  2R8D A;  1W1K A;  1VAO A;  1SB3 B;  3W8Z A;  4ML8 A;  5G5G B;  3NVV B;  1W1L A;  4BC7 A;  1VDV A;  1UXY A;  3SR6 B;  5L6G A;  2AXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...