2R8DA

The structure of transporter associated domain corc_hlyc from a xylella fastidiosa temecula1 hemolysin in complex with mg++ and mn++
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
78
Chain Sequence
ALMVTREDGSFLIDGTLPIEELREVLGAENNYHTLAGMCISYFGRIPHVGEYFDWAGWRIEIVDLDGARIDLLLQRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of transporter associated domain CorC in complex with Mg++ and Mn++ from Xylella fastidiosa.
rcsb
source organism Xylella fastidiosa
molecule tags Toxin
molecule keywords Hemolysin
total genus 16
structure length 78
sequence length 85
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2r8dA00
4BBYA 1FO4A 1DIQA 3LLBA 5AE1A 3C0PA 2O3GA 1AHZA 2GQUA 1SB3B 1T3QC 5HMRA 4ZOHB 2P3HA 3NS1B 1W1QA 2YVSA 3S1FA 1JROA 1VDVA 5G5GB 2BVHA 2R2ZA 3KJMA 2I0KA 1QLTA 1VAOA 2MBRA 3I99A 1JRPA 1FIQB 1I19A 2PLSA 3W8XA 4JAYA 4XLOA 1W1JA 5AE2A 5FXDA 3S1DA 1RM6B 3W8ZA 4JB1A 2VFVA 1ZR6A 3JS8A 3PM9A 1W1LA 5HHZA 5G5HB 2VFRA 2E3TA 3ETRB 2Q4WA 4O95A 1UXYA 2VAOA 3W8WA 1FFVC 1N5XA 1HSKA 3S1EA 2RK5A 2GQTA 1MBBA 1WYGA 2P13A 2VFSA 2BVGA 4PYTA 5FXPA 5FXEA 2OAIA 3DQ0A 4OALA 3NVZB 2PLIA 1W1SA 3TX1A 5ADZA 2NQWA 1E8FA 3NVVB 1AHUA 2W55A 2QKNA 4BC7A 3BW7A 1MBTA 1N5WC 2AXRA 3SR6B 1N60C 4HG0A 2W3RA 3S1CA 2W3SA 3NVWB 1N61C 4MLAA 3DEDA 3EUB3 5AE3A 5FXFA 5HQXA 4BCAA 1E8GA 3AM9A 2QPMA 1FFUC 2R8DA 1W1RA 3AMZA 1W1OA 4ML8A 1DZNA 1W1KA 1DIIA 1AHVA 2Q85A 3B9JB 3NVYB 1WVEA 2P4PA 1E0YA 2VFTA 1V97A 1E8HA 3NRZB 3AN1A 1QLUA 4BC9A 2VFUA 1ZXIC 2BVFA 3LAEA 1F0XA 2EXRA 2W54A 1N62C 1N63C 1W1MA 1WVFA 3HRDC
chains in the Genus database with same CATH superfamily
4BBYA 1FO4A 1DIQA 3LLBA 5AE1A 3C0PA 2O3GA 1AHZA 2GQUA 2WDWA 1SB3B 5L6FA 1T3QC 2Y3SA 5HMRA 3FW7A 4ZOHB 2P3HA 3NS1B 1W1QA 2YVSA 3S1FA 1JROA 2Y08A 1VDVA 5G5GB 2BVHA 3FW9A 2R2ZA 3KJMA 2I0KA 1QLTA 1VAOA 2MBRA 4PVEA 3I99A 1JRPA 2Y3RA 1FIQB 1I19A 2PLSA 3W8XA 2Y4GA 2UUVA 4JAYA 4XLOA 1W1JA 4PWBA 5AE2A 5L6GA 5FXDA 3S1DA 1RM6B 3W8ZA 4JB1A 2VFVA 1ZR6A 3JS8A 3PM9A 4PVJA 1W1LA 5HHZA 5AWVA 3POPA 5G5HB 2VFRA 2E3TA 3PQBA 3ETRB 3TSHA 2IPIA 2Q4WA 4O95A 1UXYA 2VAOA 3W8WA 3FWAA 4DNSA 1FFVC 1N5XA 1HSKA 3S1EA 2RK5A 2GQTA 1MBBA 1WYGA 2P13A 2VFSA 4EC3A 2BVGA 3D2HA 4PYTA 5FXPA 5FXEA 2OAIA 3DQ0A 4OALA 3NVZB 2PLIA 3HSUA 1W1SA 3TX1A 5ADZA 2NQWA 2UUUA 1E8FA 3NVVB 1AHUA 2W55A 3FW8A 2QKNA 4BC7A 3BW7A 1MBTA 1N5WC 2AXRA 5D79A 1N60C 4HG0A 2W3RA 3SR6B 3S1CA 4PVKA 3RJ8A 2W3SA 3NVWB 3TSJA 1N61C 4MLAA 3DEDA 3EUB3 5AE3A 5FXFA 5HQXA 4BCAA 3D2JA 4PVHA 1E8GA 3AM9A 3RJAA 2QPMA 1FFUC 2R8DA 3D2DA 3VTEA 1W1RA 3AMZA 1W1OA 4ML8A 4UD8A 1DZNA 1W1KA 1DIIA 1AHVA 2Q85A 3B9JB 4PWCA 3NVYB 4PZFA 5I1WA 5K8EA 1WVEA 2P4PA 5I1VA 3GSYA 1E0YA 2VFTA 1V97A 1E8HA 3NRZB 3AN1A 1QLUA 4BC9A 2VFUA 1ZXIC 2BVFA 3LAEA 1F0XA 2EXRA 2W54A 1N62C 1N63C 1W1MA 1WVFA 3HRDC
chains in the Genus database with same CATH topology
4BBYA 1FO4A 1DIQA 3LLBA 5AE1A 3C0PA 2O3GA 1AHZA 2GQUA 2WDWA 1SB3B 5L6FA 1T3QC 2Y3SA 5HMRA 3FW7A 4ZOHB 2P3HA 3NS1B 1W1QA 2YVSA 3S1FA 1JROA 2Y08A 1VDVA 5G5GB 2BVHA 3FW9A 2R2ZA 3KJMA 2I0KA 1QLTA 1VAOA 2MBRA 4PVEA 3I99A 1JRPA 2Y3RA 1FIQB 1I19A 2PLSA 3W8XA 2Y4GA 2UUVA 4JAYA 4XLOA 1W1JA 4PWBA 5AE2A 5L6GA 5FXDA 3S1DA 1RM6B 3W8ZA 4JB1A 2VFVA 1ZR6A 3JS8A 3PM9A 4PVJA 1W1LA 5HHZA 5AWVA 3POPA 5G5HB 2VFRA 2E3TA 3PQBA 3ETRB 3TSHA 2IPIA 2Q4WA 4O95A 1UXYA 2VAOA 3W8WA 3FWAA 4DNSA 1FFVC 1N5XA 1HSKA 3S1EA 2RK5A 2GQTA 1MBBA 1WYGA 2P13A 2VFSA 4EC3A 2BVGA 3D2HA 4PYTA 5FXPA 5FXEA 2OAIA 3DQ0A 4OALA 3NVZB 2PLIA 3HSUA 1W1SA 3TX1A 5ADZA 2NQWA 2UUUA 1E8FA 3NVVB 1AHUA 2W55A 3FW8A 2QKNA 4BC7A 3BW7A 1MBTA 1N5WC 2AXRA 5D79A 1N60C 4HG0A 2W3RA 3SR6B 3S1CA 4PVKA 3RJ8A 2W3SA 3NVWB 3TSJA 1N61C 4MLAA 3DEDA 3EUB3 5AE3A 5FXFA 5HQXA 4BCAA 3D2JA 4PVHA 1E8GA 3AM9A 3RJAA 2QPMA 1FFUC 2R8DA 3D2DA 3VTEA 1W1RA 3AMZA 1W1OA 4ML8A 4UD8A 1DZNA 1W1KA 1DIIA 1AHVA 2Q85A 3B9JB 4PWCA 3NVYB 4PZFA 5I1WA 5K8EA 1WVEA 2P4PA 5I1VA 3GSYA 1E0YA 2VFTA 1V97A 1E8HA 3NRZB 3AN1A 1QLUA 4BC9A 2VFUA 1ZXIC 2BVFA 3LAEA 1F0XA 2EXRA 2W54A 1N62C 1N63C 1W1MA 1WVFA 3HRDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBY A;  1FO4 A;  1DIQ A;  3LLB A;  5AE1 A;  3C0P A;  2O3G A;  1AHZ A;  2GQU A;  1SB3 B;  1T3Q C;  5HMR A;  4ZOH B;  2P3H A;  3NS1 B;  1W1Q A;  2YVS A;  3S1F A;  1JRO A;  1VDV A;  5G5G B;  2BVH A;  2R2Z A;  3KJM A;  2I0K A;  1QLT A;  1VAO A;  2MBR A;  3I99 A;  1JRP A;  1FIQ B;  1I19 A;  2PLS A;  3W8X A;  4JAY A;  4XLO A;  1W1J A;  5AE2 A;  5FXD A;  3S1D A;  1RM6 B;  3W8Z A;  4JB1 A;  2VFV A;  1ZR6 A;  3JS8 A;  3PM9 A;  1W1L A;  5HHZ A;  5G5H B;  2VFR A;  2E3T A;  3ETR B;  2Q4W A;  4O95 A;  1UXY A;  2VAO A;  3W8W A;  1FFV C;  1N5X A;  1HSK A;  3S1E A;  2RK5 A;  2GQT A;  1MBB A;  1WYG A;  2P13 A;  2VFS A;  2BVG A;  4PYT A;  5FXP A;  5FXE A;  2OAI A;  3DQ0 A;  4OAL A;  3NVZ B;  2PLI A;  1W1S A;  3TX1 A;  5ADZ A;  2NQW A;  1E8F A;  3NVV B;  1AHU A;  2W55 A;  2QKN A;  4BC7 A;  3BW7 A;  1MBT A;  1N5W C;  2AXR A;  3SR6 B;  1N60 C;  4HG0 A;  2W3R A;  3S1C A;  2W3S A;  3NVW B;  1N61 C;  4MLA A;  3DED A;  3EUB 3;  5AE3 A;  5FXF A;  5HQX A;  4BCA A;  1E8G A;  3AM9 A;  2QPM A;  1FFU C;  2R8D A;  1W1R A;  3AMZ A;  1W1O A;  4ML8 A;  1DZN A;  1W1K A;  1DII A;  1AHV A;  2Q85 A;  3B9J B;  3NVY B;  1WVE A;  2P4P A;  1E0Y A;  2VFT A;  1V97 A;  1E8H A;  3NRZ B;  3AN1 A;  1QLU A;  4BC9 A;  2VFU A;  1ZXI C;  2BVF A;  3LAE A;  1F0X A;  2EXR A;  2W54 A;  1N62 C;  1N63 C;  1W1M A;  1WVF A;  3HRD C; 
#chains in the Genus database with same CATH topology
 4BBY A;  1FO4 A;  1DIQ A;  3LLB A;  5AE1 A;  3C0P A;  2O3G A;  1AHZ A;  2GQU A;  2WDW A;  1SB3 B;  5L6F A;  1T3Q C;  2Y3S A;  5HMR A;  3FW7 A;  4ZOH B;  2P3H A;  3NS1 B;  1W1Q A;  2YVS A;  3S1F A;  1JRO A;  2Y08 A;  1VDV A;  5G5G B;  2BVH A;  3FW9 A;  2R2Z A;  3KJM A;  2I0K A;  1QLT A;  1VAO A;  2MBR A;  4PVE A;  3I99 A;  1JRP A;  2Y3R A;  1FIQ B;  1I19 A;  2PLS A;  3W8X A;  2Y4G A;  2UUV A;  4JAY A;  4XLO A;  1W1J A;  4PWB A;  5AE2 A;  5L6G A;  5FXD A;  3S1D A;  1RM6 B;  3W8Z A;  4JB1 A;  2VFV A;  1ZR6 A;  3JS8 A;  3PM9 A;  4PVJ A;  1W1L A;  5HHZ A;  5AWV A;  3POP A;  5G5H B;  2VFR A;  2E3T A;  3PQB A;  3ETR B;  3TSH A;  2IPI A;  2Q4W A;  4O95 A;  1UXY A;  2VAO A;  3W8W A;  3FWA A;  4DNS A;  1FFV C;  1N5X A;  1HSK A;  3S1E A;  2RK5 A;  2GQT A;  1MBB A;  1WYG A;  2P13 A;  2VFS A;  4EC3 A;  2BVG A;  3D2H A;  4PYT A;  5FXP A;  5FXE A;  2OAI A;  3DQ0 A;  4OAL A;  3NVZ B;  2PLI A;  3HSU A;  1W1S A;  3TX1 A;  5ADZ A;  2NQW A;  2UUU A;  1E8F A;  3NVV B;  1AHU A;  2W55 A;  3FW8 A;  2QKN A;  4BC7 A;  3BW7 A;  1MBT A;  1N5W C;  2AXR A;  5D79 A;  1N60 C;  4HG0 A;  2W3R A;  3SR6 B;  3S1C A;  4PVK A;  3RJ8 A;  2W3S A;  3NVW B;  3TSJ A;  1N61 C;  4MLA A;  3DED A;  3EUB 3;  5AE3 A;  5FXF A;  5HQX A;  4BCA A;  3D2J A;  4PVH A;  1E8G A;  3AM9 A;  3RJA A;  2QPM A;  1FFU C;  2R8D A;  3D2D A;  3VTE A;  1W1R A;  3AMZ A;  1W1O A;  4ML8 A;  4UD8 A;  1DZN A;  1W1K A;  1DII A;  1AHV A;  2Q85 A;  3B9J B;  4PWC A;  3NVY B;  4PZF A;  5I1W A;  5K8E A;  1WVE A;  2P4P A;  5I1V A;  3GSY A;  1E0Y A;  2VFT A;  1V97 A;  1E8H A;  3NRZ B;  3AN1 A;  1QLU A;  4BC9 A;  2VFU A;  1ZXI C;  2BVF A;  3LAE A;  1F0X A;  2EXR A;  2W54 A;  1N62 C;  1N63 C;  1W1M A;  1WVF A;  3HRD C; 
#chains in the Genus database with same CATH homology
 4BBY A;  1FO4 A;  1DIQ A;  3LLB A;  5AE1 A;  3C0P A;  2O3G A;  1AHZ A;  2GQU A;  2WDW A;  1SB3 B;  5L6F A;  1T3Q C;  2Y3S A;  5HMR A;  3FW7 A;  4ZOH B;  2P3H A;  3NS1 B;  1W1Q A;  2YVS A;  3S1F A;  1JRO A;  2Y08 A;  1VDV A;  5G5G B;  2BVH A;  3FW9 A;  2R2Z A;  3KJM A;  2I0K A;  1QLT A;  1VAO A;  2MBR A;  4PVE A;  3I99 A;  1JRP A;  2Y3R A;  1FIQ B;  1I19 A;  2PLS A;  3W8X A;  2Y4G A;  2UUV A;  4JAY A;  4XLO A;  1W1J A;  4PWB A;  5AE2 A;  5L6G A;  5FXD A;  3S1D A;  1RM6 B;  3W8Z A;  4JB1 A;  2VFV A;  1ZR6 A;  3JS8 A;  3PM9 A;  4PVJ A;  1W1L A;  5HHZ A;  5AWV A;  3POP A;  5G5H B;  2VFR A;  2E3T A;  3PQB A;  3ETR B;  3TSH A;  2IPI A;  2Q4W A;  4O95 A;  1UXY A;  2VAO A;  3W8W A;  3FWA A;  4DNS A;  1FFV C;  1N5X A;  1HSK A;  3S1E A;  2RK5 A;  2GQT A;  1MBB A;  1WYG A;  2P13 A;  2VFS A;  4EC3 A;  2BVG A;  3D2H A;  4PYT A;  5FXP A;  5FXE A;  2OAI A;  3DQ0 A;  4OAL A;  3NVZ B;  2PLI A;  3HSU A;  1W1S A;  3TX1 A;  5ADZ A;  2NQW A;  2UUU A;  1E8F A;  3NVV B;  1AHU A;  2W55 A;  3FW8 A;  2QKN A;  4BC7 A;  3BW7 A;  1MBT A;  1N5W C;  2AXR A;  5D79 A;  1N60 C;  4HG0 A;  2W3R A;  3SR6 B;  3S1C A;  4PVK A;  3RJ8 A;  2W3S A;  3NVW B;  3TSJ A;  1N61 C;  4MLA A;  3DED A;  3EUB 3;  5AE3 A;  5FXF A;  5HQX A;  4BCA A;  3D2J A;  4PVH A;  1E8G A;  3AM9 A;  3RJA A;  2QPM A;  1FFU C;  2R8D A;  3D2D A;  3VTE A;  1W1R A;  3AMZ A;  1W1O A;  4ML8 A;  4UD8 A;  1DZN A;  1W1K A;  1DII A;  1AHV A;  2Q85 A;  3B9J B;  4PWC A;  3NVY B;  4PZF A;  5I1W A;  5K8E A;  1WVE A;  2P4P A;  5I1V A;  3GSY A;  1E0Y A;  2VFT A;  1V97 A;  1E8H A;  3NRZ B;  3AN1 A;  1QLU A;  4BC9 A;  2VFU A;  1ZXI C;  2BVF A;  3LAE A;  1F0X A;  2EXR A;  2W54 A;  1N62 C;  1N63 C;  1W1M A;  1WVF A;  3HRD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...