1MBTA

Oxidoreductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
340
Chain Sequence
b'HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title The structure of the substrate-free form of MurB, an essential enzyme for the synthesis of bacterial cell walls.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbtA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbtA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbtA01
3FW8A 2BVFA 2E3TA 4DNSA 3I99A 5G5HB 2AXRA 4XLOA 3DEDA 5FXDA 1W1MA 1W1OA 3D2JA 4PVEA 1JROA 4UD8A 4PVJA 4PVHA 3D2DA 1N5WC 3ETRB 2P13A 5FXPA 1WYGA 2BVGA 2Q85A 4JAYA 2W3RA 4BCAA 2PLSA 3LAEA 1N63C 1V97A 2MBRA 4PYTA 1FFVC 4OALA 4ML8A 3W8WA 5AE2A 3NVYB 5ADZA 1AHZA 5AE3A 4BBYA 1F0XA 1W1JA 4O95A 3BW7A 4HG0A 3B9JB 3TSHA 3NS1B 1ZR6A 5FXEA 3S1FA 3VTEA 2I0KA 2VFSA 4JB1A 2PLIA 3AN1A 3S1CA 5HQXA 2P3HA 1I19A 2VFVA 4MLAA 1W1SA 3D2HA 3NRZB 2VFRA 3S1DA 1DZNA 3C0PA 3GSYA 1DIIA 3EUB3 1WVFA 1W1QA 1QLUA 1WVEA 1VDVA 4EC3A 4ZOHB 1AHUA 1QLTA 1E0YA 1N62C 1E8GA 1HSKA 3JS8A 3NVWB 2W54A 3SR6B 2GQTA 2RK5A 1N61C 1RM6B 1SB3B 1FFUC 1ZXIC 3DQ0A 1VAOA 5D79A 2NQWA 1T3QC 3TSJA 3FW7A 2VFTA 4PWCA 1N5XA 2GQUA 3W8XA 1AHVA 1E8FA 4PWBA 1MBBA 4PVKA 5FXFA 2OAIA 3TX1A 2VFUA 1FO4A 2O3GA 1DIQA 1UXYA 1FIQB 2YVSA 4BC7A 3W8ZA 2W3SA 3KJMA 1W1LA 2Q4WA 5HMRA 2R8DA 2BVHA 3NVZB 3HRDC 1E8HA 3AM9A 3LLBA 2P4PA 2EXRA 3FW9A 3PM9A 1MBTA 3FWAA 2VAOA 1JRPA 1W1RA 2QPMA 3AMZA 3NVVB 5HHZA 1N60C 3S1EA 5AE1A 5G5GB 4BC9A 4PZFA 1W1KA 2R2ZA 2W55A 2QKNA
chains in the Genus database with same CATH superfamily
3FW8A 2BVFA 2E3TA 4DNSA 3I99A 5G5HB 2AXRA 4XLOA 3DEDA 5FXDA 1W1MA 3POPA 1W1OA 3D2JA 4PVEA 1JROA 4UD8A 4PVJA 2Y3RA 4PVHA 3D2DA 1N5WC 3ETRB 2P13A 5FXPA 2Y08A 1WYGA 2BVGA 2Q85A 4JAYA 3RJ8A 2W3RA 4BCAA 2PLSA 3LAEA 1N63C 1V97A 2MBRA 4PYTA 1FFVC 4OALA 4ML8A 3W8WA 3EJEB 5AE2A 3NVYB 5ADZA 1AHZA 2UUUA 5AE3A 4BBYA 2Y3SA 1F0XA 1W1JA 4O95A 3BW7A 4HG0A 3B9JB 3TSHA 3NS1B 1ZR6A 5FXEA 3S1FA 3VTEA 2I0KA 2VFSA 4JB1A 2PLIA 3AN1A 3S1CA 5HQXA 3PQBA 2P3HA 1I19A 2VFVA 2IPIA 4MLAA 1W1SA 3D2HA 3NRZB 2VFRA 3S1DA 5I1VA 1DZNA 3C0PA 3EJBB 3GSYA 2UUVA 1DIIA 5AWVA 3EUB3 1WVFA 1W1QA 1QLUA 1WVEA 1VDVA 4EC3A 4ZOHB 1AHUA 1QLTA 1E0YA 1N62C 1E8GA 1HSKA 3JS8A 3NVWB 2W54A 3SR6B 2GQTA 2RK5A 1N61C 1RM6B 1SB3B 3RJAA 1FFUC 1ZXIC 3DQ0A 5K8EA 1VAOA 5D79A 2NQWA 1T3QC 3TSJA 3FW7A 2VFTA 4PWCA 1N5XA 2GQUA 3W8XA 1AHVA 5L6GA 3HSUA 1E8FA 4PWBA 1MBBA 4PVKA 5FXFA 2OAIA 3TX1A 2VFUA 1FO4A 2O3GA 1DIQA 1UXYA 1FIQB 2YVSA 4BC7A 3W8ZA 2W3SA 3KJMA 1W1LA 2Q4WA 5HMRA 2R8DA 2BVHA 3NVZB 3HRDC 1E8HA 3AM9A 5I1WA 3LLBA 3EJDB 2P4PA 2EXRA 3FW9A 3PM9A 1MBTA 3FWAA 2VAOA 1JRPA 2Y4GA 1W1RA 2QPMA 3AMZA 3NVVB 5HHZA 5L6FA 1N60C 3S1EA 5AE1A 5G5GB 2WDWA 4BC9A 4PZFA 1W1KA 2R2ZA 2W55A 2QKNA
chains in the Genus database with same CATH topology
3FW8A 2BVFA 2E3TA 4DNSA 3I99A 5G5HB 2AXRA 4XLOA 3DEDA 5FXDA 1W1MA 3POPA 1W1OA 3D2JA 4PVEA 1JROA 4UD8A 4PVJA 2Y3RA 4PVHA 3D2DA 1N5WC 3ETRB 2P13A 5FXPA 2Y08A 1WYGA 2BVGA 2Q85A 4JAYA 3RJ8A 2W3RA 4BCAA 2PLSA 3LAEA 1N63C 1V97A 2MBRA 4PYTA 1FFVC 4OALA 4ML8A 3W8WA 5AE2A 3NVYB 5ADZA 1AHZA 2UUUA 5AE3A 4BBYA 2Y3SA 1F0XA 1W1JA 4O95A 3BW7A 4HG0A 3B9JB 3TSHA 3NS1B 1ZR6A 5FXEA 3S1FA 3VTEA 2I0KA 2VFSA 4JB1A 2PLIA 3AN1A 3S1CA 5HQXA 3PQBA 2P3HA 1I19A 2VFVA 2IPIA 4MLAA 1W1SA 3D2HA 3NRZB 2VFRA 3S1DA 5I1VA 1DZNA 3C0PA 2UUVA 3GSYA 1DIIA 5AWVA 3EUB3 1WVFA 1W1QA 1QLUA 1WVEA 1VDVA 4EC3A 4ZOHB 1AHUA 1QLTA 1E0YA 1N62C 1E8GA 1HSKA 3JS8A 3NVWB 2W54A 3SR6B 2GQTA 2RK5A 1N61C 1RM6B 1SB3B 3RJAA 1FFUC 1ZXIC 3DQ0A 5K8EA 1VAOA 5D79A 2NQWA 1T3QC 3TSJA 3FW7A 2VFTA 4PWCA 1N5XA 2GQUA 3W8XA 1AHVA 5L6GA 3HSUA 1E8FA 4PWBA 1MBBA 4PVKA 5FXFA 2OAIA 3TX1A 2VFUA 1FO4A 2O3GA 1DIQA 1UXYA 1FIQB 2YVSA 4BC7A 3W8ZA 2W3SA 3KJMA 1W1LA 2Q4WA 5HMRA 2R8DA 2BVHA 3NVZB 3HRDC 1E8HA 3AM9A 5I1WA 3LLBA 2P4PA 2EXRA 3FW9A 3PM9A 1MBTA 3FWAA 2VAOA 1JRPA 2Y4GA 1W1RA 2QPMA 3AMZA 3NVVB 5HHZA 5L6FA 1N60C 3S1EA 5AE1A 5G5GB 2WDWA 4BC9A 4PZFA 1W1KA 2R2ZA 2W55A 2QKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW8 A;  2BVF A;  2E3T A;  4DNS A;  3I99 A;  5G5H B;  2AXR A;  4XLO A;  3DED A;  5FXD A;  1W1M A;  1W1O A;  3D2J A;  4PVE A;  1JRO A;  4UD8 A;  4PVJ A;  4PVH A;  3D2D A;  1N5W C;  3ETR B;  2P13 A;  5FXP A;  1WYG A;  2BVG A;  2Q85 A;  4JAY A;  2W3R A;  4BCA A;  2PLS A;  3LAE A;  1N63 C;  1V97 A;  2MBR A;  4PYT A;  1FFV C;  4OAL A;  4ML8 A;  3W8W A;  5AE2 A;  3NVY B;  5ADZ A;  1AHZ A;  5AE3 A;  4BBY A;  1F0X A;  1W1J A;  4O95 A;  3BW7 A;  4HG0 A;  3B9J B;  3TSH A;  3NS1 B;  1ZR6 A;  5FXE A;  3S1F A;  3VTE A;  2I0K A;  2VFS A;  4JB1 A;  2PLI A;  3AN1 A;  3S1C A;  5HQX A;  2P3H A;  1I19 A;  2VFV A;  4MLA A;  1W1S A;  3D2H A;  3NRZ B;  2VFR A;  3S1D A;  1DZN A;  3C0P A;  3GSY A;  1DII A;  3EUB 3;  1WVF A;  1W1Q A;  1QLU A;  1WVE A;  1VDV A;  4EC3 A;  4ZOH B;  1AHU A;  1QLT A;  1E0Y A;  1N62 C;  1E8G A;  1HSK A;  3JS8 A;  3NVW B;  2W54 A;  3SR6 B;  2GQT A;  2RK5 A;  1N61 C;  1RM6 B;  1SB3 B;  1FFU C;  1ZXI C;  3DQ0 A;  1VAO A;  5D79 A;  2NQW A;  1T3Q C;  3TSJ A;  3FW7 A;  2VFT A;  4PWC A;  1N5X A;  2GQU A;  3W8X A;  1AHV A;  1E8F A;  4PWB A;  1MBB A;  4PVK A;  5FXF A;  2OAI A;  3TX1 A;  2VFU A;  1FO4 A;  2O3G A;  1DIQ A;  1UXY A;  1FIQ B;  2YVS A;  4BC7 A;  3W8Z A;  2W3S A;  3KJM A;  1W1L A;  2Q4W A;  5HMR A;  2R8D A;  2BVH A;  3NVZ B;  3HRD C;  1E8H A;  3AM9 A;  3LLB A;  2P4P A;  2EXR A;  3FW9 A;  3PM9 A;  1MBT A;  3FWA A;  2VAO A;  1JRP A;  1W1R A;  2QPM A;  3AMZ A;  3NVV B;  5HHZ A;  1N60 C;  3S1E A;  5AE1 A;  5G5G B;  4BC9 A;  4PZF A;  1W1K A;  2R2Z A;  2W55 A;  2QKN A; 
#chains in the Genus database with same CATH topology
 3FW8 A;  2BVF A;  2E3T A;  4DNS A;  3I99 A;  5G5H B;  2AXR A;  4XLO A;  3DED A;  5FXD A;  1W1M A;  3POP A;  1W1O A;  3D2J A;  4PVE A;  1JRO A;  4UD8 A;  4PVJ A;  2Y3R A;  4PVH A;  3D2D A;  1N5W C;  3ETR B;  2P13 A;  5FXP A;  2Y08 A;  1WYG A;  2BVG A;  2Q85 A;  4JAY A;  3RJ8 A;  2W3R A;  4BCA A;  2PLS A;  3LAE A;  1N63 C;  1V97 A;  2MBR A;  4PYT A;  1FFV C;  4OAL A;  4ML8 A;  3W8W A;  3EJE B;  5AE2 A;  3NVY B;  5ADZ A;  1AHZ A;  2UUU A;  5AE3 A;  4BBY A;  2Y3S A;  1F0X A;  1W1J A;  4O95 A;  3BW7 A;  4HG0 A;  3B9J B;  3TSH A;  3NS1 B;  1ZR6 A;  5FXE A;  3S1F A;  3VTE A;  2I0K A;  2VFS A;  4JB1 A;  2PLI A;  3AN1 A;  3S1C A;  5HQX A;  3PQB A;  2P3H A;  1I19 A;  2VFV A;  2IPI A;  4MLA A;  1W1S A;  3D2H A;  3NRZ B;  2VFR A;  3S1D A;  5I1V A;  1DZN A;  3C0P A;  3EJB B;  3GSY A;  2UUV A;  1DII A;  5AWV A;  3EUB 3;  1WVF A;  1W1Q A;  1QLU A;  1WVE A;  1VDV A;  4EC3 A;  4ZOH B;  1AHU A;  1QLT A;  1E0Y A;  1N62 C;  1E8G A;  1HSK A;  3JS8 A;  3NVW B;  2W54 A;  3SR6 B;  2GQT A;  2RK5 A;  1N61 C;  1RM6 B;  1SB3 B;  3RJA A;  1FFU C;  1ZXI C;  3DQ0 A;  5K8E A;  1VAO A;  5D79 A;  2NQW A;  1T3Q C;  3TSJ A;  3FW7 A;  2VFT A;  4PWC A;  1N5X A;  2GQU A;  3W8X A;  1AHV A;  5L6G A;  3HSU A;  1E8F A;  4PWB A;  1MBB A;  4PVK A;  5FXF A;  2OAI A;  3TX1 A;  2VFU A;  1FO4 A;  2O3G A;  1DIQ A;  1UXY A;  1FIQ B;  2YVS A;  4BC7 A;  3W8Z A;  2W3S A;  3KJM A;  1W1L A;  2Q4W A;  5HMR A;  2R8D A;  2BVH A;  3NVZ B;  3HRD C;  1E8H A;  3AM9 A;  5I1W A;  3LLB A;  3EJD B;  2P4P A;  2EXR A;  3FW9 A;  3PM9 A;  1MBT A;  3FWA A;  2VAO A;  1JRP A;  2Y4G A;  1W1R A;  2QPM A;  3AMZ A;  3NVV B;  5HHZ A;  5L6F A;  1N60 C;  3S1E A;  5AE1 A;  5G5G B;  2WDW A;  4BC9 A;  4PZF A;  1W1K A;  2R2Z A;  2W55 A;  2QKN A; 
#chains in the Genus database with same CATH homology
 3FW8 A;  2BVF A;  2E3T A;  4DNS A;  3I99 A;  5G5H B;  2AXR A;  4XLO A;  3DED A;  5FXD A;  1W1M A;  3POP A;  1W1O A;  3D2J A;  4PVE A;  1JRO A;  4UD8 A;  4PVJ A;  2Y3R A;  4PVH A;  3D2D A;  1N5W C;  3ETR B;  2P13 A;  5FXP A;  2Y08 A;  1WYG A;  2BVG A;  2Q85 A;  4JAY A;  3RJ8 A;  2W3R A;  4BCA A;  2PLS A;  3LAE A;  1N63 C;  1V97 A;  2MBR A;  4PYT A;  1FFV C;  4OAL A;  4ML8 A;  3W8W A;  5AE2 A;  3NVY B;  5ADZ A;  1AHZ A;  2UUU A;  5AE3 A;  4BBY A;  2Y3S A;  1F0X A;  1W1J A;  4O95 A;  3BW7 A;  4HG0 A;  3B9J B;  3TSH A;  3NS1 B;  1ZR6 A;  5FXE A;  3S1F A;  3VTE A;  2I0K A;  2VFS A;  4JB1 A;  2PLI A;  3AN1 A;  3S1C A;  5HQX A;  3PQB A;  2P3H A;  1I19 A;  2VFV A;  2IPI A;  4MLA A;  1W1S A;  3D2H A;  3NRZ B;  2VFR A;  3S1D A;  5I1V A;  1DZN A;  3C0P A;  2UUV A;  3GSY A;  1DII A;  5AWV A;  3EUB 3;  1WVF A;  1W1Q A;  1QLU A;  1WVE A;  1VDV A;  4EC3 A;  4ZOH B;  1AHU A;  1QLT A;  1E0Y A;  1N62 C;  1E8G A;  1HSK A;  3JS8 A;  3NVW B;  2W54 A;  3SR6 B;  2GQT A;  2RK5 A;  1N61 C;  1RM6 B;  1SB3 B;  3RJA A;  1FFU C;  1ZXI C;  3DQ0 A;  5K8E A;  1VAO A;  5D79 A;  2NQW A;  1T3Q C;  3TSJ A;  3FW7 A;  2VFT A;  4PWC A;  1N5X A;  2GQU A;  3W8X A;  1AHV A;  5L6G A;  3HSU A;  1E8F A;  4PWB A;  1MBB A;  4PVK A;  5FXF A;  2OAI A;  3TX1 A;  2VFU A;  1FO4 A;  2O3G A;  1DIQ A;  1UXY A;  1FIQ B;  2YVS A;  4BC7 A;  3W8Z A;  2W3S A;  3KJM A;  1W1L A;  2Q4W A;  5HMR A;  2R8D A;  2BVH A;  3NVZ B;  3HRD C;  1E8H A;  3AM9 A;  5I1W A;  3LLB A;  2P4P A;  2EXR A;  3FW9 A;  3PM9 A;  1MBT A;  3FWA A;  2VAO A;  1JRP A;  2Y4G A;  1W1R A;  2QPM A;  3AMZ A;  3NVV B;  5HHZ A;  5L6F A;  1N60 C;  3S1E A;  5AE1 A;  5G5G B;  2WDW A;  4BC9 A;  4PZF A;  1W1K A;  2R2Z A;  2W55 A;  2QKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...