1MBTA

Oxidoreductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title The structure of the substrate-free form of MurB, an essential enzyme for the synthesis of bacterial cell walls.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbtA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbtA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbtA01
1FO4A 1E0YA 3GSYA 2PLIA 4OALA 1DZNA 5ADZA 2VFUA 3EUB3 1N5XA 1AHZA 1E8FA 4HG0A 2AXRA 3W8XA 1DIQA 3NVWB 2I0KA 4EC3A 3NVYB 2E3TA 1QLUA 1WVEA 3D2DA 4JAYA 1E8HA 2R2ZA 3BW7A 2BVHA 1VDVA 2Q85A 3AMZA 3TX1A 5G5HB 3JS8A 1F0XA 1DIIA 4BC9A 2W3SA 1N60C 1FIQB 4PZFA 3PM9A 2W3RA 2R8DA 1VAOA 1MBBA 1WYGA 2VFSA 1N62C 5FXPA 2VFTA 4PWBA 2O3GA 1W1SA 3HRDC 3FW8A 3KJMA 3VTEA 4PWCA 1W1LA 3D2HA 4PVJA 3TSJA 5AE2A 3S1CA 1UXYA 5FXFA 3TSHA 1FFVC 4ZOHB 3NRZB 3S1FA 2VAOA 2MBRA 3DEDA 1QLTA 1E8GA 2VFRA 3FWAA 2PLSA 4BBYA 1MBTA 5HHZA 1W1QA 3AM9A 1ZR6A 5AE3A 1ZXIC 3FW7A 4MLAA 3D2JA 1JROA 4DNSA 1W1JA 4BC7A 1RM6B 4ML8A 2W54A 2Q4WA 2VFVA 2OAIA 1N61C 2GQTA 4PYTA 4JB1A 4PVKA 4BCAA 3I99A 2QPMA 5HMRA 5FXEA 3C0PA 5HQXA 3SR6B 4PVHA 3W8WA 2BVGA 3DQ0A 3S1DA 2P13A 1AHVA 3S1EA 2RK5A 1I19A 3B9JB 3FW9A 2W55A 1V97A 3NS1B 5FXDA 4XLOA 4O95A 3NVVB 3W8ZA 1W1KA 2P3HA 1N5WC 1AHUA 3LLBA 4UD8A 4PVEA 2P4PA 2NQWA 2EXRA 1N63C 1T3QC 1SB3B 2GQUA 2YVSA 3ETRB 1W1MA 5AE1A 5G5GB 2QKNA 1W1OA 3LAEA 1HSKA 1FFUC 1W1RA 1JRPA 5D79A 3AN1A 1WVFA 3NVZB 2BVFA
chains in the Genus database with same CATH superfamily
1FO4A 1E0YA 3GSYA 2PLIA 4OALA 1DZNA 5ADZA 2VFUA 3EUB3 1N5XA 1AHZA 2Y3SA 3POPA 1E8FA 4HG0A 2UUUA 2AXRA 2IPIA 3W8XA 1DIQA 5L6FA 3NVWB 2I0KA 4EC3A 3EJDB 3NVYB 3HSUA 2E3TA 1QLUA 1WVEA 3D2DA 4JAYA 1E8HA 2R2ZA 3BW7A 2BVHA 1VDVA 2Q85A 3AMZA 3TX1A 5G5HB 3JS8A 1F0XA 1DIIA 4BC9A 2W3SA 1N60C 1FIQB 4PZFA 3PM9A 2W3RA 2R8DA 1VAOA 1MBBA 1WYGA 2VFSA 1N62C 5FXPA 2VFTA 4PWBA 2O3GA 1W1SA 3HRDC 3FW8A 3KJMA 3VTEA 3RJ8A 2WDWA 4PWCA 1W1LA 3D2HA 4PVJA 5AWVA 3TSJA 5AE2A 3S1CA 1UXYA 5FXFA 5I1WA 3TSHA 1FFVC 4ZOHB 5L6GA 3NRZB 3S1FA 2VAOA 5I1VA 2MBRA 3DEDA 1QLTA 1E8GA 2VFRA 3FWAA 2PLSA 4BBYA 1MBTA 5HHZA 1W1QA 3AM9A 1ZR6A 5AE3A 1ZXIC 3FW7A 4MLAA 3EJBB 3D2JA 1JROA 2Y3RA 4DNSA 1W1JA 4BC7A 1RM6B 4ML8A 2W54A 2Q4WA 2VFVA 2OAIA 1N61C 2GQTA 4PYTA 4JB1A 4PVKA 4BCAA 3I99A 2QPMA 5HMRA 5FXEA 3C0PA 5HQXA 3SR6B 4PVHA 3EJEB 2BVGA 3DQ0A 3S1DA 3W8WA 2P13A 3RJAA 1AHVA 3S1EA 2RK5A 2Y08A 1I19A 3B9JB 3FW9A 2W55A 1V97A 3NS1B 5K8EA 5FXDA 4XLOA 3PQBA 3NVVB 4O95A 3W8ZA 1W1KA 2P3HA 1N5WC 1AHUA 2Y4GA 3LLBA 4UD8A 4PVEA 2P4PA 2NQWA 2EXRA 1N63C 1T3QC 1SB3B 2GQUA 2YVSA 3ETRB 1W1MA 5AE1A 2UUVA 5G5GB 2QKNA 1W1OA 3LAEA 1HSKA 1FFUC 1W1RA 1JRPA 5D79A 3AN1A 1WVFA 3NVZB 2BVFA
chains in the Genus database with same CATH topology
1FO4A 1E0YA 3GSYA 2PLIA 4OALA 1DZNA 5ADZA 2VFUA 3EUB3 1N5XA 1AHZA 2Y3SA 3POPA 1E8FA 4HG0A 2UUUA 2AXRA 2IPIA 3W8XA 1DIQA 5L6FA 3NVWB 2I0KA 4EC3A 3HSUA 3NVYB 2E3TA 1QLUA 1WVEA 3D2DA 4JAYA 1E8HA 2R2ZA 3BW7A 2BVHA 1VDVA 2Q85A 3AMZA 3TX1A 5G5HB 3JS8A 1F0XA 1DIIA 4BC9A 2W3SA 1N60C 1FIQB 4PZFA 3PM9A 2W3RA 2R8DA 1VAOA 1MBBA 1WYGA 2VFSA 1N62C 5FXPA 2VFTA 4PWBA 2O3GA 1W1SA 3HRDC 3FW8A 3KJMA 3VTEA 3RJ8A 2WDWA 4PWCA 1W1LA 3D2HA 4PVJA 5AWVA 3TSJA 5AE2A 3S1CA 1UXYA 5FXFA 5I1WA 3TSHA 1FFVC 4ZOHB 5L6GA 3NRZB 3S1FA 2VAOA 5I1VA 2MBRA 3DEDA 1QLTA 1E8GA 2VFRA 3FWAA 2PLSA 4BBYA 1MBTA 5HHZA 1W1QA 3AM9A 1ZR6A 5AE3A 1ZXIC 3FW7A 4MLAA 3D2JA 1JROA 2Y3RA 4DNSA 1W1JA 4BC7A 1RM6B 4ML8A 2W54A 2Q4WA 2VFVA 2OAIA 1N61C 2GQTA 4PYTA 4JB1A 4PVKA 4BCAA 3I99A 2QPMA 5HMRA 5FXEA 3C0PA 5HQXA 3SR6B 4PVHA 3W8WA 2BVGA 3DQ0A 3S1DA 2P13A 3RJAA 1AHVA 3S1EA 2RK5A 2Y08A 1I19A 3B9JB 3FW9A 2W55A 1V97A 3NS1B 5K8EA 5FXDA 4XLOA 3PQBA 4O95A 3NVVB 3W8ZA 1W1KA 2P3HA 1N5WC 1AHUA 2Y4GA 3LLBA 4UD8A 4PVEA 2P4PA 2NQWA 2EXRA 1N63C 1T3QC 1SB3B 2GQUA 2YVSA 3ETRB 1W1MA 5AE1A 2UUVA 5G5GB 2QKNA 1W1OA 3LAEA 1HSKA 1FFUC 1W1RA 1JRPA 5D79A 3AN1A 1WVFA 3NVZB 2BVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO4 A;  1E0Y A;  3GSY A;  2PLI A;  4OAL A;  1DZN A;  5ADZ A;  2VFU A;  3EUB 3;  1N5X A;  1AHZ A;  1E8F A;  4HG0 A;  2AXR A;  3W8X A;  1DIQ A;  3NVW B;  2I0K A;  4EC3 A;  3NVY B;  2E3T A;  1QLU A;  1WVE A;  3D2D A;  4JAY A;  1E8H A;  2R2Z A;  3BW7 A;  2BVH A;  1VDV A;  2Q85 A;  3AMZ A;  3TX1 A;  5G5H B;  3JS8 A;  1F0X A;  1DII A;  4BC9 A;  2W3S A;  1N60 C;  1FIQ B;  4PZF A;  3PM9 A;  2W3R A;  2R8D A;  1VAO A;  1MBB A;  1WYG A;  2VFS A;  1N62 C;  5FXP A;  2VFT A;  4PWB A;  2O3G A;  1W1S A;  3HRD C;  3FW8 A;  3KJM A;  3VTE A;  4PWC A;  1W1L A;  3D2H A;  4PVJ A;  3TSJ A;  5AE2 A;  3S1C A;  1UXY A;  5FXF A;  3TSH A;  1FFV C;  4ZOH B;  3NRZ B;  3S1F A;  2VAO A;  2MBR A;  3DED A;  1QLT A;  1E8G A;  2VFR A;  3FWA A;  2PLS A;  4BBY A;  1MBT A;  5HHZ A;  1W1Q A;  3AM9 A;  1ZR6 A;  5AE3 A;  1ZXI C;  3FW7 A;  4MLA A;  3D2J A;  1JRO A;  4DNS A;  1W1J A;  4BC7 A;  1RM6 B;  4ML8 A;  2W54 A;  2Q4W A;  2VFV A;  2OAI A;  1N61 C;  2GQT A;  4PYT A;  4JB1 A;  4PVK A;  4BCA A;  3I99 A;  2QPM A;  5HMR A;  5FXE A;  3C0P A;  5HQX A;  3SR6 B;  4PVH A;  3W8W A;  2BVG A;  3DQ0 A;  3S1D A;  2P13 A;  1AHV A;  3S1E A;  2RK5 A;  1I19 A;  3B9J B;  3FW9 A;  2W55 A;  1V97 A;  3NS1 B;  5FXD A;  4XLO A;  4O95 A;  3NVV B;  3W8Z A;  1W1K A;  2P3H A;  1N5W C;  1AHU A;  3LLB A;  4UD8 A;  4PVE A;  2P4P A;  2NQW A;  2EXR A;  1N63 C;  1T3Q C;  1SB3 B;  2GQU A;  2YVS A;  3ETR B;  1W1M A;  5AE1 A;  5G5G B;  2QKN A;  1W1O A;  3LAE A;  1HSK A;  1FFU C;  1W1R A;  1JRP A;  5D79 A;  3AN1 A;  1WVF A;  3NVZ B;  2BVF A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  1E0Y A;  3GSY A;  2PLI A;  4OAL A;  1DZN A;  5ADZ A;  2VFU A;  3EUB 3;  1N5X A;  1AHZ A;  2Y3S A;  3POP A;  1E8F A;  4HG0 A;  2UUU A;  2AXR A;  2IPI A;  3W8X A;  1DIQ A;  5L6F A;  3NVW B;  2I0K A;  4EC3 A;  3EJD B;  3NVY B;  3HSU A;  2E3T A;  1QLU A;  1WVE A;  3D2D A;  4JAY A;  1E8H A;  2R2Z A;  3BW7 A;  2BVH A;  1VDV A;  2Q85 A;  3AMZ A;  3TX1 A;  5G5H B;  3JS8 A;  1F0X A;  1DII A;  4BC9 A;  2W3S A;  1N60 C;  1FIQ B;  4PZF A;  3PM9 A;  2W3R A;  2R8D A;  1VAO A;  1MBB A;  1WYG A;  2VFS A;  1N62 C;  5FXP A;  2VFT A;  4PWB A;  2O3G A;  1W1S A;  3HRD C;  3FW8 A;  3KJM A;  3VTE A;  3RJ8 A;  2WDW A;  4PWC A;  1W1L A;  3D2H A;  4PVJ A;  5AWV A;  3TSJ A;  5AE2 A;  3S1C A;  1UXY A;  5FXF A;  5I1W A;  3TSH A;  1FFV C;  4ZOH B;  5L6G A;  3NRZ B;  3S1F A;  2VAO A;  5I1V A;  2MBR A;  3DED A;  1QLT A;  1E8G A;  2VFR A;  3FWA A;  2PLS A;  4BBY A;  1MBT A;  5HHZ A;  1W1Q A;  3AM9 A;  1ZR6 A;  5AE3 A;  1ZXI C;  3FW7 A;  4MLA A;  3EJB B;  3D2J A;  1JRO A;  2Y3R A;  4DNS A;  1W1J A;  4BC7 A;  1RM6 B;  4ML8 A;  2W54 A;  2Q4W A;  2VFV A;  2OAI A;  1N61 C;  2GQT A;  4PYT A;  4JB1 A;  4PVK A;  4BCA A;  3I99 A;  2QPM A;  5HMR A;  5FXE A;  3C0P A;  5HQX A;  3SR6 B;  4PVH A;  3EJE B;  2BVG A;  3DQ0 A;  3S1D A;  3W8W A;  2P13 A;  3RJA A;  1AHV A;  3S1E A;  2RK5 A;  2Y08 A;  1I19 A;  3B9J B;  3FW9 A;  2W55 A;  1V97 A;  3NS1 B;  5K8E A;  5FXD A;  4XLO A;  3PQB A;  3NVV B;  4O95 A;  3W8Z A;  1W1K A;  2P3H A;  1N5W C;  1AHU A;  2Y4G A;  3LLB A;  4UD8 A;  4PVE A;  2P4P A;  2NQW A;  2EXR A;  1N63 C;  1T3Q C;  1SB3 B;  2GQU A;  2YVS A;  3ETR B;  1W1M A;  5AE1 A;  2UUV A;  5G5G B;  2QKN A;  1W1O A;  3LAE A;  1HSK A;  1FFU C;  1W1R A;  1JRP A;  5D79 A;  3AN1 A;  1WVF A;  3NVZ B;  2BVF A; 
#chains in the Genus database with same CATH homology
 1FO4 A;  1E0Y A;  3GSY A;  2PLI A;  4OAL A;  1DZN A;  5ADZ A;  2VFU A;  3EUB 3;  1N5X A;  1AHZ A;  2Y3S A;  3POP A;  1E8F A;  4HG0 A;  2UUU A;  2AXR A;  2IPI A;  3W8X A;  1DIQ A;  5L6F A;  3NVW B;  2I0K A;  4EC3 A;  3HSU A;  3NVY B;  2E3T A;  1QLU A;  1WVE A;  3D2D A;  4JAY A;  1E8H A;  2R2Z A;  3BW7 A;  2BVH A;  1VDV A;  2Q85 A;  3AMZ A;  3TX1 A;  5G5H B;  3JS8 A;  1F0X A;  1DII A;  4BC9 A;  2W3S A;  1N60 C;  1FIQ B;  4PZF A;  3PM9 A;  2W3R A;  2R8D A;  1VAO A;  1MBB A;  1WYG A;  2VFS A;  1N62 C;  5FXP A;  2VFT A;  4PWB A;  2O3G A;  1W1S A;  3HRD C;  3FW8 A;  3KJM A;  3VTE A;  3RJ8 A;  2WDW A;  4PWC A;  1W1L A;  3D2H A;  4PVJ A;  5AWV A;  3TSJ A;  5AE2 A;  3S1C A;  1UXY A;  5FXF A;  5I1W A;  3TSH A;  1FFV C;  4ZOH B;  5L6G A;  3NRZ B;  3S1F A;  2VAO A;  5I1V A;  2MBR A;  3DED A;  1QLT A;  1E8G A;  2VFR A;  3FWA A;  2PLS A;  4BBY A;  1MBT A;  5HHZ A;  1W1Q A;  3AM9 A;  1ZR6 A;  5AE3 A;  1ZXI C;  3FW7 A;  4MLA A;  3D2J A;  1JRO A;  2Y3R A;  4DNS A;  1W1J A;  4BC7 A;  1RM6 B;  4ML8 A;  2W54 A;  2Q4W A;  2VFV A;  2OAI A;  1N61 C;  2GQT A;  4PYT A;  4JB1 A;  4PVK A;  4BCA A;  3I99 A;  2QPM A;  5HMR A;  5FXE A;  3C0P A;  5HQX A;  3SR6 B;  4PVH A;  3W8W A;  2BVG A;  3DQ0 A;  3S1D A;  2P13 A;  3RJA A;  1AHV A;  3S1E A;  2RK5 A;  2Y08 A;  1I19 A;  3B9J B;  3FW9 A;  2W55 A;  1V97 A;  3NS1 B;  5K8E A;  5FXD A;  4XLO A;  3PQB A;  4O95 A;  3NVV B;  3W8Z A;  1W1K A;  2P3H A;  1N5W C;  1AHU A;  2Y4G A;  3LLB A;  4UD8 A;  4PVE A;  2P4P A;  2NQW A;  2EXR A;  1N63 C;  1T3Q C;  1SB3 B;  2GQU A;  2YVS A;  3ETR B;  1W1M A;  5AE1 A;  2UUV A;  5G5G B;  2QKN A;  1W1O A;  3LAE A;  1HSK A;  1FFU C;  1W1R A;  1JRP A;  5D79 A;  3AN1 A;  1WVF A;  3NVZ B;  2BVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...