1MBTA

Oxidoreductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the substrate-free form of MurB, an essential enzyme for the synthesis of bacterial cell walls.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
total genus 98
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbtA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbtA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbtA01
2BVHA 3AN1A 2QPMA 3B9JB 3AMZA 2EXRA 5HMRA 1VAOA 3DQ0A 1QLTA 3KJMA 1E8GA 3TSHA 1AHVA 3TX1A 4BC7A 4PZFA 5D79A 2PLSA 3NS1B 1WVEA 5FXFA 5AE1A 1W1LA 4HG0A 1E8FA 1E0YA 1ZR6A 3FW8A 4PYTA 1FO4A 2P13A 2R2ZA 1HSKA 2BVFA 3S1EA 1T3QC 3D2DA 1W1RA 3DEDA 3VTEA 1F0XA 1DZNA 1N60C 1DIQA 1UXYA 3GSYA 3S1CA 1I19A 2W55A 3NRZB 1V97A 5AE2A 2YVSA 1E8HA 4DNSA 3AM9A 1WVFA 3D2JA 1JRPA 1FIQB 2VFTA 3JS8A 4XLOA 4BBYA 4ML8A 1WYGA 5FXPA 2E3TA 2O3GA 3BW7A 4PWCA 3PM9A 2VAOA 5ADZA 1MBTA 3EUB3 2W3SA 3FW9A 2W54A 5HQXA 3NVWB 2W3RA 1W1MA 1MBBA 2GQTA 1W1JA 3FW7A 2VFUA 4PVEA 2PLIA 3W8ZA 5AE3A 5FXDA 1QLUA 3NVYB 4PVHA 1N5XA 3C0PA 3SR6B 1N5WC 1VDVA 3NVVB 3I99A 3W8WA 3W8XA 1W1OA 1AHZA 1N61C 4OALA 2P3HA 2R8DA 4JAYA 2RK5A 1RM6B 3D2HA 2VFRA 2VFSA 5HHZA 4PVJA 2QKNA 2Q4WA 4EC3A 1N63C 2P4PA 3S1FA 2MBRA 2VFVA 3FWAA 1W1SA 1JROA 2GQUA 1AHUA 2AXRA 2OAIA 1W1QA 1W1KA 2NQWA 1FFUC 4PWBA 2BVGA 4BCAA 4UD8A 3TSJA 3LAEA 5G5GB 1DIIA 1ZXIC 3HRDC 2I0KA 5FXEA 5G5HB 4ZOHB 1N62C 3S1DA 2Q85A 4O95A 3NVZB 3LLBA 1FFVC 4BC9A 4PVKA 4MLAA 1SB3B 4JB1A 3ETRB
chains in the Genus database with same CATH superfamily
2BVHA 3AN1A 2QPMA 3B9JB 3AMZA 2EXRA 5HMRA 1VAOA 3DQ0A 1QLTA 3KJMA 1E8GA 3TSHA 1AHVA 3TX1A 4BC7A 4PZFA 5D79A 2PLSA 3NS1B 1WVEA 5FXFA 5AE1A 1W1LA 4HG0A 1E8FA 1E0YA 1ZR6A 3FW8A 4PYTA 1FO4A 2P13A 2R2ZA 1HSKA 2BVFA 3S1EA 1T3QC 3D2DA 1W1RA 3DEDA 3VTEA 1F0XA 1DZNA 1N60C 1DIQA 1UXYA 2IPIA 3EJEB 3GSYA 5K8EA 3S1CA 5AWVA 1I19A 2W55A 3NRZB 1V97A 5AE2A 2YVSA 1E8HA 4DNSA 3AM9A 1WVFA 3D2JA 1JRPA 1FIQB 2VFTA 3JS8A 4XLOA 4BBYA 4ML8A 1WYGA 5FXPA 2E3TA 2O3GA 3BW7A 4PWCA 3PM9A 5L6GA 2VAOA 5ADZA 3POPA 1MBTA 3EUB3 2W3SA 3FW9A 2W54A 5HQXA 3NVWB 2W3RA 1W1MA 1MBBA 2GQTA 3PQBA 1W1JA 3FW7A 2VFUA 4PVEA 2PLIA 3W8ZA 5AE3A 3RJAA 5FXDA 1QLUA 3NVYB 5L6FA 4PVHA 1N5XA 3C0PA 2UUVA 3SR6B 1N5WC 1VDVA 3NVVB 3I99A 3W8WA 3W8XA 1W1OA 1AHZA 1N61C 4OALA 2P3HA 2R8DA 4JAYA 2RK5A 1RM6B 3D2HA 2Y3RA 2Y08A 2VFRA 3HSUA 2VFSA 5HHZA 4PVJA 2Y3SA 2QKNA 2Q4WA 4EC3A 1N63C 2P4PA 3S1FA 5I1WA 2MBRA 2VFVA 3FWAA 3EJBB 1W1SA 1JROA 2GQUA 1AHUA 2AXRA 2OAIA 1W1QA 1W1KA 2UUUA 2NQWA 1FFUC 4PWBA 2BVGA 2Y4GA 4BCAA 4UD8A 3TSJA 3LAEA 5G5GB 5I1VA 1DIIA 1ZXIC 3HRDC 2I0KA 5FXEA 5G5HB 4ZOHB 1N62C 3S1DA 2WDWA 3RJ8A 2Q85A 4O95A 3NVZB 3LLBA 1FFVC 4BC9A 4PVKA 3EJDB 4MLAA 1SB3B 4JB1A 3ETRB
chains in the Genus database with same CATH topology
2BVHA 3AN1A 2QPMA 3B9JB 3AMZA 2EXRA 5HMRA 1VAOA 3DQ0A 1QLTA 3KJMA 1E8GA 3TSHA 1AHVA 3TX1A 4BC7A 4PZFA 5D79A 2PLSA 3NS1B 1WVEA 5FXFA 5AE1A 1W1LA 4HG0A 1E8FA 1E0YA 1ZR6A 3FW8A 4PYTA 1FO4A 2P13A 2R2ZA 1HSKA 2BVFA 3S1EA 1T3QC 3D2DA 1W1RA 3DEDA 3VTEA 1F0XA 1DZNA 1N60C 1DIQA 1UXYA 2IPIA 3GSYA 5K8EA 3S1CA 5AWVA 1I19A 2W55A 3NRZB 1V97A 5AE2A 2YVSA 1E8HA 4DNSA 3AM9A 1WVFA 3D2JA 1JRPA 1FIQB 2VFTA 3JS8A 4XLOA 4BBYA 4ML8A 1WYGA 5FXPA 2E3TA 2O3GA 3BW7A 4PWCA 3PM9A 5L6GA 2VAOA 5ADZA 3POPA 1MBTA 3EUB3 2W3SA 3FW9A 2W54A 5HQXA 3NVWB 2W3RA 1W1MA 1MBBA 2GQTA 3PQBA 1W1JA 3FW7A 2VFUA 4PVEA 2PLIA 3W8ZA 5AE3A 3RJAA 5FXDA 1QLUA 3NVYB 5L6FA 4PVHA 1N5XA 3C0PA 2UUVA 3SR6B 1N5WC 1VDVA 3NVVB 3I99A 3W8WA 3W8XA 1W1OA 1AHZA 1N61C 4OALA 2P3HA 2R8DA 4JAYA 2RK5A 1RM6B 3D2HA 2Y3RA 2Y08A 2VFRA 3HSUA 2VFSA 5HHZA 4PVJA 2Y3SA 2QKNA 2Q4WA 4EC3A 1N63C 2P4PA 3S1FA 5I1WA 2MBRA 2VFVA 3FWAA 1W1SA 1JROA 2GQUA 1AHUA 2AXRA 2OAIA 1W1QA 1W1KA 2UUUA 2NQWA 1FFUC 4PWBA 2BVGA 2Y4GA 4BCAA 4UD8A 3TSJA 3LAEA 5G5GB 5I1VA 1DIIA 1ZXIC 3HRDC 2I0KA 5FXEA 5G5HB 4ZOHB 1N62C 3S1DA 2WDWA 3RJ8A 2Q85A 4O95A 3NVZB 3LLBA 1FFVC 4BC9A 4PVKA 4MLAA 1SB3B 4JB1A 3ETRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BVH A;  3AN1 A;  2QPM A;  3B9J B;  3AMZ A;  2EXR A;  5HMR A;  1VAO A;  3DQ0 A;  1QLT A;  3KJM A;  1E8G A;  3TSH A;  1AHV A;  3TX1 A;  4BC7 A;  4PZF A;  5D79 A;  2PLS A;  3NS1 B;  1WVE A;  5FXF A;  5AE1 A;  1W1L A;  4HG0 A;  1E8F A;  1E0Y A;  1ZR6 A;  3FW8 A;  4PYT A;  1FO4 A;  2P13 A;  2R2Z A;  1HSK A;  2BVF A;  3S1E A;  1T3Q C;  3D2D A;  1W1R A;  3DED A;  3VTE A;  1F0X A;  1DZN A;  1N60 C;  1DIQ A;  1UXY A;  3GSY A;  3S1C A;  1I19 A;  2W55 A;  3NRZ B;  1V97 A;  5AE2 A;  2YVS A;  1E8H A;  4DNS A;  3AM9 A;  1WVF A;  3D2J A;  1JRP A;  1FIQ B;  2VFT A;  3JS8 A;  4XLO A;  4BBY A;  4ML8 A;  1WYG A;  5FXP A;  2E3T A;  2O3G A;  3BW7 A;  4PWC A;  3PM9 A;  2VAO A;  5ADZ A;  1MBT A;  3EUB 3;  2W3S A;  3FW9 A;  2W54 A;  5HQX A;  3NVW B;  2W3R A;  1W1M A;  1MBB A;  2GQT A;  1W1J A;  3FW7 A;  2VFU A;  4PVE A;  2PLI A;  3W8Z A;  5AE3 A;  5FXD A;  1QLU A;  3NVY B;  4PVH A;  1N5X A;  3C0P A;  3SR6 B;  1N5W C;  1VDV A;  3NVV B;  3I99 A;  3W8W A;  3W8X A;  1W1O A;  1AHZ A;  1N61 C;  4OAL A;  2P3H A;  2R8D A;  4JAY A;  2RK5 A;  1RM6 B;  3D2H A;  2VFR A;  2VFS A;  5HHZ A;  4PVJ A;  2QKN A;  2Q4W A;  4EC3 A;  1N63 C;  2P4P A;  3S1F A;  2MBR A;  2VFV A;  3FWA A;  1W1S A;  1JRO A;  2GQU A;  1AHU A;  2AXR A;  2OAI A;  1W1Q A;  1W1K A;  2NQW A;  1FFU C;  4PWB A;  2BVG A;  4BCA A;  4UD8 A;  3TSJ A;  3LAE A;  5G5G B;  1DII A;  1ZXI C;  3HRD C;  2I0K A;  5FXE A;  5G5H B;  4ZOH B;  1N62 C;  3S1D A;  2Q85 A;  4O95 A;  3NVZ B;  3LLB A;  1FFV C;  4BC9 A;  4PVK A;  4MLA A;  1SB3 B;  4JB1 A;  3ETR B; 
#chains in the Genus database with same CATH topology
 2BVH A;  3AN1 A;  2QPM A;  3B9J B;  3AMZ A;  2EXR A;  5HMR A;  1VAO A;  3DQ0 A;  1QLT A;  3KJM A;  1E8G A;  3TSH A;  1AHV A;  3TX1 A;  4BC7 A;  4PZF A;  5D79 A;  2PLS A;  3NS1 B;  1WVE A;  5FXF A;  5AE1 A;  1W1L A;  4HG0 A;  1E8F A;  1E0Y A;  1ZR6 A;  3FW8 A;  4PYT A;  1FO4 A;  2P13 A;  2R2Z A;  1HSK A;  2BVF A;  3S1E A;  1T3Q C;  3D2D A;  1W1R A;  3DED A;  3VTE A;  1F0X A;  1DZN A;  1N60 C;  1DIQ A;  1UXY A;  2IPI A;  3EJE B;  3GSY A;  5K8E A;  3S1C A;  5AWV A;  1I19 A;  2W55 A;  3NRZ B;  1V97 A;  5AE2 A;  2YVS A;  1E8H A;  4DNS A;  3AM9 A;  1WVF A;  3D2J A;  1JRP A;  1FIQ B;  2VFT A;  3JS8 A;  4XLO A;  4BBY A;  4ML8 A;  1WYG A;  5FXP A;  2E3T A;  2O3G A;  3BW7 A;  4PWC A;  3PM9 A;  5L6G A;  2VAO A;  5ADZ A;  3POP A;  1MBT A;  3EUB 3;  2W3S A;  3FW9 A;  2W54 A;  5HQX A;  3NVW B;  2W3R A;  1W1M A;  1MBB A;  2GQT A;  3PQB A;  1W1J A;  3FW7 A;  2VFU A;  4PVE A;  2PLI A;  3W8Z A;  5AE3 A;  3RJA A;  5FXD A;  1QLU A;  3NVY B;  5L6F A;  4PVH A;  1N5X A;  3C0P A;  2UUV A;  3SR6 B;  1N5W C;  1VDV A;  3NVV B;  3I99 A;  3W8W A;  3W8X A;  1W1O A;  1AHZ A;  1N61 C;  4OAL A;  2P3H A;  2R8D A;  4JAY A;  2RK5 A;  1RM6 B;  3D2H A;  2Y3R A;  2Y08 A;  2VFR A;  3HSU A;  2VFS A;  5HHZ A;  4PVJ A;  2Y3S A;  2QKN A;  2Q4W A;  4EC3 A;  1N63 C;  2P4P A;  3S1F A;  5I1W A;  2MBR A;  2VFV A;  3FWA A;  3EJB B;  1W1S A;  1JRO A;  2GQU A;  1AHU A;  2AXR A;  2OAI A;  1W1Q A;  1W1K A;  2UUU A;  2NQW A;  1FFU C;  4PWB A;  2BVG A;  2Y4G A;  4BCA A;  4UD8 A;  3TSJ A;  3LAE A;  5G5G B;  5I1V A;  1DII A;  1ZXI C;  3HRD C;  2I0K A;  5FXE A;  5G5H B;  4ZOH B;  1N62 C;  3S1D A;  2WDW A;  3RJ8 A;  2Q85 A;  4O95 A;  3NVZ B;  3LLB A;  1FFV C;  4BC9 A;  4PVK A;  3EJD B;  4MLA A;  1SB3 B;  4JB1 A;  3ETR B; 
#chains in the Genus database with same CATH homology
 2BVH A;  3AN1 A;  2QPM A;  3B9J B;  3AMZ A;  2EXR A;  5HMR A;  1VAO A;  3DQ0 A;  1QLT A;  3KJM A;  1E8G A;  3TSH A;  1AHV A;  3TX1 A;  4BC7 A;  4PZF A;  5D79 A;  2PLS A;  3NS1 B;  1WVE A;  5FXF A;  5AE1 A;  1W1L A;  4HG0 A;  1E8F A;  1E0Y A;  1ZR6 A;  3FW8 A;  4PYT A;  1FO4 A;  2P13 A;  2R2Z A;  1HSK A;  2BVF A;  3S1E A;  1T3Q C;  3D2D A;  1W1R A;  3DED A;  3VTE A;  1F0X A;  1DZN A;  1N60 C;  1DIQ A;  1UXY A;  2IPI A;  3GSY A;  5K8E A;  3S1C A;  5AWV A;  1I19 A;  2W55 A;  3NRZ B;  1V97 A;  5AE2 A;  2YVS A;  1E8H A;  4DNS A;  3AM9 A;  1WVF A;  3D2J A;  1JRP A;  1FIQ B;  2VFT A;  3JS8 A;  4XLO A;  4BBY A;  4ML8 A;  1WYG A;  5FXP A;  2E3T A;  2O3G A;  3BW7 A;  4PWC A;  3PM9 A;  5L6G A;  2VAO A;  5ADZ A;  3POP A;  1MBT A;  3EUB 3;  2W3S A;  3FW9 A;  2W54 A;  5HQX A;  3NVW B;  2W3R A;  1W1M A;  1MBB A;  2GQT A;  3PQB A;  1W1J A;  3FW7 A;  2VFU A;  4PVE A;  2PLI A;  3W8Z A;  5AE3 A;  3RJA A;  5FXD A;  1QLU A;  3NVY B;  5L6F A;  4PVH A;  1N5X A;  3C0P A;  2UUV A;  3SR6 B;  1N5W C;  1VDV A;  3NVV B;  3I99 A;  3W8W A;  3W8X A;  1W1O A;  1AHZ A;  1N61 C;  4OAL A;  2P3H A;  2R8D A;  4JAY A;  2RK5 A;  1RM6 B;  3D2H A;  2Y3R A;  2Y08 A;  2VFR A;  3HSU A;  2VFS A;  5HHZ A;  4PVJ A;  2Y3S A;  2QKN A;  2Q4W A;  4EC3 A;  1N63 C;  2P4P A;  3S1F A;  5I1W A;  2MBR A;  2VFV A;  3FWA A;  1W1S A;  1JRO A;  2GQU A;  1AHU A;  2AXR A;  2OAI A;  1W1Q A;  1W1K A;  2UUU A;  2NQW A;  1FFU C;  4PWB A;  2BVG A;  2Y4G A;  4BCA A;  4UD8 A;  3TSJ A;  3LAE A;  5G5G B;  5I1V A;  1DII A;  1ZXI C;  3HRD C;  2I0K A;  5FXE A;  5G5H B;  4ZOH B;  1N62 C;  3S1D A;  2WDW A;  3RJ8 A;  2Q85 A;  4O95 A;  3NVZ B;  3LLB A;  1FFV C;  4BC9 A;  4PVK A;  4MLA A;  1SB3 B;  4JB1 A;  3ETR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...