1MBTA

Oxidoreductase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the substrate-free form of MurB, an essential enzyme for the synthesis of bacterial cell walls.
pubmed doi rcsb
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
molecule tags Oxidoreductase
total genus 98
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbtA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbtA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbtA01
4PVJA 1W1SA 2EXRA 5AE1A 3AM9A 3KJMA 3TX1A 4BC7A 2O3GA 1F0XA 3D2DA 5ADZA 2QKNA 5D79A 2W54A 5AE2A 3AN1A 3S1DA 3DQ0A 5HQXA 3D2JA 4BC9A 3S1EA 2PLSA 1QLTA 1W1LA 3FWAA 1T3QC 4EC3A 3S1CA 4UD8A 3HRDC 3FW9A 2RK5A 5HMRA 2AXRA 2R2ZA 5G5GB 1N60C 1WYGA 2W55A 2OAIA 2VFUA 4JAYA 5AE3A 1E8FA 3LAEA 2P3HA 4BCAA 3NVVB 3SR6B 3ETRB 5FXDA 3GSYA 1N5XA 3TSHA 3TSJA 1QLUA 3NRZB 3VTEA 4BBYA 4ZOHB 2Q4WA 3DEDA 2VFSA 2PLIA 1HSKA 2W3RA 2W3SA 2VFRA 1W1JA 3JS8A 3FW7A 2VFTA 1SB3B 1WVEA 1W1MA 1FFUC 2YVSA 5FXPA 5G5HB 3W8XA 5FXEA 1DIQA 2P13A 1AHZA 1V97A 1DZNA 1ZXIC 4OALA 1E0YA 2MBRA 3EUB3 4PZFA 4XLOA 1FFVC 1N61C 1N5WC 1MBBA 3AMZA 2E3TA 1AHUA 1W1RA 3C0PA 1FO4A 3NS1B 2P4PA 3D2HA 3W8ZA 3NVZB 1DIIA 4PWCA 5HHZA 2GQUA 4PVKA 1E8HA 2BVHA 1WVFA 4MLAA 3S1FA 4HG0A 1E8GA 4PVHA 1JRPA 1VDVA 2VAOA 4ML8A 4PVEA 1FIQB 1UXYA 3W8WA 3LLBA 1W1OA 2VFVA 4PWBA 2NQWA 4O95A 1VAOA 1W1KA 3PM9A 2BVFA 2QPMA 1ZR6A 4JB1A 1MBTA 1W1QA 5FXFA 1JROA 1I19A 3FW8A 3I99A 2I0KA 3BW7A 2Q85A 2BVGA 1AHVA 3NVYB 2GQTA 1N63C 2R8DA 3NVWB 1RM6B 3B9JB 1N62C 4DNSA 4PYTA
chains in the Genus database with same CATH superfamily
4PVJA 1W1SA 2EXRA 5AE1A 3AM9A 3KJMA 3TX1A 4BC7A 2O3GA 2Y3SA 1F0XA 3D2DA 5ADZA 2UUUA 2QKNA 5D79A 2W54A 5AE2A 3AN1A 3S1DA 3DQ0A 5HQXA 3D2JA 4BC9A 3S1EA 2PLSA 2Y3RA 1QLTA 1W1LA 3FWAA 1T3QC 4EC3A 3S1CA 4UD8A 3HRDC 3FW9A 2RK5A 5HMRA 2AXRA 5K8EA 2R2ZA 5G5GB 1N60C 1WYGA 2W55A 2OAIA 3RJ8A 2VFUA 4JAYA 2IPIA 5AE3A 1E8FA 3LAEA 2P3HA 4BCAA 3PQBA 3NVVB 5L6FA 3SR6B 3ETRB 5FXDA 3GSYA 1N5XA 3TSHA 3TSJA 1QLUA 3NRZB 3VTEA 4BBYA 4ZOHB 2Q4WA 3DEDA 2VFSA 2PLIA 1HSKA 2W3RA 2W3SA 2VFRA 1W1JA 3JS8A 3FW7A 2VFTA 1SB3B 1WVEA 1W1MA 1FFUC 2YVSA 5FXPA 5G5HB 2WDWA 3W8XA 5FXEA 1DIQA 2P13A 1AHZA 1V97A 1DZNA 1ZXIC 4OALA 1E0YA 2MBRA 3EUB3 4PZFA 4XLOA 1FFVC 1N61C 1N5WC 1MBBA 3AMZA 2E3TA 1AHUA 1W1RA 2Y4GA 3POPA 3C0PA 5I1WA 1FO4A 3NS1B 3HSUA 2P4PA 3D2HA 3W8ZA 3NVZB 1DIIA 4PWCA 5HHZA 2GQUA 4PVKA 1E8HA 2BVHA 2Y08A 1WVFA 5L6GA 3RJAA 4MLAA 3S1FA 4HG0A 1E8GA 3EJBB 4PVHA 1JRPA 1VDVA 2VAOA 4ML8A 4PVEA 1FIQB 1UXYA 3W8WA 3LLBA 1W1OA 3EJDB 2VFVA 4PWBA 2NQWA 5AWVA 4O95A 1VAOA 1W1KA 3PM9A 2BVFA 2QPMA 1ZR6A 4JB1A 1MBTA 1W1QA 5FXFA 1JROA 1I19A 3EJEB 3FW8A 3I99A 2I0KA 3BW7A 2Q85A 2BVGA 1AHVA 3NVYB 2GQTA 1N63C 3NVWB 2R8DA 5I1VA 2UUVA 1RM6B 3B9JB 1N62C 4DNSA 4PYTA
chains in the Genus database with same CATH topology
4PVJA 1W1SA 2EXRA 5AE1A 3AM9A 3KJMA 3TX1A 4BC7A 2O3GA 2Y3SA 1F0XA 3D2DA 5ADZA 2UUUA 2QKNA 5D79A 2W54A 5AE2A 3AN1A 3S1DA 3DQ0A 5HQXA 3D2JA 4BC9A 3S1EA 2PLSA 2Y3RA 1QLTA 1W1LA 3FWAA 1T3QC 4EC3A 3S1CA 4UD8A 3HRDC 3FW9A 2RK5A 5HMRA 2AXRA 5K8EA 2R2ZA 5G5GB 1N60C 1WYGA 2W55A 2OAIA 3RJ8A 2VFUA 4JAYA 2IPIA 5AE3A 1E8FA 3LAEA 2P3HA 4BCAA 3PQBA 3NVVB 5L6FA 3SR6B 3ETRB 5FXDA 3GSYA 1N5XA 3TSHA 3TSJA 1QLUA 3NRZB 3VTEA 4BBYA 4ZOHB 2Q4WA 3DEDA 2VFSA 2PLIA 1HSKA 2W3RA 2W3SA 2VFRA 1W1JA 3JS8A 3FW7A 2VFTA 1SB3B 1WVEA 1W1MA 1FFUC 2YVSA 5FXPA 5G5HB 2WDWA 3W8XA 5FXEA 1DIQA 2P13A 1AHZA 1V97A 1DZNA 1ZXIC 4OALA 1E0YA 2MBRA 3EUB3 4PZFA 4XLOA 1FFVC 1N61C 1N5WC 1MBBA 3AMZA 2E3TA 1AHUA 1W1RA 2Y4GA 3POPA 3C0PA 5I1WA 1FO4A 3NS1B 3HSUA 2P4PA 3D2HA 3W8ZA 3NVZB 1DIIA 4PWCA 5HHZA 2GQUA 4PVKA 1E8HA 2BVHA 2Y08A 1WVFA 5L6GA 3RJAA 4MLAA 3S1FA 4HG0A 1E8GA 4PVHA 1JRPA 1VDVA 2VAOA 4ML8A 4PVEA 1FIQB 1UXYA 3W8WA 3LLBA 1W1OA 2VFVA 4PWBA 2NQWA 5AWVA 4O95A 1VAOA 1W1KA 3PM9A 2BVFA 2QPMA 1ZR6A 4JB1A 1MBTA 1W1QA 5FXFA 1JROA 1I19A 3FW8A 3I99A 2I0KA 3BW7A 2Q85A 2BVGA 1AHVA 3NVYB 2GQTA 1N63C 2R8DA 3NVWB 5I1VA 2UUVA 1RM6B 3B9JB 1N62C 4DNSA 4PYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PVJ A;  1W1S A;  2EXR A;  5AE1 A;  3AM9 A;  3KJM A;  3TX1 A;  4BC7 A;  2O3G A;  1F0X A;  3D2D A;  5ADZ A;  2QKN A;  5D79 A;  2W54 A;  5AE2 A;  3AN1 A;  3S1D A;  3DQ0 A;  5HQX A;  3D2J A;  4BC9 A;  3S1E A;  2PLS A;  1QLT A;  1W1L A;  3FWA A;  1T3Q C;  4EC3 A;  3S1C A;  4UD8 A;  3HRD C;  3FW9 A;  2RK5 A;  5HMR A;  2AXR A;  2R2Z A;  5G5G B;  1N60 C;  1WYG A;  2W55 A;  2OAI A;  2VFU A;  4JAY A;  5AE3 A;  1E8F A;  3LAE A;  2P3H A;  4BCA A;  3NVV B;  3SR6 B;  3ETR B;  5FXD A;  3GSY A;  1N5X A;  3TSH A;  3TSJ A;  1QLU A;  3NRZ B;  3VTE A;  4BBY A;  4ZOH B;  2Q4W A;  3DED A;  2VFS A;  2PLI A;  1HSK A;  2W3R A;  2W3S A;  2VFR A;  1W1J A;  3JS8 A;  3FW7 A;  2VFT A;  1SB3 B;  1WVE A;  1W1M A;  1FFU C;  2YVS A;  5FXP A;  5G5H B;  3W8X A;  5FXE A;  1DIQ A;  2P13 A;  1AHZ A;  1V97 A;  1DZN A;  1ZXI C;  4OAL A;  1E0Y A;  2MBR A;  3EUB 3;  4PZF A;  4XLO A;  1FFV C;  1N61 C;  1N5W C;  1MBB A;  3AMZ A;  2E3T A;  1AHU A;  1W1R A;  3C0P A;  1FO4 A;  3NS1 B;  2P4P A;  3D2H A;  3W8Z A;  3NVZ B;  1DII A;  4PWC A;  5HHZ A;  2GQU A;  4PVK A;  1E8H A;  2BVH A;  1WVF A;  4MLA A;  3S1F A;  4HG0 A;  1E8G A;  4PVH A;  1JRP A;  1VDV A;  2VAO A;  4ML8 A;  4PVE A;  1FIQ B;  1UXY A;  3W8W A;  3LLB A;  1W1O A;  2VFV A;  4PWB A;  2NQW A;  4O95 A;  1VAO A;  1W1K A;  3PM9 A;  2BVF A;  2QPM A;  1ZR6 A;  4JB1 A;  1MBT A;  1W1Q A;  5FXF A;  1JRO A;  1I19 A;  3FW8 A;  3I99 A;  2I0K A;  3BW7 A;  2Q85 A;  2BVG A;  1AHV A;  3NVY B;  2GQT A;  1N63 C;  2R8D A;  3NVW B;  1RM6 B;  3B9J B;  1N62 C;  4DNS A;  4PYT A; 
#chains in the Genus database with same CATH topology
 4PVJ A;  1W1S A;  2EXR A;  5AE1 A;  3AM9 A;  3KJM A;  3TX1 A;  4BC7 A;  2O3G A;  2Y3S A;  1F0X A;  3D2D A;  5ADZ A;  2UUU A;  2QKN A;  5D79 A;  2W54 A;  5AE2 A;  3AN1 A;  3S1D A;  3DQ0 A;  5HQX A;  3D2J A;  4BC9 A;  3S1E A;  2PLS A;  2Y3R A;  1QLT A;  1W1L A;  3FWA A;  1T3Q C;  4EC3 A;  3S1C A;  4UD8 A;  3HRD C;  3FW9 A;  2RK5 A;  5HMR A;  2AXR A;  5K8E A;  2R2Z A;  5G5G B;  1N60 C;  1WYG A;  2W55 A;  2OAI A;  3RJ8 A;  2VFU A;  4JAY A;  2IPI A;  5AE3 A;  1E8F A;  3LAE A;  2P3H A;  4BCA A;  3PQB A;  3NVV B;  5L6F A;  3SR6 B;  3ETR B;  5FXD A;  3GSY A;  1N5X A;  3TSH A;  3TSJ A;  1QLU A;  3NRZ B;  3VTE A;  4BBY A;  4ZOH B;  2Q4W A;  3DED A;  2VFS A;  2PLI A;  1HSK A;  2W3R A;  2W3S A;  2VFR A;  1W1J A;  3JS8 A;  3FW7 A;  2VFT A;  1SB3 B;  1WVE A;  1W1M A;  1FFU C;  2YVS A;  5FXP A;  5G5H B;  2WDW A;  3W8X A;  5FXE A;  1DIQ A;  2P13 A;  1AHZ A;  1V97 A;  1DZN A;  1ZXI C;  4OAL A;  1E0Y A;  2MBR A;  3EUB 3;  4PZF A;  4XLO A;  1FFV C;  1N61 C;  1N5W C;  1MBB A;  3AMZ A;  2E3T A;  1AHU A;  1W1R A;  2Y4G A;  3POP A;  3C0P A;  5I1W A;  1FO4 A;  3NS1 B;  3HSU A;  2P4P A;  3D2H A;  3W8Z A;  3NVZ B;  1DII A;  4PWC A;  5HHZ A;  2GQU A;  4PVK A;  1E8H A;  2BVH A;  2Y08 A;  1WVF A;  5L6G A;  3RJA A;  4MLA A;  3S1F A;  4HG0 A;  1E8G A;  3EJB B;  4PVH A;  1JRP A;  1VDV A;  2VAO A;  4ML8 A;  4PVE A;  1FIQ B;  1UXY A;  3W8W A;  3LLB A;  1W1O A;  3EJD B;  2VFV A;  4PWB A;  2NQW A;  5AWV A;  4O95 A;  1VAO A;  1W1K A;  3PM9 A;  2BVF A;  2QPM A;  1ZR6 A;  4JB1 A;  1MBT A;  1W1Q A;  5FXF A;  1JRO A;  1I19 A;  3EJE B;  3FW8 A;  3I99 A;  2I0K A;  3BW7 A;  2Q85 A;  2BVG A;  1AHV A;  3NVY B;  2GQT A;  1N63 C;  3NVW B;  2R8D A;  5I1V A;  2UUV A;  1RM6 B;  3B9J B;  1N62 C;  4DNS A;  4PYT A; 
#chains in the Genus database with same CATH homology
 4PVJ A;  1W1S A;  2EXR A;  5AE1 A;  3AM9 A;  3KJM A;  3TX1 A;  4BC7 A;  2O3G A;  2Y3S A;  1F0X A;  3D2D A;  5ADZ A;  2UUU A;  2QKN A;  5D79 A;  2W54 A;  5AE2 A;  3AN1 A;  3S1D A;  3DQ0 A;  5HQX A;  3D2J A;  4BC9 A;  3S1E A;  2PLS A;  2Y3R A;  1QLT A;  1W1L A;  3FWA A;  1T3Q C;  4EC3 A;  3S1C A;  4UD8 A;  3HRD C;  3FW9 A;  2RK5 A;  5HMR A;  2AXR A;  5K8E A;  2R2Z A;  5G5G B;  1N60 C;  1WYG A;  2W55 A;  2OAI A;  3RJ8 A;  2VFU A;  4JAY A;  2IPI A;  5AE3 A;  1E8F A;  3LAE A;  2P3H A;  4BCA A;  3PQB A;  3NVV B;  5L6F A;  3SR6 B;  3ETR B;  5FXD A;  3GSY A;  1N5X A;  3TSH A;  3TSJ A;  1QLU A;  3NRZ B;  3VTE A;  4BBY A;  4ZOH B;  2Q4W A;  3DED A;  2VFS A;  2PLI A;  1HSK A;  2W3R A;  2W3S A;  2VFR A;  1W1J A;  3JS8 A;  3FW7 A;  2VFT A;  1SB3 B;  1WVE A;  1W1M A;  1FFU C;  2YVS A;  5FXP A;  5G5H B;  2WDW A;  3W8X A;  5FXE A;  1DIQ A;  2P13 A;  1AHZ A;  1V97 A;  1DZN A;  1ZXI C;  4OAL A;  1E0Y A;  2MBR A;  3EUB 3;  4PZF A;  4XLO A;  1FFV C;  1N61 C;  1N5W C;  1MBB A;  3AMZ A;  2E3T A;  1AHU A;  1W1R A;  2Y4G A;  3POP A;  3C0P A;  5I1W A;  1FO4 A;  3NS1 B;  3HSU A;  2P4P A;  3D2H A;  3W8Z A;  3NVZ B;  1DII A;  4PWC A;  5HHZ A;  2GQU A;  4PVK A;  1E8H A;  2BVH A;  2Y08 A;  1WVF A;  5L6G A;  3RJA A;  4MLA A;  3S1F A;  4HG0 A;  1E8G A;  4PVH A;  1JRP A;  1VDV A;  2VAO A;  4ML8 A;  4PVE A;  1FIQ B;  1UXY A;  3W8W A;  3LLB A;  1W1O A;  2VFV A;  4PWB A;  2NQW A;  5AWV A;  4O95 A;  1VAO A;  1W1K A;  3PM9 A;  2BVF A;  2QPM A;  1ZR6 A;  4JB1 A;  1MBT A;  1W1Q A;  5FXF A;  1JRO A;  1I19 A;  3FW8 A;  3I99 A;  2I0K A;  3BW7 A;  2Q85 A;  2BVG A;  1AHV A;  3NVY B;  2GQT A;  1N63 C;  2R8D A;  3NVW B;  5I1V A;  2UUV A;  1RM6 B;  3B9J B;  1N62 C;  4DNS A;  4PYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...