3LLBA

The crystal structure of the protein pa3983 with unknown function from pseudomonas aeruginosa pao1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SYIKPLPSGDFIVKALTPVDAFNDFFGSEFSDEEFDTVGGLVMSAFGHLPKRNEVVELGEFRFRVLNADSRRVHLLRLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the protein NE1376 with unknown function from Nitrosomonas europaea ATCC 19718
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3llbA00
2BVHA 1W1QA 1WVEA 2RK5A 3I99A 4BCAA 5AE2A 5FXEA 2P4PA 1QLTA 1N63C 2AXRA 4HG0A 1N60C 3EUB3 3S1DA 2W3RA 1VDVA 3SR6B 1MBTA 2OAIA 3AM9A 4XLOA 3NS1B 5FXPA 4PYTA 2W55A 2VFRA 5AE3A 2YVSA 2O3GA 1F0XA 1DZNA 2E3TA 5HMRA 1FFVC 1FO4A 1V97A 1AHUA 3KJMA 4BC9A 1I19A 3S1EA 1N5WC 4JB1A 4OALA 1N61C 2BVFA 3C0PA 2Q4WA 5G5GB 3AN1A 2MBRA 5G5HB 3NVVB 5ADZA 1RM6B 3BW7A 1SB3B 3S1FA 1W1RA 1ZR6A 3DEDA 3NRZB 4BBYA 3W8XA 1AHVA 3W8ZA 4ML8A 1WYGA 3NVZB 1W1JA 2P3HA 1ZXIC 2BVGA 1FFUC 2NQWA 3LLBA 1MBBA 3W8WA 1AHZA 2I0KA 2W54A 3NVWB 5HHZA 3DQ0A 3JS8A 3LAEA 3PM9A 5FXFA 2R8DA 1W1SA 1W1OA 1T3QC 1QLUA 1JRPA 4BC7A 1WVFA 1W1LA 2GQTA 2EXRA 5HQXA 1E0YA 2VFVA 4ZOHB 2VFTA 1W1KA 2QPMA 1DIQA 4MLAA 1HSKA 3HRDC 2QKNA 3ETRB 1E8FA 3B9JB 1VAOA 2VFSA 3TX1A 2VFUA 1E8GA 3AMZA 3S1CA 1W1MA 1FIQB 2GQUA 4JAYA 2PLSA 1N62C 1UXYA 1E8HA 2R2ZA 2W3SA 5FXDA 5AE1A 1JROA 2Q85A 3NVYB 2VAOA 4O95A 1N5XA 1DIIA 2P13A 2PLIA
chains in the Genus database with same CATH superfamily
2BVHA 1W1QA 3FW9A 1WVEA 2RK5A 5I1WA 3I99A 3RJ8A 4BCAA 5AE2A 5FXEA 2P4PA 1QLTA 1N63C 2AXRA 4HG0A 1N60C 3EUB3 3S1DA 2W3RA 1VDVA 2IPIA 3HSUA 3SR6B 1MBTA 2Y3RA 2OAIA 3AM9A 5I1VA 4PWCA 4XLOA 3NS1B 5FXPA 4PYTA 4EC3A 2W55A 4UD8A 2VFRA 5AE3A 2YVSA 2O3GA 1F0XA 1DZNA 2E3TA 5HMRA 5K8EA 1FFVC 2UUUA 1FO4A 1V97A 1AHUA 3KJMA 4BC9A 3GSYA 1I19A 3S1EA 1N5WC 2Y3SA 4JB1A 4OALA 4PVHA 1N61C 2BVFA 3FW8A 3C0PA 2Q4WA 5G5GB 3AN1A 2MBRA 5G5HB 3NVVB 3VTEA 5ADZA 1RM6B 3BW7A 1SB3B 3S1FA 1W1RA 1ZR6A 3DEDA 3NRZB 4BBYA 3W8XA 1AHVA 3W8ZA 4ML8A 3D2HA 1WYGA 3NVZB 1W1JA 5D79A 4DNSA 2P3HA 1ZXIC 2BVGA 3RJAA 1FFUC 2NQWA 3LLBA 1MBBA 4PVEA 3W8WA 1AHZA 2I0KA 2Y08A 2W54A 3D2DA 5L6FA 3NVWB 5HHZA 3DQ0A 3JS8A 3LAEA 2Y4GA 3PM9A 5FXFA 2R8DA 1W1SA 1W1OA 1T3QC 3D2JA 3FW7A 1QLUA 1JRPA 4BC7A 5AWVA 1WVFA 1W1LA 5L6GA 3PQBA 3TSJA 2GQTA 2EXRA 5HQXA 1E0YA 3POPA 2VFVA 4ZOHB 2VFTA 1W1KA 2QPMA 4PVKA 1DIQA 4MLAA 1HSKA 3HRDC 2QKNA 3ETRB 1E8FA 3B9JB 1VAOA 2VFSA 4PWBA 4PZFA 3TX1A 2VFUA 1E8GA 3AMZA 3S1CA 1W1MA 1FIQB 2GQUA 4PVJA 2UUVA 4JAYA 3FWAA 2PLSA 1N62C 1UXYA 1E8HA 2R2ZA 2W3SA 5FXDA 3TSHA 5AE1A 1JROA 2Q85A 3NVYB 2VAOA 4O95A 1N5XA 1DIIA 2P13A 2PLIA 2WDWA
chains in the Genus database with same CATH topology
2BVHA 1W1QA 3FW9A 1WVEA 2RK5A 5I1WA 3I99A 3RJ8A 4BCAA 5AE2A 5FXEA 2P4PA 1QLTA 1N63C 2AXRA 4HG0A 1N60C 3EUB3 3S1DA 2W3RA 1VDVA 2IPIA 3HSUA 3SR6B 1MBTA 2Y3RA 2OAIA 3AM9A 5I1VA 4PWCA 4XLOA 3NS1B 5FXPA 4PYTA 4EC3A 2W55A 4UD8A 2VFRA 5AE3A 2YVSA 2O3GA 1F0XA 1DZNA 2E3TA 5HMRA 5K8EA 1FFVC 2UUUA 1FO4A 1V97A 1AHUA 3KJMA 4BC9A 3GSYA 1I19A 3S1EA 1N5WC 2Y3SA 4JB1A 4OALA 4PVHA 1N61C 2BVFA 3FW8A 3C0PA 2Q4WA 5G5GB 3AN1A 2MBRA 5G5HB 3NVVB 3VTEA 5ADZA 1RM6B 3BW7A 1SB3B 3S1FA 1W1RA 1ZR6A 3DEDA 3NRZB 4BBYA 3W8XA 1AHVA 3W8ZA 4ML8A 3D2HA 1WYGA 3NVZB 1W1JA 5D79A 4DNSA 2P3HA 1ZXIC 2BVGA 3RJAA 1FFUC 2NQWA 3LLBA 1MBBA 4PVEA 3W8WA 1AHZA 2I0KA 2Y08A 2W54A 3D2DA 5L6FA 3NVWB 5HHZA 3DQ0A 3JS8A 3LAEA 2Y4GA 3PM9A 5FXFA 2R8DA 1W1SA 1W1OA 1T3QC 3D2JA 3FW7A 1QLUA 1JRPA 4BC7A 5AWVA 1WVFA 1W1LA 5L6GA 3PQBA 3TSJA 2GQTA 2EXRA 5HQXA 1E0YA 3POPA 2VFVA 4ZOHB 2VFTA 1W1KA 2QPMA 4PVKA 1DIQA 4MLAA 1HSKA 3HRDC 2QKNA 3ETRB 1E8FA 3B9JB 1VAOA 2VFSA 4PWBA 4PZFA 3TX1A 2VFUA 1E8GA 3AMZA 3S1CA 1W1MA 1FIQB 2GQUA 4PVJA 2UUVA 4JAYA 3FWAA 2PLSA 1N62C 1UXYA 1E8HA 2R2ZA 2W3SA 5FXDA 3TSHA 5AE1A 1JROA 2Q85A 3NVYB 2VAOA 4O95A 1N5XA 1DIIA 2P13A 2PLIA 2WDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BVH A;  1W1Q A;  1WVE A;  2RK5 A;  3I99 A;  4BCA A;  5AE2 A;  5FXE A;  2P4P A;  1QLT A;  1N63 C;  2AXR A;  4HG0 A;  1N60 C;  3EUB 3;  3S1D A;  2W3R A;  1VDV A;  3SR6 B;  1MBT A;  2OAI A;  3AM9 A;  4XLO A;  3NS1 B;  5FXP A;  4PYT A;  2W55 A;  2VFR A;  5AE3 A;  2YVS A;  2O3G A;  1F0X A;  1DZN A;  2E3T A;  5HMR A;  1FFV C;  1FO4 A;  1V97 A;  1AHU A;  3KJM A;  4BC9 A;  1I19 A;  3S1E A;  1N5W C;  4JB1 A;  4OAL A;  1N61 C;  2BVF A;  3C0P A;  2Q4W A;  5G5G B;  3AN1 A;  2MBR A;  5G5H B;  3NVV B;  5ADZ A;  1RM6 B;  3BW7 A;  1SB3 B;  3S1F A;  1W1R A;  1ZR6 A;  3DED A;  3NRZ B;  4BBY A;  3W8X A;  1AHV A;  3W8Z A;  4ML8 A;  1WYG A;  3NVZ B;  1W1J A;  2P3H A;  1ZXI C;  2BVG A;  1FFU C;  2NQW A;  3LLB A;  1MBB A;  3W8W A;  1AHZ A;  2I0K A;  2W54 A;  3NVW B;  5HHZ A;  3DQ0 A;  3JS8 A;  3LAE A;  3PM9 A;  5FXF A;  2R8D A;  1W1S A;  1W1O A;  1T3Q C;  1QLU A;  1JRP A;  4BC7 A;  1WVF A;  1W1L A;  2GQT A;  2EXR A;  5HQX A;  1E0Y A;  2VFV A;  4ZOH B;  2VFT A;  1W1K A;  2QPM A;  1DIQ A;  4MLA A;  1HSK A;  3HRD C;  2QKN A;  3ETR B;  1E8F A;  3B9J B;  1VAO A;  2VFS A;  3TX1 A;  2VFU A;  1E8G A;  3AMZ A;  3S1C A;  1W1M A;  1FIQ B;  2GQU A;  4JAY A;  2PLS A;  1N62 C;  1UXY A;  1E8H A;  2R2Z A;  2W3S A;  5FXD A;  5AE1 A;  1JRO A;  2Q85 A;  3NVY B;  2VAO A;  4O95 A;  1N5X A;  1DII A;  2P13 A;  2PLI A; 
#chains in the Genus database with same CATH topology
 2BVH A;  1W1Q A;  3FW9 A;  1WVE A;  2RK5 A;  5I1W A;  3I99 A;  3RJ8 A;  4BCA A;  5AE2 A;  5FXE A;  2P4P A;  1QLT A;  1N63 C;  2AXR A;  4HG0 A;  1N60 C;  3EUB 3;  3S1D A;  2W3R A;  1VDV A;  2IPI A;  3HSU A;  3SR6 B;  1MBT A;  2Y3R A;  2OAI A;  3AM9 A;  5I1V A;  4PWC A;  4XLO A;  3NS1 B;  5FXP A;  4PYT A;  4EC3 A;  2W55 A;  4UD8 A;  2VFR A;  5AE3 A;  2YVS A;  2O3G A;  1F0X A;  1DZN A;  2E3T A;  5HMR A;  5K8E A;  1FFV C;  2UUU A;  1FO4 A;  1V97 A;  1AHU A;  3KJM A;  4BC9 A;  3GSY A;  1I19 A;  3S1E A;  1N5W C;  2Y3S A;  4JB1 A;  4OAL A;  4PVH A;  1N61 C;  2BVF A;  3FW8 A;  3C0P A;  2Q4W A;  5G5G B;  3AN1 A;  2MBR A;  5G5H B;  3NVV B;  3VTE A;  5ADZ A;  1RM6 B;  3BW7 A;  1SB3 B;  3S1F A;  1W1R A;  1ZR6 A;  3DED A;  3NRZ B;  4BBY A;  3W8X A;  1AHV A;  3W8Z A;  4ML8 A;  3D2H A;  1WYG A;  3NVZ B;  1W1J A;  5D79 A;  4DNS A;  2P3H A;  1ZXI C;  2BVG A;  3RJA A;  1FFU C;  2NQW A;  3LLB A;  1MBB A;  4PVE A;  3W8W A;  1AHZ A;  2I0K A;  2Y08 A;  2W54 A;  3D2D A;  5L6F A;  3NVW B;  5HHZ A;  3DQ0 A;  3JS8 A;  3LAE A;  2Y4G A;  3PM9 A;  5FXF A;  2R8D A;  1W1S A;  1W1O A;  1T3Q C;  3D2J A;  3FW7 A;  1QLU A;  1JRP A;  4BC7 A;  5AWV A;  1WVF A;  1W1L A;  5L6G A;  3PQB A;  3TSJ A;  2GQT A;  2EXR A;  5HQX A;  1E0Y A;  3POP A;  2VFV A;  4ZOH B;  2VFT A;  1W1K A;  2QPM A;  4PVK A;  1DIQ A;  4MLA A;  1HSK A;  3HRD C;  2QKN A;  3ETR B;  1E8F A;  3B9J B;  1VAO A;  2VFS A;  4PWB A;  4PZF A;  3TX1 A;  2VFU A;  1E8G A;  3AMZ A;  3S1C A;  1W1M A;  1FIQ B;  2GQU A;  4PVJ A;  2UUV A;  4JAY A;  3FWA A;  2PLS A;  1N62 C;  1UXY A;  1E8H A;  2R2Z A;  2W3S A;  5FXD A;  3TSH A;  5AE1 A;  1JRO A;  2Q85 A;  3NVY B;  2VAO A;  4O95 A;  1N5X A;  1DII A;  2P13 A;  2PLI A;  2WDW A; 
#chains in the Genus database with same CATH homology
 2BVH A;  1W1Q A;  3FW9 A;  1WVE A;  2RK5 A;  5I1W A;  3I99 A;  3RJ8 A;  4BCA A;  5AE2 A;  5FXE A;  2P4P A;  1QLT A;  1N63 C;  2AXR A;  4HG0 A;  1N60 C;  3EUB 3;  3S1D A;  2W3R A;  1VDV A;  2IPI A;  3HSU A;  3SR6 B;  1MBT A;  2Y3R A;  2OAI A;  3AM9 A;  5I1V A;  4PWC A;  4XLO A;  3NS1 B;  5FXP A;  4PYT A;  4EC3 A;  2W55 A;  4UD8 A;  2VFR A;  5AE3 A;  2YVS A;  2O3G A;  1F0X A;  1DZN A;  2E3T A;  5HMR A;  5K8E A;  1FFV C;  2UUU A;  1FO4 A;  1V97 A;  1AHU A;  3KJM A;  4BC9 A;  3GSY A;  1I19 A;  3S1E A;  1N5W C;  2Y3S A;  4JB1 A;  4OAL A;  4PVH A;  1N61 C;  2BVF A;  3FW8 A;  3C0P A;  2Q4W A;  5G5G B;  3AN1 A;  2MBR A;  5G5H B;  3NVV B;  3VTE A;  5ADZ A;  1RM6 B;  3BW7 A;  1SB3 B;  3S1F A;  1W1R A;  1ZR6 A;  3DED A;  3NRZ B;  4BBY A;  3W8X A;  1AHV A;  3W8Z A;  4ML8 A;  3D2H A;  1WYG A;  3NVZ B;  1W1J A;  5D79 A;  4DNS A;  2P3H A;  1ZXI C;  2BVG A;  3RJA A;  1FFU C;  2NQW A;  3LLB A;  1MBB A;  4PVE A;  3W8W A;  1AHZ A;  2I0K A;  2Y08 A;  2W54 A;  3D2D A;  5L6F A;  3NVW B;  5HHZ A;  3DQ0 A;  3JS8 A;  3LAE A;  2Y4G A;  3PM9 A;  5FXF A;  2R8D A;  1W1S A;  1W1O A;  1T3Q C;  3D2J A;  3FW7 A;  1QLU A;  1JRP A;  4BC7 A;  5AWV A;  1WVF A;  1W1L A;  5L6G A;  3PQB A;  3TSJ A;  2GQT A;  2EXR A;  5HQX A;  1E0Y A;  3POP A;  2VFV A;  4ZOH B;  2VFT A;  1W1K A;  2QPM A;  4PVK A;  1DIQ A;  4MLA A;  1HSK A;  3HRD C;  2QKN A;  3ETR B;  1E8F A;  3B9J B;  1VAO A;  2VFS A;  4PWB A;  4PZF A;  3TX1 A;  2VFU A;  1E8G A;  3AMZ A;  3S1C A;  1W1M A;  1FIQ B;  2GQU A;  4PVJ A;  2UUV A;  4JAY A;  3FWA A;  2PLS A;  1N62 C;  1UXY A;  1E8H A;  2R2Z A;  2W3S A;  5FXD A;  3TSH A;  5AE1 A;  1JRO A;  2Q85 A;  3NVY B;  2VAO A;  4O95 A;  1N5X A;  1DII A;  2P13 A;  2PLI A;  2WDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...