3LLBA

The crystal structure of the protein pa3983 with unknown function from pseudomonas aeruginosa pao1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SYIKPLPSGDFIVKALTPVDAFNDFFGSEFSDEEFDTVGGLVMSAFGHLPKRNEVVELGEFRFRVLNADSRRVHLLRLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title The crystal structure of the protein NE1376 with unknown function from Nitrosomonas europaea ATCC 19718
rcsb
source organism Pseudomonas aeruginosa
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3llbA00
3BW7A 3JS8A 4BBYA 2QKNA 1HSKA 2NQWA 3AM9A 3W8XA 1FO4A 1FFVC 1FFUC 3AMZA 4BC9A 3KJMA 5G5GB 1W1KA 1RM6B 1ZXIC 2RK5A 3EUB3 2VFSA 1W1SA 4ZOHB 1W1OA 2R8DA 4BC7A 5AE3A 2VAOA 2I0KA 1N5XA 2QPMA 1QLTA 2W55A 2YVSA 4HG0A 3S1FA 3HRDC 1JRPA 2BVFA 3LAEA 3NRZB 5FXPA 2GQTA 5HQXA 4JB1A 5HMRA 3SR6B 2R2ZA 1MBTA 1DIIA 3TX1A 4BCAA 4O95A 2AXRA 5AE1A 1E0YA 1N5WC 1W1JA 3W8WA 1ZR6A 1SB3B 2BVHA 2Q4WA 3NVYB 4JAYA 1VAOA 1N63C 1N62C 1UXYA 3ETRB 2W3SA 2O3GA 1E8FA 2BVGA 2P13A 1FIQB 3NVZB 2E3TA 4XLOA 1VDVA 2VFRA 3B9JB 1WYGA 1AHZA 5HHZA 4MLAA 1WVFA 2PLSA 3NVVB 4OALA 1E8HA 2VFUA 1MBBA 2P3HA 2W3RA 4PYTA 2EXRA 3AN1A 1W1LA 2MBRA 1V97A 3S1DA 1QLUA 1W1RA 2W54A 5FXFA 1DIQA 1AHUA 1F0XA 3W8ZA 1W1MA 3S1EA 1AHVA 5FXEA 5AE2A 3PM9A 5G5HB 1N61C 2P4PA 1JROA 2PLIA 2VFTA 1I19A 3C0PA 4ML8A 3NS1B 2VFVA 1W1QA 1WVEA 3LLBA 5ADZA 5FXDA 2GQUA 3I99A 3NVWB 3S1CA 1N60C 1E8GA 1DZNA 3DEDA 3DQ0A 2Q85A 1T3QC 2OAIA
chains in the Genus database with same CATH superfamily
3BW7A 3JS8A 4BBYA 2QKNA 1HSKA 2NQWA 3AM9A 3RJ8A 3W8XA 1FO4A 1FFVC 1FFUC 3AMZA 4BC9A 3HSUA 3KJMA 5G5GB 1W1KA 1RM6B 2Y3SA 1ZXIC 2RK5A 3EUB3 2VFSA 1W1SA 5I1WA 4ZOHB 1W1OA 2R8DA 4BC7A 5AE3A 4PVKA 2VAOA 4PWBA 2I0KA 1N5XA 5I1VA 2QPMA 1QLTA 2W55A 3PQBA 3FW8A 5K8EA 2YVSA 4HG0A 3S1FA 3HRDC 1JRPA 2BVFA 3LAEA 3NRZB 4PVJA 5FXPA 2GQTA 5AWVA 3GSYA 5HQXA 4JB1A 4PVHA 5HMRA 3SR6B 4UD8A 2R2ZA 1MBTA 1DIIA 3TX1A 4BCAA 4O95A 2AXRA 3TSHA 5AE1A 2Y08A 1E0YA 1N5WC 1W1JA 3D2DA 3FWAA 3POPA 3W8WA 1ZR6A 1SB3B 2BVHA 2Q4WA 3NVYB 4JAYA 1VAOA 1N63C 2IPIA 1N62C 1UXYA 3ETRB 2W3SA 2O3GA 1E8FA 2BVGA 2P13A 1FIQB 3NVZB 2E3TA 4XLOA 5L6GA 1VDVA 2VFRA 3D2JA 3B9JB 1WYGA 1AHZA 5HHZA 4MLAA 1WVFA 2PLSA 3NVVB 4OALA 1E8HA 3TSJA 2VFUA 1MBBA 2P3HA 2W3RA 4PYTA 2EXRA 3AN1A 1W1LA 2MBRA 1V97A 3S1DA 2UUVA 2UUUA 1QLUA 1W1RA 2W54A 4PZFA 5FXFA 1DIQA 1AHUA 1F0XA 3D2HA 3W8ZA 1W1MA 2Y3RA 3S1EA 2WDWA 4PWCA 1AHVA 5FXEA 5AE2A 3PM9A 5G5HB 1N61C 2P4PA 3RJAA 1JROA 4PVEA 2PLIA 2VFTA 1I19A 3C0PA 4ML8A 3VTEA 4EC3A 3NS1B 5L6FA 2VFVA 2Y4GA 1W1QA 1WVEA 5D79A 3FW7A 3LLBA 3FW9A 5ADZA 5FXDA 2GQUA 3I99A 3NVWB 3S1CA 1N60C 1E8GA 1DZNA 3DEDA 3DQ0A 2Q85A 4DNSA 1T3QC 2OAIA
chains in the Genus database with same CATH topology
3BW7A 3JS8A 4BBYA 2QKNA 1HSKA 2NQWA 3AM9A 3RJ8A 3W8XA 1FO4A 1FFVC 1FFUC 3AMZA 4BC9A 3HSUA 3KJMA 5G5GB 1W1KA 1RM6B 2Y3SA 1ZXIC 2RK5A 3EUB3 2VFSA 1W1SA 5I1WA 4ZOHB 1W1OA 2R8DA 4BC7A 5AE3A 4PVKA 2VAOA 4PWBA 2I0KA 1N5XA 5I1VA 2QPMA 1QLTA 2W55A 3PQBA 3FW8A 5K8EA 2YVSA 4HG0A 3S1FA 3HRDC 1JRPA 2BVFA 3LAEA 3NRZB 4PVJA 5FXPA 2GQTA 5AWVA 3GSYA 5HQXA 4JB1A 4PVHA 5HMRA 3SR6B 4UD8A 2R2ZA 1MBTA 1DIIA 3TX1A 4BCAA 4O95A 2AXRA 3TSHA 5AE1A 2Y08A 1E0YA 1N5WC 1W1JA 3D2DA 3FWAA 3POPA 3W8WA 1ZR6A 1SB3B 2BVHA 2Q4WA 3NVYB 4JAYA 1VAOA 1N63C 2IPIA 1N62C 1UXYA 3ETRB 2W3SA 2O3GA 1E8FA 2BVGA 2P13A 1FIQB 3NVZB 2E3TA 4XLOA 5L6GA 1VDVA 2VFRA 3D2JA 3B9JB 1WYGA 1AHZA 5HHZA 4MLAA 1WVFA 2PLSA 3NVVB 4OALA 1E8HA 3TSJA 2VFUA 1MBBA 2P3HA 2W3RA 4PYTA 2EXRA 3AN1A 1W1LA 2MBRA 1V97A 3S1DA 2UUVA 2UUUA 1QLUA 1W1RA 2W54A 4PZFA 5FXFA 1DIQA 1AHUA 1F0XA 3D2HA 3W8ZA 1W1MA 2Y3RA 3S1EA 2WDWA 4PWCA 1AHVA 5FXEA 5AE2A 3PM9A 5G5HB 1N61C 2P4PA 3RJAA 1JROA 4PVEA 2PLIA 2VFTA 1I19A 3C0PA 4ML8A 3VTEA 4EC3A 3NS1B 5L6FA 2VFVA 2Y4GA 1W1QA 1WVEA 5D79A 3FW7A 3LLBA 3FW9A 5ADZA 5FXDA 2GQUA 3I99A 3NVWB 3S1CA 1N60C 1E8GA 1DZNA 3DEDA 3DQ0A 2Q85A 4DNSA 1T3QC 2OAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW7 A;  3JS8 A;  4BBY A;  2QKN A;  1HSK A;  2NQW A;  3AM9 A;  3W8X A;  1FO4 A;  1FFV C;  1FFU C;  3AMZ A;  4BC9 A;  3KJM A;  5G5G B;  1W1K A;  1RM6 B;  1ZXI C;  2RK5 A;  3EUB 3;  2VFS A;  1W1S A;  4ZOH B;  1W1O A;  2R8D A;  4BC7 A;  5AE3 A;  2VAO A;  2I0K A;  1N5X A;  2QPM A;  1QLT A;  2W55 A;  2YVS A;  4HG0 A;  3S1F A;  3HRD C;  1JRP A;  2BVF A;  3LAE A;  3NRZ B;  5FXP A;  2GQT A;  5HQX A;  4JB1 A;  5HMR A;  3SR6 B;  2R2Z A;  1MBT A;  1DII A;  3TX1 A;  4BCA A;  4O95 A;  2AXR A;  5AE1 A;  1E0Y A;  1N5W C;  1W1J A;  3W8W A;  1ZR6 A;  1SB3 B;  2BVH A;  2Q4W A;  3NVY B;  4JAY A;  1VAO A;  1N63 C;  1N62 C;  1UXY A;  3ETR B;  2W3S A;  2O3G A;  1E8F A;  2BVG A;  2P13 A;  1FIQ B;  3NVZ B;  2E3T A;  4XLO A;  1VDV A;  2VFR A;  3B9J B;  1WYG A;  1AHZ A;  5HHZ A;  4MLA A;  1WVF A;  2PLS A;  3NVV B;  4OAL A;  1E8H A;  2VFU A;  1MBB A;  2P3H A;  2W3R A;  4PYT A;  2EXR A;  3AN1 A;  1W1L A;  2MBR A;  1V97 A;  3S1D A;  1QLU A;  1W1R A;  2W54 A;  5FXF A;  1DIQ A;  1AHU A;  1F0X A;  3W8Z A;  1W1M A;  3S1E A;  1AHV A;  5FXE A;  5AE2 A;  3PM9 A;  5G5H B;  1N61 C;  2P4P A;  1JRO A;  2PLI A;  2VFT A;  1I19 A;  3C0P A;  4ML8 A;  3NS1 B;  2VFV A;  1W1Q A;  1WVE A;  3LLB A;  5ADZ A;  5FXD A;  2GQU A;  3I99 A;  3NVW B;  3S1C A;  1N60 C;  1E8G A;  1DZN A;  3DED A;  3DQ0 A;  2Q85 A;  1T3Q C;  2OAI A; 
#chains in the Genus database with same CATH topology
 3BW7 A;  3JS8 A;  4BBY A;  2QKN A;  1HSK A;  2NQW A;  3AM9 A;  3RJ8 A;  3W8X A;  1FO4 A;  1FFV C;  1FFU C;  3AMZ A;  4BC9 A;  3HSU A;  3KJM A;  5G5G B;  1W1K A;  1RM6 B;  2Y3S A;  1ZXI C;  2RK5 A;  3EUB 3;  2VFS A;  1W1S A;  5I1W A;  4ZOH B;  1W1O A;  2R8D A;  4BC7 A;  5AE3 A;  4PVK A;  2VAO A;  4PWB A;  2I0K A;  1N5X A;  5I1V A;  2QPM A;  1QLT A;  2W55 A;  3PQB A;  3FW8 A;  5K8E A;  2YVS A;  4HG0 A;  3S1F A;  3HRD C;  1JRP A;  2BVF A;  3LAE A;  3NRZ B;  4PVJ A;  5FXP A;  2GQT A;  5AWV A;  3GSY A;  5HQX A;  4JB1 A;  4PVH A;  5HMR A;  3SR6 B;  4UD8 A;  2R2Z A;  1MBT A;  1DII A;  3TX1 A;  4BCA A;  4O95 A;  2AXR A;  3TSH A;  5AE1 A;  2Y08 A;  1E0Y A;  1N5W C;  1W1J A;  3D2D A;  3FWA A;  3POP A;  3W8W A;  1ZR6 A;  1SB3 B;  2BVH A;  2Q4W A;  3NVY B;  4JAY A;  1VAO A;  1N63 C;  2IPI A;  1N62 C;  1UXY A;  3ETR B;  2W3S A;  2O3G A;  1E8F A;  2BVG A;  2P13 A;  1FIQ B;  3NVZ B;  2E3T A;  4XLO A;  5L6G A;  1VDV A;  2VFR A;  3D2J A;  3B9J B;  1WYG A;  1AHZ A;  5HHZ A;  4MLA A;  1WVF A;  2PLS A;  3NVV B;  4OAL A;  1E8H A;  3TSJ A;  2VFU A;  1MBB A;  2P3H A;  2W3R A;  4PYT A;  2EXR A;  3AN1 A;  1W1L A;  2MBR A;  1V97 A;  3S1D A;  2UUV A;  2UUU A;  1QLU A;  1W1R A;  2W54 A;  4PZF A;  5FXF A;  1DIQ A;  1AHU A;  1F0X A;  3D2H A;  3W8Z A;  1W1M A;  2Y3R A;  3S1E A;  2WDW A;  4PWC A;  1AHV A;  5FXE A;  5AE2 A;  3PM9 A;  5G5H B;  1N61 C;  2P4P A;  3RJA A;  1JRO A;  4PVE A;  2PLI A;  2VFT A;  1I19 A;  3C0P A;  4ML8 A;  3VTE A;  4EC3 A;  3NS1 B;  5L6F A;  2VFV A;  2Y4G A;  1W1Q A;  1WVE A;  5D79 A;  3FW7 A;  3LLB A;  3FW9 A;  5ADZ A;  5FXD A;  2GQU A;  3I99 A;  3NVW B;  3S1C A;  1N60 C;  1E8G A;  1DZN A;  3DED A;  3DQ0 A;  2Q85 A;  4DNS A;  1T3Q C;  2OAI A; 
#chains in the Genus database with same CATH homology
 3BW7 A;  3JS8 A;  4BBY A;  2QKN A;  1HSK A;  2NQW A;  3AM9 A;  3RJ8 A;  3W8X A;  1FO4 A;  1FFV C;  1FFU C;  3AMZ A;  4BC9 A;  3HSU A;  3KJM A;  5G5G B;  1W1K A;  1RM6 B;  2Y3S A;  1ZXI C;  2RK5 A;  3EUB 3;  2VFS A;  1W1S A;  5I1W A;  4ZOH B;  1W1O A;  2R8D A;  4BC7 A;  5AE3 A;  4PVK A;  2VAO A;  4PWB A;  2I0K A;  1N5X A;  5I1V A;  2QPM A;  1QLT A;  2W55 A;  3PQB A;  3FW8 A;  5K8E A;  2YVS A;  4HG0 A;  3S1F A;  3HRD C;  1JRP A;  2BVF A;  3LAE A;  3NRZ B;  4PVJ A;  5FXP A;  2GQT A;  5AWV A;  3GSY A;  5HQX A;  4JB1 A;  4PVH A;  5HMR A;  3SR6 B;  4UD8 A;  2R2Z A;  1MBT A;  1DII A;  3TX1 A;  4BCA A;  4O95 A;  2AXR A;  3TSH A;  5AE1 A;  2Y08 A;  1E0Y A;  1N5W C;  1W1J A;  3D2D A;  3FWA A;  3POP A;  3W8W A;  1ZR6 A;  1SB3 B;  2BVH A;  2Q4W A;  3NVY B;  4JAY A;  1VAO A;  1N63 C;  2IPI A;  1N62 C;  1UXY A;  3ETR B;  2W3S A;  2O3G A;  1E8F A;  2BVG A;  2P13 A;  1FIQ B;  3NVZ B;  2E3T A;  4XLO A;  5L6G A;  1VDV A;  2VFR A;  3D2J A;  3B9J B;  1WYG A;  1AHZ A;  5HHZ A;  4MLA A;  1WVF A;  2PLS A;  3NVV B;  4OAL A;  1E8H A;  3TSJ A;  2VFU A;  1MBB A;  2P3H A;  2W3R A;  4PYT A;  2EXR A;  3AN1 A;  1W1L A;  2MBR A;  1V97 A;  3S1D A;  2UUV A;  2UUU A;  1QLU A;  1W1R A;  2W54 A;  4PZF A;  5FXF A;  1DIQ A;  1AHU A;  1F0X A;  3D2H A;  3W8Z A;  1W1M A;  2Y3R A;  3S1E A;  2WDW A;  4PWC A;  1AHV A;  5FXE A;  5AE2 A;  3PM9 A;  5G5H B;  1N61 C;  2P4P A;  3RJA A;  1JRO A;  4PVE A;  2PLI A;  2VFT A;  1I19 A;  3C0P A;  4ML8 A;  3VTE A;  4EC3 A;  3NS1 B;  5L6F A;  2VFV A;  2Y4G A;  1W1Q A;  1WVE A;  5D79 A;  3FW7 A;  3LLB A;  3FW9 A;  5ADZ A;  5FXD A;  2GQU A;  3I99 A;  3NVW B;  3S1C A;  1N60 C;  1E8G A;  1DZN A;  3DED A;  3DQ0 A;  2Q85 A;  4DNS A;  1T3Q C;  2OAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...