3LLBA

The crystal structure of the protein pa3983 with unknown function from pseudomonas aeruginosa pao1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
SYIKPLPSGDFIVKALTPVDAFNDFFGSEFSDEEFDTVGGLVMSAFGHLPKRNEVVELGEFRFRVLNADSRRVHLLRLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title The crystal structure of the protein NE1376 with unknown function from Nitrosomonas europaea ATCC 19718
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 18
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3llbA00
5AE2A 1QLUA 4JB1A 3B9JB 3NVVB 2VAOA 3LLBA 4OALA 1FFVC 1I19A 2W3SA 2YVSA 5HHZA 1WVEA 3W8ZA 1FIQB 1W1JA 1WVFA 1DZNA 3DQ0A 1ZR6A 5AE1A 1N63C 1JROA 4ZOHB 3EUB3 1N60C 1SB3B 5G5GB 4BC7A 1DIQA 2W55A 3TX1A 5FXEA 3NVYB 2P13A 1W1OA 1W1LA 1ZXIC 4XLOA 1HSKA 2O3GA 3NRZB 1WYGA 3I99A 1N5WC 3AM9A 2GQUA 1AHZA 2VFVA 3KJMA 3DEDA 1FO4A 2VFSA 3HRDC 1AHUA 4PYTA 1RM6B 1W1MA 1DIIA 3NVZB 3S1FA 4ML8A 5HMRA 3S1EA 1W1KA 1AHVA 1N62C 4BCAA 2MBRA 2I0KA 1E8FA 2OAIA 1JRPA 2P4PA 3NS1B 1W1RA 1VDVA 4BC9A 1E0YA 2QPMA 2VFRA 2W54A 2VFTA 4JAYA 4BBYA 3SR6B 2PLSA 1MBBA 4HG0A 5ADZA 2R2ZA 1W1QA 2QKNA 1E8HA 2P3HA 3S1DA 2GQTA 1T3QC 2W3RA 2BVHA 1V97A 4MLAA 3W8WA 1N5XA 3BW7A 5FXDA 1N61C 3C0PA 3PM9A 3LAEA 2Q85A 1UXYA 3ETRB 2AXRA 5FXFA 2Q4WA 1E8GA 2EXRA 2BVGA 5AE3A 1FFUC 3JS8A 5FXPA 2PLIA 3NVWB 5G5HB 1MBTA 1QLTA 2NQWA 1F0XA 1VAOA 2RK5A 2R8DA 4O95A 2VFUA 3W8XA 5HQXA 2E3TA 3S1CA 3AMZA 1W1SA 3AN1A 2BVFA
chains in the Genus database with same CATH superfamily
5AE2A 1QLUA 4JB1A 3B9JB 3NVVB 3FWAA 2VAOA 3LLBA 4OALA 1FFVC 1I19A 2W3SA 4DNSA 2YVSA 5HHZA 1WVEA 3RJAA 3W8ZA 1FIQB 4EC3A 1W1JA 3D2JA 1WVFA 2Y08A 1DZNA 2UUVA 2Y4GA 3DQ0A 3POPA 1ZR6A 4PVJA 5AE1A 1N63C 1JROA 5D79A 4ZOHB 3EUB3 1N60C 1SB3B 5G5GB 4BC7A 1DIQA 5I1VA 2W55A 3TX1A 5FXEA 3NVYB 2P13A 1W1OA 4PZFA 1W1LA 5K8EA 1ZXIC 2Y3SA 4XLOA 1HSKA 2IPIA 3D2HA 2O3GA 3NRZB 1WYGA 3I99A 1N5WC 3AM9A 2GQUA 1AHZA 2VFVA 3FW8A 3KJMA 3PQBA 3DEDA 1FO4A 5L6GA 2VFSA 3HRDC 1AHUA 4PYTA 1RM6B 1W1MA 3FW9A 1DIIA 3NVZB 3S1FA 4ML8A 5HMRA 3S1EA 1W1KA 1AHVA 4PVHA 1N62C 3GSYA 4BCAA 2MBRA 2I0KA 1E8FA 2OAIA 1JRPA 2P4PA 3NS1B 3VTEA 1W1RA 1VDVA 4BC9A 1E0YA 2QPMA 2VFRA 2W54A 2VFTA 4JAYA 4BBYA 3SR6B 2PLSA 1MBBA 4HG0A 5ADZA 2R2ZA 3HSUA 1W1QA 3TSHA 2QKNA 1E8HA 2P3HA 3RJ8A 3S1DA 2GQTA 1T3QC 4UD8A 2W3RA 4PVEA 2BVHA 1V97A 4MLAA 3W8WA 1N5XA 3BW7A 5FXDA 1N61C 3C0PA 3PM9A 4PVKA 3LAEA 2UUUA 5AWVA 2Q85A 1UXYA 3ETRB 2AXRA 5FXFA 4PWCA 2Q4WA 3TSJA 1E8GA 2EXRA 2BVGA 5AE3A 1FFUC 3JS8A 5FXPA 2PLIA 3NVWB 3FW7A 5G5HB 5I1WA 1MBTA 5L6FA 1QLTA 2NQWA 4PWBA 1F0XA 1VAOA 2Y3RA 2RK5A 2R8DA 4O95A 2VFUA 3W8XA 5HQXA 2E3TA 3S1CA 3AMZA 1W1SA 3D2DA 3AN1A 2WDWA 2BVFA
chains in the Genus database with same CATH topology
5AE2A 1QLUA 4JB1A 3B9JB 3NVVB 3FWAA 2VAOA 3LLBA 4OALA 1FFVC 1I19A 2W3SA 4DNSA 2YVSA 5HHZA 1WVEA 3RJAA 3W8ZA 1FIQB 4EC3A 1W1JA 3D2JA 1WVFA 2Y08A 1DZNA 2UUVA 2Y4GA 3DQ0A 3POPA 1ZR6A 4PVJA 5AE1A 1N63C 1JROA 5D79A 4ZOHB 3EUB3 1N60C 1SB3B 5G5GB 4BC7A 1DIQA 5I1VA 2W55A 3TX1A 5FXEA 3NVYB 2P13A 1W1OA 4PZFA 1W1LA 5K8EA 1ZXIC 2Y3SA 4XLOA 1HSKA 2IPIA 3D2HA 2O3GA 3NRZB 1WYGA 3I99A 1N5WC 3AM9A 2GQUA 1AHZA 2VFVA 3FW8A 3KJMA 3PQBA 3DEDA 1FO4A 5L6GA 2VFSA 3HRDC 1AHUA 4PYTA 1RM6B 1W1MA 3FW9A 1DIIA 3NVZB 3S1FA 4ML8A 5HMRA 3S1EA 1W1KA 1AHVA 4PVHA 1N62C 3GSYA 4BCAA 2MBRA 2I0KA 1E8FA 2OAIA 1JRPA 2P4PA 3NS1B 3VTEA 1W1RA 1VDVA 4BC9A 1E0YA 2QPMA 2VFRA 2W54A 2VFTA 4JAYA 4BBYA 3SR6B 2PLSA 1MBBA 4HG0A 5ADZA 2R2ZA 3HSUA 1W1QA 3TSHA 2QKNA 1E8HA 2P3HA 3RJ8A 3S1DA 2GQTA 1T3QC 4UD8A 2W3RA 4PVEA 2BVHA 1V97A 4MLAA 3W8WA 1N5XA 3BW7A 5FXDA 1N61C 3C0PA 3PM9A 4PVKA 3LAEA 2UUUA 5AWVA 2Q85A 1UXYA 3ETRB 2AXRA 5FXFA 4PWCA 2Q4WA 3TSJA 1E8GA 2EXRA 2BVGA 5AE3A 1FFUC 3JS8A 5FXPA 2PLIA 3NVWB 3FW7A 5G5HB 5I1WA 1MBTA 5L6FA 1QLTA 2NQWA 4PWBA 1F0XA 1VAOA 2Y3RA 2RK5A 2R8DA 4O95A 2VFUA 3W8XA 5HQXA 2E3TA 3S1CA 3AMZA 1W1SA 3D2DA 3AN1A 2WDWA 2BVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE2 A;  1QLU A;  4JB1 A;  3B9J B;  3NVV B;  2VAO A;  3LLB A;  4OAL A;  1FFV C;  1I19 A;  2W3S A;  2YVS A;  5HHZ A;  1WVE A;  3W8Z A;  1FIQ B;  1W1J A;  1WVF A;  1DZN A;  3DQ0 A;  1ZR6 A;  5AE1 A;  1N63 C;  1JRO A;  4ZOH B;  3EUB 3;  1N60 C;  1SB3 B;  5G5G B;  4BC7 A;  1DIQ A;  2W55 A;  3TX1 A;  5FXE A;  3NVY B;  2P13 A;  1W1O A;  1W1L A;  1ZXI C;  4XLO A;  1HSK A;  2O3G A;  3NRZ B;  1WYG A;  3I99 A;  1N5W C;  3AM9 A;  2GQU A;  1AHZ A;  2VFV A;  3KJM A;  3DED A;  1FO4 A;  2VFS A;  3HRD C;  1AHU A;  4PYT A;  1RM6 B;  1W1M A;  1DII A;  3NVZ B;  3S1F A;  4ML8 A;  5HMR A;  3S1E A;  1W1K A;  1AHV A;  1N62 C;  4BCA A;  2MBR A;  2I0K A;  1E8F A;  2OAI A;  1JRP A;  2P4P A;  3NS1 B;  1W1R A;  1VDV A;  4BC9 A;  1E0Y A;  2QPM A;  2VFR A;  2W54 A;  2VFT A;  4JAY A;  4BBY A;  3SR6 B;  2PLS A;  1MBB A;  4HG0 A;  5ADZ A;  2R2Z A;  1W1Q A;  2QKN A;  1E8H A;  2P3H A;  3S1D A;  2GQT A;  1T3Q C;  2W3R A;  2BVH A;  1V97 A;  4MLA A;  3W8W A;  1N5X A;  3BW7 A;  5FXD A;  1N61 C;  3C0P A;  3PM9 A;  3LAE A;  2Q85 A;  1UXY A;  3ETR B;  2AXR A;  5FXF A;  2Q4W A;  1E8G A;  2EXR A;  2BVG A;  5AE3 A;  1FFU C;  3JS8 A;  5FXP A;  2PLI A;  3NVW B;  5G5H B;  1MBT A;  1QLT A;  2NQW A;  1F0X A;  1VAO A;  2RK5 A;  2R8D A;  4O95 A;  2VFU A;  3W8X A;  5HQX A;  2E3T A;  3S1C A;  3AMZ A;  1W1S A;  3AN1 A;  2BVF A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  1QLU A;  4JB1 A;  3B9J B;  3NVV B;  3FWA A;  2VAO A;  3LLB A;  4OAL A;  1FFV C;  1I19 A;  2W3S A;  4DNS A;  2YVS A;  5HHZ A;  1WVE A;  3RJA A;  3W8Z A;  1FIQ B;  4EC3 A;  1W1J A;  3D2J A;  1WVF A;  2Y08 A;  1DZN A;  2UUV A;  2Y4G A;  3DQ0 A;  3POP A;  1ZR6 A;  4PVJ A;  5AE1 A;  1N63 C;  1JRO A;  5D79 A;  4ZOH B;  3EUB 3;  1N60 C;  1SB3 B;  5G5G B;  4BC7 A;  1DIQ A;  5I1V A;  2W55 A;  3TX1 A;  5FXE A;  3NVY B;  2P13 A;  1W1O A;  4PZF A;  1W1L A;  5K8E A;  1ZXI C;  2Y3S A;  4XLO A;  1HSK A;  2IPI A;  3D2H A;  2O3G A;  3NRZ B;  1WYG A;  3I99 A;  1N5W C;  3AM9 A;  2GQU A;  1AHZ A;  2VFV A;  3FW8 A;  3KJM A;  3PQB A;  3DED A;  1FO4 A;  5L6G A;  2VFS A;  3HRD C;  1AHU A;  4PYT A;  1RM6 B;  1W1M A;  3FW9 A;  1DII A;  3NVZ B;  3S1F A;  4ML8 A;  5HMR A;  3S1E A;  1W1K A;  1AHV A;  4PVH A;  1N62 C;  3GSY A;  4BCA A;  2MBR A;  2I0K A;  1E8F A;  2OAI A;  1JRP A;  2P4P A;  3NS1 B;  3VTE A;  1W1R A;  1VDV A;  4BC9 A;  1E0Y A;  2QPM A;  2VFR A;  2W54 A;  2VFT A;  4JAY A;  4BBY A;  3SR6 B;  2PLS A;  1MBB A;  4HG0 A;  5ADZ A;  2R2Z A;  3HSU A;  1W1Q A;  3TSH A;  2QKN A;  1E8H A;  2P3H A;  3RJ8 A;  3S1D A;  2GQT A;  1T3Q C;  4UD8 A;  2W3R A;  4PVE A;  2BVH A;  1V97 A;  4MLA A;  3W8W A;  1N5X A;  3BW7 A;  5FXD A;  1N61 C;  3C0P A;  3PM9 A;  4PVK A;  3LAE A;  2UUU A;  5AWV A;  2Q85 A;  1UXY A;  3ETR B;  2AXR A;  5FXF A;  4PWC A;  2Q4W A;  3TSJ A;  1E8G A;  2EXR A;  2BVG A;  5AE3 A;  1FFU C;  3JS8 A;  5FXP A;  2PLI A;  3NVW B;  3FW7 A;  5G5H B;  5I1W A;  1MBT A;  5L6F A;  1QLT A;  2NQW A;  4PWB A;  1F0X A;  1VAO A;  2Y3R A;  2RK5 A;  2R8D A;  4O95 A;  2VFU A;  3W8X A;  5HQX A;  2E3T A;  3S1C A;  3AMZ A;  1W1S A;  3D2D A;  3AN1 A;  2WDW A;  2BVF A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  1QLU A;  4JB1 A;  3B9J B;  3NVV B;  3FWA A;  2VAO A;  3LLB A;  4OAL A;  1FFV C;  1I19 A;  2W3S A;  4DNS A;  2YVS A;  5HHZ A;  1WVE A;  3RJA A;  3W8Z A;  1FIQ B;  4EC3 A;  1W1J A;  3D2J A;  1WVF A;  2Y08 A;  1DZN A;  2UUV A;  2Y4G A;  3DQ0 A;  3POP A;  1ZR6 A;  4PVJ A;  5AE1 A;  1N63 C;  1JRO A;  5D79 A;  4ZOH B;  3EUB 3;  1N60 C;  1SB3 B;  5G5G B;  4BC7 A;  1DIQ A;  5I1V A;  2W55 A;  3TX1 A;  5FXE A;  3NVY B;  2P13 A;  1W1O A;  4PZF A;  1W1L A;  5K8E A;  1ZXI C;  2Y3S A;  4XLO A;  1HSK A;  2IPI A;  3D2H A;  2O3G A;  3NRZ B;  1WYG A;  3I99 A;  1N5W C;  3AM9 A;  2GQU A;  1AHZ A;  2VFV A;  3FW8 A;  3KJM A;  3PQB A;  3DED A;  1FO4 A;  5L6G A;  2VFS A;  3HRD C;  1AHU A;  4PYT A;  1RM6 B;  1W1M A;  3FW9 A;  1DII A;  3NVZ B;  3S1F A;  4ML8 A;  5HMR A;  3S1E A;  1W1K A;  1AHV A;  4PVH A;  1N62 C;  3GSY A;  4BCA A;  2MBR A;  2I0K A;  1E8F A;  2OAI A;  1JRP A;  2P4P A;  3NS1 B;  3VTE A;  1W1R A;  1VDV A;  4BC9 A;  1E0Y A;  2QPM A;  2VFR A;  2W54 A;  2VFT A;  4JAY A;  4BBY A;  3SR6 B;  2PLS A;  1MBB A;  4HG0 A;  5ADZ A;  2R2Z A;  3HSU A;  1W1Q A;  3TSH A;  2QKN A;  1E8H A;  2P3H A;  3RJ8 A;  3S1D A;  2GQT A;  1T3Q C;  4UD8 A;  2W3R A;  4PVE A;  2BVH A;  1V97 A;  4MLA A;  3W8W A;  1N5X A;  3BW7 A;  5FXD A;  1N61 C;  3C0P A;  3PM9 A;  4PVK A;  3LAE A;  2UUU A;  5AWV A;  2Q85 A;  1UXY A;  3ETR B;  2AXR A;  5FXF A;  4PWC A;  2Q4W A;  3TSJ A;  1E8G A;  2EXR A;  2BVG A;  5AE3 A;  1FFU C;  3JS8 A;  5FXP A;  2PLI A;  3NVW B;  3FW7 A;  5G5H B;  5I1W A;  1MBT A;  5L6F A;  1QLT A;  2NQW A;  4PWB A;  1F0X A;  1VAO A;  2Y3R A;  2RK5 A;  2R8D A;  4O95 A;  2VFU A;  3W8X A;  5HQX A;  2E3T A;  3S1C A;  3AMZ A;  1W1S A;  3D2D A;  3AN1 A;  2WDW A;  2BVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...