2MBRA

Murb wild type, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 105
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2mbrA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2mbrA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 2mbrA01
1W1MA 4ML8A 2VFTA 3S1EA 2BVGA 2MBRA 2QKNA 2VFVA 3AM9A 4BC9A 3W8XA 3NVWB 4PVHA 3AN1A 5FXPA 2NQWA 5D79A 1JROA 4BBYA 2R2ZA 3LAEA 2P3HA 4OALA 3W8ZA 1N62C 1FO4A 1AHZA 2RK5A 2W55A 3GSYA 2VFRA 3PM9A 3C0PA 2VFUA 1UXYA 2W54A 3TX1A 4DNSA 1N5XA 2P4PA 4PVEA 3NVYB 5G5GB 1HSKA 3TSJA 1MBTA 1DIIA 1VAOA 3KJMA 4BCAA 2GQUA 1QLTA 4O95A 4PWCA 5HHZA 3NRZB 4PVJA 2GQTA 1W1OA 5HQXA 3W8WA 2E3TA 4HG0A 3JS8A 3LLBA 2QPMA 2VFSA 1T3QC 4PWBA 1W1KA 2P13A 1DZNA 1AHVA 1W1LA 3BW7A 5FXEA 1E0YA 5AE3A 2YVSA 3NVVB 3S1CA 1W1SA 1WVFA 5HMRA 1MBBA 3D2JA 1E8FA 1FFUC 2Q85A 2EXRA 3I99A 3S1FA 3VTEA 4JAYA 1F0XA 1W1JA 2AXRA 2VAOA 3D2HA 5G5HB 3DQ0A 1N5WC 1E8GA 5ADZA 2Q4WA 1I19A 1QLUA 1W1RA 4UD8A 4MLAA 1FIQB 3FWAA 3NS1B 1JRPA 1N60C 3FW8A 5AE2A 3SR6B 4BC7A 1SB3B 3B9JB 1WVEA 4PVKA 5AE1A 2W3SA 1V97A 1W1QA 1ZR6A 3D2DA 4PYTA 2BVFA 3FW7A 5FXDA 3NVZB 2BVHA 1FFVC 5FXFA 2PLIA 2PLSA 3S1DA 3ETRB 1N61C 3DEDA 3EUB3 4EC3A 1N63C 4XLOA 2I0KA 3HRDC 4ZOHB 1WYGA 1ZXIC 1E8HA 2O3GA 2W3RA 1AHUA 3TSHA 1RM6B 1DIQA 4PZFA 2OAIA 1VDVA 3AMZA 3FW9A 4JB1A 2R8DA
chains in the Genus database with same CATH superfamily
1W1MA 3EJBB 4ML8A 3POPA 2VFTA 3S1EA 2BVGA 2MBRA 2QKNA 2VFVA 3AM9A 4BC9A 3W8XA 3NVWB 4PVHA 3AN1A 5FXPA 2NQWA 5D79A 1JROA 4BBYA 2R2ZA 3LAEA 2P3HA 4OALA 5I1WA 3W8ZA 1N62C 1FO4A 1AHZA 2RK5A 2W55A 3GSYA 2VFRA 3PM9A 3C0PA 2VFUA 1UXYA 2W54A 3TX1A 4DNSA 2Y4GA 1N5XA 5I1VA 3NVYB 4PVEA 2P4PA 2Y08A 1HSKA 5G5GB 3TSJA 1MBTA 5AWVA 1DIIA 1VAOA 3KJMA 4BCAA 2GQUA 1QLTA 4O95A 3EJDB 4PWCA 5HHZA 2IPIA 3EJEB 3NRZB 4PVJA 2GQTA 1W1OA 5HQXA 3W8WA 2E3TA 4HG0A 3JS8A 3LLBA 2QPMA 2VFSA 1T3QC 4PWBA 1W1KA 2P13A 1DZNA 1AHVA 1W1LA 3BW7A 5FXEA 1E0YA 2Y3RA 5AE3A 3NVVB 2YVSA 3S1CA 1W1SA 3RJ8A 1WVFA 5HMRA 1MBBA 3D2JA 1E8FA 1FFUC 2Q85A 2EXRA 3I99A 3S1FA 3VTEA 4JAYA 2UUUA 1F0XA 1W1JA 2AXRA 2VAOA 3D2HA 5G5HB 3DQ0A 2WDWA 1N5WC 1E8GA 5ADZA 2Q4WA 3RJAA 1I19A 1QLUA 1W1RA 4UD8A 4MLAA 1FIQB 3FWAA 3NS1B 1JRPA 1N60C 3FW8A 5AE2A 5L6FA 2Y3SA 3SR6B 4BC7A 1SB3B 3B9JB 1WVEA 4PVKA 5AE1A 2W3SA 3PQBA 1V97A 1W1QA 1ZR6A 3D2DA 4PYTA 2BVFA 3FW7A 5FXDA 3NVZB 2BVHA 1FFVC 5FXFA 2PLIA 2PLSA 3S1DA 3ETRB 1N61C 3DEDA 3EUB3 4EC3A 1N63C 4XLOA 2I0KA 3HRDC 4ZOHB 2UUVA 1WYGA 1ZXIC 1E8HA 2O3GA 3HSUA 2W3RA 5K8EA 1AHUA 5L6GA 3TSHA 1RM6B 1DIQA 4PZFA 2OAIA 1VDVA 3AMZA 3FW9A 4JB1A 2R8DA
chains in the Genus database with same CATH topology
1W1MA 4ML8A 3POPA 2VFTA 3S1EA 2BVGA 2MBRA 2QKNA 2VFVA 3AM9A 4BC9A 3W8XA 3NVWB 4PVHA 3AN1A 5FXPA 2NQWA 5D79A 1JROA 4BBYA 2R2ZA 3LAEA 2P3HA 4OALA 5I1WA 3W8ZA 1N62C 1FO4A 1AHZA 2RK5A 2W55A 3GSYA 2VFRA 3PM9A 3C0PA 2VFUA 1UXYA 2W54A 3TX1A 4DNSA 2Y4GA 1N5XA 5I1VA 2P4PA 4PVEA 3NVYB 2Y08A 1HSKA 5G5GB 3TSJA 1MBTA 5AWVA 1DIIA 1VAOA 3KJMA 4BCAA 2GQUA 1QLTA 4O95A 4PWCA 2IPIA 5HHZA 3NRZB 4PVJA 2GQTA 1W1OA 5HQXA 3W8WA 2E3TA 4HG0A 3JS8A 3LLBA 2QPMA 2VFSA 1T3QC 4PWBA 1W1KA 2P13A 1DZNA 1AHVA 1W1LA 3BW7A 5FXEA 1E0YA 2Y3RA 5AE3A 2YVSA 3NVVB 3S1CA 1W1SA 3RJ8A 1WVFA 5HMRA 1MBBA 3D2JA 1E8FA 1FFUC 2Q85A 2EXRA 3I99A 3S1FA 3VTEA 4JAYA 2UUUA 1F0XA 1W1JA 2AXRA 2VAOA 3D2HA 5G5HB 3DQ0A 2WDWA 1N5WC 1E8GA 5ADZA 2Q4WA 3RJAA 1I19A 1QLUA 1W1RA 4UD8A 4MLAA 1FIQB 3FWAA 3NS1B 1JRPA 1N60C 3FW8A 5AE2A 5L6FA 2Y3SA 3SR6B 4BC7A 1SB3B 3B9JB 1WVEA 4PVKA 5AE1A 2W3SA 3PQBA 1V97A 1W1QA 1ZR6A 3D2DA 4PYTA 2BVFA 3FW7A 5FXDA 3NVZB 2BVHA 1FFVC 5FXFA 2PLIA 2PLSA 3S1DA 3ETRB 1N61C 3DEDA 3EUB3 4EC3A 1N63C 4XLOA 2I0KA 3HRDC 4ZOHB 2UUVA 1WYGA 1ZXIC 1E8HA 2O3GA 3HSUA 2W3RA 5K8EA 1AHUA 5L6GA 3TSHA 1RM6B 1DIQA 4PZFA 2OAIA 1VDVA 3AMZA 3FW9A 4JB1A 2R8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1M A;  4ML8 A;  2VFT A;  3S1E A;  2BVG A;  2MBR A;  2QKN A;  2VFV A;  3AM9 A;  4BC9 A;  3W8X A;  3NVW B;  4PVH A;  3AN1 A;  5FXP A;  2NQW A;  5D79 A;  1JRO A;  4BBY A;  2R2Z A;  3LAE A;  2P3H A;  4OAL A;  3W8Z A;  1N62 C;  1FO4 A;  1AHZ A;  2RK5 A;  2W55 A;  3GSY A;  2VFR A;  3PM9 A;  3C0P A;  2VFU A;  1UXY A;  2W54 A;  3TX1 A;  4DNS A;  1N5X A;  2P4P A;  4PVE A;  3NVY B;  5G5G B;  1HSK A;  3TSJ A;  1MBT A;  1DII A;  1VAO A;  3KJM A;  4BCA A;  2GQU A;  1QLT A;  4O95 A;  4PWC A;  5HHZ A;  3NRZ B;  4PVJ A;  2GQT A;  1W1O A;  5HQX A;  3W8W A;  2E3T A;  4HG0 A;  3JS8 A;  3LLB A;  2QPM A;  2VFS A;  1T3Q C;  4PWB A;  1W1K A;  2P13 A;  1DZN A;  1AHV A;  1W1L A;  3BW7 A;  5FXE A;  1E0Y A;  5AE3 A;  2YVS A;  3NVV B;  3S1C A;  1W1S A;  1WVF A;  5HMR A;  1MBB A;  3D2J A;  1E8F A;  1FFU C;  2Q85 A;  2EXR A;  3I99 A;  3S1F A;  3VTE A;  4JAY A;  1F0X A;  1W1J A;  2AXR A;  2VAO A;  3D2H A;  5G5H B;  3DQ0 A;  1N5W C;  1E8G A;  5ADZ A;  2Q4W A;  1I19 A;  1QLU A;  1W1R A;  4UD8 A;  4MLA A;  1FIQ B;  3FWA A;  3NS1 B;  1JRP A;  1N60 C;  3FW8 A;  5AE2 A;  3SR6 B;  4BC7 A;  1SB3 B;  3B9J B;  1WVE A;  4PVK A;  5AE1 A;  2W3S A;  1V97 A;  1W1Q A;  1ZR6 A;  3D2D A;  4PYT A;  2BVF A;  3FW7 A;  5FXD A;  3NVZ B;  2BVH A;  1FFV C;  5FXF A;  2PLI A;  2PLS A;  3S1D A;  3ETR B;  1N61 C;  3DED A;  3EUB 3;  4EC3 A;  1N63 C;  4XLO A;  2I0K A;  3HRD C;  4ZOH B;  1WYG A;  1ZXI C;  1E8H A;  2O3G A;  2W3R A;  1AHU A;  3TSH A;  1RM6 B;  1DIQ A;  4PZF A;  2OAI A;  1VDV A;  3AMZ A;  3FW9 A;  4JB1 A;  2R8D A; 
#chains in the Genus database with same CATH topology
 1W1M A;  3EJB B;  4ML8 A;  3POP A;  2VFT A;  3S1E A;  2BVG A;  2MBR A;  2QKN A;  2VFV A;  3AM9 A;  4BC9 A;  3W8X A;  3NVW B;  4PVH A;  3AN1 A;  5FXP A;  2NQW A;  5D79 A;  1JRO A;  4BBY A;  2R2Z A;  3LAE A;  2P3H A;  4OAL A;  5I1W A;  3W8Z A;  1N62 C;  1FO4 A;  1AHZ A;  2RK5 A;  2W55 A;  3GSY A;  2VFR A;  3PM9 A;  3C0P A;  2VFU A;  1UXY A;  2W54 A;  3TX1 A;  4DNS A;  2Y4G A;  1N5X A;  5I1V A;  3NVY B;  4PVE A;  2P4P A;  2Y08 A;  1HSK A;  5G5G B;  3TSJ A;  1MBT A;  5AWV A;  1DII A;  1VAO A;  3KJM A;  4BCA A;  2GQU A;  1QLT A;  4O95 A;  3EJD B;  4PWC A;  5HHZ A;  2IPI A;  3EJE B;  3NRZ B;  4PVJ A;  2GQT A;  1W1O A;  5HQX A;  3W8W A;  2E3T A;  4HG0 A;  3JS8 A;  3LLB A;  2QPM A;  2VFS A;  1T3Q C;  4PWB A;  1W1K A;  2P13 A;  1DZN A;  1AHV A;  1W1L A;  3BW7 A;  5FXE A;  1E0Y A;  2Y3R A;  5AE3 A;  3NVV B;  2YVS A;  3S1C A;  1W1S A;  3RJ8 A;  1WVF A;  5HMR A;  1MBB A;  3D2J A;  1E8F A;  1FFU C;  2Q85 A;  2EXR A;  3I99 A;  3S1F A;  3VTE A;  4JAY A;  2UUU A;  1F0X A;  1W1J A;  2AXR A;  2VAO A;  3D2H A;  5G5H B;  3DQ0 A;  2WDW A;  1N5W C;  1E8G A;  5ADZ A;  2Q4W A;  3RJA A;  1I19 A;  1QLU A;  1W1R A;  4UD8 A;  4MLA A;  1FIQ B;  3FWA A;  3NS1 B;  1JRP A;  1N60 C;  3FW8 A;  5AE2 A;  5L6F A;  2Y3S A;  3SR6 B;  4BC7 A;  1SB3 B;  3B9J B;  1WVE A;  4PVK A;  5AE1 A;  2W3S A;  3PQB A;  1V97 A;  1W1Q A;  1ZR6 A;  3D2D A;  4PYT A;  2BVF A;  3FW7 A;  5FXD A;  3NVZ B;  2BVH A;  1FFV C;  5FXF A;  2PLI A;  2PLS A;  3S1D A;  3ETR B;  1N61 C;  3DED A;  3EUB 3;  4EC3 A;  1N63 C;  4XLO A;  2I0K A;  3HRD C;  4ZOH B;  2UUV A;  1WYG A;  1ZXI C;  1E8H A;  2O3G A;  3HSU A;  2W3R A;  5K8E A;  1AHU A;  5L6G A;  3TSH A;  1RM6 B;  1DIQ A;  4PZF A;  2OAI A;  1VDV A;  3AMZ A;  3FW9 A;  4JB1 A;  2R8D A; 
#chains in the Genus database with same CATH homology
 1W1M A;  4ML8 A;  3POP A;  2VFT A;  3S1E A;  2BVG A;  2MBR A;  2QKN A;  2VFV A;  3AM9 A;  4BC9 A;  3W8X A;  3NVW B;  4PVH A;  3AN1 A;  5FXP A;  2NQW A;  5D79 A;  1JRO A;  4BBY A;  2R2Z A;  3LAE A;  2P3H A;  4OAL A;  5I1W A;  3W8Z A;  1N62 C;  1FO4 A;  1AHZ A;  2RK5 A;  2W55 A;  3GSY A;  2VFR A;  3PM9 A;  3C0P A;  2VFU A;  1UXY A;  2W54 A;  3TX1 A;  4DNS A;  2Y4G A;  1N5X A;  5I1V A;  2P4P A;  4PVE A;  3NVY B;  2Y08 A;  1HSK A;  5G5G B;  3TSJ A;  1MBT A;  5AWV A;  1DII A;  1VAO A;  3KJM A;  4BCA A;  2GQU A;  1QLT A;  4O95 A;  4PWC A;  2IPI A;  5HHZ A;  3NRZ B;  4PVJ A;  2GQT A;  1W1O A;  5HQX A;  3W8W A;  2E3T A;  4HG0 A;  3JS8 A;  3LLB A;  2QPM A;  2VFS A;  1T3Q C;  4PWB A;  1W1K A;  2P13 A;  1DZN A;  1AHV A;  1W1L A;  3BW7 A;  5FXE A;  1E0Y A;  2Y3R A;  5AE3 A;  2YVS A;  3NVV B;  3S1C A;  1W1S A;  3RJ8 A;  1WVF A;  5HMR A;  1MBB A;  3D2J A;  1E8F A;  1FFU C;  2Q85 A;  2EXR A;  3I99 A;  3S1F A;  3VTE A;  4JAY A;  2UUU A;  1F0X A;  1W1J A;  2AXR A;  2VAO A;  3D2H A;  5G5H B;  3DQ0 A;  2WDW A;  1N5W C;  1E8G A;  5ADZ A;  2Q4W A;  3RJA A;  1I19 A;  1QLU A;  1W1R A;  4UD8 A;  4MLA A;  1FIQ B;  3FWA A;  3NS1 B;  1JRP A;  1N60 C;  3FW8 A;  5AE2 A;  5L6F A;  2Y3S A;  3SR6 B;  4BC7 A;  1SB3 B;  3B9J B;  1WVE A;  4PVK A;  5AE1 A;  2W3S A;  3PQB A;  1V97 A;  1W1Q A;  1ZR6 A;  3D2D A;  4PYT A;  2BVF A;  3FW7 A;  5FXD A;  3NVZ B;  2BVH A;  1FFV C;  5FXF A;  2PLI A;  2PLS A;  3S1D A;  3ETR B;  1N61 C;  3DED A;  3EUB 3;  4EC3 A;  1N63 C;  4XLO A;  2I0K A;  3HRD C;  4ZOH B;  2UUV A;  1WYG A;  1ZXI C;  1E8H A;  2O3G A;  3HSU A;  2W3R A;  5K8E A;  1AHU A;  5L6G A;  3TSH A;  1RM6 B;  1DIQ A;  4PZF A;  2OAI A;  1VDV A;  3AMZ A;  3FW9 A;  4JB1 A;  2R8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...