2MBRA

Murb wild type, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
total genus 105
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2mbrA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2mbrA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 2mbrA01
4MLAA 3TX1A 3NVZB 2PLIA 2BVGA 3S1FA 1WVEA 1W1OA 2W54A 2BVFA 3AM9A 1W1RA 1N5WC 4BC9A 5AE3A 1RM6B 1ZXIC 3AN1A 4PWCA 3W8ZA 5AE1A 1JRPA 1QLTA 4EC3A 1N60C 3W8WA 1MBBA 2OAIA 1N63C 5HHZA 2AXRA 3SR6B 5HQXA 1E8FA 2NQWA 2W55A 2P3HA 5D79A 1T3QC 4ML8A 5FXFA 4XLOA 2VFVA 3PM9A 2O3GA 3B9JB 4HG0A 3TSJA 3LLBA 4BBYA 5FXEA 4ZOHB 2VFTA 1N5XA 2Q85A 1HSKA 4JAYA 1AHUA 3FWAA 3I99A 2E3TA 2VFRA 2GQUA 3D2DA 3FW7A 1E8HA 3NVWB 1W1JA 5G5HB 1FFVC 2R2ZA 4PVKA 1FO4A 2VAOA 1JROA 4PVEA 2QPMA 5AE2A 1W1LA 3VTEA 4PVJA 2W3SA 1AHVA 3HRDC 2QKNA 3DEDA 3NVYB 1VDVA 1DIIA 4JB1A 1DIQA 1I19A 2VFSA 1MBTA 1DZNA 1WVFA 4OALA 2P13A 1V97A 1FFUC 5ADZA 3S1EA 3FW9A 1N62C 2VFUA 1F0XA 1W1MA 5G5GB 1W1KA 1SB3B 1E0YA 2I0KA 3JS8A 3AMZA 2RK5A 3NS1B 2W3RA 3NVVB 3TSHA 2YVSA 3ETRB 2PLSA 4BC7A 3S1CA 1VAOA 2MBRA 3BW7A 5FXDA 1QLUA 3D2HA 4PVHA 1UXYA 1W1SA 1ZR6A 4PZFA 1N61C 3FW8A 3GSYA 1E8GA 5FXPA 2Q4WA 3NRZB 3W8XA 2BVHA 1FIQB 2P4PA 1WYGA 3KJMA 4DNSA 1AHZA 3D2JA 3EUB3 4PWBA 4BCAA 3C0PA 3LAEA 2R8DA 3DQ0A 2EXRA 1W1QA 4O95A 4UD8A 5HMRA 4PYTA 2GQTA 3S1DA
chains in the Genus database with same CATH superfamily
4MLAA 3TX1A 3NVZB 2PLIA 2BVGA 3S1FA 1WVEA 1W1OA 2W54A 2BVFA 3AM9A 1W1RA 1N5WC 2WDWA 4BC9A 5AE3A 1RM6B 1ZXIC 3AN1A 4PWCA 3W8ZA 5AE1A 1JRPA 1QLTA 4EC3A 1N60C 3W8WA 2Y3RA 1MBBA 2OAIA 1N63C 5HHZA 2AXRA 3SR6B 5HQXA 3EJBB 1E8FA 2NQWA 3PQBA 2W55A 2P3HA 3RJAA 5D79A 1T3QC 4ML8A 5FXFA 4XLOA 2VFVA 3PM9A 2O3GA 5L6GA 3B9JB 4HG0A 3TSJA 3LLBA 4BBYA 5FXEA 4ZOHB 2VFTA 1N5XA 2Q85A 1HSKA 4JAYA 1AHUA 3FWAA 3I99A 2E3TA 2VFRA 2GQUA 3D2DA 3FW7A 1E8HA 3NVWB 1W1JA 5G5HB 5L6FA 1FFVC 2R2ZA 4PVKA 1FO4A 2VAOA 1JROA 4PVEA 2QPMA 5I1VA 5AE2A 1W1LA 3VTEA 4PVJA 2W3SA 1AHVA 3HRDC 2QKNA 3DEDA 3HSUA 3NVYB 1VDVA 1DIIA 4JB1A 1DIQA 5AWVA 1I19A 2VFSA 1MBTA 5K8EA 3EJDB 1DZNA 2Y08A 1WVFA 2IPIA 2UUVA 4OALA 2P13A 1V97A 1FFUC 5ADZA 3S1EA 3FW9A 1N62C 2VFUA 1F0XA 1W1MA 5G5GB 1W1KA 1SB3B 1E0YA 2I0KA 3JS8A 3AMZA 2RK5A 3NS1B 2W3RA 3NVVB 3TSHA 2YVSA 3ETRB 2PLSA 4BC7A 3RJ8A 3S1CA 1VAOA 2MBRA 3BW7A 5FXDA 2UUUA 2Y3SA 1QLUA 3D2HA 4PVHA 1UXYA 1W1SA 1ZR6A 4PZFA 1N61C 3FW8A 3GSYA 1E8GA 5FXPA 2Q4WA 2Y4GA 3NRZB 3EJEB 3W8XA 2BVHA 1FIQB 2P4PA 1WYGA 3KJMA 4DNSA 1AHZA 3D2JA 3EUB3 4PWBA 4BCAA 3C0PA 3POPA 3LAEA 2R8DA 3DQ0A 2EXRA 1W1QA 4O95A 5I1WA 4UD8A 5HMRA 4PYTA 2GQTA 3S1DA
chains in the Genus database with same CATH topology
4MLAA 3TX1A 3NVZB 2PLIA 2BVGA 3S1FA 1WVEA 1W1OA 2W54A 2BVFA 3AM9A 1W1RA 1N5WC 2WDWA 4BC9A 5AE3A 1RM6B 1ZXIC 3AN1A 4PWCA 3W8ZA 5AE1A 1JRPA 1QLTA 4EC3A 1N60C 3W8WA 2Y3RA 1MBBA 2OAIA 1N63C 5HHZA 2AXRA 3SR6B 5HQXA 1E8FA 2NQWA 3PQBA 2W55A 2P3HA 3RJAA 5D79A 1T3QC 4ML8A 5FXFA 4XLOA 2VFVA 3PM9A 2O3GA 5L6GA 3B9JB 4HG0A 3TSJA 3LLBA 4BBYA 5FXEA 4ZOHB 2VFTA 1N5XA 2Q85A 1HSKA 4JAYA 1AHUA 3FWAA 3I99A 2E3TA 2VFRA 2GQUA 3D2DA 3FW7A 1E8HA 3NVWB 1W1JA 5G5HB 5L6FA 1FFVC 2R2ZA 4PVKA 1FO4A 2VAOA 1JROA 4PVEA 2QPMA 5I1VA 5AE2A 1W1LA 3VTEA 4PVJA 2W3SA 1AHVA 3HRDC 2QKNA 3DEDA 3HSUA 3NVYB 1VDVA 1DIIA 4JB1A 1DIQA 5AWVA 1I19A 2VFSA 1MBTA 5K8EA 1DZNA 2Y08A 1WVFA 2IPIA 2UUVA 4OALA 2P13A 1V97A 1FFUC 5ADZA 3S1EA 3FW9A 1N62C 2VFUA 1F0XA 1W1MA 5G5GB 1W1KA 1SB3B 1E0YA 2I0KA 3JS8A 3AMZA 2RK5A 3NS1B 2W3RA 3NVVB 3TSHA 2YVSA 3ETRB 2PLSA 4BC7A 3RJ8A 3S1CA 1VAOA 2MBRA 3BW7A 5FXDA 2UUUA 2Y3SA 1QLUA 3D2HA 4PVHA 1UXYA 1W1SA 1ZR6A 4PZFA 1N61C 3FW8A 3GSYA 1E8GA 5FXPA 2Q4WA 2Y4GA 3NRZB 3W8XA 2BVHA 1FIQB 2P4PA 1WYGA 3KJMA 4DNSA 1AHZA 3D2JA 3EUB3 4PWBA 4BCAA 3C0PA 3POPA 3LAEA 2R8DA 3DQ0A 2EXRA 1W1QA 4O95A 5I1WA 4UD8A 5HMRA 4PYTA 2GQTA 3S1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLA A;  3TX1 A;  3NVZ B;  2PLI A;  2BVG A;  3S1F A;  1WVE A;  1W1O A;  2W54 A;  2BVF A;  3AM9 A;  1W1R A;  1N5W C;  4BC9 A;  5AE3 A;  1RM6 B;  1ZXI C;  3AN1 A;  4PWC A;  3W8Z A;  5AE1 A;  1JRP A;  1QLT A;  4EC3 A;  1N60 C;  3W8W A;  1MBB A;  2OAI A;  1N63 C;  5HHZ A;  2AXR A;  3SR6 B;  5HQX A;  1E8F A;  2NQW A;  2W55 A;  2P3H A;  5D79 A;  1T3Q C;  4ML8 A;  5FXF A;  4XLO A;  2VFV A;  3PM9 A;  2O3G A;  3B9J B;  4HG0 A;  3TSJ A;  3LLB A;  4BBY A;  5FXE A;  4ZOH B;  2VFT A;  1N5X A;  2Q85 A;  1HSK A;  4JAY A;  1AHU A;  3FWA A;  3I99 A;  2E3T A;  2VFR A;  2GQU A;  3D2D A;  3FW7 A;  1E8H A;  3NVW B;  1W1J A;  5G5H B;  1FFV C;  2R2Z A;  4PVK A;  1FO4 A;  2VAO A;  1JRO A;  4PVE A;  2QPM A;  5AE2 A;  1W1L A;  3VTE A;  4PVJ A;  2W3S A;  1AHV A;  3HRD C;  2QKN A;  3DED A;  3NVY B;  1VDV A;  1DII A;  4JB1 A;  1DIQ A;  1I19 A;  2VFS A;  1MBT A;  1DZN A;  1WVF A;  4OAL A;  2P13 A;  1V97 A;  1FFU C;  5ADZ A;  3S1E A;  3FW9 A;  1N62 C;  2VFU A;  1F0X A;  1W1M A;  5G5G B;  1W1K A;  1SB3 B;  1E0Y A;  2I0K A;  3JS8 A;  3AMZ A;  2RK5 A;  3NS1 B;  2W3R A;  3NVV B;  3TSH A;  2YVS A;  3ETR B;  2PLS A;  4BC7 A;  3S1C A;  1VAO A;  2MBR A;  3BW7 A;  5FXD A;  1QLU A;  3D2H A;  4PVH A;  1UXY A;  1W1S A;  1ZR6 A;  4PZF A;  1N61 C;  3FW8 A;  3GSY A;  1E8G A;  5FXP A;  2Q4W A;  3NRZ B;  3W8X A;  2BVH A;  1FIQ B;  2P4P A;  1WYG A;  3KJM A;  4DNS A;  1AHZ A;  3D2J A;  3EUB 3;  4PWB A;  4BCA A;  3C0P A;  3LAE A;  2R8D A;  3DQ0 A;  2EXR A;  1W1Q A;  4O95 A;  4UD8 A;  5HMR A;  4PYT A;  2GQT A;  3S1D A; 
#chains in the Genus database with same CATH topology
 4MLA A;  3TX1 A;  3NVZ B;  2PLI A;  2BVG A;  3S1F A;  1WVE A;  1W1O A;  2W54 A;  2BVF A;  3AM9 A;  1W1R A;  1N5W C;  2WDW A;  4BC9 A;  5AE3 A;  1RM6 B;  1ZXI C;  3AN1 A;  4PWC A;  3W8Z A;  5AE1 A;  1JRP A;  1QLT A;  4EC3 A;  1N60 C;  3W8W A;  2Y3R A;  1MBB A;  2OAI A;  1N63 C;  5HHZ A;  2AXR A;  3SR6 B;  5HQX A;  3EJB B;  1E8F A;  2NQW A;  3PQB A;  2W55 A;  2P3H A;  3RJA A;  5D79 A;  1T3Q C;  4ML8 A;  5FXF A;  4XLO A;  2VFV A;  3PM9 A;  2O3G A;  5L6G A;  3B9J B;  4HG0 A;  3TSJ A;  3LLB A;  4BBY A;  5FXE A;  4ZOH B;  2VFT A;  1N5X A;  2Q85 A;  1HSK A;  4JAY A;  1AHU A;  3FWA A;  3I99 A;  2E3T A;  2VFR A;  2GQU A;  3D2D A;  3FW7 A;  1E8H A;  3NVW B;  1W1J A;  5G5H B;  5L6F A;  1FFV C;  2R2Z A;  4PVK A;  1FO4 A;  2VAO A;  1JRO A;  4PVE A;  2QPM A;  5I1V A;  5AE2 A;  1W1L A;  3VTE A;  4PVJ A;  2W3S A;  1AHV A;  3HRD C;  2QKN A;  3DED A;  3HSU A;  3NVY B;  1VDV A;  1DII A;  4JB1 A;  1DIQ A;  5AWV A;  1I19 A;  2VFS A;  1MBT A;  5K8E A;  3EJD B;  1DZN A;  2Y08 A;  1WVF A;  2IPI A;  2UUV A;  4OAL A;  2P13 A;  1V97 A;  1FFU C;  5ADZ A;  3S1E A;  3FW9 A;  1N62 C;  2VFU A;  1F0X A;  1W1M A;  5G5G B;  1W1K A;  1SB3 B;  1E0Y A;  2I0K A;  3JS8 A;  3AMZ A;  2RK5 A;  3NS1 B;  2W3R A;  3NVV B;  3TSH A;  2YVS A;  3ETR B;  2PLS A;  4BC7 A;  3RJ8 A;  3S1C A;  1VAO A;  2MBR A;  3BW7 A;  5FXD A;  2UUU A;  2Y3S A;  1QLU A;  3D2H A;  4PVH A;  1UXY A;  1W1S A;  1ZR6 A;  4PZF A;  1N61 C;  3FW8 A;  3GSY A;  1E8G A;  5FXP A;  2Q4W A;  2Y4G A;  3NRZ B;  3EJE B;  3W8X A;  2BVH A;  1FIQ B;  2P4P A;  1WYG A;  3KJM A;  4DNS A;  1AHZ A;  3D2J A;  3EUB 3;  4PWB A;  4BCA A;  3C0P A;  3POP A;  3LAE A;  2R8D A;  3DQ0 A;  2EXR A;  1W1Q A;  4O95 A;  5I1W A;  4UD8 A;  5HMR A;  4PYT A;  2GQT A;  3S1D A; 
#chains in the Genus database with same CATH homology
 4MLA A;  3TX1 A;  3NVZ B;  2PLI A;  2BVG A;  3S1F A;  1WVE A;  1W1O A;  2W54 A;  2BVF A;  3AM9 A;  1W1R A;  1N5W C;  2WDW A;  4BC9 A;  5AE3 A;  1RM6 B;  1ZXI C;  3AN1 A;  4PWC A;  3W8Z A;  5AE1 A;  1JRP A;  1QLT A;  4EC3 A;  1N60 C;  3W8W A;  2Y3R A;  1MBB A;  2OAI A;  1N63 C;  5HHZ A;  2AXR A;  3SR6 B;  5HQX A;  1E8F A;  2NQW A;  3PQB A;  2W55 A;  2P3H A;  3RJA A;  5D79 A;  1T3Q C;  4ML8 A;  5FXF A;  4XLO A;  2VFV A;  3PM9 A;  2O3G A;  5L6G A;  3B9J B;  4HG0 A;  3TSJ A;  3LLB A;  4BBY A;  5FXE A;  4ZOH B;  2VFT A;  1N5X A;  2Q85 A;  1HSK A;  4JAY A;  1AHU A;  3FWA A;  3I99 A;  2E3T A;  2VFR A;  2GQU A;  3D2D A;  3FW7 A;  1E8H A;  3NVW B;  1W1J A;  5G5H B;  5L6F A;  1FFV C;  2R2Z A;  4PVK A;  1FO4 A;  2VAO A;  1JRO A;  4PVE A;  2QPM A;  5I1V A;  5AE2 A;  1W1L A;  3VTE A;  4PVJ A;  2W3S A;  1AHV A;  3HRD C;  2QKN A;  3DED A;  3HSU A;  3NVY B;  1VDV A;  1DII A;  4JB1 A;  1DIQ A;  5AWV A;  1I19 A;  2VFS A;  1MBT A;  5K8E A;  1DZN A;  2Y08 A;  1WVF A;  2IPI A;  2UUV A;  4OAL A;  2P13 A;  1V97 A;  1FFU C;  5ADZ A;  3S1E A;  3FW9 A;  1N62 C;  2VFU A;  1F0X A;  1W1M A;  5G5G B;  1W1K A;  1SB3 B;  1E0Y A;  2I0K A;  3JS8 A;  3AMZ A;  2RK5 A;  3NS1 B;  2W3R A;  3NVV B;  3TSH A;  2YVS A;  3ETR B;  2PLS A;  4BC7 A;  3RJ8 A;  3S1C A;  1VAO A;  2MBR A;  3BW7 A;  5FXD A;  2UUU A;  2Y3S A;  1QLU A;  3D2H A;  4PVH A;  1UXY A;  1W1S A;  1ZR6 A;  4PZF A;  1N61 C;  3FW8 A;  3GSY A;  1E8G A;  5FXP A;  2Q4W A;  2Y4G A;  3NRZ B;  3W8X A;  2BVH A;  1FIQ B;  2P4P A;  1WYG A;  3KJM A;  4DNS A;  1AHZ A;  3D2J A;  3EUB 3;  4PWB A;  4BCA A;  3C0P A;  3POP A;  3LAE A;  2R8D A;  3DQ0 A;  2EXR A;  1W1Q A;  4O95 A;  5I1W A;  4UD8 A;  5HMR A;  4PYT A;  2GQT A;  3S1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...