2Y08A

Structure of the substrate-free fad-dependent tirandamycin oxidase taml
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
498
structure length
498
Chain Sequence
b'HIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 157
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y08A01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y08A02
5L6FA 3VTEA 5AWVA 3W8WA 3FW7A 3GSYA 4PVEA 4PZFA 2Y3RA 2Y3SA 3TSJA 5K8EA 5D79A 3FWAA 2IPIA 3RJAA 3POPA 3W8XA 4PVHA 3D2JA 3FW8A 3W8ZA 3PQBA 4XLOA 2UUUA 4EC3A 3HSUA 3D2DA 2BVGA 4PWBA 3TSHA 2Y4GA 3FW9A 2BVFA 2UUVA 4DNSA 2WDWA 4PVKA 2Y08A 2AXRA 5L6GA 1ZR6A 5I1VA 5I1WA 3RJ8A 4PVJA 2BVHA 4UD8A 3D2HA 4PWCA
chains in the Genus database with same CATH superfamily
5HQXA 5FXEA 2PLIA 2VFVA 3VTEA 1W1KA 5AWVA 1F0XA 1WVEA 1N5WC 1VDVA 3NVYB 2W54A 4JAYA 4BCAA 3GSYA 2Y3RA 3NVVB 3TSJA 1W1RA 2GQTA 3FWAA 3POPA 3S1DA 1FIQB 3NS1B 1UXYA 4PYTA 4OALA 1I19A 5FXFA 2YVSA 4HG0A 3TX1A 2Y4GA 3DQ0A 1QLTA 5G5GB 3S1CA 3LAEA 2Y08A 5L6GA 1E8FA 4BBYA 3HRDC 1JRPA 2VFUA 1ZR6A 3RJ8A 4UD8A 3D2HA 4O95A 2OAIA 4MLAA 3SR6B 1VAOA 1FO4A 3S1FA 1N63C 1T3QC 3FW7A 2RK5A 4PZFA 5K8EA 5D79A 2VFRA 2P3HA 4JB1A 1FFUC 5HHZA 1DZNA 4PWBA 1AHVA 1WVFA 2P13A 5AE1A 3C0PA 3JS8A 3EUB3 1W1MA 2R2ZA 1QLUA 1AHUA 5FXPA 3AMZA 1SB3B 1MBBA 1AHZA 2W3SA 2P4PA 2GQUA 2VAOA 3W8WA 1N5XA 3LLBA 1WYGA 1E8HA 1ZXIC 4BC9A 3RJAA 3DEDA 5ADZA 3D2JA 1RM6B 1W1OA 2R8DA 1DIIA 3I99A 5FXDA 2UUUA 1HSKA 2BVGA 2O3GA 2QKNA 3TSHA 1FFVC 1V97A 1W1QA 3FW9A 2BVFA 3S1EA 1N61C 2VFSA 2EXRA 4PVKA 4ZOHB 3ETRB 2VFTA 2Q4WA 4BC7A 5AE2A 1N62C 5G5HB 3PM9A 4PVHA 3BW7A 3AN1A 5L6FA 2W55A 1MBTA 4ML8A 1W1SA 3KJMA 1E0YA 4PVEA 1W1LA 1E8GA 2Y3SA 2PLSA 2IPIA 3W8XA 3FW8A 3W8ZA 3PQBA 4XLOA 2I0KA 2MBRA 4EC3A 1JROA 5HMRA 3D2DA 3HSUA 3NVZB 1N60C 1W1JA 2QPMA 2E3TA 3B9JB 3NRZB 2UUVA 5AE3A 3NVWB 4DNSA 2WDWA 3AM9A 2AXRA 1DIQA 5I1VA 5I1WA 2NQWA 2W3RA 4PVJA 2BVHA 2Q85A 4PWCA
chains in the Genus database with same CATH topology
5HQXA 5FXEA 2PLIA 2VFVA 3VTEA 1W1KA 5AWVA 1F0XA 1WVEA 1N5WC 1VDVA 3NVYB 2W54A 4JAYA 4BCAA 3GSYA 2Y3RA 3NVVB 3TSJA 1W1RA 2GQTA 3FWAA 3POPA 3S1DA 1FIQB 3NS1B 1UXYA 4PYTA 4OALA 1I19A 5FXFA 2YVSA 4HG0A 3TX1A 2Y4GA 3DQ0A 1QLTA 5G5GB 3S1CA 3LAEA 2Y08A 5L6GA 1E8FA 4BBYA 3HRDC 1JRPA 2VFUA 1ZR6A 3RJ8A 4UD8A 3D2HA 4O95A 2OAIA 4MLAA 3SR6B 1VAOA 1FO4A 3S1FA 1N63C 1T3QC 3FW7A 2RK5A 4PZFA 5K8EA 5D79A 2VFRA 2P3HA 4JB1A 1FFUC 5HHZA 1DZNA 4PWBA 1AHVA 1WVFA 2P13A 5AE1A 3C0PA 3JS8A 3EUB3 1W1MA 2R2ZA 1QLUA 1AHUA 5FXPA 3AMZA 1SB3B 1MBBA 1AHZA 2W3SA 2P4PA 2GQUA 2VAOA 3W8WA 1N5XA 3LLBA 1WYGA 1E8HA 1ZXIC 4BC9A 3RJAA 3DEDA 5ADZA 3D2JA 1RM6B 1W1OA 2R8DA 1DIIA 3I99A 5FXDA 2UUUA 1HSKA 2BVGA 2O3GA 2QKNA 3TSHA 1FFVC 1V97A 1W1QA 3FW9A 2BVFA 3S1EA 1N61C 2VFSA 2EXRA 4PVKA 4ZOHB 3ETRB 2VFTA 2Q4WA 4BC7A 5AE2A 1N62C 5G5HB 3PM9A 4PVHA 3BW7A 3AN1A 5L6FA 2W55A 1MBTA 4ML8A 1W1SA 3KJMA 1E0YA 4PVEA 1W1LA 1E8GA 2Y3SA 2PLSA 2IPIA 3W8XA 3FW8A 3W8ZA 3PQBA 4XLOA 2I0KA 2MBRA 4EC3A 1JROA 5HMRA 3D2DA 3HSUA 3NVZB 1N60C 1W1JA 2QPMA 2E3TA 3B9JB 3NRZB 2UUVA 5AE3A 3NVWB 4DNSA 2WDWA 3AM9A 2AXRA 1DIQA 5I1VA 5I1WA 2NQWA 2W3RA 4PVJA 2BVHA 2Q85A 4PWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L6F A;  3VTE A;  5AWV A;  3W8W A;  3FW7 A;  3GSY A;  4PVE A;  4PZF A;  2Y3R A;  2Y3S A;  3TSJ A;  5K8E A;  5D79 A;  3FWA A;  2IPI A;  3RJA A;  3POP A;  3W8X A;  4PVH A;  3D2J A;  3FW8 A;  3W8Z A;  3PQB A;  4XLO A;  2UUU A;  4EC3 A;  3HSU A;  3D2D A;  2BVG A;  4PWB A;  3TSH A;  2Y4G A;  3FW9 A;  2BVF A;  2UUV A;  4DNS A;  2WDW A;  4PVK A;  2Y08 A;  2AXR A;  5L6G A;  1ZR6 A;  5I1V A;  5I1W A;  3RJ8 A;  4PVJ A;  2BVH A;  4UD8 A;  3D2H A;  4PWC A; 
#chains in the Genus database with same CATH topology
 5HQX A;  5FXE A;  2PLI A;  2VFV A;  3VTE A;  1W1K A;  5AWV A;  1F0X A;  1WVE A;  1N5W C;  1VDV A;  3NVY B;  2W54 A;  4JAY A;  4BCA A;  3GSY A;  2Y3R A;  3NVV B;  3TSJ A;  1W1R A;  2GQT A;  3FWA A;  3POP A;  3S1D A;  1FIQ B;  3NS1 B;  1UXY A;  4PYT A;  4OAL A;  1I19 A;  5FXF A;  2YVS A;  4HG0 A;  3TX1 A;  2Y4G A;  3DQ0 A;  1QLT A;  5G5G B;  3S1C A;  3LAE A;  2Y08 A;  5L6G A;  1E8F A;  4BBY A;  3HRD C;  1JRP A;  2VFU A;  1ZR6 A;  3RJ8 A;  4UD8 A;  3D2H A;  4O95 A;  2OAI A;  4MLA A;  3SR6 B;  1VAO A;  1FO4 A;  3S1F A;  1N63 C;  1T3Q C;  3FW7 A;  2RK5 A;  4PZF A;  5K8E A;  5D79 A;  2VFR A;  2P3H A;  4JB1 A;  1FFU C;  5HHZ A;  1DZN A;  4PWB A;  1AHV A;  1WVF A;  2P13 A;  5AE1 A;  3C0P A;  3JS8 A;  3EUB 3;  1W1M A;  2R2Z A;  1QLU A;  1AHU A;  5FXP A;  3AMZ A;  1SB3 B;  1MBB A;  1AHZ A;  2W3S A;  2P4P A;  2GQU A;  2VAO A;  3W8W A;  1N5X A;  3LLB A;  1WYG A;  1E8H A;  1ZXI C;  4BC9 A;  3RJA A;  3DED A;  5ADZ A;  3D2J A;  1RM6 B;  1W1O A;  2R8D A;  1DII A;  3I99 A;  5FXD A;  2UUU A;  1HSK A;  2BVG A;  2O3G A;  2QKN A;  3TSH A;  1FFV C;  1V97 A;  1W1Q A;  3FW9 A;  2BVF A;  3S1E A;  1N61 C;  2VFS A;  2EXR A;  4PVK A;  4ZOH B;  3ETR B;  2VFT A;  2Q4W A;  4BC7 A;  5AE2 A;  1N62 C;  5G5H B;  3PM9 A;  4PVH A;  3BW7 A;  3AN1 A;  5L6F A;  2W55 A;  1MBT A;  4ML8 A;  1W1S A;  3KJM A;  1E0Y A;  4PVE A;  1W1L A;  1E8G A;  2Y3S A;  2PLS A;  2IPI A;  3W8X A;  3FW8 A;  3W8Z A;  3PQB A;  4XLO A;  2I0K A;  2MBR A;  4EC3 A;  1JRO A;  5HMR A;  3D2D A;  3HSU A;  3NVZ B;  1N60 C;  1W1J A;  2QPM A;  2E3T A;  3B9J B;  3NRZ B;  2UUV A;  5AE3 A;  3NVW B;  4DNS A;  2WDW A;  3AM9 A;  2AXR A;  1DIQ A;  5I1V A;  5I1W A;  2NQW A;  2W3R A;  4PVJ A;  2BVH A;  2Q85 A;  4PWC A; 
#chains in the Genus database with same CATH homology
 5HQX A;  5FXE A;  2PLI A;  2VFV A;  3VTE A;  1W1K A;  5AWV A;  1F0X A;  1WVE A;  1N5W C;  1VDV A;  3NVY B;  2W54 A;  4JAY A;  4BCA A;  3GSY A;  2Y3R A;  3NVV B;  3TSJ A;  1W1R A;  2GQT A;  3FWA A;  3POP A;  3S1D A;  1FIQ B;  3NS1 B;  1UXY A;  4PYT A;  4OAL A;  1I19 A;  5FXF A;  2YVS A;  4HG0 A;  3TX1 A;  2Y4G A;  3DQ0 A;  1QLT A;  5G5G B;  3S1C A;  3LAE A;  2Y08 A;  5L6G A;  1E8F A;  4BBY A;  3HRD C;  1JRP A;  2VFU A;  1ZR6 A;  3RJ8 A;  4UD8 A;  3D2H A;  4O95 A;  2OAI A;  4MLA A;  3SR6 B;  1VAO A;  1FO4 A;  3S1F A;  1N63 C;  1T3Q C;  3FW7 A;  2RK5 A;  4PZF A;  5K8E A;  5D79 A;  2VFR A;  2P3H A;  4JB1 A;  1FFU C;  5HHZ A;  1DZN A;  4PWB A;  1AHV A;  1WVF A;  2P13 A;  5AE1 A;  3C0P A;  3JS8 A;  3EUB 3;  1W1M A;  2R2Z A;  1QLU A;  1AHU A;  5FXP A;  3AMZ A;  1SB3 B;  1MBB A;  1AHZ A;  2W3S A;  2P4P A;  2GQU A;  2VAO A;  3W8W A;  1N5X A;  3LLB A;  1WYG A;  1E8H A;  1ZXI C;  4BC9 A;  3RJA A;  3DED A;  5ADZ A;  3D2J A;  1RM6 B;  1W1O A;  2R8D A;  1DII A;  3I99 A;  5FXD A;  2UUU A;  1HSK A;  2BVG A;  2O3G A;  2QKN A;  3TSH A;  1FFV C;  1V97 A;  1W1Q A;  3FW9 A;  2BVF A;  3S1E A;  1N61 C;  2VFS A;  2EXR A;  4PVK A;  4ZOH B;  3ETR B;  2VFT A;  2Q4W A;  4BC7 A;  5AE2 A;  1N62 C;  5G5H B;  3PM9 A;  4PVH A;  3BW7 A;  3AN1 A;  5L6F A;  2W55 A;  1MBT A;  4ML8 A;  1W1S A;  3KJM A;  1E0Y A;  4PVE A;  1W1L A;  1E8G A;  2Y3S A;  2PLS A;  2IPI A;  3W8X A;  3FW8 A;  3W8Z A;  3PQB A;  4XLO A;  2I0K A;  2MBR A;  4EC3 A;  1JRO A;  5HMR A;  3D2D A;  3HSU A;  3NVZ B;  1N60 C;  1W1J A;  2QPM A;  2E3T A;  3B9J B;  3NRZ B;  2UUV A;  5AE3 A;  3NVW B;  4DNS A;  2WDW A;  3AM9 A;  2AXR A;  1DIQ A;  5I1V A;  5I1W A;  2NQW A;  2W3R A;  4PVJ A;  2BVH A;  2Q85 A;  4PWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...