2Y08A

Structure of the substrate-free fad-dependent tirandamycin oxidase taml
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
498
structure length
498
Chain Sequence
HIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
total genus 157
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y08A01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y08A02
3VTEA 2WDWA 4PVKA 4EC3A 3D2JA 4DNSA 3W8ZA 2Y3RA 3HSUA 3RJ8A 2BVFA 2IPIA 3TSJA 3D2DA 3POPA 3FW9A 4UD8A 3W8XA 2Y3SA 3FW7A 3FWAA 2UUVA 4PVEA 3W8WA 5D79A 5I1WA 4PVJA 3TSHA 3PQBA 3D2HA 5I1VA 5K8EA 3FW8A 4PWBA 2BVHA 3GSYA 5AWVA 1ZR6A 2Y08A 5L6FA 2AXRA 4PVHA 4XLOA 5L6GA 2BVGA 4PWCA 2Y4GA 3RJAA 4PZFA 2UUUA
chains in the Genus database with same CATH superfamily
1WVFA 2GQUA 5HMRA 3DEDA 3VTEA 1SB3B 2Q4WA 2WDWA 3D2JA 2IPIA 1MBBA 1E8GA 1JROA 1WVEA 3FW9A 3NRZB 4HG0A 1AHVA 1W1MA 1T3QC 3S1CA 2W55A 3D2HA 3AMZA 3FW8A 4PWBA 2O3GA 1F0XA 5FXPA 4BBYA 1ZR6A 2Y08A 3NVWB 1I19A 3B9JB 5L6GA 3HRDC 1QLUA 1W1RA 1W1JA 2P3HA 2Q85A 3AN1A 5HHZA 3ETRB 4EC3A 2YVSA 4DNSA 2VFUA 3W8ZA 5HQXA 2Y3RA 3HSUA 2P4PA 2P13A 2PLSA 4UD8A 1W1SA 3W8XA 1FFUC 3DQ0A 3FW7A 1JRPA 2E3TA 3FWAA 4BC9A 1W1QA 3W8WA 4O95A 2VFVA 3TSHA 1W1KA 5AE3A 5K8EA 2BVHA 3NVVB 2VFRA 3I99A 5G5GB 3GSYA 2OAIA 5L6FA 2VFTA 2BVGA 1N61C 4PWCA 1AHUA 3TX1A 3AM9A 1HSKA 4JAYA 3NS1B 4ML8A 4OALA 2NQWA 1AHZA 2VFSA 5FXFA 4PVKA 2VAOA 3LLBA 1MBTA 1VAOA 4BCAA 2BVFA 3TSJA 1W1LA 3BW7A 3D2DA 3POPA 5FXDA 5AE2A 1N63C 1N60C 3C0PA 1N5XA 5AE1A 2PLIA 3KJMA 2UUVA 2W54A 2I0KA 3SR6B 1ZXIC 3LAEA 1WYGA 1FFVC 2W3RA 1QLTA 2AXRA 4PVHA 4XLOA 1FO4A 2GQTA 1V97A 1N62C 2R2ZA 3RJAA 4PZFA 1RM6B 4PYTA 1N5WC 4MLAA 3PM9A 4JB1A 1VDVA 2R8DA 2MBRA 3S1FA 3EUB3 2RK5A 5G5HB 3S1EA 1E8FA 3RJ8A 1DIQA 5FXEA 4BC7A 3JS8A 1W1OA 3S1DA 2Y3SA 1E8HA 3NVYB 4PVEA 2QPMA 5D79A 1DIIA 4PVJA 5I1WA 1FIQB 2EXRA 3PQBA 1UXYA 5ADZA 5I1VA 2W3SA 3NVZB 1E0YA 4ZOHB 1DZNA 5AWVA 2Y4GA 2QKNA 2UUUA
chains in the Genus database with same CATH topology
1WVFA 2GQUA 5HMRA 3DEDA 3VTEA 1SB3B 2Q4WA 2WDWA 3D2JA 2IPIA 1MBBA 1E8GA 1JROA 1WVEA 3FW9A 3NRZB 4HG0A 1AHVA 1W1MA 1T3QC 3S1CA 2W55A 3D2HA 3AMZA 3FW8A 4PWBA 2O3GA 1F0XA 5FXPA 4BBYA 1ZR6A 2Y08A 3NVWB 1I19A 3B9JB 5L6GA 3HRDC 1QLUA 1W1RA 1W1JA 2P3HA 2Q85A 3AN1A 5HHZA 3ETRB 4EC3A 2YVSA 4DNSA 2VFUA 3W8ZA 5HQXA 2Y3RA 3HSUA 2P4PA 2P13A 2PLSA 4UD8A 1W1SA 3W8XA 1FFUC 3DQ0A 3FW7A 1JRPA 2E3TA 3FWAA 4BC9A 1W1QA 3W8WA 4O95A 2VFVA 3TSHA 1W1KA 5AE3A 5K8EA 2BVHA 3NVVB 2VFRA 3I99A 5G5GB 3GSYA 2OAIA 5L6FA 2VFTA 2BVGA 1N61C 4PWCA 1AHUA 3TX1A 3AM9A 1HSKA 4JAYA 3NS1B 4ML8A 4OALA 2NQWA 1AHZA 2VFSA 5FXFA 4PVKA 2VAOA 3LLBA 1MBTA 1VAOA 4BCAA 2BVFA 3TSJA 1W1LA 3BW7A 3D2DA 3POPA 5FXDA 5AE2A 1N63C 1N60C 3C0PA 1N5XA 5AE1A 2PLIA 3KJMA 2UUVA 2W54A 2I0KA 3SR6B 1ZXIC 3LAEA 1WYGA 1FFVC 2W3RA 1QLTA 2AXRA 4PVHA 4XLOA 1FO4A 2GQTA 1V97A 1N62C 2R2ZA 3RJAA 4PZFA 1RM6B 4PYTA 1N5WC 4MLAA 3PM9A 4JB1A 1VDVA 2R8DA 2MBRA 3S1FA 3EUB3 2RK5A 5G5HB 3S1EA 1E8FA 3RJ8A 1DIQA 5FXEA 4BC7A 3JS8A 1W1OA 3S1DA 2Y3SA 1E8HA 3NVYB 4PVEA 2QPMA 5D79A 1DIIA 4PVJA 5I1WA 1FIQB 2EXRA 3PQBA 1UXYA 5ADZA 5I1VA 2W3SA 3NVZB 1E0YA 4ZOHB 1DZNA 5AWVA 2Y4GA 2QKNA 2UUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTE A;  2WDW A;  4PVK A;  4EC3 A;  3D2J A;  4DNS A;  3W8Z A;  2Y3R A;  3HSU A;  3RJ8 A;  2BVF A;  2IPI A;  3TSJ A;  3D2D A;  3POP A;  3FW9 A;  4UD8 A;  3W8X A;  2Y3S A;  3FW7 A;  3FWA A;  2UUV A;  4PVE A;  3W8W A;  5D79 A;  5I1W A;  4PVJ A;  3TSH A;  3PQB A;  3D2H A;  5I1V A;  5K8E A;  3FW8 A;  4PWB A;  2BVH A;  3GSY A;  5AWV A;  1ZR6 A;  2Y08 A;  5L6F A;  2AXR A;  4PVH A;  4XLO A;  5L6G A;  2BVG A;  4PWC A;  2Y4G A;  3RJA A;  4PZF A;  2UUU A; 
#chains in the Genus database with same CATH topology
 1WVF A;  2GQU A;  5HMR A;  3DED A;  3VTE A;  1SB3 B;  2Q4W A;  2WDW A;  3D2J A;  2IPI A;  1MBB A;  1E8G A;  1JRO A;  1WVE A;  3FW9 A;  3NRZ B;  4HG0 A;  1AHV A;  1W1M A;  1T3Q C;  3S1C A;  2W55 A;  3D2H A;  3AMZ A;  3FW8 A;  4PWB A;  2O3G A;  1F0X A;  5FXP A;  4BBY A;  1ZR6 A;  2Y08 A;  3NVW B;  1I19 A;  3B9J B;  5L6G A;  3HRD C;  1QLU A;  1W1R A;  1W1J A;  2P3H A;  2Q85 A;  3AN1 A;  5HHZ A;  3ETR B;  4EC3 A;  2YVS A;  4DNS A;  2VFU A;  3W8Z A;  5HQX A;  2Y3R A;  3HSU A;  2P4P A;  2P13 A;  2PLS A;  4UD8 A;  1W1S A;  3W8X A;  1FFU C;  3DQ0 A;  3FW7 A;  1JRP A;  2E3T A;  3FWA A;  4BC9 A;  1W1Q A;  3W8W A;  4O95 A;  2VFV A;  3TSH A;  1W1K A;  5AE3 A;  5K8E A;  2BVH A;  3NVV B;  2VFR A;  3I99 A;  5G5G B;  3GSY A;  2OAI A;  5L6F A;  2VFT A;  2BVG A;  1N61 C;  4PWC A;  1AHU A;  3TX1 A;  3AM9 A;  1HSK A;  4JAY A;  3NS1 B;  4ML8 A;  4OAL A;  2NQW A;  1AHZ A;  2VFS A;  5FXF A;  4PVK A;  2VAO A;  3LLB A;  1MBT A;  1VAO A;  4BCA A;  2BVF A;  3TSJ A;  1W1L A;  3BW7 A;  3D2D A;  3POP A;  5FXD A;  5AE2 A;  1N63 C;  1N60 C;  3C0P A;  1N5X A;  5AE1 A;  2PLI A;  3KJM A;  2UUV A;  2W54 A;  2I0K A;  3SR6 B;  1ZXI C;  3LAE A;  1WYG A;  1FFV C;  2W3R A;  1QLT A;  2AXR A;  4PVH A;  4XLO A;  1FO4 A;  2GQT A;  1V97 A;  1N62 C;  2R2Z A;  3RJA A;  4PZF A;  1RM6 B;  4PYT A;  1N5W C;  4MLA A;  3PM9 A;  4JB1 A;  1VDV A;  2R8D A;  2MBR A;  3S1F A;  3EUB 3;  2RK5 A;  5G5H B;  3S1E A;  1E8F A;  3RJ8 A;  1DIQ A;  5FXE A;  4BC7 A;  3JS8 A;  1W1O A;  3S1D A;  2Y3S A;  1E8H A;  3NVY B;  4PVE A;  2QPM A;  5D79 A;  1DII A;  4PVJ A;  5I1W A;  1FIQ B;  2EXR A;  3PQB A;  1UXY A;  5ADZ A;  5I1V A;  2W3S A;  3NVZ B;  1E0Y A;  4ZOH B;  1DZN A;  5AWV A;  2Y4G A;  2QKN A;  2UUU A; 
#chains in the Genus database with same CATH homology
 1WVF A;  2GQU A;  5HMR A;  3DED A;  3VTE A;  1SB3 B;  2Q4W A;  2WDW A;  3D2J A;  2IPI A;  1MBB A;  1E8G A;  1JRO A;  1WVE A;  3FW9 A;  3NRZ B;  4HG0 A;  1AHV A;  1W1M A;  1T3Q C;  3S1C A;  2W55 A;  3D2H A;  3AMZ A;  3FW8 A;  4PWB A;  2O3G A;  1F0X A;  5FXP A;  4BBY A;  1ZR6 A;  2Y08 A;  3NVW B;  1I19 A;  3B9J B;  5L6G A;  3HRD C;  1QLU A;  1W1R A;  1W1J A;  2P3H A;  2Q85 A;  3AN1 A;  5HHZ A;  3ETR B;  4EC3 A;  2YVS A;  4DNS A;  2VFU A;  3W8Z A;  5HQX A;  2Y3R A;  3HSU A;  2P4P A;  2P13 A;  2PLS A;  4UD8 A;  1W1S A;  3W8X A;  1FFU C;  3DQ0 A;  3FW7 A;  1JRP A;  2E3T A;  3FWA A;  4BC9 A;  1W1Q A;  3W8W A;  4O95 A;  2VFV A;  3TSH A;  1W1K A;  5AE3 A;  5K8E A;  2BVH A;  3NVV B;  2VFR A;  3I99 A;  5G5G B;  3GSY A;  2OAI A;  5L6F A;  2VFT A;  2BVG A;  1N61 C;  4PWC A;  1AHU A;  3TX1 A;  3AM9 A;  1HSK A;  4JAY A;  3NS1 B;  4ML8 A;  4OAL A;  2NQW A;  1AHZ A;  2VFS A;  5FXF A;  4PVK A;  2VAO A;  3LLB A;  1MBT A;  1VAO A;  4BCA A;  2BVF A;  3TSJ A;  1W1L A;  3BW7 A;  3D2D A;  3POP A;  5FXD A;  5AE2 A;  1N63 C;  1N60 C;  3C0P A;  1N5X A;  5AE1 A;  2PLI A;  3KJM A;  2UUV A;  2W54 A;  2I0K A;  3SR6 B;  1ZXI C;  3LAE A;  1WYG A;  1FFV C;  2W3R A;  1QLT A;  2AXR A;  4PVH A;  4XLO A;  1FO4 A;  2GQT A;  1V97 A;  1N62 C;  2R2Z A;  3RJA A;  4PZF A;  1RM6 B;  4PYT A;  1N5W C;  4MLA A;  3PM9 A;  4JB1 A;  1VDV A;  2R8D A;  2MBR A;  3S1F A;  3EUB 3;  2RK5 A;  5G5H B;  3S1E A;  1E8F A;  3RJ8 A;  1DIQ A;  5FXE A;  4BC7 A;  3JS8 A;  1W1O A;  3S1D A;  2Y3S A;  1E8H A;  3NVY B;  4PVE A;  2QPM A;  5D79 A;  1DII A;  4PVJ A;  5I1W A;  1FIQ B;  2EXR A;  3PQB A;  1UXY A;  5ADZ A;  5I1V A;  2W3S A;  3NVZ B;  1E0Y A;  4ZOH B;  1DZN A;  5AWV A;  2Y4G A;  2QKN A;  2UUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...