2Y08A

Structure of the substrate-free fad-dependent tirandamycin oxidase taml
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
498
structure length
498
Chain Sequence
HIDSVAPGDIRYEDLRRGENLRFVGDPEEIHLVGSAAEIEQVLSRAVRSGKRVAVRSGGHCYEDFVANSDVRVVMDMSRLSAVGFDEERGAFAVEAGATLGAVYKTLFRVWGVTLPGGACPDVGAGGHILGGGYGPLSRMHGSIVDYLHAVEVVVVDASGDARTVIATREPSDPNHDLWWAHTGGGGGNFGVVVRYWLRTAEADVPPEPGRLLPRPPAEVLLNTTVWPWEGLDEAAFARLVRNHGRWFEQNSGPDSPWCDLYSVLALTRSQSGALAMTTQLDATGPDAEKRLETYLAAVSEGVGVQPHSDTRRLPWLHSTRWPGIAGDGDMTGRAKIKAAYARRSFDDRQIGTLYTRLTSTDYDNPAGVVALIAYGGKVNAVPADRTAVAQRDSILKIVYVTTWEDPAQDPVHVRWIRELYRDVYADTGGVPVPGGAADGAYVNYPDVDLADEEWNTSGVPWSELYYKDAYPRLQAVKARWDPRNVFRHALSVRVPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TAML
publication title Tirandamycin Biosynthesis is Mediated by Co-Dependent Oxidative Enzymes
pubmed doi rcsb
source organism Streptomyces sp. 307-9
molecule tags Oxidoreductase
total genus 157
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2y08A01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2y08A02
3GSYA 4XLOA 3PQBA 3D2JA 2Y3RA 4DNSA 3W8ZA 4PWBA 2Y4GA 2Y3SA 3POPA 3FW8A 3FW7A 2UUUA 2AXRA 4UD8A 3RJ8A 3VTEA 2IPIA 4PVEA 2WDWA 4PWCA 3W8XA 5L6FA 3D2HA 5AWVA 4PVKA 4PVJA 3TSJA 4EC3A 3HSUA 3D2DA 5I1WA 3TSHA 2UUVA 4PVHA 5L6GA 2BVGA 3RJAA 3W8WA 2BVHA 5I1VA 2Y08A 3FWAA 3FW9A 5D79A 1ZR6A 4PZFA 5K8EA 2BVFA
chains in the Genus database with same CATH superfamily
1FO4A 1E0YA 3GSYA 2PLIA 4OALA 1DZNA 5ADZA 2VFUA 3EUB3 1N5XA 1AHZA 2Y3SA 3POPA 1E8FA 4HG0A 2UUUA 2AXRA 2IPIA 3W8XA 1DIQA 5L6FA 3NVWB 2I0KA 4EC3A 3HSUA 3NVYB 2E3TA 1QLUA 1WVEA 3D2DA 4JAYA 1E8HA 2R2ZA 2BVHA 1VDVA 2Q85A 3BW7A 3AMZA 3TX1A 5G5HB 3JS8A 1F0XA 1DIIA 4BC9A 2W3SA 1N60C 1FIQB 4PZFA 3PM9A 2R8DA 2W3RA 1VAOA 1MBBA 1WYGA 2VFSA 1N62C 5FXPA 2VFTA 4PWBA 2O3GA 1W1SA 3HRDC 3FW8A 3KJMA 3VTEA 3RJ8A 2WDWA 4PWCA 1W1LA 3D2HA 4PVJA 5AWVA 3TSJA 5AE2A 3S1CA 1UXYA 5FXFA 5I1WA 3TSHA 1FFVC 4ZOHB 5L6GA 3NRZB 3S1FA 2VAOA 5I1VA 2MBRA 3DEDA 1QLTA 1E8GA 2VFRA 3FWAA 2PLSA 4BBYA 1MBTA 5HHZA 1W1QA 3AM9A 1ZR6A 5AE3A 1ZXIC 3FW7A 4MLAA 3D2JA 1JROA 2Y3RA 4DNSA 1W1JA 4BC7A 1RM6B 4ML8A 2W54A 2Q4WA 2OAIA 2VFVA 1N61C 2GQTA 4PYTA 4JB1A 4PVKA 4BCAA 3I99A 2QPMA 5HMRA 5FXEA 3C0PA 5HQXA 3SR6B 4PVHA 3W8WA 2BVGA 2P13A 3DQ0A 3RJAA 3S1DA 1AHVA 2RK5A 3S1EA 2Y08A 1I19A 3B9JB 3FW9A 2W55A 3NVZB 1V97A 3NS1B 5K8EA 5FXDA 4XLOA 3PQBA 3NVVB 4O95A 3W8ZA 1W1KA 2P3HA 1N5WC 1AHUA 2Y4GA 3LLBA 4UD8A 4PVEA 2NQWA 2EXRA 1N63C 1SB3B 1T3QC 2GQUA 2YVSA 3ETRB 1W1MA 2UUVA 5AE1A 5G5GB 2QKNA 1W1OA 3LAEA 1HSKA 1FFUC 1JRPA 1W1RA 5D79A 3AN1A 1WVFA 2P4PA 2BVFA
chains in the Genus database with same CATH topology
1FO4A 1E0YA 3GSYA 2PLIA 4OALA 1DZNA 5ADZA 2VFUA 3EUB3 1N5XA 1AHZA 2Y3SA 3POPA 1E8FA 4HG0A 2UUUA 2AXRA 2IPIA 3W8XA 1DIQA 5L6FA 3NVWB 2I0KA 4EC3A 3HSUA 3NVYB 2E3TA 1QLUA 1WVEA 3D2DA 4JAYA 1E8HA 2R2ZA 2BVHA 1VDVA 2Q85A 3BW7A 3AMZA 3TX1A 5G5HB 3JS8A 1F0XA 1DIIA 4BC9A 2W3SA 1N60C 1FIQB 4PZFA 3PM9A 2R8DA 2W3RA 1VAOA 1MBBA 1WYGA 2VFSA 1N62C 5FXPA 2VFTA 4PWBA 2O3GA 1W1SA 3HRDC 3FW8A 3KJMA 3VTEA 3RJ8A 2WDWA 4PWCA 1W1LA 3D2HA 4PVJA 5AWVA 3TSJA 5AE2A 3S1CA 1UXYA 5FXFA 5I1WA 3TSHA 1FFVC 4ZOHB 5L6GA 3NRZB 3S1FA 2VAOA 5I1VA 2MBRA 3DEDA 1QLTA 1E8GA 2VFRA 3FWAA 2PLSA 4BBYA 1MBTA 5HHZA 1W1QA 3AM9A 1ZR6A 5AE3A 1ZXIC 3FW7A 4MLAA 3D2JA 1JROA 2Y3RA 4DNSA 1W1JA 4BC7A 1RM6B 4ML8A 2W54A 2Q4WA 2OAIA 2VFVA 1N61C 2GQTA 4PYTA 4JB1A 4PVKA 4BCAA 3I99A 2QPMA 5HMRA 5FXEA 3C0PA 5HQXA 3SR6B 4PVHA 3W8WA 2BVGA 2P13A 3DQ0A 3RJAA 3S1DA 1AHVA 2RK5A 3S1EA 2Y08A 1I19A 3B9JB 3FW9A 2W55A 3NVZB 1V97A 3NS1B 5K8EA 5FXDA 4XLOA 3PQBA 3NVVB 4O95A 3W8ZA 1W1KA 2P3HA 1N5WC 1AHUA 2Y4GA 3LLBA 4UD8A 4PVEA 2NQWA 2EXRA 1N63C 1SB3B 1T3QC 2GQUA 2YVSA 3ETRB 1W1MA 2UUVA 5AE1A 5G5GB 2QKNA 1W1OA 3LAEA 1HSKA 1FFUC 1JRPA 1W1RA 5D79A 3AN1A 1WVFA 2P4PA 2BVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GSY A;  4XLO A;  3PQB A;  3D2J A;  2Y3R A;  4DNS A;  3W8Z A;  4PWB A;  2Y4G A;  2Y3S A;  3POP A;  3FW8 A;  3FW7 A;  2UUU A;  2AXR A;  4UD8 A;  3RJ8 A;  3VTE A;  2IPI A;  4PVE A;  2WDW A;  4PWC A;  3W8X A;  5L6F A;  3D2H A;  5AWV A;  4PVK A;  4PVJ A;  3TSJ A;  4EC3 A;  3HSU A;  3D2D A;  5I1W A;  3TSH A;  2UUV A;  4PVH A;  5L6G A;  2BVG A;  3RJA A;  3W8W A;  2BVH A;  5I1V A;  2Y08 A;  3FWA A;  3FW9 A;  5D79 A;  1ZR6 A;  4PZF A;  5K8E A;  2BVF A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  1E0Y A;  3GSY A;  2PLI A;  4OAL A;  1DZN A;  5ADZ A;  2VFU A;  3EUB 3;  1N5X A;  1AHZ A;  2Y3S A;  3POP A;  1E8F A;  4HG0 A;  2UUU A;  2AXR A;  2IPI A;  3W8X A;  1DIQ A;  5L6F A;  3NVW B;  2I0K A;  4EC3 A;  3HSU A;  3NVY B;  2E3T A;  1QLU A;  1WVE A;  3D2D A;  4JAY A;  1E8H A;  2R2Z A;  2BVH A;  1VDV A;  2Q85 A;  3BW7 A;  3AMZ A;  3TX1 A;  5G5H B;  3JS8 A;  1F0X A;  1DII A;  4BC9 A;  2W3S A;  1N60 C;  1FIQ B;  4PZF A;  3PM9 A;  2R8D A;  2W3R A;  1VAO A;  1MBB A;  1WYG A;  2VFS A;  1N62 C;  5FXP A;  2VFT A;  4PWB A;  2O3G A;  1W1S A;  3HRD C;  3FW8 A;  3KJM A;  3VTE A;  3RJ8 A;  2WDW A;  4PWC A;  1W1L A;  3D2H A;  4PVJ A;  5AWV A;  3TSJ A;  5AE2 A;  3S1C A;  1UXY A;  5FXF A;  5I1W A;  3TSH A;  1FFV C;  4ZOH B;  5L6G A;  3NRZ B;  3S1F A;  2VAO A;  5I1V A;  2MBR A;  3DED A;  1QLT A;  1E8G A;  2VFR A;  3FWA A;  2PLS A;  4BBY A;  1MBT A;  5HHZ A;  1W1Q A;  3AM9 A;  1ZR6 A;  5AE3 A;  1ZXI C;  3FW7 A;  4MLA A;  3D2J A;  1JRO A;  2Y3R A;  4DNS A;  1W1J A;  4BC7 A;  1RM6 B;  4ML8 A;  2W54 A;  2Q4W A;  2OAI A;  2VFV A;  1N61 C;  2GQT A;  4PYT A;  4JB1 A;  4PVK A;  4BCA A;  3I99 A;  2QPM A;  5HMR A;  5FXE A;  3C0P A;  5HQX A;  3SR6 B;  4PVH A;  3W8W A;  2BVG A;  2P13 A;  3DQ0 A;  3RJA A;  3S1D A;  1AHV A;  2RK5 A;  3S1E A;  2Y08 A;  1I19 A;  3B9J B;  3FW9 A;  2W55 A;  3NVZ B;  1V97 A;  3NS1 B;  5K8E A;  5FXD A;  4XLO A;  3PQB A;  3NVV B;  4O95 A;  3W8Z A;  1W1K A;  2P3H A;  1N5W C;  1AHU A;  2Y4G A;  3LLB A;  4UD8 A;  4PVE A;  2NQW A;  2EXR A;  1N63 C;  1SB3 B;  1T3Q C;  2GQU A;  2YVS A;  3ETR B;  1W1M A;  2UUV A;  5AE1 A;  5G5G B;  2QKN A;  1W1O A;  3LAE A;  1HSK A;  1FFU C;  1JRP A;  1W1R A;  5D79 A;  3AN1 A;  1WVF A;  2P4P A;  2BVF A; 
#chains in the Genus database with same CATH homology
 1FO4 A;  1E0Y A;  3GSY A;  2PLI A;  4OAL A;  1DZN A;  5ADZ A;  2VFU A;  3EUB 3;  1N5X A;  1AHZ A;  2Y3S A;  3POP A;  1E8F A;  4HG0 A;  2UUU A;  2AXR A;  2IPI A;  3W8X A;  1DIQ A;  5L6F A;  3NVW B;  2I0K A;  4EC3 A;  3HSU A;  3NVY B;  2E3T A;  1QLU A;  1WVE A;  3D2D A;  4JAY A;  1E8H A;  2R2Z A;  2BVH A;  1VDV A;  2Q85 A;  3BW7 A;  3AMZ A;  3TX1 A;  5G5H B;  3JS8 A;  1F0X A;  1DII A;  4BC9 A;  2W3S A;  1N60 C;  1FIQ B;  4PZF A;  3PM9 A;  2R8D A;  2W3R A;  1VAO A;  1MBB A;  1WYG A;  2VFS A;  1N62 C;  5FXP A;  2VFT A;  4PWB A;  2O3G A;  1W1S A;  3HRD C;  3FW8 A;  3KJM A;  3VTE A;  3RJ8 A;  2WDW A;  4PWC A;  1W1L A;  3D2H A;  4PVJ A;  5AWV A;  3TSJ A;  5AE2 A;  3S1C A;  1UXY A;  5FXF A;  5I1W A;  3TSH A;  1FFV C;  4ZOH B;  5L6G A;  3NRZ B;  3S1F A;  2VAO A;  5I1V A;  2MBR A;  3DED A;  1QLT A;  1E8G A;  2VFR A;  3FWA A;  2PLS A;  4BBY A;  1MBT A;  5HHZ A;  1W1Q A;  3AM9 A;  1ZR6 A;  5AE3 A;  1ZXI C;  3FW7 A;  4MLA A;  3D2J A;  1JRO A;  2Y3R A;  4DNS A;  1W1J A;  4BC7 A;  1RM6 B;  4ML8 A;  2W54 A;  2Q4W A;  2OAI A;  2VFV A;  1N61 C;  2GQT A;  4PYT A;  4JB1 A;  4PVK A;  4BCA A;  3I99 A;  2QPM A;  5HMR A;  5FXE A;  3C0P A;  5HQX A;  3SR6 B;  4PVH A;  3W8W A;  2BVG A;  2P13 A;  3DQ0 A;  3RJA A;  3S1D A;  1AHV A;  2RK5 A;  3S1E A;  2Y08 A;  1I19 A;  3B9J B;  3FW9 A;  2W55 A;  3NVZ B;  1V97 A;  3NS1 B;  5K8E A;  5FXD A;  4XLO A;  3PQB A;  3NVV B;  4O95 A;  3W8Z A;  1W1K A;  2P3H A;  1N5W C;  1AHU A;  2Y4G A;  3LLB A;  4UD8 A;  4PVE A;  2NQW A;  2EXR A;  1N63 C;  1SB3 B;  1T3Q C;  2GQU A;  2YVS A;  3ETR B;  1W1M A;  2UUV A;  5AE1 A;  5G5G B;  2QKN A;  1W1O A;  3LAE A;  1HSK A;  1FFU C;  1JRP A;  1W1R A;  5D79 A;  3AN1 A;  1WVF A;  2P4P A;  2BVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...