5HQXA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor hetdz
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
495
structure length
460
Chain Sequence
VGGGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRGRARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGRRFDYVEGFVVAAESVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGRAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
total genus 143
structure length 460
sequence length 495
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hqxA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hqxA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hqxA03
1N63C 1E8FA 3LAEA 5HHZA 1N5XA 4MLAA 1N61C 2Q4WA 3NVZB 3S1EA 4JB1A 1QLUA 1UXYA 5HMRA 2MBRA 1MBTA 1DZNA 1AHUA 5FXPA 4PWCA 3NRZB 4ML8A 2BVFA 3W8WA 1AHVA 1T3QC 1FFUC 2VAOA 2W3RA 2P13A 2I0KA 1HSKA 1E0YA 3SR6B 5FXEA 1FFVC 1E8HA 4PVEA 2VFSA 3AM9A 4BC7A 2BVGA 1VAOA 3FWAA 4DNSA 3NVWB 4UD8A 3S1FA 4BCAA 2GQUA 3I99A 3C0PA 1W1LA 3AN1A 5FXDA 3S1DA 2RK5A 1W1QA 1AHZA 4BBYA 3TSJA 2VFRA 2VFVA 1WVFA 2E3TA 1W1OA 5FXFA 3W8XA 3VTEA 3JS8A 1I19A 2VFTA 1W1SA 1N60C 1W1MA 2P3HA 3NVYB 3D2DA 2YVSA 2QKNA 1W1JA 3NS1B 4BC9A 1W1RA 2Q85A 4EC3A 3BW7A 4PVKA 2O3GA 1JROA 1DIIA 1DIQA 3PM9A 2GQTA 4PYTA 2W3SA 2VFUA 4O95A 1QLTA 3B9JB 1W1KA 1JRPA 1WVEA 4PVHA 4PZFA 1F0XA 2PLIA 1VDVA 3ETRB 2W54A 5D79A 1ZXIC 3W8ZA 1FO4A 3FW9A 5AE1A 2P4PA 2BVHA 3AMZA 2PLSA 4PVJA 2EXRA 3S1CA 3DQ0A 1V97A 2W55A 3TSHA 3NVVB 4HG0A 4PWBA 1WYGA 3FW7A 1FIQB 1E8GA 4XLOA 2AXRA 4ZOHB 5G5HB 1MBBA 2NQWA 5AE2A 2R8DA 5G5GB 2OAIA 3DEDA 1N62C 1RM6B 3D2JA 1N5WC 3EUB3 3D2HA 5HQXA 2R2ZA 1SB3B 2QPMA 3FW8A 4OALA 3TX1A 5AE3A 1ZR6A 3KJMA 5ADZA 4JAYA 3HRDC 3GSYA 3LLBA
chains in the Genus database with same CATH superfamily
1N63C 3EJEB 1E8FA 3LAEA 5HHZA 1N5XA 4MLAA 1N61C 2Q4WA 3NVZB 3S1EA 4JB1A 1QLUA 1UXYA 5HMRA 2MBRA 1MBTA 1DZNA 1AHUA 5FXPA 4PWCA 3NRZB 4ML8A 3EJDB 2BVFA 3W8WA 1AHVA 1T3QC 2Y3SA 1FFUC 2VAOA 5I1VA 2W3RA 2IPIA 2P13A 2I0KA 1HSKA 1E0YA 3SR6B 5FXEA 2UUVA 1FFVC 1E8HA 4PVEA 2VFSA 3AM9A 4BC7A 2BVGA 1VAOA 3FWAA 4DNSA 3NVWB 4UD8A 3S1FA 4BCAA 2GQUA 3I99A 3C0PA 1W1LA 3AN1A 5FXDA 3S1DA 2RK5A 1W1QA 1AHZA 3PQBA 4BBYA 3TSJA 2VFRA 2VFVA 1WVFA 2E3TA 1W1OA 5FXFA 3W8XA 5L6GA 3VTEA 3JS8A 1I19A 2Y08A 2VFTA 1W1SA 1N60C 1W1MA 2P3HA 3NVYB 3D2DA 2YVSA 2QKNA 1W1JA 3NS1B 4BC9A 1W1RA 2Q85A 4EC3A 3BW7A 4PVKA 2O3GA 2Y3RA 1JROA 1DIIA 1DIQA 3EJBB 3PM9A 2GQTA 4PYTA 2W3SA 2VFUA 3RJ8A 4O95A 1QLTA 3B9JB 1W1KA 3HSUA 1JRPA 1WVEA 4PVHA 4PZFA 3POPA 1F0XA 2PLIA 1VDVA 3ETRB 2W54A 5D79A 1ZXIC 3W8ZA 1FO4A 3FW9A 5AE1A 2P4PA 2BVHA 3AMZA 2Y4GA 2PLSA 2WDWA 5L6FA 4PVJA 2EXRA 3S1CA 3DQ0A 1V97A 2W55A 5I1WA 3TSHA 3NVVB 4HG0A 4PWBA 1WYGA 3FW7A 1FIQB 1E8GA 4XLOA 2AXRA 4ZOHB 5G5HB 1MBBA 2NQWA 5AE2A 5AWVA 3RJAA 5K8EA 2R8DA 5G5GB 2OAIA 3DEDA 1N62C 1RM6B 3D2JA 2UUUA 1N5WC 3EUB3 3D2HA 5HQXA 2R2ZA 1SB3B 2QPMA 3FW8A 4OALA 3TX1A 5AE3A 1ZR6A 3KJMA 5ADZA 4JAYA 3HRDC 3GSYA 3LLBA
chains in the Genus database with same CATH topology
1N63C 1E8FA 3LAEA 5HHZA 1N5XA 4MLAA 1N61C 2Q4WA 3NVZB 3S1EA 4JB1A 1QLUA 1UXYA 5HMRA 2MBRA 1MBTA 1DZNA 1AHUA 5FXPA 4PWCA 3NRZB 4ML8A 2BVFA 3W8WA 1AHVA 1T3QC 2Y3SA 1FFUC 2VAOA 5I1VA 2W3RA 2IPIA 2P13A 2I0KA 1HSKA 1E0YA 3SR6B 5FXEA 2UUVA 1FFVC 1E8HA 4PVEA 2VFSA 3AM9A 4BC7A 2BVGA 1VAOA 3FWAA 4DNSA 3NVWB 4UD8A 3S1FA 4BCAA 2GQUA 3I99A 3C0PA 1W1LA 3AN1A 5FXDA 3S1DA 2RK5A 1W1QA 1AHZA 3PQBA 4BBYA 3TSJA 2VFRA 2VFVA 1WVFA 2E3TA 1W1OA 5FXFA 3W8XA 5L6GA 3VTEA 3JS8A 1I19A 2Y08A 2VFTA 1W1SA 1N60C 1W1MA 2P3HA 3NVYB 3D2DA 2YVSA 2QKNA 1W1JA 3NS1B 4BC9A 1W1RA 2Q85A 4EC3A 3BW7A 4PVKA 2O3GA 2Y3RA 1JROA 1DIIA 1DIQA 3PM9A 2GQTA 4PYTA 2W3SA 2VFUA 3RJ8A 4O95A 1QLTA 3B9JB 1W1KA 3HSUA 1JRPA 1WVEA 4PVHA 4PZFA 3POPA 1F0XA 2PLIA 1VDVA 3ETRB 2W54A 5D79A 1ZXIC 3W8ZA 1FO4A 3FW9A 5AE1A 2P4PA 2BVHA 3AMZA 2Y4GA 2PLSA 2WDWA 5L6FA 4PVJA 2EXRA 3S1CA 3DQ0A 1V97A 2W55A 5I1WA 3TSHA 3NVVB 4HG0A 4PWBA 1WYGA 3FW7A 1FIQB 1E8GA 4XLOA 2AXRA 4ZOHB 5G5HB 1MBBA 2NQWA 5AE2A 5AWVA 3RJAA 5K8EA 2R8DA 5G5GB 2OAIA 3DEDA 1N62C 1RM6B 3D2JA 2UUUA 1N5WC 3EUB3 3D2HA 5HQXA 2R2ZA 1SB3B 2QPMA 3FW8A 4OALA 3TX1A 5AE3A 1ZR6A 3KJMA 5ADZA 4JAYA 3HRDC 3GSYA 3LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 C;  1E8F A;  3LAE A;  5HHZ A;  1N5X A;  4MLA A;  1N61 C;  2Q4W A;  3NVZ B;  3S1E A;  4JB1 A;  1QLU A;  1UXY A;  5HMR A;  2MBR A;  1MBT A;  1DZN A;  1AHU A;  5FXP A;  4PWC A;  3NRZ B;  4ML8 A;  2BVF A;  3W8W A;  1AHV A;  1T3Q C;  1FFU C;  2VAO A;  2W3R A;  2P13 A;  2I0K A;  1HSK A;  1E0Y A;  3SR6 B;  5FXE A;  1FFV C;  1E8H A;  4PVE A;  2VFS A;  3AM9 A;  4BC7 A;  2BVG A;  1VAO A;  3FWA A;  4DNS A;  3NVW B;  4UD8 A;  3S1F A;  4BCA A;  2GQU A;  3I99 A;  3C0P A;  1W1L A;  3AN1 A;  5FXD A;  3S1D A;  2RK5 A;  1W1Q A;  1AHZ A;  4BBY A;  3TSJ A;  2VFR A;  2VFV A;  1WVF A;  2E3T A;  1W1O A;  5FXF A;  3W8X A;  3VTE A;  3JS8 A;  1I19 A;  2VFT A;  1W1S A;  1N60 C;  1W1M A;  2P3H A;  3NVY B;  3D2D A;  2YVS A;  2QKN A;  1W1J A;  3NS1 B;  4BC9 A;  1W1R A;  2Q85 A;  4EC3 A;  3BW7 A;  4PVK A;  2O3G A;  1JRO A;  1DII A;  1DIQ A;  3PM9 A;  2GQT A;  4PYT A;  2W3S A;  2VFU A;  4O95 A;  1QLT A;  3B9J B;  1W1K A;  1JRP A;  1WVE A;  4PVH A;  4PZF A;  1F0X A;  2PLI A;  1VDV A;  3ETR B;  2W54 A;  5D79 A;  1ZXI C;  3W8Z A;  1FO4 A;  3FW9 A;  5AE1 A;  2P4P A;  2BVH A;  3AMZ A;  2PLS A;  4PVJ A;  2EXR A;  3S1C A;  3DQ0 A;  1V97 A;  2W55 A;  3TSH A;  3NVV B;  4HG0 A;  4PWB A;  1WYG A;  3FW7 A;  1FIQ B;  1E8G A;  4XLO A;  2AXR A;  4ZOH B;  5G5H B;  1MBB A;  2NQW A;  5AE2 A;  2R8D A;  5G5G B;  2OAI A;  3DED A;  1N62 C;  1RM6 B;  3D2J A;  1N5W C;  3EUB 3;  3D2H A;  5HQX A;  2R2Z A;  1SB3 B;  2QPM A;  3FW8 A;  4OAL A;  3TX1 A;  5AE3 A;  1ZR6 A;  3KJM A;  5ADZ A;  4JAY A;  3HRD C;  3GSY A;  3LLB A; 
#chains in the Genus database with same CATH topology
 1N63 C;  3EJE B;  1E8F A;  3LAE A;  5HHZ A;  1N5X A;  4MLA A;  1N61 C;  2Q4W A;  3NVZ B;  3S1E A;  4JB1 A;  1QLU A;  1UXY A;  5HMR A;  2MBR A;  1MBT A;  1DZN A;  1AHU A;  5FXP A;  4PWC A;  3NRZ B;  4ML8 A;  3EJD B;  2BVF A;  3W8W A;  1AHV A;  1T3Q C;  2Y3S A;  1FFU C;  2VAO A;  5I1V A;  2W3R A;  2IPI A;  2P13 A;  2I0K A;  1HSK A;  1E0Y A;  3SR6 B;  5FXE A;  2UUV A;  1FFV C;  1E8H A;  4PVE A;  2VFS A;  3AM9 A;  4BC7 A;  2BVG A;  1VAO A;  3FWA A;  4DNS A;  3NVW B;  4UD8 A;  3S1F A;  4BCA A;  2GQU A;  3I99 A;  3C0P A;  1W1L A;  3AN1 A;  5FXD A;  3S1D A;  2RK5 A;  1W1Q A;  1AHZ A;  3PQB A;  4BBY A;  3TSJ A;  2VFR A;  2VFV A;  1WVF A;  2E3T A;  1W1O A;  5FXF A;  3W8X A;  5L6G A;  3VTE A;  3JS8 A;  1I19 A;  2Y08 A;  2VFT A;  1W1S A;  1N60 C;  1W1M A;  2P3H A;  3NVY B;  3D2D A;  2YVS A;  2QKN A;  1W1J A;  3NS1 B;  4BC9 A;  1W1R A;  2Q85 A;  4EC3 A;  3BW7 A;  4PVK A;  2O3G A;  2Y3R A;  1JRO A;  1DII A;  1DIQ A;  3EJB B;  3PM9 A;  2GQT A;  4PYT A;  2W3S A;  2VFU A;  3RJ8 A;  4O95 A;  1QLT A;  3B9J B;  1W1K A;  3HSU A;  1JRP A;  1WVE A;  4PVH A;  4PZF A;  3POP A;  1F0X A;  2PLI A;  1VDV A;  3ETR B;  2W54 A;  5D79 A;  1ZXI C;  3W8Z A;  1FO4 A;  3FW9 A;  5AE1 A;  2P4P A;  2BVH A;  3AMZ A;  2Y4G A;  2PLS A;  2WDW A;  5L6F A;  4PVJ A;  2EXR A;  3S1C A;  3DQ0 A;  1V97 A;  2W55 A;  5I1W A;  3TSH A;  3NVV B;  4HG0 A;  4PWB A;  1WYG A;  3FW7 A;  1FIQ B;  1E8G A;  4XLO A;  2AXR A;  4ZOH B;  5G5H B;  1MBB A;  2NQW A;  5AE2 A;  5AWV A;  3RJA A;  5K8E A;  2R8D A;  5G5G B;  2OAI A;  3DED A;  1N62 C;  1RM6 B;  3D2J A;  2UUU A;  1N5W C;  3EUB 3;  3D2H A;  5HQX A;  2R2Z A;  1SB3 B;  2QPM A;  3FW8 A;  4OAL A;  3TX1 A;  5AE3 A;  1ZR6 A;  3KJM A;  5ADZ A;  4JAY A;  3HRD C;  3GSY A;  3LLB A; 
#chains in the Genus database with same CATH homology
 1N63 C;  1E8F A;  3LAE A;  5HHZ A;  1N5X A;  4MLA A;  1N61 C;  2Q4W A;  3NVZ B;  3S1E A;  4JB1 A;  1QLU A;  1UXY A;  5HMR A;  2MBR A;  1MBT A;  1DZN A;  1AHU A;  5FXP A;  4PWC A;  3NRZ B;  4ML8 A;  2BVF A;  3W8W A;  1AHV A;  1T3Q C;  2Y3S A;  1FFU C;  2VAO A;  5I1V A;  2W3R A;  2IPI A;  2P13 A;  2I0K A;  1HSK A;  1E0Y A;  3SR6 B;  5FXE A;  2UUV A;  1FFV C;  1E8H A;  4PVE A;  2VFS A;  3AM9 A;  4BC7 A;  2BVG A;  1VAO A;  3FWA A;  4DNS A;  3NVW B;  4UD8 A;  3S1F A;  4BCA A;  2GQU A;  3I99 A;  3C0P A;  1W1L A;  3AN1 A;  5FXD A;  3S1D A;  2RK5 A;  1W1Q A;  1AHZ A;  3PQB A;  4BBY A;  3TSJ A;  2VFR A;  2VFV A;  1WVF A;  2E3T A;  1W1O A;  5FXF A;  3W8X A;  5L6G A;  3VTE A;  3JS8 A;  1I19 A;  2Y08 A;  2VFT A;  1W1S A;  1N60 C;  1W1M A;  2P3H A;  3NVY B;  3D2D A;  2YVS A;  2QKN A;  1W1J A;  3NS1 B;  4BC9 A;  1W1R A;  2Q85 A;  4EC3 A;  3BW7 A;  4PVK A;  2O3G A;  2Y3R A;  1JRO A;  1DII A;  1DIQ A;  3PM9 A;  2GQT A;  4PYT A;  2W3S A;  2VFU A;  3RJ8 A;  4O95 A;  1QLT A;  3B9J B;  1W1K A;  3HSU A;  1JRP A;  1WVE A;  4PVH A;  4PZF A;  3POP A;  1F0X A;  2PLI A;  1VDV A;  3ETR B;  2W54 A;  5D79 A;  1ZXI C;  3W8Z A;  1FO4 A;  3FW9 A;  5AE1 A;  2P4P A;  2BVH A;  3AMZ A;  2Y4G A;  2PLS A;  2WDW A;  5L6F A;  4PVJ A;  2EXR A;  3S1C A;  3DQ0 A;  1V97 A;  2W55 A;  5I1W A;  3TSH A;  3NVV B;  4HG0 A;  4PWB A;  1WYG A;  3FW7 A;  1FIQ B;  1E8G A;  4XLO A;  2AXR A;  4ZOH B;  5G5H B;  1MBB A;  2NQW A;  5AE2 A;  5AWV A;  3RJA A;  5K8E A;  2R8D A;  5G5G B;  2OAI A;  3DED A;  1N62 C;  1RM6 B;  3D2J A;  2UUU A;  1N5W C;  3EUB 3;  3D2H A;  5HQX A;  2R2Z A;  1SB3 B;  2QPM A;  3FW8 A;  4OAL A;  3TX1 A;  5AE3 A;  1ZR6 A;  3KJM A;  5ADZ A;  4JAY A;  3HRD C;  3GSY A;  3LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...