5HQXA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor hetdz
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
495
structure length
460
Chain Sequence
VGGGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRGRARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGRRFDYVEGFVVAAESVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGRAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 143
structure length 460
sequence length 495
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hqxA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hqxA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hqxA03
3W8WA 1FFUC 2E3TA 3VTEA 1W1JA 5D79A 1N5WC 1W1LA 1WVEA 3S1DA 3W8XA 5FXDA 1N60C 4PVKA 1UXYA 3HRDC 1HSKA 1W1OA 5HMRA 2R8DA 3FW9A 1FO4A 3D2JA 5AE2A 3D2DA 2VFSA 4ZOHB 1DZNA 1N63C 2W55A 1VDVA 1SB3B 2BVHA 3NRZB 1E8GA 3TX1A 4ML8A 4PWCA 4BBYA 2VFTA 1QLUA 2P3HA 2VFRA 4JAYA 1T3QC 3S1EA 3LLBA 4PVHA 5G5HB 2Q4WA 3W8ZA 1E8FA 3JS8A 2NQWA 4XLOA 4MLAA 3NVWB 1N5XA 5FXFA 2P4PA 3EUB3 3SR6B 3TSHA 1VAOA 2W54A 3ETRB 5G5GB 2YVSA 3PM9A 3AN1A 1W1RA 3FW7A 3DQ0A 1W1KA 2VFUA 1N61C 4UD8A 1WYGA 3B9JB 3S1FA 1F0XA 4PWBA 1ZR6A 3C0PA 2W3SA 1JROA 4OALA 2BVFA 1FFVC 1AHVA 3S1CA 1ZXIC 2MBRA 2AXRA 4O95A 1FIQB 3TSJA 5HQXA 2Q85A 1AHZA 1JRPA 3FW8A 5HHZA 3AM9A 1RM6B 2W3RA 2P13A 2QPMA 1W1SA 1E8HA 4PVEA 1WVFA 3DEDA 1MBTA 2GQUA 1W1MA 1N62C 3I99A 2VAOA 5FXPA 3LAEA 4DNSA 3AMZA 4HG0A 2VFVA 3D2HA 5FXEA 3BW7A 1AHUA 4BCAA 2O3GA 3NS1B 1DIQA 4PVJA 3NVZB 3NVVB 2I0KA 1I19A 1QLTA 4PZFA 4JB1A 5ADZA 2RK5A 4PYTA 5AE1A 1DIIA 1V97A 2PLIA 4BC7A 3NVYB 2PLSA 4EC3A 1W1QA 3KJMA 2GQTA 2OAIA 2EXRA 1MBBA 5AE3A 4BC9A 3FWAA 3GSYA 2BVGA 2QKNA 1E0YA 2R2ZA
chains in the Genus database with same CATH superfamily
3W8WA 1FFUC 2E3TA 2UUVA 3VTEA 1W1JA 5D79A 1N5WC 1W1LA 1WVEA 3S1DA 3W8XA 5FXDA 5I1VA 1N60C 4PVKA 1UXYA 3HRDC 1HSKA 1W1OA 5HMRA 2R8DA 3FW9A 1FO4A 3D2JA 5AE2A 2IPIA 2UUUA 5L6FA 3D2DA 2VFSA 2Y3SA 4ZOHB 1DZNA 1N63C 2W55A 2WDWA 1VDVA 1SB3B 2BVHA 3NRZB 1E8GA 3TX1A 4ML8A 4PWCA 4BBYA 2VFTA 1QLUA 2Y4GA 2P3HA 2VFRA 4JAYA 1T3QC 3S1EA 3PQBA 3LLBA 4PVHA 5G5HB 2Q4WA 3W8ZA 1E8FA 3JS8A 3EJDB 3NVWB 4XLOA 4MLAA 2NQWA 1N5XA 5FXFA 2P4PA 3EUB3 3SR6B 3TSHA 1VAOA 2W54A 3ETRB 5G5GB 3EJBB 2YVSA 3PM9A 3AN1A 1W1RA 3FW7A 3DQ0A 1W1KA 2VFUA 1N61C 4UD8A 1WYGA 3B9JB 3S1FA 1F0XA 4PWBA 1ZR6A 3C0PA 2W3SA 1JROA 4OALA 2BVFA 1FFVC 1AHVA 3S1CA 1ZXIC 2MBRA 2AXRA 4O95A 1FIQB 3TSJA 5HQXA 2Q85A 1AHZA 1JRPA 3FW8A 5HHZA 5AWVA 3AM9A 1RM6B 2W3RA 2P13A 2QPMA 1W1SA 1E8HA 3HSUA 4PVEA 1WVFA 3DEDA 1MBTA 2GQUA 1W1MA 5I1WA 1N62C 3I99A 2VAOA 5FXPA 3LAEA 4DNSA 3AMZA 2Y3RA 4HG0A 2VFVA 3D2HA 5FXEA 3BW7A 1AHUA 4BCAA 2O3GA 3NS1B 1DIQA 3NVVB 3NVZB 4PVJA 2I0KA 2Y08A 1I19A 1QLTA 4PZFA 4JB1A 3EJEB 5ADZA 2RK5A 4PYTA 5AE1A 1DIIA 3RJAA 1V97A 2PLIA 4BC7A 3NVYB 5L6GA 2PLSA 4EC3A 1W1QA 3KJMA 2GQTA 2OAIA 3POPA 2EXRA 1MBBA 5AE3A 3RJ8A 4BC9A 3FWAA 3GSYA 2BVGA 2QKNA 1E0YA 2R2ZA 5K8EA
chains in the Genus database with same CATH topology
3W8WA 1FFUC 2E3TA 2UUVA 3VTEA 1W1JA 5D79A 1N5WC 1W1LA 1WVEA 3S1DA 3W8XA 5FXDA 5I1VA 1N60C 4PVKA 1UXYA 3HRDC 1HSKA 1W1OA 5HMRA 2R8DA 3FW9A 1FO4A 3D2JA 5AE2A 2IPIA 2UUUA 5L6FA 3D2DA 2VFSA 2Y3SA 4ZOHB 1DZNA 1N63C 2W55A 2WDWA 1VDVA 1SB3B 2BVHA 3NRZB 1E8GA 3TX1A 4ML8A 4PWCA 4BBYA 2VFTA 1QLUA 2Y4GA 2P3HA 2VFRA 4JAYA 1T3QC 3S1EA 3PQBA 3LLBA 4PVHA 5G5HB 2Q4WA 3W8ZA 1E8FA 3JS8A 2NQWA 4XLOA 4MLAA 3NVWB 1N5XA 5FXFA 2P4PA 3EUB3 3SR6B 3TSHA 1VAOA 2W54A 3ETRB 5G5GB 2YVSA 3PM9A 3AN1A 1W1RA 3FW7A 3DQ0A 1W1KA 2VFUA 1N61C 4UD8A 1WYGA 3B9JB 3S1FA 1F0XA 4PWBA 1ZR6A 3C0PA 2W3SA 1JROA 4OALA 2BVFA 1FFVC 1AHVA 3S1CA 1ZXIC 2MBRA 2AXRA 4O95A 1FIQB 3TSJA 5HQXA 2Q85A 1AHZA 1JRPA 3FW8A 5HHZA 5AWVA 3AM9A 1RM6B 2W3RA 2P13A 2QPMA 1W1SA 1E8HA 3HSUA 4PVEA 1WVFA 3DEDA 1MBTA 2GQUA 1W1MA 5I1WA 1N62C 3I99A 2VAOA 5FXPA 3LAEA 4DNSA 3AMZA 2Y3RA 4HG0A 2VFVA 3D2HA 5FXEA 3BW7A 1AHUA 4BCAA 2O3GA 3NS1B 1DIQA 4PVJA 3NVZB 2Y08A 2I0KA 3NVVB 1I19A 1QLTA 4PZFA 4JB1A 5ADZA 2RK5A 4PYTA 5AE1A 1DIIA 3RJAA 1V97A 2PLIA 4BC7A 3NVYB 5L6GA 2PLSA 4EC3A 1W1QA 3KJMA 2GQTA 2OAIA 3POPA 2EXRA 1MBBA 5AE3A 3RJ8A 4BC9A 3FWAA 3GSYA 2BVGA 2QKNA 1E0YA 2R2ZA 5K8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8W A;  1FFU C;  2E3T A;  3VTE A;  1W1J A;  5D79 A;  1N5W C;  1W1L A;  1WVE A;  3S1D A;  3W8X A;  5FXD A;  1N60 C;  4PVK A;  1UXY A;  3HRD C;  1HSK A;  1W1O A;  5HMR A;  2R8D A;  3FW9 A;  1FO4 A;  3D2J A;  5AE2 A;  3D2D A;  2VFS A;  4ZOH B;  1DZN A;  1N63 C;  2W55 A;  1VDV A;  1SB3 B;  2BVH A;  3NRZ B;  1E8G A;  3TX1 A;  4ML8 A;  4PWC A;  4BBY A;  2VFT A;  1QLU A;  2P3H A;  2VFR A;  4JAY A;  1T3Q C;  3S1E A;  3LLB A;  4PVH A;  5G5H B;  2Q4W A;  3W8Z A;  1E8F A;  3JS8 A;  2NQW A;  4XLO A;  4MLA A;  3NVW B;  1N5X A;  5FXF A;  2P4P A;  3EUB 3;  3SR6 B;  3TSH A;  1VAO A;  2W54 A;  3ETR B;  5G5G B;  2YVS A;  3PM9 A;  3AN1 A;  1W1R A;  3FW7 A;  3DQ0 A;  1W1K A;  2VFU A;  1N61 C;  4UD8 A;  1WYG A;  3B9J B;  3S1F A;  1F0X A;  4PWB A;  1ZR6 A;  3C0P A;  2W3S A;  1JRO A;  4OAL A;  2BVF A;  1FFV C;  1AHV A;  3S1C A;  1ZXI C;  2MBR A;  2AXR A;  4O95 A;  1FIQ B;  3TSJ A;  5HQX A;  2Q85 A;  1AHZ A;  1JRP A;  3FW8 A;  5HHZ A;  3AM9 A;  1RM6 B;  2W3R A;  2P13 A;  2QPM A;  1W1S A;  1E8H A;  4PVE A;  1WVF A;  3DED A;  1MBT A;  2GQU A;  1W1M A;  1N62 C;  3I99 A;  2VAO A;  5FXP A;  3LAE A;  4DNS A;  3AMZ A;  4HG0 A;  2VFV A;  3D2H A;  5FXE A;  3BW7 A;  1AHU A;  4BCA A;  2O3G A;  3NS1 B;  1DIQ A;  4PVJ A;  3NVZ B;  3NVV B;  2I0K A;  1I19 A;  1QLT A;  4PZF A;  4JB1 A;  5ADZ A;  2RK5 A;  4PYT A;  5AE1 A;  1DII A;  1V97 A;  2PLI A;  4BC7 A;  3NVY B;  2PLS A;  4EC3 A;  1W1Q A;  3KJM A;  2GQT A;  2OAI A;  2EXR A;  1MBB A;  5AE3 A;  4BC9 A;  3FWA A;  3GSY A;  2BVG A;  2QKN A;  1E0Y A;  2R2Z A; 
#chains in the Genus database with same CATH topology
 3W8W A;  1FFU C;  2E3T A;  2UUV A;  3VTE A;  1W1J A;  5D79 A;  1N5W C;  1W1L A;  1WVE A;  3S1D A;  3W8X A;  5FXD A;  5I1V A;  1N60 C;  4PVK A;  1UXY A;  3HRD C;  1HSK A;  1W1O A;  5HMR A;  2R8D A;  3FW9 A;  1FO4 A;  3D2J A;  5AE2 A;  2IPI A;  2UUU A;  5L6F A;  3D2D A;  2VFS A;  2Y3S A;  4ZOH B;  1DZN A;  1N63 C;  2W55 A;  2WDW A;  1VDV A;  1SB3 B;  2BVH A;  3NRZ B;  1E8G A;  3TX1 A;  4ML8 A;  4PWC A;  4BBY A;  2VFT A;  1QLU A;  2Y4G A;  2P3H A;  2VFR A;  4JAY A;  1T3Q C;  3S1E A;  3PQB A;  3LLB A;  4PVH A;  5G5H B;  2Q4W A;  3W8Z A;  1E8F A;  3JS8 A;  3EJD B;  3NVW B;  4XLO A;  4MLA A;  2NQW A;  1N5X A;  5FXF A;  2P4P A;  3EUB 3;  3SR6 B;  3TSH A;  1VAO A;  2W54 A;  3ETR B;  5G5G B;  3EJB B;  2YVS A;  3PM9 A;  3AN1 A;  1W1R A;  3FW7 A;  3DQ0 A;  1W1K A;  2VFU A;  1N61 C;  4UD8 A;  1WYG A;  3B9J B;  3S1F A;  1F0X A;  4PWB A;  1ZR6 A;  3C0P A;  2W3S A;  1JRO A;  4OAL A;  2BVF A;  1FFV C;  1AHV A;  3S1C A;  1ZXI C;  2MBR A;  2AXR A;  4O95 A;  1FIQ B;  3TSJ A;  5HQX A;  2Q85 A;  1AHZ A;  1JRP A;  3FW8 A;  5HHZ A;  5AWV A;  3AM9 A;  1RM6 B;  2W3R A;  2P13 A;  2QPM A;  1W1S A;  1E8H A;  3HSU A;  4PVE A;  1WVF A;  3DED A;  1MBT A;  2GQU A;  1W1M A;  5I1W A;  1N62 C;  3I99 A;  2VAO A;  5FXP A;  3LAE A;  4DNS A;  3AMZ A;  2Y3R A;  4HG0 A;  2VFV A;  3D2H A;  5FXE A;  3BW7 A;  1AHU A;  4BCA A;  2O3G A;  3NS1 B;  1DIQ A;  3NVV B;  3NVZ B;  4PVJ A;  2I0K A;  2Y08 A;  1I19 A;  1QLT A;  4PZF A;  4JB1 A;  3EJE B;  5ADZ A;  2RK5 A;  4PYT A;  5AE1 A;  1DII A;  3RJA A;  1V97 A;  2PLI A;  4BC7 A;  3NVY B;  5L6G A;  2PLS A;  4EC3 A;  1W1Q A;  3KJM A;  2GQT A;  2OAI A;  3POP A;  2EXR A;  1MBB A;  5AE3 A;  3RJ8 A;  4BC9 A;  3FWA A;  3GSY A;  2BVG A;  2QKN A;  1E0Y A;  2R2Z A;  5K8E A; 
#chains in the Genus database with same CATH homology
 3W8W A;  1FFU C;  2E3T A;  2UUV A;  3VTE A;  1W1J A;  5D79 A;  1N5W C;  1W1L A;  1WVE A;  3S1D A;  3W8X A;  5FXD A;  5I1V A;  1N60 C;  4PVK A;  1UXY A;  3HRD C;  1HSK A;  1W1O A;  5HMR A;  2R8D A;  3FW9 A;  1FO4 A;  3D2J A;  5AE2 A;  2IPI A;  2UUU A;  5L6F A;  3D2D A;  2VFS A;  2Y3S A;  4ZOH B;  1DZN A;  1N63 C;  2W55 A;  2WDW A;  1VDV A;  1SB3 B;  2BVH A;  3NRZ B;  1E8G A;  3TX1 A;  4ML8 A;  4PWC A;  4BBY A;  2VFT A;  1QLU A;  2Y4G A;  2P3H A;  2VFR A;  4JAY A;  1T3Q C;  3S1E A;  3PQB A;  3LLB A;  4PVH A;  5G5H B;  2Q4W A;  3W8Z A;  1E8F A;  3JS8 A;  2NQW A;  4XLO A;  4MLA A;  3NVW B;  1N5X A;  5FXF A;  2P4P A;  3EUB 3;  3SR6 B;  3TSH A;  1VAO A;  2W54 A;  3ETR B;  5G5G B;  2YVS A;  3PM9 A;  3AN1 A;  1W1R A;  3FW7 A;  3DQ0 A;  1W1K A;  2VFU A;  1N61 C;  4UD8 A;  1WYG A;  3B9J B;  3S1F A;  1F0X A;  4PWB A;  1ZR6 A;  3C0P A;  2W3S A;  1JRO A;  4OAL A;  2BVF A;  1FFV C;  1AHV A;  3S1C A;  1ZXI C;  2MBR A;  2AXR A;  4O95 A;  1FIQ B;  3TSJ A;  5HQX A;  2Q85 A;  1AHZ A;  1JRP A;  3FW8 A;  5HHZ A;  5AWV A;  3AM9 A;  1RM6 B;  2W3R A;  2P13 A;  2QPM A;  1W1S A;  1E8H A;  3HSU A;  4PVE A;  1WVF A;  3DED A;  1MBT A;  2GQU A;  1W1M A;  5I1W A;  1N62 C;  3I99 A;  2VAO A;  5FXP A;  3LAE A;  4DNS A;  3AMZ A;  2Y3R A;  4HG0 A;  2VFV A;  3D2H A;  5FXE A;  3BW7 A;  1AHU A;  4BCA A;  2O3G A;  3NS1 B;  1DIQ A;  4PVJ A;  3NVZ B;  2Y08 A;  2I0K A;  3NVV B;  1I19 A;  1QLT A;  4PZF A;  4JB1 A;  5ADZ A;  2RK5 A;  4PYT A;  5AE1 A;  1DII A;  3RJA A;  1V97 A;  2PLI A;  4BC7 A;  3NVY B;  5L6G A;  2PLS A;  4EC3 A;  1W1Q A;  3KJM A;  2GQT A;  2OAI A;  3POP A;  2EXR A;  1MBB A;  5AE3 A;  3RJ8 A;  4BC9 A;  3FWA A;  3GSY A;  2BVG A;  2QKN A;  1E0Y A;  2R2Z A;  5K8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...