5HQXA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor hetdz
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
495
structure length
460
Chain Sequence
VGGGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRGRARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGRRFDYVEGFVVAAESVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGRAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
total genus 143
structure length 460
sequence length 495
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hqxA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hqxA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hqxA03
2QPMA 3B9JB 1JROA 4PVJA 5G5HB 1VDVA 3TSHA 3W8XA 1QLTA 3D2JA 2GQUA 1AHUA 1DZNA 3FW7A 3S1CA 2VFTA 4PZFA 1UXYA 2P13A 3SR6B 3NVVB 1W1KA 1V97A 2VFRA 2BVFA 2BVGA 4ZOHB 1E8HA 4BBYA 1WYGA 2GQTA 1WVEA 1N5WC 2NQWA 1W1RA 3ETRB 3TSJA 5HHZA 1DIIA 5FXDA 1FFVC 2R8DA 4OALA 3NRZB 1N62C 3GSYA 2VFUA 3JS8A 3AMZA 3W8ZA 5HQXA 1W1QA 2EXRA 3DQ0A 3W8WA 1N61C 3C0PA 4PYTA 3I99A 4PVHA 1FIQB 3NVYB 3HRDC 5AE1A 1HSKA 1N63C 4XLOA 1E0YA 2P4PA 3NVWB 1N5XA 1VAOA 3LAEA 1I19A 3NVZB 1QLUA 2RK5A 3EUB3 3FW9A 2VFSA 2P3HA 4BC7A 1ZR6A 3TX1A 1T3QC 5HMRA 3D2HA 2W54A 3NS1B 2MBRA 3AN1A 4PVEA 2AXRA 4O95A 2VAOA 5ADZA 3LLBA 4UD8A 1RM6B 1FO4A 2W3RA 4BCAA 2BVHA 1E8FA 1W1OA 1WVFA 3VTEA 2O3GA 5FXEA 4EC3A 4MLAA 2VFVA 1W1SA 2W55A 3S1FA 3S1DA 3D2DA 1JRPA 3AM9A 3FWAA 1E8GA 2PLIA 1W1LA 4PWBA 1ZXIC 4JB1A 1MBBA 2R2ZA 4HG0A 2Q4WA 1SB3B 3KJMA 5D79A 1FFUC 1W1MA 4DNSA 3DEDA 5FXPA 1DIQA 1W1JA 2W3SA 1AHZA 1F0XA 4ML8A 2PLSA 3S1EA 1AHVA 1N60C 5AE2A 4BC9A 2QKNA 2E3TA 5FXFA 3BW7A 5AE3A 2YVSA 2Q85A 4PVKA 3PM9A 4PWCA 2OAIA 1MBTA 4JAYA 5G5GB 2I0KA 3FW8A
chains in the Genus database with same CATH superfamily
2QPMA 2Y08A 3B9JB 1JROA 5I1WA 4PVJA 5G5HB 1VDVA 3TSHA 3W8XA 1QLTA 3D2JA 5K8EA 2GQUA 1AHUA 1DZNA 3FW7A 3S1CA 2VFTA 4PZFA 5AWVA 2UUVA 1UXYA 2P13A 3SR6B 3NVVB 1W1KA 1V97A 2VFRA 2BVFA 2BVGA 4ZOHB 1E8HA 4BBYA 1WYGA 2GQTA 1WVEA 1N5WC 2NQWA 1W1RA 3ETRB 3TSJA 5I1VA 5HHZA 1DIIA 5FXDA 1FFVC 2R8DA 4OALA 3NRZB 1N62C 3GSYA 2VFUA 3JS8A 3AMZA 3W8ZA 5HQXA 1W1QA 2EXRA 5L6FA 3DQ0A 3W8WA 1N61C 3C0PA 4PYTA 3I99A 4PVHA 1FIQB 3NVYB 3HRDC 5AE1A 1HSKA 1N63C 3HSUA 4XLOA 1E0YA 2P4PA 3POPA 3NVWB 1N5XA 1VAOA 3LAEA 1I19A 3NVZB 1QLUA 2RK5A 3EUB3 3RJAA 3FW9A 2VFSA 2P3HA 4BC7A 1ZR6A 3TX1A 1T3QC 5HMRA 3D2HA 2W54A 3NS1B 2MBRA 3AN1A 4PVEA 2AXRA 4O95A 2VAOA 5ADZA 3LLBA 4UD8A 1RM6B 1FO4A 2W3RA 4BCAA 2BVHA 1E8FA 1W1OA 1WVFA 3VTEA 2O3GA 2Y3SA 3PQBA 5FXEA 4EC3A 4MLAA 2VFVA 1W1SA 2W55A 3S1FA 3S1DA 2UUUA 3D2DA 1JRPA 3AM9A 3FWAA 1E8GA 2PLIA 1W1LA 4PWBA 1ZXIC 2Y4GA 4JB1A 1MBBA 2R2ZA 4HG0A 3RJ8A 2Y3RA 2Q4WA 1SB3B 3KJMA 5D79A 1FFUC 1W1MA 4DNSA 3DEDA 5FXPA 1DIQA 1W1JA 3EJEB 2W3SA 1AHZA 3EJBB 2IPIA 1F0XA 4ML8A 2PLSA 3S1EA 1AHVA 1N60C 5AE2A 4BC9A 2QKNA 3EJDB 2E3TA 5FXFA 3BW7A 5AE3A 2WDWA 2YVSA 2Q85A 4PVKA 3PM9A 4PWCA 2OAIA 1MBTA 4JAYA 5G5GB 2I0KA 5L6GA 3FW8A
chains in the Genus database with same CATH topology
2QPMA 2Y08A 3B9JB 1JROA 5I1WA 4PVJA 5G5HB 1VDVA 3TSHA 3W8XA 1QLTA 3D2JA 5K8EA 2GQUA 1AHUA 1DZNA 3FW7A 3S1CA 2VFTA 4PZFA 5AWVA 2UUVA 1UXYA 2P13A 3SR6B 3NVVB 1W1KA 1V97A 2VFRA 2BVFA 2BVGA 4ZOHB 1E8HA 4BBYA 1WYGA 2GQTA 1WVEA 1N5WC 2NQWA 1W1RA 3ETRB 3TSJA 5I1VA 5HHZA 1DIIA 5FXDA 1FFVC 2R8DA 4OALA 3NRZB 1N62C 3GSYA 2VFUA 3JS8A 3AMZA 3W8ZA 5HQXA 1W1QA 2EXRA 5L6FA 3DQ0A 3W8WA 1N61C 3C0PA 4PYTA 3I99A 4PVHA 1FIQB 3NVYB 3HRDC 5AE1A 1HSKA 1N63C 3HSUA 4XLOA 1E0YA 2P4PA 3POPA 3NVWB 1N5XA 1VAOA 3LAEA 1I19A 3NVZB 1QLUA 2RK5A 3EUB3 3RJAA 3FW9A 2VFSA 2P3HA 4BC7A 1ZR6A 3TX1A 1T3QC 5HMRA 3D2HA 2W54A 3NS1B 2MBRA 3AN1A 4PVEA 2AXRA 4O95A 2VAOA 5ADZA 3LLBA 4UD8A 1RM6B 1FO4A 2W3RA 4BCAA 2BVHA 1E8FA 1W1OA 1WVFA 3VTEA 2O3GA 2Y3SA 3PQBA 5FXEA 4EC3A 4MLAA 2VFVA 1W1SA 2W55A 3S1FA 3S1DA 2UUUA 3D2DA 1JRPA 3AM9A 3FWAA 1E8GA 2PLIA 1W1LA 4PWBA 1ZXIC 2Y4GA 4JB1A 1MBBA 2R2ZA 4HG0A 3RJ8A 2Y3RA 2Q4WA 1SB3B 3KJMA 5D79A 1FFUC 1W1MA 4DNSA 3DEDA 5FXPA 1DIQA 1W1JA 2W3SA 1AHZA 2IPIA 1F0XA 4ML8A 2PLSA 3S1EA 1AHVA 1N60C 5AE2A 4BC9A 2QKNA 2E3TA 5FXFA 3BW7A 5AE3A 2WDWA 2YVSA 2Q85A 4PVKA 3PM9A 4PWCA 2OAIA 1MBTA 4JAYA 5G5GB 2I0KA 5L6GA 3FW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPM A;  3B9J B;  1JRO A;  4PVJ A;  5G5H B;  1VDV A;  3TSH A;  3W8X A;  1QLT A;  3D2J A;  2GQU A;  1AHU A;  1DZN A;  3FW7 A;  3S1C A;  2VFT A;  4PZF A;  1UXY A;  2P13 A;  3SR6 B;  3NVV B;  1W1K A;  1V97 A;  2VFR A;  2BVF A;  2BVG A;  4ZOH B;  1E8H A;  4BBY A;  1WYG A;  2GQT A;  1WVE A;  1N5W C;  2NQW A;  1W1R A;  3ETR B;  3TSJ A;  5HHZ A;  1DII A;  5FXD A;  1FFV C;  2R8D A;  4OAL A;  3NRZ B;  1N62 C;  3GSY A;  2VFU A;  3JS8 A;  3AMZ A;  3W8Z A;  5HQX A;  1W1Q A;  2EXR A;  3DQ0 A;  3W8W A;  1N61 C;  3C0P A;  4PYT A;  3I99 A;  4PVH A;  1FIQ B;  3NVY B;  3HRD C;  5AE1 A;  1HSK A;  1N63 C;  4XLO A;  1E0Y A;  2P4P A;  3NVW B;  1N5X A;  1VAO A;  3LAE A;  1I19 A;  3NVZ B;  1QLU A;  2RK5 A;  3EUB 3;  3FW9 A;  2VFS A;  2P3H A;  4BC7 A;  1ZR6 A;  3TX1 A;  1T3Q C;  5HMR A;  3D2H A;  2W54 A;  3NS1 B;  2MBR A;  3AN1 A;  4PVE A;  2AXR A;  4O95 A;  2VAO A;  5ADZ A;  3LLB A;  4UD8 A;  1RM6 B;  1FO4 A;  2W3R A;  4BCA A;  2BVH A;  1E8F A;  1W1O A;  1WVF A;  3VTE A;  2O3G A;  5FXE A;  4EC3 A;  4MLA A;  2VFV A;  1W1S A;  2W55 A;  3S1F A;  3S1D A;  3D2D A;  1JRP A;  3AM9 A;  3FWA A;  1E8G A;  2PLI A;  1W1L A;  4PWB A;  1ZXI C;  4JB1 A;  1MBB A;  2R2Z A;  4HG0 A;  2Q4W A;  1SB3 B;  3KJM A;  5D79 A;  1FFU C;  1W1M A;  4DNS A;  3DED A;  5FXP A;  1DIQ A;  1W1J A;  2W3S A;  1AHZ A;  1F0X A;  4ML8 A;  2PLS A;  3S1E A;  1AHV A;  1N60 C;  5AE2 A;  4BC9 A;  2QKN A;  2E3T A;  5FXF A;  3BW7 A;  5AE3 A;  2YVS A;  2Q85 A;  4PVK A;  3PM9 A;  4PWC A;  2OAI A;  1MBT A;  4JAY A;  5G5G B;  2I0K A;  3FW8 A; 
#chains in the Genus database with same CATH topology
 2QPM A;  2Y08 A;  3B9J B;  1JRO A;  5I1W A;  4PVJ A;  5G5H B;  1VDV A;  3TSH A;  3W8X A;  1QLT A;  3D2J A;  5K8E A;  2GQU A;  1AHU A;  1DZN A;  3FW7 A;  3S1C A;  2VFT A;  4PZF A;  5AWV A;  2UUV A;  1UXY A;  2P13 A;  3SR6 B;  3NVV B;  1W1K A;  1V97 A;  2VFR A;  2BVF A;  2BVG A;  4ZOH B;  1E8H A;  4BBY A;  1WYG A;  2GQT A;  1WVE A;  1N5W C;  2NQW A;  1W1R A;  3ETR B;  3TSJ A;  5I1V A;  5HHZ A;  1DII A;  5FXD A;  1FFV C;  2R8D A;  4OAL A;  3NRZ B;  1N62 C;  3GSY A;  2VFU A;  3JS8 A;  3AMZ A;  3W8Z A;  5HQX A;  1W1Q A;  2EXR A;  5L6F A;  3DQ0 A;  3W8W A;  1N61 C;  3C0P A;  4PYT A;  3I99 A;  4PVH A;  1FIQ B;  3NVY B;  3HRD C;  5AE1 A;  1HSK A;  1N63 C;  3HSU A;  4XLO A;  1E0Y A;  2P4P A;  3POP A;  3NVW B;  1N5X A;  1VAO A;  3LAE A;  1I19 A;  3NVZ B;  1QLU A;  2RK5 A;  3EUB 3;  3RJA A;  3FW9 A;  2VFS A;  2P3H A;  4BC7 A;  1ZR6 A;  3TX1 A;  1T3Q C;  5HMR A;  3D2H A;  2W54 A;  3NS1 B;  2MBR A;  3AN1 A;  4PVE A;  2AXR A;  4O95 A;  2VAO A;  5ADZ A;  3LLB A;  4UD8 A;  1RM6 B;  1FO4 A;  2W3R A;  4BCA A;  2BVH A;  1E8F A;  1W1O A;  1WVF A;  3VTE A;  2O3G A;  2Y3S A;  3PQB A;  5FXE A;  4EC3 A;  4MLA A;  2VFV A;  1W1S A;  2W55 A;  3S1F A;  3S1D A;  2UUU A;  3D2D A;  1JRP A;  3AM9 A;  3FWA A;  1E8G A;  2PLI A;  1W1L A;  4PWB A;  1ZXI C;  2Y4G A;  4JB1 A;  1MBB A;  2R2Z A;  4HG0 A;  3RJ8 A;  2Y3R A;  2Q4W A;  1SB3 B;  3KJM A;  5D79 A;  1FFU C;  1W1M A;  4DNS A;  3DED A;  5FXP A;  1DIQ A;  1W1J A;  3EJE B;  2W3S A;  1AHZ A;  3EJB B;  2IPI A;  1F0X A;  4ML8 A;  2PLS A;  3S1E A;  1AHV A;  1N60 C;  5AE2 A;  4BC9 A;  2QKN A;  3EJD B;  2E3T A;  5FXF A;  3BW7 A;  5AE3 A;  2WDW A;  2YVS A;  2Q85 A;  4PVK A;  3PM9 A;  4PWC A;  2OAI A;  1MBT A;  4JAY A;  5G5G B;  2I0K A;  5L6G A;  3FW8 A; 
#chains in the Genus database with same CATH homology
 2QPM A;  2Y08 A;  3B9J B;  1JRO A;  5I1W A;  4PVJ A;  5G5H B;  1VDV A;  3TSH A;  3W8X A;  1QLT A;  3D2J A;  5K8E A;  2GQU A;  1AHU A;  1DZN A;  3FW7 A;  3S1C A;  2VFT A;  4PZF A;  5AWV A;  2UUV A;  1UXY A;  2P13 A;  3SR6 B;  3NVV B;  1W1K A;  1V97 A;  2VFR A;  2BVF A;  2BVG A;  4ZOH B;  1E8H A;  4BBY A;  1WYG A;  2GQT A;  1WVE A;  1N5W C;  2NQW A;  1W1R A;  3ETR B;  3TSJ A;  5I1V A;  5HHZ A;  1DII A;  5FXD A;  1FFV C;  2R8D A;  4OAL A;  3NRZ B;  1N62 C;  3GSY A;  2VFU A;  3JS8 A;  3AMZ A;  3W8Z A;  5HQX A;  1W1Q A;  2EXR A;  5L6F A;  3DQ0 A;  3W8W A;  1N61 C;  3C0P A;  4PYT A;  3I99 A;  4PVH A;  1FIQ B;  3NVY B;  3HRD C;  5AE1 A;  1HSK A;  1N63 C;  3HSU A;  4XLO A;  1E0Y A;  2P4P A;  3POP A;  3NVW B;  1N5X A;  1VAO A;  3LAE A;  1I19 A;  3NVZ B;  1QLU A;  2RK5 A;  3EUB 3;  3RJA A;  3FW9 A;  2VFS A;  2P3H A;  4BC7 A;  1ZR6 A;  3TX1 A;  1T3Q C;  5HMR A;  3D2H A;  2W54 A;  3NS1 B;  2MBR A;  3AN1 A;  4PVE A;  2AXR A;  4O95 A;  2VAO A;  5ADZ A;  3LLB A;  4UD8 A;  1RM6 B;  1FO4 A;  2W3R A;  4BCA A;  2BVH A;  1E8F A;  1W1O A;  1WVF A;  3VTE A;  2O3G A;  2Y3S A;  3PQB A;  5FXE A;  4EC3 A;  4MLA A;  2VFV A;  1W1S A;  2W55 A;  3S1F A;  3S1D A;  2UUU A;  3D2D A;  1JRP A;  3AM9 A;  3FWA A;  1E8G A;  2PLI A;  1W1L A;  4PWB A;  1ZXI C;  2Y4G A;  4JB1 A;  1MBB A;  2R2Z A;  4HG0 A;  3RJ8 A;  2Y3R A;  2Q4W A;  1SB3 B;  3KJM A;  5D79 A;  1FFU C;  1W1M A;  4DNS A;  3DED A;  5FXP A;  1DIQ A;  1W1J A;  2W3S A;  1AHZ A;  2IPI A;  1F0X A;  4ML8 A;  2PLS A;  3S1E A;  1AHV A;  1N60 C;  5AE2 A;  4BC9 A;  2QKN A;  2E3T A;  5FXF A;  3BW7 A;  5AE3 A;  2WDW A;  2YVS A;  2Q85 A;  4PVK A;  3PM9 A;  4PWC A;  2OAI A;  1MBT A;  4JAY A;  5G5G B;  2I0K A;  5L6G A;  3FW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...