5HQXA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor hetdz
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
495
structure length
460
Chain Sequence
VGGGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRGRARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGSGRRFDYVEGFVVAAESVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGRAGAGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
total genus 143
structure length 460
sequence length 495
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hqxA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hqxA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hqxA03
2PLIA 2VFVA 4PYTA 1MBBA 2GQTA 3DQ0A 3VTEA 1W1KA 1N61C 4XLOA 1FO4A 3LAEA 1E8GA 3S1CA 1AHVA 3NVVB 2GQUA 2RK5A 2E3TA 3TSJA 2I0KA 4PVEA 3S1FA 1QLUA 1W1JA 1JROA 5D79A 2O3GA 3FW8A 3FWAA 5FXFA 1N62C 2W55A 3D2HA 1N60C 2BVFA 1E8FA 1I19A 4MLAA 3PM9A 4PWCA 3S1DA 3W8WA 1UXYA 5HQXA 1FFVC 2VFTA 3GSYA 3FW7A 2NQWA 1N5WC 3SR6B 3FW9A 2BVGA 4UD8A 1FIQB 1N63C 1DIQA 3KJMA 3BW7A 2VFRA 1E0YA 1WVEA 1W1LA 1MBTA 1WYGA 1W1QA 4EC3A 5AE1A 1HSKA 1RM6B 3LLBA 5AE2A 3AM9A 1ZXIC 4BC7A 4PWBA 4JAYA 2OAIA 2YVSA 3TSHA 3DEDA 2QKNA 1DZNA 5FXPA 5G5GB 4PZFA 5FXDA 2Q4WA 4OALA 3NRZB 1F0XA 2W54A 1FFUC 4PVKA 5ADZA 4BBYA 3NS1B 2P4PA 4JB1A 1ZR6A 3AN1A 3ETRB 2MBRA 2P13A 1WVFA 3C0PA 4O95A 2R8DA 3JS8A 3EUB3 3NVZB 5HMRA 3AMZA 3I99A 4PVJA 2EXRA 1VDVA 2VFUA 2BVHA 4ML8A 2P3HA 2PLSA 1VAOA 2QPMA 1AHUA 5FXEA 4DNSA 3HRDC 1W1OA 1V97A 3B9JB 3D2DA 4HG0A 1JRPA 1N5XA 4PVHA 1AHZA 1W1MA 4BCAA 1W1RA 1W1SA 2AXRA 1E8HA 2W3RA 3NVYB 1T3QC 1DIIA 4BC9A 5G5HB 3NVWB 5HHZA 3S1EA 2Q85A 5AE3A 4ZOHB 1SB3B 2W3SA 2VFSA 2VAOA 3D2JA 1QLTA 3TX1A 3W8ZA 2R2ZA 3W8XA
chains in the Genus database with same CATH superfamily
2PLIA 2VFVA 4PYTA 1MBBA 2Y3SA 2WDWA 2GQTA 3DQ0A 3VTEA 3POPA 1W1KA 1N61C 4XLOA 1FO4A 3LAEA 3RJAA 1E8GA 3S1CA 1AHVA 3NVVB 2GQUA 2RK5A 2E3TA 3TSJA 2I0KA 4PVEA 3S1FA 1QLUA 1W1JA 1JROA 5D79A 2O3GA 3FW8A 3EJBB 3FWAA 5FXFA 1N62C 2W55A 3D2HA 1N60C 2BVFA 1E8FA 1I19A 4MLAA 3PM9A 4PWCA 3S1DA 3W8WA 5K8EA 1UXYA 5HQXA 1FFVC 2VFTA 3GSYA 3FW7A 2NQWA 1N5WC 3SR6B 3FW9A 2BVGA 4UD8A 1FIQB 1N63C 1DIQA 3KJMA 3BW7A 2VFRA 1E0YA 1WVEA 1W1LA 2UUUA 2UUVA 3EJDB 1MBTA 1WYGA 1W1QA 4EC3A 5AE1A 1HSKA 1RM6B 5AWVA 3LLBA 5AE2A 3AM9A 1ZXIC 4BC7A 4PWBA 4JAYA 2OAIA 2YVSA 3TSHA 3DEDA 2QKNA 1DZNA 5FXPA 3PQBA 5G5GB 4PZFA 5FXDA 2Q4WA 4OALA 3NRZB 1F0XA 3EJEB 2W54A 1FFUC 4PVKA 5ADZA 4BBYA 3NS1B 2P4PA 4JB1A 1ZR6A 3AN1A 3ETRB 2MBRA 2P13A 1WVFA 3C0PA 4O95A 2R8DA 2Y4GA 3JS8A 3EUB3 3NVZB 5HMRA 3AMZA 3I99A 4PVJA 2EXRA 1VDVA 2VFUA 2BVHA 4ML8A 2P3HA 2PLSA 5I1VA 1VAOA 2QPMA 1AHUA 5FXEA 4DNSA 3HRDC 3HSUA 1W1OA 2Y08A 1V97A 5L6FA 3B9JB 3D2DA 4HG0A 1JRPA 1N5XA 4PVHA 1AHZA 1W1MA 4BCAA 1W1RA 2IPIA 1W1SA 2AXRA 1E8HA 2W3RA 3NVYB 1T3QC 1DIIA 4BC9A 5G5HB 3NVWB 5HHZA 3S1EA 2Q85A 5AE3A 4ZOHB 5L6GA 1SB3B 3RJ8A 2W3SA 2VFSA 2VAOA 3D2JA 1QLTA 2Y3RA 5I1WA 3TX1A 3W8ZA 2R2ZA 3W8XA
chains in the Genus database with same CATH topology
2PLIA 2VFVA 4PYTA 1MBBA 2Y3SA 2WDWA 2GQTA 3DQ0A 3VTEA 3POPA 1W1KA 1N61C 4XLOA 1FO4A 3LAEA 3RJAA 1E8GA 3S1CA 1AHVA 3NVVB 2GQUA 2RK5A 2E3TA 3TSJA 2I0KA 4PVEA 3S1FA 1QLUA 1W1JA 1JROA 5D79A 2O3GA 3FW8A 3FWAA 5FXFA 1N62C 2W55A 3D2HA 1N60C 2BVFA 1E8FA 1I19A 4MLAA 3PM9A 4PWCA 3S1DA 3W8WA 5K8EA 1UXYA 5HQXA 1FFVC 2VFTA 3GSYA 3FW7A 2NQWA 1N5WC 3SR6B 3FW9A 2BVGA 4UD8A 1FIQB 1N63C 1DIQA 3KJMA 3BW7A 2VFRA 1E0YA 1WVEA 1W1LA 2UUUA 2UUVA 1MBTA 1WYGA 1W1QA 4EC3A 5AE1A 1HSKA 1RM6B 5AWVA 3LLBA 5AE2A 3AM9A 1ZXIC 4BC7A 4PWBA 4JAYA 2OAIA 2YVSA 3TSHA 3DEDA 2QKNA 1DZNA 5FXPA 3PQBA 5G5GB 4PZFA 5FXDA 2Q4WA 4OALA 3NRZB 1F0XA 2W54A 1FFUC 4PVKA 5ADZA 4BBYA 3NS1B 2P4PA 4JB1A 1ZR6A 3AN1A 3ETRB 2MBRA 2P13A 1WVFA 3C0PA 4O95A 2R8DA 2Y4GA 3JS8A 3EUB3 3NVZB 5HMRA 3AMZA 3I99A 4PVJA 2EXRA 1VDVA 2VFUA 2BVHA 4ML8A 2P3HA 2PLSA 5I1VA 1VAOA 2QPMA 1AHUA 5FXEA 4DNSA 3HRDC 3HSUA 1W1OA 2Y08A 1V97A 5L6FA 3B9JB 3D2DA 4HG0A 1JRPA 1N5XA 4PVHA 1AHZA 1W1MA 4BCAA 1W1RA 2IPIA 1W1SA 2AXRA 1E8HA 2W3RA 3NVYB 1T3QC 1DIIA 4BC9A 5G5HB 3NVWB 5HHZA 3S1EA 2Q85A 5AE3A 4ZOHB 5L6GA 1SB3B 3RJ8A 2W3SA 2VFSA 2VAOA 3D2JA 1QLTA 2Y3RA 5I1WA 3TX1A 3W8ZA 2R2ZA 3W8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLI A;  2VFV A;  4PYT A;  1MBB A;  2GQT A;  3DQ0 A;  3VTE A;  1W1K A;  1N61 C;  4XLO A;  1FO4 A;  3LAE A;  1E8G A;  3S1C A;  1AHV A;  3NVV B;  2GQU A;  2RK5 A;  2E3T A;  3TSJ A;  2I0K A;  4PVE A;  3S1F A;  1QLU A;  1W1J A;  1JRO A;  5D79 A;  2O3G A;  3FW8 A;  3FWA A;  5FXF A;  1N62 C;  2W55 A;  3D2H A;  1N60 C;  2BVF A;  1E8F A;  1I19 A;  4MLA A;  3PM9 A;  4PWC A;  3S1D A;  3W8W A;  1UXY A;  5HQX A;  1FFV C;  2VFT A;  3GSY A;  3FW7 A;  2NQW A;  1N5W C;  3SR6 B;  3FW9 A;  2BVG A;  4UD8 A;  1FIQ B;  1N63 C;  1DIQ A;  3KJM A;  3BW7 A;  2VFR A;  1E0Y A;  1WVE A;  1W1L A;  1MBT A;  1WYG A;  1W1Q A;  4EC3 A;  5AE1 A;  1HSK A;  1RM6 B;  3LLB A;  5AE2 A;  3AM9 A;  1ZXI C;  4BC7 A;  4PWB A;  4JAY A;  2OAI A;  2YVS A;  3TSH A;  3DED A;  2QKN A;  1DZN A;  5FXP A;  5G5G B;  4PZF A;  5FXD A;  2Q4W A;  4OAL A;  3NRZ B;  1F0X A;  2W54 A;  1FFU C;  4PVK A;  5ADZ A;  4BBY A;  3NS1 B;  2P4P A;  4JB1 A;  1ZR6 A;  3AN1 A;  3ETR B;  2MBR A;  2P13 A;  1WVF A;  3C0P A;  4O95 A;  2R8D A;  3JS8 A;  3EUB 3;  3NVZ B;  5HMR A;  3AMZ A;  3I99 A;  4PVJ A;  2EXR A;  1VDV A;  2VFU A;  2BVH A;  4ML8 A;  2P3H A;  2PLS A;  1VAO A;  2QPM A;  1AHU A;  5FXE A;  4DNS A;  3HRD C;  1W1O A;  1V97 A;  3B9J B;  3D2D A;  4HG0 A;  1JRP A;  1N5X A;  4PVH A;  1AHZ A;  1W1M A;  4BCA A;  1W1R A;  1W1S A;  2AXR A;  1E8H A;  2W3R A;  3NVY B;  1T3Q C;  1DII A;  4BC9 A;  5G5H B;  3NVW B;  5HHZ A;  3S1E A;  2Q85 A;  5AE3 A;  4ZOH B;  1SB3 B;  2W3S A;  2VFS A;  2VAO A;  3D2J A;  1QLT A;  3TX1 A;  3W8Z A;  2R2Z A;  3W8X A; 
#chains in the Genus database with same CATH topology
 2PLI A;  2VFV A;  4PYT A;  1MBB A;  2Y3S A;  2WDW A;  2GQT A;  3DQ0 A;  3VTE A;  3POP A;  1W1K A;  1N61 C;  4XLO A;  1FO4 A;  3LAE A;  3RJA A;  1E8G A;  3S1C A;  1AHV A;  3NVV B;  2GQU A;  2RK5 A;  2E3T A;  3TSJ A;  2I0K A;  4PVE A;  3S1F A;  1QLU A;  1W1J A;  1JRO A;  5D79 A;  2O3G A;  3FW8 A;  3EJB B;  3FWA A;  5FXF A;  1N62 C;  2W55 A;  3D2H A;  1N60 C;  2BVF A;  1E8F A;  1I19 A;  4MLA A;  3PM9 A;  4PWC A;  3S1D A;  3W8W A;  5K8E A;  1UXY A;  5HQX A;  1FFV C;  2VFT A;  3GSY A;  3FW7 A;  2NQW A;  1N5W C;  3SR6 B;  3FW9 A;  2BVG A;  4UD8 A;  1FIQ B;  1N63 C;  1DIQ A;  3KJM A;  3BW7 A;  2VFR A;  1E0Y A;  1WVE A;  1W1L A;  2UUU A;  2UUV A;  3EJD B;  1MBT A;  1WYG A;  1W1Q A;  4EC3 A;  5AE1 A;  1HSK A;  1RM6 B;  5AWV A;  3LLB A;  5AE2 A;  3AM9 A;  1ZXI C;  4BC7 A;  4PWB A;  4JAY A;  2OAI A;  2YVS A;  3TSH A;  3DED A;  2QKN A;  1DZN A;  5FXP A;  3PQB A;  5G5G B;  4PZF A;  5FXD A;  2Q4W A;  4OAL A;  3NRZ B;  1F0X A;  3EJE B;  2W54 A;  1FFU C;  4PVK A;  5ADZ A;  4BBY A;  3NS1 B;  2P4P A;  4JB1 A;  1ZR6 A;  3AN1 A;  3ETR B;  2MBR A;  2P13 A;  1WVF A;  3C0P A;  4O95 A;  2R8D A;  2Y4G A;  3JS8 A;  3EUB 3;  3NVZ B;  5HMR A;  3AMZ A;  3I99 A;  4PVJ A;  2EXR A;  1VDV A;  2VFU A;  2BVH A;  4ML8 A;  2P3H A;  2PLS A;  5I1V A;  1VAO A;  2QPM A;  1AHU A;  5FXE A;  4DNS A;  3HRD C;  3HSU A;  1W1O A;  2Y08 A;  1V97 A;  5L6F A;  3B9J B;  3D2D A;  4HG0 A;  1JRP A;  1N5X A;  4PVH A;  1AHZ A;  1W1M A;  4BCA A;  1W1R A;  2IPI A;  1W1S A;  2AXR A;  1E8H A;  2W3R A;  3NVY B;  1T3Q C;  1DII A;  4BC9 A;  5G5H B;  3NVW B;  5HHZ A;  3S1E A;  2Q85 A;  5AE3 A;  4ZOH B;  5L6G A;  1SB3 B;  3RJ8 A;  2W3S A;  2VFS A;  2VAO A;  3D2J A;  1QLT A;  2Y3R A;  5I1W A;  3TX1 A;  3W8Z A;  2R2Z A;  3W8X A; 
#chains in the Genus database with same CATH homology
 2PLI A;  2VFV A;  4PYT A;  1MBB A;  2Y3S A;  2WDW A;  2GQT A;  3DQ0 A;  3VTE A;  3POP A;  1W1K A;  1N61 C;  4XLO A;  1FO4 A;  3LAE A;  3RJA A;  1E8G A;  3S1C A;  1AHV A;  3NVV B;  2GQU A;  2RK5 A;  2E3T A;  3TSJ A;  2I0K A;  4PVE A;  3S1F A;  1QLU A;  1W1J A;  1JRO A;  5D79 A;  2O3G A;  3FW8 A;  3FWA A;  5FXF A;  1N62 C;  2W55 A;  3D2H A;  1N60 C;  2BVF A;  1E8F A;  1I19 A;  4MLA A;  3PM9 A;  4PWC A;  3S1D A;  3W8W A;  5K8E A;  1UXY A;  5HQX A;  1FFV C;  2VFT A;  3GSY A;  3FW7 A;  2NQW A;  1N5W C;  3SR6 B;  3FW9 A;  2BVG A;  4UD8 A;  1FIQ B;  1N63 C;  1DIQ A;  3KJM A;  3BW7 A;  2VFR A;  1E0Y A;  1WVE A;  1W1L A;  2UUU A;  2UUV A;  1MBT A;  1WYG A;  1W1Q A;  4EC3 A;  5AE1 A;  1HSK A;  1RM6 B;  5AWV A;  3LLB A;  5AE2 A;  3AM9 A;  1ZXI C;  4BC7 A;  4PWB A;  4JAY A;  2OAI A;  2YVS A;  3TSH A;  3DED A;  2QKN A;  1DZN A;  5FXP A;  3PQB A;  5G5G B;  4PZF A;  5FXD A;  2Q4W A;  4OAL A;  3NRZ B;  1F0X A;  2W54 A;  1FFU C;  4PVK A;  5ADZ A;  4BBY A;  3NS1 B;  2P4P A;  4JB1 A;  1ZR6 A;  3AN1 A;  3ETR B;  2MBR A;  2P13 A;  1WVF A;  3C0P A;  4O95 A;  2R8D A;  2Y4G A;  3JS8 A;  3EUB 3;  3NVZ B;  5HMR A;  3AMZ A;  3I99 A;  4PVJ A;  2EXR A;  1VDV A;  2VFU A;  2BVH A;  4ML8 A;  2P3H A;  2PLS A;  5I1V A;  1VAO A;  2QPM A;  1AHU A;  5FXE A;  4DNS A;  3HRD C;  3HSU A;  1W1O A;  2Y08 A;  1V97 A;  5L6F A;  3B9J B;  3D2D A;  4HG0 A;  1JRP A;  1N5X A;  4PVH A;  1AHZ A;  1W1M A;  4BCA A;  1W1R A;  2IPI A;  1W1S A;  2AXR A;  1E8H A;  2W3R A;  3NVY B;  1T3Q C;  1DII A;  4BC9 A;  5G5H B;  3NVW B;  5HHZ A;  3S1E A;  2Q85 A;  5AE3 A;  4ZOH B;  5L6G A;  1SB3 B;  3RJ8 A;  2W3S A;  2VFS A;  2VAO A;  3D2J A;  1QLT A;  2Y3R A;  5I1W A;  3TX1 A;  3W8Z A;  2R2Z A;  3W8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...