1MBBA

Oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title (E)-enolbutyryl-UDP-N-acetylglucosamine as a mechanistic probe of UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
total genus 100
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbbA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbbA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbbA01
2GQTA 3AM9A 3AN1A 1QLUA 1T3QC 3C0PA 5ADZA 2YVSA 1RM6B 1W1JA 2AXRA 3I99A 2R2ZA 5HQXA 2W55A 3TSHA 1AHVA 4ML8A 1AHZA 4HG0A 4PWCA 3B9JB 2I0KA 3NVYB 3BW7A 4PVJA 2E3TA 2Q85A 3HRDC 1SB3B 1MBTA 1N60C 2GQUA 1AHUA 2BVGA 2VFSA 1ZXIC 5G5GB 5FXEA 1WVFA 1N5XA 1HSKA 2P3HA 3NRZB 3LAEA 1FO4A 1MBBA 1FFVC 1QLTA 3S1DA 3AMZA 1W1MA 4DNSA 3ETRB 3FW7A 3DQ0A 5FXFA 2W3SA 1VDVA 4JAYA 4MLAA 3D2JA 5AE2A 1W1OA 1N62C 5AE1A 3FWAA 4PVEA 1N5WC 1W1SA 3FW9A 2EXRA 4BBYA 3FW8A 1E0YA 3GSYA 1VAOA 3S1CA 3NS1B 4EC3A 1DIIA 4BC7A 1JRPA 5HMRA 3S1EA 2VAOA 1W1KA 1JROA 1WVEA 2VFTA 3D2HA 5AE3A 2BVFA 3EUB3 4PVKA 5D79A 1E8HA 2QKNA 3SR6B 2QPMA 1FFUC 4ZOHB 3KJMA 3LLBA 1W1QA 3DEDA 1E8FA 4XLOA 2O3GA 1W1LA 1N61C 2OAIA 3NVVB 4JB1A 1FIQB 2RK5A 1WYGA 4PZFA 3NVWB 4UD8A 2VFRA 3NVZB 3VTEA 4BCAA 2PLSA 3S1FA 4PYTA 1E8GA 3JS8A 2BVHA 2MBRA 2W54A 1DIQA 2P13A 3W8ZA 3W8XA 4PVHA 1UXYA 5HHZA 2P4PA 3W8WA 1F0XA 2Q4WA 5G5HB 2W3RA 3TX1A 1W1RA 2VFVA 3TSJA 3D2DA 5FXDA 1DZNA 1N63C 2NQWA 2R8DA 2VFUA 2PLIA 1I19A 4O95A 4PWBA 1ZR6A 1V97A 4BC9A 5FXPA 3PM9A 4OALA
chains in the Genus database with same CATH superfamily
2GQTA 3AM9A 3AN1A 1QLUA 1T3QC 3C0PA 3EJBB 5ADZA 2YVSA 1RM6B 3HSUA 1W1JA 2AXRA 3I99A 2R2ZA 2WDWA 5HQXA 2W55A 3TSHA 1AHVA 4ML8A 1AHZA 4HG0A 4PWCA 3B9JB 2UUUA 2I0KA 3NVYB 3BW7A 4PVJA 2E3TA 2Q85A 3HRDC 1SB3B 1MBTA 1N60C 5I1WA 2GQUA 1AHUA 2BVGA 5L6GA 2VFSA 1ZXIC 5G5GB 5FXEA 1WVFA 5K8EA 1N5XA 1HSKA 2P3HA 3NRZB 2IPIA 3LAEA 1FO4A 1MBBA 1FFVC 3PQBA 1QLTA 3S1DA 3AMZA 1W1MA 5I1VA 4DNSA 3ETRB 5AWVA 3FW7A 3DQ0A 5FXFA 2W3SA 1VDVA 4JAYA 4MLAA 3D2JA 5AE2A 1W1OA 1N62C 5AE1A 3FWAA 4PVEA 1N5WC 1W1SA 3FW9A 2EXRA 4BBYA 3FW8A 3RJ8A 1E0YA 3GSYA 1VAOA 3S1CA 3NS1B 4EC3A 1DIIA 4BC7A 1JRPA 5HMRA 3S1EA 2VAOA 1W1KA 1JROA 1WVEA 2VFTA 3D2HA 3EJEB 2BVFA 3EUB3 4PVKA 5D79A 5AE3A 1E8HA 2QKNA 3SR6B 2Y08A 2QPMA 1FFUC 4ZOHB 3KJMA 3LLBA 3POPA 2Y4GA 1W1QA 3DEDA 1E8FA 4XLOA 2O3GA 1W1LA 2UUVA 1N61C 2OAIA 3EJDB 3NVVB 4JB1A 1FIQB 2RK5A 1WYGA 3NVWB 4PZFA 4UD8A 2VFRA 3NVZB 3VTEA 4BCAA 2PLSA 3S1FA 4PYTA 1E8GA 3JS8A 2BVHA 2MBRA 2W54A 2Y3RA 1DIQA 2P13A 3W8ZA 3W8XA 2Y3SA 4PVHA 1UXYA 5HHZA 2P4PA 3W8WA 1F0XA 5L6FA 2Q4WA 5G5HB 2W3RA 3TX1A 1W1RA 2VFVA 3TSJA 3D2DA 5FXDA 1DZNA 1N63C 2NQWA 2R8DA 3RJAA 2VFUA 2PLIA 1I19A 4O95A 4PWBA 1ZR6A 1V97A 4BC9A 5FXPA 3PM9A 4OALA
chains in the Genus database with same CATH topology
2GQTA 3AM9A 3AN1A 1QLUA 1T3QC 3C0PA 5ADZA 2YVSA 1RM6B 3HSUA 1W1JA 2AXRA 3I99A 2R2ZA 2WDWA 5HQXA 2W55A 3TSHA 1AHVA 4ML8A 1AHZA 4HG0A 4PWCA 3B9JB 2UUUA 2I0KA 3NVYB 3BW7A 4PVJA 2E3TA 2Q85A 3HRDC 1SB3B 1MBTA 1N60C 5I1WA 2GQUA 1AHUA 2BVGA 5L6GA 2VFSA 1ZXIC 5G5GB 5FXEA 1WVFA 5K8EA 1N5XA 1HSKA 2P3HA 3NRZB 2IPIA 3LAEA 1FO4A 1MBBA 1FFVC 3PQBA 1QLTA 3S1DA 3AMZA 1W1MA 5I1VA 4DNSA 3ETRB 5AWVA 3FW7A 3DQ0A 5FXFA 2W3SA 1VDVA 4JAYA 4MLAA 3D2JA 5AE2A 1W1OA 1N62C 5AE1A 3FWAA 4PVEA 1N5WC 1W1SA 3FW9A 2EXRA 4BBYA 3FW8A 3RJ8A 1E0YA 3GSYA 1VAOA 3S1CA 3NS1B 4EC3A 1DIIA 4BC7A 1JRPA 5HMRA 3S1EA 2VAOA 1W1KA 1JROA 1WVEA 2VFTA 3D2HA 5AE3A 2BVFA 3EUB3 4PVKA 5D79A 1E8HA 2QKNA 3SR6B 2Y08A 2QPMA 1FFUC 4ZOHB 3KJMA 3LLBA 3POPA 2Y4GA 1W1QA 3DEDA 1E8FA 4XLOA 2O3GA 1W1LA 2UUVA 1N61C 2OAIA 3NVVB 4JB1A 1FIQB 2RK5A 1WYGA 4PZFA 3NVWB 4UD8A 2VFRA 3NVZB 3VTEA 4BCAA 2PLSA 3S1FA 4PYTA 1E8GA 3JS8A 2BVHA 2MBRA 2W54A 2Y3RA 1DIQA 2P13A 3W8ZA 3W8XA 2Y3SA 4PVHA 1UXYA 5HHZA 2P4PA 3W8WA 1F0XA 5L6FA 2Q4WA 5G5HB 2W3RA 3TX1A 1W1RA 2VFVA 3TSJA 3D2DA 5FXDA 1DZNA 1N63C 2NQWA 2R8DA 3RJAA 2VFUA 2PLIA 1I19A 4O95A 4PWBA 1ZR6A 1V97A 4BC9A 5FXPA 3PM9A 4OALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQT A;  3AM9 A;  3AN1 A;  1QLU A;  1T3Q C;  3C0P A;  5ADZ A;  2YVS A;  1RM6 B;  1W1J A;  2AXR A;  3I99 A;  2R2Z A;  5HQX A;  2W55 A;  3TSH A;  1AHV A;  4ML8 A;  1AHZ A;  4HG0 A;  4PWC A;  3B9J B;  2I0K A;  3NVY B;  3BW7 A;  4PVJ A;  2E3T A;  2Q85 A;  3HRD C;  1SB3 B;  1MBT A;  1N60 C;  2GQU A;  1AHU A;  2BVG A;  2VFS A;  1ZXI C;  5G5G B;  5FXE A;  1WVF A;  1N5X A;  1HSK A;  2P3H A;  3NRZ B;  3LAE A;  1FO4 A;  1MBB A;  1FFV C;  1QLT A;  3S1D A;  3AMZ A;  1W1M A;  4DNS A;  3ETR B;  3FW7 A;  3DQ0 A;  5FXF A;  2W3S A;  1VDV A;  4JAY A;  4MLA A;  3D2J A;  5AE2 A;  1W1O A;  1N62 C;  5AE1 A;  3FWA A;  4PVE A;  1N5W C;  1W1S A;  3FW9 A;  2EXR A;  4BBY A;  3FW8 A;  1E0Y A;  3GSY A;  1VAO A;  3S1C A;  3NS1 B;  4EC3 A;  1DII A;  4BC7 A;  1JRP A;  5HMR A;  3S1E A;  2VAO A;  1W1K A;  1JRO A;  1WVE A;  2VFT A;  3D2H A;  5AE3 A;  2BVF A;  3EUB 3;  4PVK A;  5D79 A;  1E8H A;  2QKN A;  3SR6 B;  2QPM A;  1FFU C;  4ZOH B;  3KJM A;  3LLB A;  1W1Q A;  3DED A;  1E8F A;  4XLO A;  2O3G A;  1W1L A;  1N61 C;  2OAI A;  3NVV B;  4JB1 A;  1FIQ B;  2RK5 A;  1WYG A;  4PZF A;  3NVW B;  4UD8 A;  2VFR A;  3NVZ B;  3VTE A;  4BCA A;  2PLS A;  3S1F A;  4PYT A;  1E8G A;  3JS8 A;  2BVH A;  2MBR A;  2W54 A;  1DIQ A;  2P13 A;  3W8Z A;  3W8X A;  4PVH A;  1UXY A;  5HHZ A;  2P4P A;  3W8W A;  1F0X A;  2Q4W A;  5G5H B;  2W3R A;  3TX1 A;  1W1R A;  2VFV A;  3TSJ A;  3D2D A;  5FXD A;  1DZN A;  1N63 C;  2NQW A;  2R8D A;  2VFU A;  2PLI A;  1I19 A;  4O95 A;  4PWB A;  1ZR6 A;  1V97 A;  4BC9 A;  5FXP A;  3PM9 A;  4OAL A; 
#chains in the Genus database with same CATH topology
 2GQT A;  3AM9 A;  3AN1 A;  1QLU A;  1T3Q C;  3C0P A;  3EJB B;  5ADZ A;  2YVS A;  1RM6 B;  3HSU A;  1W1J A;  2AXR A;  3I99 A;  2R2Z A;  2WDW A;  5HQX A;  2W55 A;  3TSH A;  1AHV A;  4ML8 A;  1AHZ A;  4HG0 A;  4PWC A;  3B9J B;  2UUU A;  2I0K A;  3NVY B;  3BW7 A;  4PVJ A;  2E3T A;  2Q85 A;  3HRD C;  1SB3 B;  1MBT A;  1N60 C;  5I1W A;  2GQU A;  1AHU A;  2BVG A;  5L6G A;  2VFS A;  1ZXI C;  5G5G B;  5FXE A;  1WVF A;  5K8E A;  1N5X A;  1HSK A;  2P3H A;  3NRZ B;  2IPI A;  3LAE A;  1FO4 A;  1MBB A;  1FFV C;  3PQB A;  1QLT A;  3S1D A;  3AMZ A;  1W1M A;  5I1V A;  4DNS A;  3ETR B;  5AWV A;  3FW7 A;  3DQ0 A;  5FXF A;  2W3S A;  1VDV A;  4JAY A;  4MLA A;  3D2J A;  5AE2 A;  1W1O A;  1N62 C;  5AE1 A;  3FWA A;  4PVE A;  1N5W C;  1W1S A;  3FW9 A;  2EXR A;  4BBY A;  3FW8 A;  3RJ8 A;  1E0Y A;  3GSY A;  1VAO A;  3S1C A;  3NS1 B;  4EC3 A;  1DII A;  4BC7 A;  1JRP A;  5HMR A;  3S1E A;  2VAO A;  1W1K A;  1JRO A;  1WVE A;  2VFT A;  3D2H A;  3EJE B;  2BVF A;  3EUB 3;  4PVK A;  5D79 A;  5AE3 A;  1E8H A;  2QKN A;  3SR6 B;  2Y08 A;  2QPM A;  1FFU C;  4ZOH B;  3KJM A;  3LLB A;  3POP A;  2Y4G A;  1W1Q A;  3DED A;  1E8F A;  4XLO A;  2O3G A;  1W1L A;  2UUV A;  1N61 C;  2OAI A;  3EJD B;  3NVV B;  4JB1 A;  1FIQ B;  2RK5 A;  1WYG A;  3NVW B;  4PZF A;  4UD8 A;  2VFR A;  3NVZ B;  3VTE A;  4BCA A;  2PLS A;  3S1F A;  4PYT A;  1E8G A;  3JS8 A;  2BVH A;  2MBR A;  2W54 A;  2Y3R A;  1DIQ A;  2P13 A;  3W8Z A;  3W8X A;  2Y3S A;  4PVH A;  1UXY A;  5HHZ A;  2P4P A;  3W8W A;  1F0X A;  5L6F A;  2Q4W A;  5G5H B;  2W3R A;  3TX1 A;  1W1R A;  2VFV A;  3TSJ A;  3D2D A;  5FXD A;  1DZN A;  1N63 C;  2NQW A;  2R8D A;  3RJA A;  2VFU A;  2PLI A;  1I19 A;  4O95 A;  4PWB A;  1ZR6 A;  1V97 A;  4BC9 A;  5FXP A;  3PM9 A;  4OAL A; 
#chains in the Genus database with same CATH homology
 2GQT A;  3AM9 A;  3AN1 A;  1QLU A;  1T3Q C;  3C0P A;  5ADZ A;  2YVS A;  1RM6 B;  3HSU A;  1W1J A;  2AXR A;  3I99 A;  2R2Z A;  2WDW A;  5HQX A;  2W55 A;  3TSH A;  1AHV A;  4ML8 A;  1AHZ A;  4HG0 A;  4PWC A;  3B9J B;  2UUU A;  2I0K A;  3NVY B;  3BW7 A;  4PVJ A;  2E3T A;  2Q85 A;  3HRD C;  1SB3 B;  1MBT A;  1N60 C;  5I1W A;  2GQU A;  1AHU A;  2BVG A;  5L6G A;  2VFS A;  1ZXI C;  5G5G B;  5FXE A;  1WVF A;  5K8E A;  1N5X A;  1HSK A;  2P3H A;  3NRZ B;  2IPI A;  3LAE A;  1FO4 A;  1MBB A;  1FFV C;  3PQB A;  1QLT A;  3S1D A;  3AMZ A;  1W1M A;  5I1V A;  4DNS A;  3ETR B;  5AWV A;  3FW7 A;  3DQ0 A;  5FXF A;  2W3S A;  1VDV A;  4JAY A;  4MLA A;  3D2J A;  5AE2 A;  1W1O A;  1N62 C;  5AE1 A;  3FWA A;  4PVE A;  1N5W C;  1W1S A;  3FW9 A;  2EXR A;  4BBY A;  3FW8 A;  3RJ8 A;  1E0Y A;  3GSY A;  1VAO A;  3S1C A;  3NS1 B;  4EC3 A;  1DII A;  4BC7 A;  1JRP A;  5HMR A;  3S1E A;  2VAO A;  1W1K A;  1JRO A;  1WVE A;  2VFT A;  3D2H A;  5AE3 A;  2BVF A;  3EUB 3;  4PVK A;  5D79 A;  1E8H A;  2QKN A;  3SR6 B;  2Y08 A;  2QPM A;  1FFU C;  4ZOH B;  3KJM A;  3LLB A;  3POP A;  2Y4G A;  1W1Q A;  3DED A;  1E8F A;  4XLO A;  2O3G A;  1W1L A;  2UUV A;  1N61 C;  2OAI A;  3NVV B;  4JB1 A;  1FIQ B;  2RK5 A;  1WYG A;  4PZF A;  3NVW B;  4UD8 A;  2VFR A;  3NVZ B;  3VTE A;  4BCA A;  2PLS A;  3S1F A;  4PYT A;  1E8G A;  3JS8 A;  2BVH A;  2MBR A;  2W54 A;  2Y3R A;  1DIQ A;  2P13 A;  3W8Z A;  3W8X A;  2Y3S A;  4PVH A;  1UXY A;  5HHZ A;  2P4P A;  3W8W A;  1F0X A;  5L6F A;  2Q4W A;  5G5H B;  2W3R A;  3TX1 A;  1W1R A;  2VFV A;  3TSJ A;  3D2D A;  5FXD A;  1DZN A;  1N63 C;  2NQW A;  2R8D A;  3RJA A;  2VFU A;  2PLI A;  1I19 A;  4O95 A;  4PWB A;  1ZR6 A;  1V97 A;  4BC9 A;  5FXP A;  3PM9 A;  4OAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...