1MBBA

Oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title (E)-enolbutyryl-UDP-N-acetylglucosamine as a mechanistic probe of UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 100
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbbA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbbA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbbA01
5D79A 5FXDA 5FXEA 3B9JB 1W1SA 1FFUC 5FXFA 2PLIA 2VFUA 1E8FA 1W1MA 1MBBA 2MBRA 3C0PA 4O95A 3W8WA 3DEDA 3NVYB 1AHUA 4BC7A 3VTEA 3EUB3 2W3SA 1I19A 1DZNA 2R8DA 1RM6B 4UD8A 3AN1A 5FXPA 2GQUA 1QLUA 3I99A 5G5GB 3FW9A 5HQXA 3PM9A 2E3TA 3S1EA 1AHZA 3JS8A 2BVFA 2R2ZA 2Q85A 2P3HA 3NVWB 2YVSA 3D2DA 3FW7A 1SB3B 3GSYA 5AE3A 2VFSA 1N63C 3SR6B 2OAIA 2PLSA 1N61C 3FW8A 1N5XA 1W1JA 4JB1A 5HMRA 4HG0A 2O3GA 4OALA 1MBTA 3S1FA 3TSHA 2W54A 4BC9A 1N5WC 1W1RA 1JRPA 2VAOA 5ADZA 3TSJA 2BVHA 3AM9A 4ML8A 3FWAA 1ZXIC 4BCAA 5HHZA 2NQWA 1FO4A 2W55A 1QLTA 3W8XA 2GQTA 3BW7A 4PVEA 1JROA 1W1OA 2BVGA 3AMZA 3ETRB 2W3RA 1W1QA 4PWCA 2P13A 3W8ZA 3DQ0A 3D2HA 1DIQA 1VAOA 3NS1B 1E8HA 3KJMA 2VFVA 2EXRA 1AHVA 4EC3A 2P4PA 1N60C 2RK5A 1W1LA 4PWBA 4XLOA 4PZFA 3LLBA 3S1CA 1WVEA 1HSKA 1V97A 1F0XA 4PVHA 1FIQB 4JAYA 1FFVC 1UXYA 1E8GA 4PYTA 2AXRA 3HRDC 4ZOHB 1VDVA 1N62C 4DNSA 3NVZB 4PVKA 3TX1A 1E0YA 1T3QC 1WYGA 2QKNA 1ZR6A 2VFTA 4PVJA 4BBYA 5AE1A 3S1DA 4MLAA 1WVFA 3D2JA 1DIIA 2Q4WA 2VFRA 5AE2A 3LAEA 5G5HB 3NVVB 2QPMA 3NRZB 1W1KA 2I0KA
chains in the Genus database with same CATH superfamily
5D79A 3POPA 5FXDA 5FXEA 2Y4GA 3B9JB 1W1SA 1FFUC 5FXFA 2PLIA 2VFUA 1E8FA 2UUVA 1W1MA 1MBBA 2MBRA 3C0PA 4O95A 3W8WA 3DEDA 3NVYB 1AHUA 4BC7A 3VTEA 3EUB3 3EJDB 2W3SA 1I19A 1DZNA 3PQBA 2R8DA 1RM6B 4UD8A 3AN1A 5FXPA 2GQUA 1QLUA 3I99A 5G5GB 3FW9A 5HQXA 3PM9A 2E3TA 3RJ8A 3EJBB 3S1EA 1AHZA 3JS8A 2IPIA 2BVFA 2R2ZA 2Q85A 2P3HA 3NVWB 2YVSA 3D2DA 3FW7A 1SB3B 3GSYA 5AE3A 2VFSA 1N63C 3EJEB 3SR6B 2OAIA 2PLSA 1N61C 3FW8A 1N5XA 1W1JA 4JB1A 5HMRA 4HG0A 3RJAA 5AWVA 5I1WA 2O3GA 4OALA 5L6GA 1MBTA 3S1FA 3TSHA 2Y08A 2W54A 4BC9A 1N5WC 1W1RA 1JRPA 2VAOA 5ADZA 3TSJA 2BVHA 3AM9A 4ML8A 2Y3SA 3FWAA 1ZXIC 4BCAA 5HHZA 2NQWA 1FO4A 2W55A 1QLTA 3W8XA 2GQTA 3BW7A 4PVEA 2WDWA 1JROA 1W1OA 2BVGA 2Y3RA 3AMZA 3ETRB 2W3RA 1W1QA 4PWCA 2P13A 3W8ZA 3DQ0A 3D2HA 1DIQA 1VAOA 3NS1B 1E8HA 3KJMA 2VFVA 3HSUA 2EXRA 1AHVA 4EC3A 2P4PA 1N60C 2RK5A 1W1LA 4PWBA 4XLOA 4PZFA 3LLBA 3S1CA 1WVEA 1HSKA 1V97A 1F0XA 4PVHA 1FIQB 4JAYA 1FFVC 1UXYA 1E8GA 4PYTA 5I1VA 5K8EA 2AXRA 3HRDC 4ZOHB 1VDVA 1N62C 4DNSA 3NVZB 5L6FA 4PVKA 3TX1A 1E0YA 1T3QC 1WYGA 2QKNA 1ZR6A 2VFTA 4PVJA 4BBYA 5AE1A 3S1DA 4MLAA 1WVFA 3D2JA 1DIIA 2Q4WA 2VFRA 5AE2A 3LAEA 5G5HB 3NVVB 2QPMA 3NRZB 1W1KA 2I0KA 2UUUA
chains in the Genus database with same CATH topology
5D79A 3POPA 5FXDA 5FXEA 2Y4GA 3B9JB 1W1SA 1FFUC 5FXFA 2PLIA 2VFUA 1E8FA 2UUVA 1W1MA 1MBBA 2MBRA 3C0PA 4O95A 3W8WA 3DEDA 3NVYB 1AHUA 4BC7A 3VTEA 3EUB3 2W3SA 1I19A 1DZNA 3PQBA 2R8DA 1RM6B 4UD8A 3AN1A 5FXPA 2GQUA 1QLUA 3I99A 5G5GB 3FW9A 5HQXA 3PM9A 2E3TA 3RJ8A 3S1EA 1AHZA 3JS8A 2IPIA 2BVFA 2R2ZA 2Q85A 2P3HA 3NVWB 2YVSA 3D2DA 3FW7A 1SB3B 3GSYA 5AE3A 2VFSA 1N63C 3SR6B 2OAIA 2PLSA 1N61C 3FW8A 1N5XA 1W1JA 4JB1A 5HMRA 4HG0A 3RJAA 5AWVA 5I1WA 2O3GA 4OALA 5L6GA 1MBTA 3S1FA 3TSHA 2Y08A 2W54A 4BC9A 1N5WC 1W1RA 1JRPA 2VAOA 5ADZA 3TSJA 2BVHA 3AM9A 4ML8A 2Y3SA 3FWAA 1ZXIC 4BCAA 5HHZA 2NQWA 1FO4A 2W55A 1QLTA 3W8XA 2GQTA 3BW7A 4PVEA 2WDWA 1JROA 1W1OA 2BVGA 2Y3RA 3AMZA 3ETRB 2W3RA 1W1QA 4PWCA 2P13A 3W8ZA 3DQ0A 3D2HA 1DIQA 1VAOA 3NS1B 1E8HA 3KJMA 2VFVA 3HSUA 2EXRA 1AHVA 4EC3A 2P4PA 1N60C 2RK5A 1W1LA 4PWBA 4XLOA 4PZFA 3LLBA 3S1CA 1WVEA 1HSKA 1V97A 1F0XA 4PVHA 1FIQB 4JAYA 1FFVC 1UXYA 1E8GA 4PYTA 5I1VA 5K8EA 2AXRA 3HRDC 4ZOHB 1VDVA 1N62C 4DNSA 3NVZB 5L6FA 4PVKA 3TX1A 1E0YA 1T3QC 1WYGA 2QKNA 1ZR6A 2VFTA 4PVJA 4BBYA 5AE1A 3S1DA 4MLAA 1WVFA 3D2JA 1DIIA 2Q4WA 2VFRA 5AE2A 3LAEA 5G5HB 3NVVB 2QPMA 3NRZB 1W1KA 2I0KA 2UUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D79 A;  5FXD A;  5FXE A;  3B9J B;  1W1S A;  1FFU C;  5FXF A;  2PLI A;  2VFU A;  1E8F A;  1W1M A;  1MBB A;  2MBR A;  3C0P A;  4O95 A;  3W8W A;  3DED A;  3NVY B;  1AHU A;  4BC7 A;  3VTE A;  3EUB 3;  2W3S A;  1I19 A;  1DZN A;  2R8D A;  1RM6 B;  4UD8 A;  3AN1 A;  5FXP A;  2GQU A;  1QLU A;  3I99 A;  5G5G B;  3FW9 A;  5HQX A;  3PM9 A;  2E3T A;  3S1E A;  1AHZ A;  3JS8 A;  2BVF A;  2R2Z A;  2Q85 A;  2P3H A;  3NVW B;  2YVS A;  3D2D A;  3FW7 A;  1SB3 B;  3GSY A;  5AE3 A;  2VFS A;  1N63 C;  3SR6 B;  2OAI A;  2PLS A;  1N61 C;  3FW8 A;  1N5X A;  1W1J A;  4JB1 A;  5HMR A;  4HG0 A;  2O3G A;  4OAL A;  1MBT A;  3S1F A;  3TSH A;  2W54 A;  4BC9 A;  1N5W C;  1W1R A;  1JRP A;  2VAO A;  5ADZ A;  3TSJ A;  2BVH A;  3AM9 A;  4ML8 A;  3FWA A;  1ZXI C;  4BCA A;  5HHZ A;  2NQW A;  1FO4 A;  2W55 A;  1QLT A;  3W8X A;  2GQT A;  3BW7 A;  4PVE A;  1JRO A;  1W1O A;  2BVG A;  3AMZ A;  3ETR B;  2W3R A;  1W1Q A;  4PWC A;  2P13 A;  3W8Z A;  3DQ0 A;  3D2H A;  1DIQ A;  1VAO A;  3NS1 B;  1E8H A;  3KJM A;  2VFV A;  2EXR A;  1AHV A;  4EC3 A;  2P4P A;  1N60 C;  2RK5 A;  1W1L A;  4PWB A;  4XLO A;  4PZF A;  3LLB A;  3S1C A;  1WVE A;  1HSK A;  1V97 A;  1F0X A;  4PVH A;  1FIQ B;  4JAY A;  1FFV C;  1UXY A;  1E8G A;  4PYT A;  2AXR A;  3HRD C;  4ZOH B;  1VDV A;  1N62 C;  4DNS A;  3NVZ B;  4PVK A;  3TX1 A;  1E0Y A;  1T3Q C;  1WYG A;  2QKN A;  1ZR6 A;  2VFT A;  4PVJ A;  4BBY A;  5AE1 A;  3S1D A;  4MLA A;  1WVF A;  3D2J A;  1DII A;  2Q4W A;  2VFR A;  5AE2 A;  3LAE A;  5G5H B;  3NVV B;  2QPM A;  3NRZ B;  1W1K A;  2I0K A; 
#chains in the Genus database with same CATH topology
 5D79 A;  3POP A;  5FXD A;  5FXE A;  2Y4G A;  3B9J B;  1W1S A;  1FFU C;  5FXF A;  2PLI A;  2VFU A;  1E8F A;  2UUV A;  1W1M A;  1MBB A;  2MBR A;  3C0P A;  4O95 A;  3W8W A;  3DED A;  3NVY B;  1AHU A;  4BC7 A;  3VTE A;  3EUB 3;  3EJD B;  2W3S A;  1I19 A;  1DZN A;  3PQB A;  2R8D A;  1RM6 B;  4UD8 A;  3AN1 A;  5FXP A;  2GQU A;  1QLU A;  3I99 A;  5G5G B;  3FW9 A;  5HQX A;  3PM9 A;  2E3T A;  3RJ8 A;  3EJB B;  3S1E A;  1AHZ A;  3JS8 A;  2IPI A;  2BVF A;  2R2Z A;  2Q85 A;  2P3H A;  3NVW B;  2YVS A;  3D2D A;  3FW7 A;  1SB3 B;  3GSY A;  5AE3 A;  2VFS A;  1N63 C;  3EJE B;  3SR6 B;  2OAI A;  2PLS A;  1N61 C;  3FW8 A;  1N5X A;  1W1J A;  4JB1 A;  5HMR A;  4HG0 A;  3RJA A;  5AWV A;  5I1W A;  2O3G A;  4OAL A;  5L6G A;  1MBT A;  3S1F A;  3TSH A;  2Y08 A;  2W54 A;  4BC9 A;  1N5W C;  1W1R A;  1JRP A;  2VAO A;  5ADZ A;  3TSJ A;  2BVH A;  3AM9 A;  4ML8 A;  2Y3S A;  3FWA A;  1ZXI C;  4BCA A;  5HHZ A;  2NQW A;  1FO4 A;  2W55 A;  1QLT A;  3W8X A;  2GQT A;  3BW7 A;  4PVE A;  2WDW A;  1JRO A;  1W1O A;  2BVG A;  2Y3R A;  3AMZ A;  3ETR B;  2W3R A;  1W1Q A;  4PWC A;  2P13 A;  3W8Z A;  3DQ0 A;  3D2H A;  1DIQ A;  1VAO A;  3NS1 B;  1E8H A;  3KJM A;  2VFV A;  3HSU A;  2EXR A;  1AHV A;  4EC3 A;  2P4P A;  1N60 C;  2RK5 A;  1W1L A;  4PWB A;  4XLO A;  4PZF A;  3LLB A;  3S1C A;  1WVE A;  1HSK A;  1V97 A;  1F0X A;  4PVH A;  1FIQ B;  4JAY A;  1FFV C;  1UXY A;  1E8G A;  4PYT A;  5I1V A;  5K8E A;  2AXR A;  3HRD C;  4ZOH B;  1VDV A;  1N62 C;  4DNS A;  3NVZ B;  5L6F A;  4PVK A;  3TX1 A;  1E0Y A;  1T3Q C;  1WYG A;  2QKN A;  1ZR6 A;  2VFT A;  4PVJ A;  4BBY A;  5AE1 A;  3S1D A;  4MLA A;  1WVF A;  3D2J A;  1DII A;  2Q4W A;  2VFR A;  5AE2 A;  3LAE A;  5G5H B;  3NVV B;  2QPM A;  3NRZ B;  1W1K A;  2I0K A;  2UUU A; 
#chains in the Genus database with same CATH homology
 5D79 A;  3POP A;  5FXD A;  5FXE A;  2Y4G A;  3B9J B;  1W1S A;  1FFU C;  5FXF A;  2PLI A;  2VFU A;  1E8F A;  2UUV A;  1W1M A;  1MBB A;  2MBR A;  3C0P A;  4O95 A;  3W8W A;  3DED A;  3NVY B;  1AHU A;  4BC7 A;  3VTE A;  3EUB 3;  2W3S A;  1I19 A;  1DZN A;  3PQB A;  2R8D A;  1RM6 B;  4UD8 A;  3AN1 A;  5FXP A;  2GQU A;  1QLU A;  3I99 A;  5G5G B;  3FW9 A;  5HQX A;  3PM9 A;  2E3T A;  3RJ8 A;  3S1E A;  1AHZ A;  3JS8 A;  2IPI A;  2BVF A;  2R2Z A;  2Q85 A;  2P3H A;  3NVW B;  2YVS A;  3D2D A;  3FW7 A;  1SB3 B;  3GSY A;  5AE3 A;  2VFS A;  1N63 C;  3SR6 B;  2OAI A;  2PLS A;  1N61 C;  3FW8 A;  1N5X A;  1W1J A;  4JB1 A;  5HMR A;  4HG0 A;  3RJA A;  5AWV A;  5I1W A;  2O3G A;  4OAL A;  5L6G A;  1MBT A;  3S1F A;  3TSH A;  2Y08 A;  2W54 A;  4BC9 A;  1N5W C;  1W1R A;  1JRP A;  2VAO A;  5ADZ A;  3TSJ A;  2BVH A;  3AM9 A;  4ML8 A;  2Y3S A;  3FWA A;  1ZXI C;  4BCA A;  5HHZ A;  2NQW A;  1FO4 A;  2W55 A;  1QLT A;  3W8X A;  2GQT A;  3BW7 A;  4PVE A;  2WDW A;  1JRO A;  1W1O A;  2BVG A;  2Y3R A;  3AMZ A;  3ETR B;  2W3R A;  1W1Q A;  4PWC A;  2P13 A;  3W8Z A;  3DQ0 A;  3D2H A;  1DIQ A;  1VAO A;  3NS1 B;  1E8H A;  3KJM A;  2VFV A;  3HSU A;  2EXR A;  1AHV A;  4EC3 A;  2P4P A;  1N60 C;  2RK5 A;  1W1L A;  4PWB A;  4XLO A;  4PZF A;  3LLB A;  3S1C A;  1WVE A;  1HSK A;  1V97 A;  1F0X A;  4PVH A;  1FIQ B;  4JAY A;  1FFV C;  1UXY A;  1E8G A;  4PYT A;  5I1V A;  5K8E A;  2AXR A;  3HRD C;  4ZOH B;  1VDV A;  1N62 C;  4DNS A;  3NVZ B;  5L6F A;  4PVK A;  3TX1 A;  1E0Y A;  1T3Q C;  1WYG A;  2QKN A;  1ZR6 A;  2VFT A;  4PVJ A;  4BBY A;  5AE1 A;  3S1D A;  4MLA A;  1WVF A;  3D2J A;  1DII A;  2Q4W A;  2VFR A;  5AE2 A;  3LAE A;  5G5H B;  3NVV B;  2QPM A;  3NRZ B;  1W1K A;  2I0K A;  2UUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...