1MBBA

Oxidoreductase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (E)-enolbutyryl-UDP-N-acetylglucosamine as a mechanistic probe of UDP-N-acetylenolpyruvylglucosamine reductase (MurB).
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
total genus 100
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1995-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1mbbA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1mbbA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1mbbA01
3PM9A 3LLBA 4OALA 3D2HA 1UXYA 4PVJA 3W8XA 3S1EA 2W54A 3EUB3 3NVYB 1W1KA 3FW7A 3FW9A 3LAEA 4PWBA 1V97A 1W1JA 2O3GA 3TSHA 3S1DA 1N63C 3KJMA 1WVFA 3NRZB 4BC7A 1W1LA 1JRPA 3ETRB 5HHZA 2GQTA 3D2DA 2R8DA 3C0PA 1DIIA 5FXFA 1WYGA 4PVHA 4JAYA 5AE3A 2VFSA 1ZXIC 2MBRA 5AE1A 2P13A 3W8ZA 1N62C 3TSJA 4PVEA 3NVVB 1ZR6A 2BVFA 3I99A 2Q85A 2VAOA 2VFVA 1E8GA 4UD8A 5FXPA 1JROA 5D79A 2W3SA 3NVZB 1RM6B 2PLSA 1W1OA 1N61C 1MBBA 2W55A 5HMRA 1I19A 4JB1A 3GSYA 1MBTA 3NS1B 3AN1A 4XLOA 5ADZA 2AXRA 1QLUA 1FIQB 3HRDC 2VFRA 3S1FA 2Q4WA 3VTEA 1W1RA 2NQWA 2VFTA 3S1CA 4BCAA 1T3QC 1SB3B 3BW7A 1E8HA 2VFUA 4PYTA 3DQ0A 4O95A 1AHVA 4BBYA 3B9JB 4ML8A 1WVEA 2QKNA 4PZFA 4PVKA 3D2JA 3FWAA 2RK5A 2W3RA 5HQXA 4DNSA 4MLAA 3JS8A 1W1SA 3FW8A 5G5HB 1QLTA 1W1QA 3AMZA 1HSKA 4ZOHB 1W1MA 5AE2A 2P4PA 4EC3A 1N60C 1DIQA 1E8FA 3W8WA 4BC9A 1AHUA 1FFVC 1DZNA 2E3TA 3DEDA 1E0YA 3TX1A 2YVSA 1AHZA 2OAIA 1FFUC 2QPMA 5FXEA 3NVWB 2I0KA 1N5WC 2BVGA 2EXRA 1VDVA 1N5XA 1FO4A 2PLIA 2R2ZA 1VAOA 2GQUA 4PWCA 1F0XA 2P3HA 5G5GB 3AM9A 3SR6B 5FXDA 2BVHA 4HG0A
chains in the Genus database with same CATH superfamily
3PM9A 3LLBA 4OALA 3D2HA 1UXYA 4PVJA 5I1VA 3W8XA 3S1EA 2W54A 3EUB3 3NVYB 1W1KA 3FW7A 3FW9A 3LAEA 4PWBA 3HSUA 1V97A 1W1JA 2O3GA 5AWVA 3TSHA 3EJDB 3S1DA 1N63C 3KJMA 1WVFA 3NRZB 4BC7A 1W1LA 1JRPA 3ETRB 5HHZA 2GQTA 3D2DA 2R8DA 3C0PA 1DIIA 5L6FA 5FXFA 1WYGA 4PVHA 4JAYA 2Y08A 5AE3A 3RJ8A 2VFSA 1ZXIC 2MBRA 5AE1A 2Y3SA 2P13A 3W8ZA 1N62C 3TSJA 3NVVB 4PVEA 2Y4GA 1ZR6A 2BVFA 3I99A 2Q85A 2VAOA 2VFVA 1E8GA 4UD8A 5FXPA 1JROA 5D79A 2W3SA 2UUVA 3EJBB 3NVZB 1RM6B 1W1OA 2PLSA 1N61C 1MBBA 2W55A 5HMRA 1I19A 4JB1A 3GSYA 1MBTA 3NS1B 3AN1A 4XLOA 2UUUA 5ADZA 2AXRA 1QLUA 1FIQB 3HRDC 2VFRA 3S1FA 2Q4WA 3VTEA 1W1RA 2NQWA 2VFTA 3S1CA 4BCAA 1T3QC 1SB3B 3BW7A 1E8HA 2VFUA 4PYTA 3DQ0A 2Y3RA 3PQBA 4O95A 1AHVA 4BBYA 3B9JB 4ML8A 1WVEA 5I1WA 2QKNA 4PZFA 5K8EA 4PVKA 3D2JA 3FWAA 2RK5A 2IPIA 2W3RA 5HQXA 4DNSA 4MLAA 3JS8A 1W1SA 5L6GA 3FW8A 5G5HB 1QLTA 1W1QA 3AMZA 1HSKA 4ZOHB 1W1MA 5AE2A 2P4PA 4EC3A 3POPA 1N60C 1DIQA 3EJEB 1E8FA 3W8WA 4BC9A 1AHUA 1FFVC 1DZNA 2E3TA 3DEDA 1E0YA 3TX1A 2YVSA 1AHZA 2OAIA 1FFUC 2QPMA 5FXEA 3NVWB 2I0KA 1N5WC 2BVGA 2EXRA 1VDVA 1N5XA 1FO4A 2WDWA 2PLIA 2R2ZA 1VAOA 2GQUA 4PWCA 1F0XA 2P3HA 5G5GB 3AM9A 3SR6B 5FXDA 2BVHA 3RJAA 4HG0A
chains in the Genus database with same CATH topology
3PM9A 3LLBA 4OALA 3D2HA 1UXYA 4PVJA 5I1VA 3W8XA 3S1EA 2W54A 3EUB3 3NVYB 1W1KA 3FW7A 3FW9A 3LAEA 4PWBA 3HSUA 1V97A 1W1JA 2O3GA 5AWVA 3TSHA 3S1DA 1N63C 3KJMA 1WVFA 3NRZB 4BC7A 1W1LA 1JRPA 3ETRB 5HHZA 2GQTA 3D2DA 2R8DA 3C0PA 1DIIA 5L6FA 5FXFA 1WYGA 4PVHA 4JAYA 2Y08A 5AE3A 3RJ8A 2VFSA 1ZXIC 2MBRA 5AE1A 2Y3SA 2P13A 3W8ZA 1N62C 3TSJA 4PVEA 2Y4GA 3NVVB 1ZR6A 2BVFA 3I99A 2Q85A 2VAOA 2VFVA 1E8GA 4UD8A 5FXPA 1JROA 5D79A 2W3SA 2UUVA 3NVZB 1RM6B 2PLSA 1W1OA 1N61C 1MBBA 2W55A 5HMRA 1I19A 4JB1A 3GSYA 1MBTA 3NS1B 3AN1A 4XLOA 2UUUA 5ADZA 2AXRA 1QLUA 1FIQB 3HRDC 2VFRA 3S1FA 2Q4WA 3VTEA 1W1RA 2NQWA 2VFTA 3S1CA 4BCAA 1T3QC 1SB3B 3BW7A 1E8HA 2VFUA 4PYTA 3DQ0A 2Y3RA 3PQBA 4O95A 1AHVA 4BBYA 3B9JB 4ML8A 1WVEA 5I1WA 2QKNA 4PZFA 5K8EA 4PVKA 3D2JA 3FWAA 2RK5A 2IPIA 2W3RA 5HQXA 4DNSA 4MLAA 3JS8A 1W1SA 5L6GA 3FW8A 5G5HB 1QLTA 1W1QA 3AMZA 1HSKA 4ZOHB 1W1MA 5AE2A 2P4PA 4EC3A 3POPA 1N60C 1DIQA 1E8FA 3W8WA 4BC9A 1AHUA 1FFVC 1DZNA 2E3TA 3DEDA 1E0YA 3TX1A 2YVSA 1AHZA 2OAIA 1FFUC 2QPMA 5FXEA 3NVWB 2I0KA 1N5WC 2BVGA 2EXRA 1VDVA 1N5XA 1FO4A 2WDWA 2PLIA 2R2ZA 1VAOA 2GQUA 4PWCA 1F0XA 2P3HA 5G5GB 3AM9A 3SR6B 5FXDA 2BVHA 3RJAA 4HG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PM9 A;  3LLB A;  4OAL A;  3D2H A;  1UXY A;  4PVJ A;  3W8X A;  3S1E A;  2W54 A;  3EUB 3;  3NVY B;  1W1K A;  3FW7 A;  3FW9 A;  3LAE A;  4PWB A;  1V97 A;  1W1J A;  2O3G A;  3TSH A;  3S1D A;  1N63 C;  3KJM A;  1WVF A;  3NRZ B;  4BC7 A;  1W1L A;  1JRP A;  3ETR B;  5HHZ A;  2GQT A;  3D2D A;  2R8D A;  3C0P A;  1DII A;  5FXF A;  1WYG A;  4PVH A;  4JAY A;  5AE3 A;  2VFS A;  1ZXI C;  2MBR A;  5AE1 A;  2P13 A;  3W8Z A;  1N62 C;  3TSJ A;  4PVE A;  3NVV B;  1ZR6 A;  2BVF A;  3I99 A;  2Q85 A;  2VAO A;  2VFV A;  1E8G A;  4UD8 A;  5FXP A;  1JRO A;  5D79 A;  2W3S A;  3NVZ B;  1RM6 B;  2PLS A;  1W1O A;  1N61 C;  1MBB A;  2W55 A;  5HMR A;  1I19 A;  4JB1 A;  3GSY A;  1MBT A;  3NS1 B;  3AN1 A;  4XLO A;  5ADZ A;  2AXR A;  1QLU A;  1FIQ B;  3HRD C;  2VFR A;  3S1F A;  2Q4W A;  3VTE A;  1W1R A;  2NQW A;  2VFT A;  3S1C A;  4BCA A;  1T3Q C;  1SB3 B;  3BW7 A;  1E8H A;  2VFU A;  4PYT A;  3DQ0 A;  4O95 A;  1AHV A;  4BBY A;  3B9J B;  4ML8 A;  1WVE A;  2QKN A;  4PZF A;  4PVK A;  3D2J A;  3FWA A;  2RK5 A;  2W3R A;  5HQX A;  4DNS A;  4MLA A;  3JS8 A;  1W1S A;  3FW8 A;  5G5H B;  1QLT A;  1W1Q A;  3AMZ A;  1HSK A;  4ZOH B;  1W1M A;  5AE2 A;  2P4P A;  4EC3 A;  1N60 C;  1DIQ A;  1E8F A;  3W8W A;  4BC9 A;  1AHU A;  1FFV C;  1DZN A;  2E3T A;  3DED A;  1E0Y A;  3TX1 A;  2YVS A;  1AHZ A;  2OAI A;  1FFU C;  2QPM A;  5FXE A;  3NVW B;  2I0K A;  1N5W C;  2BVG A;  2EXR A;  1VDV A;  1N5X A;  1FO4 A;  2PLI A;  2R2Z A;  1VAO A;  2GQU A;  4PWC A;  1F0X A;  2P3H A;  5G5G B;  3AM9 A;  3SR6 B;  5FXD A;  2BVH A;  4HG0 A; 
#chains in the Genus database with same CATH topology
 3PM9 A;  3LLB A;  4OAL A;  3D2H A;  1UXY A;  4PVJ A;  5I1V A;  3W8X A;  3S1E A;  2W54 A;  3EUB 3;  3NVY B;  1W1K A;  3FW7 A;  3FW9 A;  3LAE A;  4PWB A;  3HSU A;  1V97 A;  1W1J A;  2O3G A;  5AWV A;  3TSH A;  3EJD B;  3S1D A;  1N63 C;  3KJM A;  1WVF A;  3NRZ B;  4BC7 A;  1W1L A;  1JRP A;  3ETR B;  5HHZ A;  2GQT A;  3D2D A;  2R8D A;  3C0P A;  1DII A;  5L6F A;  5FXF A;  1WYG A;  4PVH A;  4JAY A;  2Y08 A;  5AE3 A;  3RJ8 A;  2VFS A;  1ZXI C;  2MBR A;  5AE1 A;  2Y3S A;  2P13 A;  3W8Z A;  1N62 C;  3TSJ A;  3NVV B;  4PVE A;  2Y4G A;  1ZR6 A;  2BVF A;  3I99 A;  2Q85 A;  2VAO A;  2VFV A;  1E8G A;  4UD8 A;  5FXP A;  1JRO A;  5D79 A;  2W3S A;  2UUV A;  3EJB B;  3NVZ B;  1RM6 B;  1W1O A;  2PLS A;  1N61 C;  1MBB A;  2W55 A;  5HMR A;  1I19 A;  4JB1 A;  3GSY A;  1MBT A;  3NS1 B;  3AN1 A;  4XLO A;  2UUU A;  5ADZ A;  2AXR A;  1QLU A;  1FIQ B;  3HRD C;  2VFR A;  3S1F A;  2Q4W A;  3VTE A;  1W1R A;  2NQW A;  2VFT A;  3S1C A;  4BCA A;  1T3Q C;  1SB3 B;  3BW7 A;  1E8H A;  2VFU A;  4PYT A;  3DQ0 A;  2Y3R A;  3PQB A;  4O95 A;  1AHV A;  4BBY A;  3B9J B;  4ML8 A;  1WVE A;  5I1W A;  2QKN A;  4PZF A;  5K8E A;  4PVK A;  3D2J A;  3FWA A;  2RK5 A;  2IPI A;  2W3R A;  5HQX A;  4DNS A;  4MLA A;  3JS8 A;  1W1S A;  5L6G A;  3FW8 A;  5G5H B;  1QLT A;  1W1Q A;  3AMZ A;  1HSK A;  4ZOH B;  1W1M A;  5AE2 A;  2P4P A;  4EC3 A;  3POP A;  1N60 C;  1DIQ A;  3EJE B;  1E8F A;  3W8W A;  4BC9 A;  1AHU A;  1FFV C;  1DZN A;  2E3T A;  3DED A;  1E0Y A;  3TX1 A;  2YVS A;  1AHZ A;  2OAI A;  1FFU C;  2QPM A;  5FXE A;  3NVW B;  2I0K A;  1N5W C;  2BVG A;  2EXR A;  1VDV A;  1N5X A;  1FO4 A;  2WDW A;  2PLI A;  2R2Z A;  1VAO A;  2GQU A;  4PWC A;  1F0X A;  2P3H A;  5G5G B;  3AM9 A;  3SR6 B;  5FXD A;  2BVH A;  3RJA A;  4HG0 A; 
#chains in the Genus database with same CATH homology
 3PM9 A;  3LLB A;  4OAL A;  3D2H A;  1UXY A;  4PVJ A;  5I1V A;  3W8X A;  3S1E A;  2W54 A;  3EUB 3;  3NVY B;  1W1K A;  3FW7 A;  3FW9 A;  3LAE A;  4PWB A;  3HSU A;  1V97 A;  1W1J A;  2O3G A;  5AWV A;  3TSH A;  3S1D A;  1N63 C;  3KJM A;  1WVF A;  3NRZ B;  4BC7 A;  1W1L A;  1JRP A;  3ETR B;  5HHZ A;  2GQT A;  3D2D A;  2R8D A;  3C0P A;  1DII A;  5L6F A;  5FXF A;  1WYG A;  4PVH A;  4JAY A;  2Y08 A;  5AE3 A;  3RJ8 A;  2VFS A;  1ZXI C;  2MBR A;  5AE1 A;  2Y3S A;  2P13 A;  3W8Z A;  1N62 C;  3TSJ A;  4PVE A;  2Y4G A;  3NVV B;  1ZR6 A;  2BVF A;  3I99 A;  2Q85 A;  2VAO A;  2VFV A;  1E8G A;  4UD8 A;  5FXP A;  1JRO A;  5D79 A;  2W3S A;  2UUV A;  3NVZ B;  1RM6 B;  2PLS A;  1W1O A;  1N61 C;  1MBB A;  2W55 A;  5HMR A;  1I19 A;  4JB1 A;  3GSY A;  1MBT A;  3NS1 B;  3AN1 A;  4XLO A;  2UUU A;  5ADZ A;  2AXR A;  1QLU A;  1FIQ B;  3HRD C;  2VFR A;  3S1F A;  2Q4W A;  3VTE A;  1W1R A;  2NQW A;  2VFT A;  3S1C A;  4BCA A;  1T3Q C;  1SB3 B;  3BW7 A;  1E8H A;  2VFU A;  4PYT A;  3DQ0 A;  2Y3R A;  3PQB A;  4O95 A;  1AHV A;  4BBY A;  3B9J B;  4ML8 A;  1WVE A;  5I1W A;  2QKN A;  4PZF A;  5K8E A;  4PVK A;  3D2J A;  3FWA A;  2RK5 A;  2IPI A;  2W3R A;  5HQX A;  4DNS A;  4MLA A;  3JS8 A;  1W1S A;  5L6G A;  3FW8 A;  5G5H B;  1QLT A;  1W1Q A;  3AMZ A;  1HSK A;  4ZOH B;  1W1M A;  5AE2 A;  2P4P A;  4EC3 A;  3POP A;  1N60 C;  1DIQ A;  1E8F A;  3W8W A;  4BC9 A;  1AHU A;  1FFV C;  1DZN A;  2E3T A;  3DED A;  1E0Y A;  3TX1 A;  2YVS A;  1AHZ A;  2OAI A;  1FFU C;  2QPM A;  5FXE A;  3NVW B;  2I0K A;  1N5W C;  2BVG A;  2EXR A;  1VDV A;  1N5X A;  1FO4 A;  2WDW A;  2PLI A;  2R2Z A;  1VAO A;  2GQU A;  4PWC A;  1F0X A;  2P3H A;  5G5G B;  3AM9 A;  3SR6 B;  5FXD A;  2BVH A;  3RJA A;  4HG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...