2O3GA

Structural genomics, the crystal structure of a conserved putative domain from neisseria meningitidis mc58
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
ESLTVEGALEYVELAPQLNLPQQEEDADFHTVAGLIMEELQTIPDVGDFADFHGWRFEVVEKEGQRIERVKITKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a conserved putative domain from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Putative protein
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2o3gA00
1N63C 2YVSA 1ZR6A 5AE2A 3EUB3 5AE3A 4BCAA 3KJMA 2QKNA 5FXFA 2VFVA 2W3RA 2MBRA 1RM6B 5AE1A 3DEDA 4OALA 5FXEA 2Q4WA 1W1MA 1WVFA 2P3HA 3NVWB 5G5GB 3PM9A 3AN1A 3ETRB 3W8XA 1VAOA 3SR6B 1MBBA 2Q85A 3NS1B 1AHUA 2AXRA 3HRDC 2O3GA 3LLBA 1FFUC 3I99A 2W3SA 1ZXIC 3DQ0A 3AMZA 5HMRA 3BW7A 2R2ZA 4JAYA 2VAOA 4BBYA 4ML8A 1W1QA 1FIQB 1MBTA 2I0KA 3W8ZA 5FXDA 5HQXA 1N62C 3W8WA 1W1RA 2QPMA 4XLOA 1DIIA 2E3TA 2VFSA 2EXRA 1E8FA 5HHZA 1E8HA 4BC7A 1QLTA 2P13A 5ADZA 1AHZA 2W55A 2BVGA 1N60C 3JS8A 5FXPA 3LAEA 1W1KA 4O95A 2VFRA 2RK5A 1QLUA 1W1JA 2W54A 3S1DA 1JRPA 1W1LA 1DZNA 1V97A 2BVHA 3NVYB 3NVVB 4JB1A 1F0XA 3TX1A 1VDVA 1FO4A 2VFUA 1W1OA 4HG0A 1FFVC 1SB3B 1W1SA 4ZOHB 3S1EA 1WYGA 3C0PA 4BC9A 2P4PA 3NRZB 2NQWA 1N5XA 2PLSA 1N61C 2GQTA 1AHVA 2PLIA 2GQUA 1I19A 1E0YA 1N5WC 5G5HB 1T3QC 2OAIA 3NVZB 1DIQA 1UXYA 4MLAA 1HSKA 3S1FA 4PYTA 2R8DA 3S1CA 1WVEA 3B9JB 1E8GA 1JROA 2VFTA 2BVFA 3AM9A
chains in the Genus database with same CATH superfamily
1N63C 2YVSA 1ZR6A 3RJAA 3EUB3 2UUVA 5AE3A 5AE2A 4BCAA 3KJMA 2QKNA 5FXFA 2VFVA 2W3RA 2MBRA 1RM6B 5AE1A 3DEDA 4OALA 5AWVA 3PQBA 4PVJA 5FXEA 2WDWA 2Q4WA 1W1MA 1WVFA 2P3HA 3NVWB 4UD8A 5G5GB 3PM9A 3AN1A 3ETRB 3W8XA 1VAOA 3SR6B 1MBBA 2Q85A 3NS1B 1AHUA 2AXRA 3HRDC 2O3GA 3LLBA 5K8EA 3D2HA 2UUUA 1FFUC 3D2JA 4PZFA 3I99A 2W3SA 1ZXIC 3DQ0A 3AMZA 5HMRA 3BW7A 2R2ZA 4JAYA 2VAOA 4BBYA 4DNSA 5I1VA 4ML8A 1W1QA 1FIQB 1MBTA 4PVHA 2I0KA 3W8ZA 5FXDA 3FWAA 5HQXA 1N62C 3W8WA 1W1RA 4PVKA 3RJ8A 2QPMA 4PWCA 4XLOA 1DIIA 2E3TA 2VFSA 2EXRA 1E8FA 5HHZA 1E8HA 4BC7A 1QLTA 2P13A 3D2DA 5ADZA 1AHZA 2BVGA 1N60C 2W55A 3JS8A 5FXPA 3LAEA 1W1KA 4O95A 3TSJA 2VFRA 3VTEA 2RK5A 1QLUA 1W1JA 2W54A 3TSHA 5I1WA 3S1DA 1JRPA 1W1LA 1DZNA 1V97A 5L6FA 3GSYA 4PVEA 2BVHA 3NVYB 3NVVB 3FW9A 4JB1A 1F0XA 3TX1A 1VDVA 1FO4A 2VFUA 1W1OA 4HG0A 1FFVC 3FW8A 3POPA 1SB3B 2IPIA 1W1SA 4ZOHB 3S1EA 1WYGA 3C0PA 3HSUA 4BC9A 2P4PA 3NRZB 2Y4GA 3FW7A 2NQWA 1N5XA 2PLSA 1N61C 2GQTA 1AHVA 2PLIA 5D79A 4PWBA 5L6GA 2GQUA 1I19A 1E0YA 1N5WC 5G5HB 1T3QC 2OAIA 3NVZB 1DIQA 1UXYA 4MLAA 1HSKA 3S1FA 2Y08A 4EC3A 4PYTA 2R8DA 2Y3SA 3S1CA 1WVEA 2Y3RA 3B9JB 1E8GA 1JROA 2VFTA 2BVFA 3AM9A
chains in the Genus database with same CATH topology
1N63C 2YVSA 1ZR6A 3RJAA 3EUB3 2UUVA 5AE3A 5AE2A 4BCAA 3KJMA 2QKNA 5FXFA 2VFVA 2W3RA 2MBRA 1RM6B 5AE1A 3DEDA 4OALA 5AWVA 3PQBA 4PVJA 5FXEA 2WDWA 2Q4WA 1W1MA 1WVFA 2P3HA 3NVWB 4UD8A 5G5GB 3PM9A 3AN1A 3ETRB 3W8XA 1VAOA 3SR6B 1MBBA 2Q85A 3NS1B 1AHUA 2AXRA 3HRDC 2O3GA 3LLBA 5K8EA 3D2HA 2UUUA 1FFUC 3D2JA 4PZFA 3I99A 2W3SA 1ZXIC 3DQ0A 3AMZA 5HMRA 3BW7A 2R2ZA 4JAYA 2VAOA 4BBYA 4DNSA 5I1VA 4ML8A 1W1QA 1FIQB 1MBTA 4PVHA 2I0KA 3W8ZA 5FXDA 3FWAA 5HQXA 1N62C 3W8WA 1W1RA 4PVKA 3RJ8A 2QPMA 4PWCA 4XLOA 1DIIA 2E3TA 2VFSA 2EXRA 1E8FA 5HHZA 1E8HA 4BC7A 1QLTA 2P13A 3D2DA 5ADZA 1AHZA 2BVGA 1N60C 2W55A 3JS8A 5FXPA 3LAEA 1W1KA 4O95A 3TSJA 2VFRA 3VTEA 2RK5A 1QLUA 1W1JA 2W54A 3TSHA 5I1WA 3S1DA 1JRPA 1W1LA 1DZNA 1V97A 5L6FA 3GSYA 4PVEA 2BVHA 3NVYB 3NVVB 3FW9A 4JB1A 1F0XA 3TX1A 1VDVA 1FO4A 2VFUA 1W1OA 4HG0A 1FFVC 3FW8A 3POPA 1SB3B 2IPIA 1W1SA 4ZOHB 3S1EA 1WYGA 3C0PA 3HSUA 4BC9A 2P4PA 3NRZB 2Y4GA 3FW7A 2NQWA 1N5XA 2PLSA 1N61C 2GQTA 1AHVA 2PLIA 5D79A 4PWBA 5L6GA 2GQUA 1I19A 1E0YA 1N5WC 5G5HB 1T3QC 2OAIA 3NVZB 1DIQA 1UXYA 4MLAA 1HSKA 3S1FA 2Y08A 4EC3A 4PYTA 2R8DA 2Y3SA 3S1CA 1WVEA 2Y3RA 3B9JB 1E8GA 1JROA 2VFTA 2BVFA 3AM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N63 C;  2YVS A;  1ZR6 A;  5AE2 A;  3EUB 3;  5AE3 A;  4BCA A;  3KJM A;  2QKN A;  5FXF A;  2VFV A;  2W3R A;  2MBR A;  1RM6 B;  5AE1 A;  3DED A;  4OAL A;  5FXE A;  2Q4W A;  1W1M A;  1WVF A;  2P3H A;  3NVW B;  5G5G B;  3PM9 A;  3AN1 A;  3ETR B;  3W8X A;  1VAO A;  3SR6 B;  1MBB A;  2Q85 A;  3NS1 B;  1AHU A;  2AXR A;  3HRD C;  2O3G A;  3LLB A;  1FFU C;  3I99 A;  2W3S A;  1ZXI C;  3DQ0 A;  3AMZ A;  5HMR A;  3BW7 A;  2R2Z A;  4JAY A;  2VAO A;  4BBY A;  4ML8 A;  1W1Q A;  1FIQ B;  1MBT A;  2I0K A;  3W8Z A;  5FXD A;  5HQX A;  1N62 C;  3W8W A;  1W1R A;  2QPM A;  4XLO A;  1DII A;  2E3T A;  2VFS A;  2EXR A;  1E8F A;  5HHZ A;  1E8H A;  4BC7 A;  1QLT A;  2P13 A;  5ADZ A;  1AHZ A;  2W55 A;  2BVG A;  1N60 C;  3JS8 A;  5FXP A;  3LAE A;  1W1K A;  4O95 A;  2VFR A;  2RK5 A;  1QLU A;  1W1J A;  2W54 A;  3S1D A;  1JRP A;  1W1L A;  1DZN A;  1V97 A;  2BVH A;  3NVY B;  3NVV B;  4JB1 A;  1F0X A;  3TX1 A;  1VDV A;  1FO4 A;  2VFU A;  1W1O A;  4HG0 A;  1FFV C;  1SB3 B;  1W1S A;  4ZOH B;  3S1E A;  1WYG A;  3C0P A;  4BC9 A;  2P4P A;  3NRZ B;  2NQW A;  1N5X A;  2PLS A;  1N61 C;  2GQT A;  1AHV A;  2PLI A;  2GQU A;  1I19 A;  1E0Y A;  1N5W C;  5G5H B;  1T3Q C;  2OAI A;  3NVZ B;  1DIQ A;  1UXY A;  4MLA A;  1HSK A;  3S1F A;  4PYT A;  2R8D A;  3S1C A;  1WVE A;  3B9J B;  1E8G A;  1JRO A;  2VFT A;  2BVF A;  3AM9 A; 
#chains in the Genus database with same CATH topology
 1N63 C;  2YVS A;  1ZR6 A;  3RJA A;  3EUB 3;  2UUV A;  5AE3 A;  5AE2 A;  4BCA A;  3KJM A;  2QKN A;  5FXF A;  2VFV A;  2W3R A;  2MBR A;  1RM6 B;  5AE1 A;  3DED A;  4OAL A;  5AWV A;  3PQB A;  4PVJ A;  5FXE A;  2WDW A;  2Q4W A;  1W1M A;  1WVF A;  2P3H A;  3NVW B;  4UD8 A;  5G5G B;  3PM9 A;  3AN1 A;  3ETR B;  3W8X A;  1VAO A;  3SR6 B;  1MBB A;  2Q85 A;  3NS1 B;  1AHU A;  2AXR A;  3HRD C;  2O3G A;  3LLB A;  5K8E A;  3D2H A;  2UUU A;  1FFU C;  3D2J A;  4PZF A;  3I99 A;  2W3S A;  1ZXI C;  3DQ0 A;  3AMZ A;  5HMR A;  3BW7 A;  2R2Z A;  4JAY A;  2VAO A;  4BBY A;  4DNS A;  5I1V A;  4ML8 A;  1W1Q A;  1FIQ B;  1MBT A;  4PVH A;  2I0K A;  3W8Z A;  5FXD A;  3FWA A;  5HQX A;  1N62 C;  3W8W A;  1W1R A;  4PVK A;  3RJ8 A;  2QPM A;  4PWC A;  4XLO A;  1DII A;  2E3T A;  2VFS A;  2EXR A;  1E8F A;  5HHZ A;  1E8H A;  4BC7 A;  1QLT A;  2P13 A;  3D2D A;  5ADZ A;  1AHZ A;  2BVG A;  1N60 C;  2W55 A;  3JS8 A;  5FXP A;  3LAE A;  1W1K A;  4O95 A;  3TSJ A;  2VFR A;  3VTE A;  2RK5 A;  1QLU A;  1W1J A;  2W54 A;  3TSH A;  5I1W A;  3S1D A;  1JRP A;  1W1L A;  1DZN A;  1V97 A;  5L6F A;  3GSY A;  4PVE A;  2BVH A;  3NVY B;  3NVV B;  3FW9 A;  4JB1 A;  1F0X A;  3TX1 A;  1VDV A;  1FO4 A;  2VFU A;  1W1O A;  4HG0 A;  1FFV C;  3FW8 A;  3POP A;  1SB3 B;  2IPI A;  1W1S A;  4ZOH B;  3S1E A;  1WYG A;  3C0P A;  3HSU A;  4BC9 A;  2P4P A;  3NRZ B;  2Y4G A;  3FW7 A;  2NQW A;  1N5X A;  2PLS A;  1N61 C;  2GQT A;  1AHV A;  2PLI A;  5D79 A;  4PWB A;  5L6G A;  2GQU A;  1I19 A;  1E0Y A;  1N5W C;  5G5H B;  1T3Q C;  2OAI A;  3NVZ B;  1DIQ A;  1UXY A;  4MLA A;  1HSK A;  3S1F A;  2Y08 A;  4EC3 A;  4PYT A;  2R8D A;  2Y3S A;  3S1C A;  1WVE A;  2Y3R A;  3B9J B;  1E8G A;  1JRO A;  2VFT A;  2BVF A;  3AM9 A; 
#chains in the Genus database with same CATH homology
 1N63 C;  2YVS A;  1ZR6 A;  3RJA A;  3EUB 3;  2UUV A;  5AE3 A;  5AE2 A;  4BCA A;  3KJM A;  2QKN A;  5FXF A;  2VFV A;  2W3R A;  2MBR A;  1RM6 B;  5AE1 A;  3DED A;  4OAL A;  5AWV A;  3PQB A;  4PVJ A;  5FXE A;  2WDW A;  2Q4W A;  1W1M A;  1WVF A;  2P3H A;  3NVW B;  4UD8 A;  5G5G B;  3PM9 A;  3AN1 A;  3ETR B;  3W8X A;  1VAO A;  3SR6 B;  1MBB A;  2Q85 A;  3NS1 B;  1AHU A;  2AXR A;  3HRD C;  2O3G A;  3LLB A;  5K8E A;  3D2H A;  2UUU A;  1FFU C;  3D2J A;  4PZF A;  3I99 A;  2W3S A;  1ZXI C;  3DQ0 A;  3AMZ A;  5HMR A;  3BW7 A;  2R2Z A;  4JAY A;  2VAO A;  4BBY A;  4DNS A;  5I1V A;  4ML8 A;  1W1Q A;  1FIQ B;  1MBT A;  4PVH A;  2I0K A;  3W8Z A;  5FXD A;  3FWA A;  5HQX A;  1N62 C;  3W8W A;  1W1R A;  4PVK A;  3RJ8 A;  2QPM A;  4PWC A;  4XLO A;  1DII A;  2E3T A;  2VFS A;  2EXR A;  1E8F A;  5HHZ A;  1E8H A;  4BC7 A;  1QLT A;  2P13 A;  3D2D A;  5ADZ A;  1AHZ A;  2BVG A;  1N60 C;  2W55 A;  3JS8 A;  5FXP A;  3LAE A;  1W1K A;  4O95 A;  3TSJ A;  2VFR A;  3VTE A;  2RK5 A;  1QLU A;  1W1J A;  2W54 A;  3TSH A;  5I1W A;  3S1D A;  1JRP A;  1W1L A;  1DZN A;  1V97 A;  5L6F A;  3GSY A;  4PVE A;  2BVH A;  3NVY B;  3NVV B;  3FW9 A;  4JB1 A;  1F0X A;  3TX1 A;  1VDV A;  1FO4 A;  2VFU A;  1W1O A;  4HG0 A;  1FFV C;  3FW8 A;  3POP A;  1SB3 B;  2IPI A;  1W1S A;  4ZOH B;  3S1E A;  1WYG A;  3C0P A;  3HSU A;  4BC9 A;  2P4P A;  3NRZ B;  2Y4G A;  3FW7 A;  2NQW A;  1N5X A;  2PLS A;  1N61 C;  2GQT A;  1AHV A;  2PLI A;  5D79 A;  4PWB A;  5L6G A;  2GQU A;  1I19 A;  1E0Y A;  1N5W C;  5G5H B;  1T3Q C;  2OAI A;  3NVZ B;  1DIQ A;  1UXY A;  4MLA A;  1HSK A;  3S1F A;  2Y08 A;  4EC3 A;  4PYT A;  2R8D A;  2Y3S A;  3S1C A;  1WVE A;  2Y3R A;  3B9J B;  1E8G A;  1JRO A;  2VFT A;  2BVF A;  3AM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...