2O3GA

Structural genomics, the crystal structure of a conserved putative domain from neisseria meningitidis mc58
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
ESLTVEGALEYVELAPQLNLPQQEEDADFHTVAGLIMEELQTIPDVGDFADFHGWRFEVVEKEGQRIERVKITKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative protein
publication title The crystal structure of a conserved putative domain from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2o3gA00
2P13A 3C0PA 3S1EA 1SB3B 1VAOA 1E8FA 1VDVA 2QKNA 2NQWA 1MBBA 3LAEA 2Q4WA 1W1SA 3AN1A 1DZNA 3SR6B 5G5HB 2VFTA 3S1FA 1E8GA 1JROA 3W8XA 5HQXA 2BVFA 5AE2A 3W8ZA 4JAYA 1DIQA 2E3TA 4ML8A 5HMRA 1JRPA 5G5GB 4BC7A 2VFUA 2VFVA 3NVWB 1FFUC 2GQUA 1N63C 2Q85A 4HG0A 5AE1A 1WYGA 3NRZB 2VFRA 2W3RA 5HHZA 1AHZA 3LLBA 1E0YA 3B9JB 3DQ0A 1MBTA 2R8DA 5ADZA 2W55A 1W1QA 1W1MA 3NVYB 1T3QC 4XLOA 3NVVB 1WVEA 2P3HA 2PLIA 3HRDC 2BVGA 2R2ZA 1W1OA 1HSKA 2OAIA 4PYTA 5FXDA 2W3SA 5FXEA 1ZXIC 2EXRA 2VAOA 4O95A 1I19A 3ETRB 4MLAA 2W54A 3W8WA 2YVSA 1RM6B 3BW7A 5FXFA 4BC9A 1W1KA 1AHVA 3S1CA 3AMZA 1W1LA 1N62C 1FFVC 1N61C 3S1DA 1N60C 3EUB3 1FIQB 4ZOHB 1UXYA 1FO4A 2PLSA 3TX1A 2BVHA 2QPMA 2AXRA 3KJMA 1ZR6A 4BCAA 1W1JA 1V97A 4JB1A 1QLTA 2P4PA 1W1RA 3JS8A 3NS1B 2MBRA 3NVZB 1AHUA 1DIIA 2GQTA 1N5XA 2I0KA 3PM9A 1E8HA 4BBYA 2O3GA 3DEDA 3AM9A 1F0XA 3I99A 5FXPA 1N5WC 1QLUA 2VFSA 1WVFA 4OALA 2RK5A 5AE3A
chains in the Genus database with same CATH superfamily
2P13A 2UUVA 3C0PA 3S1EA 1SB3B 1VAOA 1E8FA 1VDVA 2QKNA 2NQWA 1MBBA 3LAEA 4PWCA 2Q4WA 1W1SA 3AN1A 1DZNA 3SR6B 3D2JA 5AWVA 3VTEA 5G5HB 2VFTA 3S1FA 1E8GA 4PWBA 1JROA 3W8XA 5HQXA 2BVFA 5AE2A 3W8ZA 2UUUA 4JAYA 1DIQA 2E3TA 4ML8A 4PVKA 5HMRA 1JRPA 5G5GB 4BC7A 2VFUA 2VFVA 3NVWB 1FFUC 2GQUA 1N63C 2Q85A 4HG0A 3HSUA 5AE1A 1WYGA 3NRZB 2VFRA 2W3RA 3RJ8A 5HHZA 1AHZA 3LLBA 2Y08A 1E0YA 3B9JB 3DQ0A 1MBTA 2R8DA 5ADZA 2W55A 1W1QA 1W1MA 3D2HA 5D79A 3NVYB 3GSYA 5I1WA 1T3QC 4XLOA 3NVVB 1WVEA 2P3HA 2PLIA 3HRDC 2BVGA 2R2ZA 3FW8A 1W1OA 1HSKA 2OAIA 4PYTA 5FXDA 2W3SA 5FXEA 1ZXIC 2EXRA 2WDWA 2VAOA 3POPA 4PVHA 2IPIA 4O95A 1I19A 3ETRB 3FWAA 4MLAA 2W54A 3W8WA 5I1VA 2YVSA 1RM6B 3BW7A 3D2DA 5FXFA 4BC9A 3TSJA 1W1KA 1AHVA 3S1CA 3AMZA 1W1LA 1N62C 4UD8A 1FFVC 1N61C 3S1DA 1N60C 3EUB3 1FIQB 4ZOHB 4DNSA 1UXYA 4PVJA 1FO4A 2PLSA 5L6FA 3TX1A 3FW9A 2BVHA 2QPMA 2AXRA 2Y3SA 3KJMA 1ZR6A 4BCAA 1W1JA 3TSHA 3FW7A 1V97A 4JB1A 4EC3A 1QLTA 2P4PA 4PVEA 1W1RA 2Y3RA 5L6GA 3JS8A 3NS1B 2MBRA 3NVZB 1AHUA 1DIIA 3RJAA 2GQTA 5K8EA 1N5XA 4PZFA 2I0KA 3PM9A 1E8HA 3PQBA 4BBYA 2O3GA 3DEDA 3AM9A 1F0XA 3I99A 5FXPA 1N5WC 1QLUA 2Y4GA 2VFSA 1WVFA 4OALA 2RK5A 5AE3A
chains in the Genus database with same CATH topology
2P13A 2UUVA 3C0PA 3S1EA 1SB3B 1VAOA 1E8FA 1VDVA 2QKNA 2NQWA 1MBBA 3LAEA 4PWCA 2Q4WA 1W1SA 3AN1A 1DZNA 3SR6B 3D2JA 5AWVA 3VTEA 5G5HB 2VFTA 3S1FA 1E8GA 4PWBA 1JROA 3W8XA 5HQXA 2BVFA 5AE2A 3W8ZA 2UUUA 4JAYA 1DIQA 2E3TA 4ML8A 4PVKA 5HMRA 1JRPA 5G5GB 4BC7A 2VFUA 2VFVA 3NVWB 1FFUC 2GQUA 1N63C 2Q85A 4HG0A 3HSUA 5AE1A 1WYGA 3NRZB 2VFRA 2W3RA 3RJ8A 5HHZA 1AHZA 3LLBA 2Y08A 1E0YA 3B9JB 3DQ0A 1MBTA 2R8DA 5ADZA 2W55A 1W1QA 1W1MA 3D2HA 5D79A 3NVYB 3GSYA 5I1WA 1T3QC 4XLOA 3NVVB 1WVEA 2P3HA 2PLIA 3HRDC 2BVGA 2R2ZA 3FW8A 1W1OA 1HSKA 2OAIA 4PYTA 5FXDA 2W3SA 5FXEA 1ZXIC 2EXRA 2WDWA 2VAOA 3POPA 4PVHA 2IPIA 4O95A 1I19A 3ETRB 3FWAA 4MLAA 2W54A 3W8WA 5I1VA 2YVSA 1RM6B 3BW7A 3D2DA 5FXFA 4BC9A 3TSJA 1W1KA 1AHVA 3S1CA 3AMZA 1W1LA 1N62C 4UD8A 1FFVC 1N61C 3S1DA 1N60C 3EUB3 1FIQB 4ZOHB 4DNSA 1UXYA 4PVJA 1FO4A 2PLSA 5L6FA 3TX1A 3FW9A 2BVHA 2QPMA 2AXRA 2Y3SA 3KJMA 1ZR6A 4BCAA 1W1JA 3TSHA 3FW7A 1V97A 4JB1A 4EC3A 1QLTA 2P4PA 4PVEA 1W1RA 2Y3RA 5L6GA 3JS8A 3NS1B 2MBRA 3NVZB 1AHUA 1DIIA 3RJAA 2GQTA 5K8EA 1N5XA 4PZFA 2I0KA 3PM9A 1E8HA 3PQBA 4BBYA 2O3GA 3DEDA 3AM9A 1F0XA 3I99A 5FXPA 1N5WC 1QLUA 2Y4GA 2VFSA 1WVFA 4OALA 2RK5A 5AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P13 A;  3C0P A;  3S1E A;  1SB3 B;  1VAO A;  1E8F A;  1VDV A;  2QKN A;  2NQW A;  1MBB A;  3LAE A;  2Q4W A;  1W1S A;  3AN1 A;  1DZN A;  3SR6 B;  5G5H B;  2VFT A;  3S1F A;  1E8G A;  1JRO A;  3W8X A;  5HQX A;  2BVF A;  5AE2 A;  3W8Z A;  4JAY A;  1DIQ A;  2E3T A;  4ML8 A;  5HMR A;  1JRP A;  5G5G B;  4BC7 A;  2VFU A;  2VFV A;  3NVW B;  1FFU C;  2GQU A;  1N63 C;  2Q85 A;  4HG0 A;  5AE1 A;  1WYG A;  3NRZ B;  2VFR A;  2W3R A;  5HHZ A;  1AHZ A;  3LLB A;  1E0Y A;  3B9J B;  3DQ0 A;  1MBT A;  2R8D A;  5ADZ A;  2W55 A;  1W1Q A;  1W1M A;  3NVY B;  1T3Q C;  4XLO A;  3NVV B;  1WVE A;  2P3H A;  2PLI A;  3HRD C;  2BVG A;  2R2Z A;  1W1O A;  1HSK A;  2OAI A;  4PYT A;  5FXD A;  2W3S A;  5FXE A;  1ZXI C;  2EXR A;  2VAO A;  4O95 A;  1I19 A;  3ETR B;  4MLA A;  2W54 A;  3W8W A;  2YVS A;  1RM6 B;  3BW7 A;  5FXF A;  4BC9 A;  1W1K A;  1AHV A;  3S1C A;  3AMZ A;  1W1L A;  1N62 C;  1FFV C;  1N61 C;  3S1D A;  1N60 C;  3EUB 3;  1FIQ B;  4ZOH B;  1UXY A;  1FO4 A;  2PLS A;  3TX1 A;  2BVH A;  2QPM A;  2AXR A;  3KJM A;  1ZR6 A;  4BCA A;  1W1J A;  1V97 A;  4JB1 A;  1QLT A;  2P4P A;  1W1R A;  3JS8 A;  3NS1 B;  2MBR A;  3NVZ B;  1AHU A;  1DII A;  2GQT A;  1N5X A;  2I0K A;  3PM9 A;  1E8H A;  4BBY A;  2O3G A;  3DED A;  3AM9 A;  1F0X A;  3I99 A;  5FXP A;  1N5W C;  1QLU A;  2VFS A;  1WVF A;  4OAL A;  2RK5 A;  5AE3 A; 
#chains in the Genus database with same CATH topology
 2P13 A;  2UUV A;  3C0P A;  3S1E A;  1SB3 B;  1VAO A;  1E8F A;  1VDV A;  2QKN A;  2NQW A;  1MBB A;  3LAE A;  4PWC A;  2Q4W A;  1W1S A;  3AN1 A;  1DZN A;  3SR6 B;  3D2J A;  5AWV A;  3VTE A;  5G5H B;  2VFT A;  3S1F A;  1E8G A;  4PWB A;  1JRO A;  3W8X A;  5HQX A;  2BVF A;  5AE2 A;  3W8Z A;  2UUU A;  4JAY A;  1DIQ A;  2E3T A;  4ML8 A;  4PVK A;  5HMR A;  1JRP A;  5G5G B;  4BC7 A;  2VFU A;  2VFV A;  3NVW B;  1FFU C;  2GQU A;  1N63 C;  2Q85 A;  4HG0 A;  3HSU A;  5AE1 A;  1WYG A;  3NRZ B;  2VFR A;  2W3R A;  3RJ8 A;  5HHZ A;  1AHZ A;  3LLB A;  2Y08 A;  1E0Y A;  3B9J B;  3DQ0 A;  1MBT A;  2R8D A;  5ADZ A;  2W55 A;  1W1Q A;  1W1M A;  3D2H A;  5D79 A;  3NVY B;  3GSY A;  5I1W A;  1T3Q C;  4XLO A;  3NVV B;  1WVE A;  2P3H A;  2PLI A;  3HRD C;  2BVG A;  2R2Z A;  3FW8 A;  1W1O A;  1HSK A;  2OAI A;  4PYT A;  5FXD A;  2W3S A;  5FXE A;  1ZXI C;  2EXR A;  2WDW A;  2VAO A;  3POP A;  4PVH A;  2IPI A;  4O95 A;  1I19 A;  3ETR B;  3FWA A;  4MLA A;  2W54 A;  3W8W A;  5I1V A;  2YVS A;  1RM6 B;  3BW7 A;  3D2D A;  5FXF A;  4BC9 A;  3TSJ A;  1W1K A;  1AHV A;  3S1C A;  3AMZ A;  1W1L A;  1N62 C;  4UD8 A;  1FFV C;  1N61 C;  3S1D A;  1N60 C;  3EUB 3;  1FIQ B;  4ZOH B;  4DNS A;  1UXY A;  4PVJ A;  1FO4 A;  2PLS A;  5L6F A;  3TX1 A;  3FW9 A;  2BVH A;  2QPM A;  2AXR A;  2Y3S A;  3KJM A;  1ZR6 A;  4BCA A;  1W1J A;  3TSH A;  3FW7 A;  1V97 A;  4JB1 A;  4EC3 A;  1QLT A;  2P4P A;  4PVE A;  1W1R A;  2Y3R A;  5L6G A;  3JS8 A;  3NS1 B;  2MBR A;  3NVZ B;  1AHU A;  1DII A;  3RJA A;  2GQT A;  5K8E A;  1N5X A;  4PZF A;  2I0K A;  3PM9 A;  1E8H A;  3PQB A;  4BBY A;  2O3G A;  3DED A;  3AM9 A;  1F0X A;  3I99 A;  5FXP A;  1N5W C;  1QLU A;  2Y4G A;  2VFS A;  1WVF A;  4OAL A;  2RK5 A;  5AE3 A; 
#chains in the Genus database with same CATH homology
 2P13 A;  2UUV A;  3C0P A;  3S1E A;  1SB3 B;  1VAO A;  1E8F A;  1VDV A;  2QKN A;  2NQW A;  1MBB A;  3LAE A;  4PWC A;  2Q4W A;  1W1S A;  3AN1 A;  1DZN A;  3SR6 B;  3D2J A;  5AWV A;  3VTE A;  5G5H B;  2VFT A;  3S1F A;  1E8G A;  4PWB A;  1JRO A;  3W8X A;  5HQX A;  2BVF A;  5AE2 A;  3W8Z A;  2UUU A;  4JAY A;  1DIQ A;  2E3T A;  4ML8 A;  4PVK A;  5HMR A;  1JRP A;  5G5G B;  4BC7 A;  2VFU A;  2VFV A;  3NVW B;  1FFU C;  2GQU A;  1N63 C;  2Q85 A;  4HG0 A;  3HSU A;  5AE1 A;  1WYG A;  3NRZ B;  2VFR A;  2W3R A;  3RJ8 A;  5HHZ A;  1AHZ A;  3LLB A;  2Y08 A;  1E0Y A;  3B9J B;  3DQ0 A;  1MBT A;  2R8D A;  5ADZ A;  2W55 A;  1W1Q A;  1W1M A;  3D2H A;  5D79 A;  3NVY B;  3GSY A;  5I1W A;  1T3Q C;  4XLO A;  3NVV B;  1WVE A;  2P3H A;  2PLI A;  3HRD C;  2BVG A;  2R2Z A;  3FW8 A;  1W1O A;  1HSK A;  2OAI A;  4PYT A;  5FXD A;  2W3S A;  5FXE A;  1ZXI C;  2EXR A;  2WDW A;  2VAO A;  3POP A;  4PVH A;  2IPI A;  4O95 A;  1I19 A;  3ETR B;  3FWA A;  4MLA A;  2W54 A;  3W8W A;  5I1V A;  2YVS A;  1RM6 B;  3BW7 A;  3D2D A;  5FXF A;  4BC9 A;  3TSJ A;  1W1K A;  1AHV A;  3S1C A;  3AMZ A;  1W1L A;  1N62 C;  4UD8 A;  1FFV C;  1N61 C;  3S1D A;  1N60 C;  3EUB 3;  1FIQ B;  4ZOH B;  4DNS A;  1UXY A;  4PVJ A;  1FO4 A;  2PLS A;  5L6F A;  3TX1 A;  3FW9 A;  2BVH A;  2QPM A;  2AXR A;  2Y3S A;  3KJM A;  1ZR6 A;  4BCA A;  1W1J A;  3TSH A;  3FW7 A;  1V97 A;  4JB1 A;  4EC3 A;  1QLT A;  2P4P A;  4PVE A;  1W1R A;  2Y3R A;  5L6G A;  3JS8 A;  3NS1 B;  2MBR A;  3NVZ B;  1AHU A;  1DII A;  3RJA A;  2GQT A;  5K8E A;  1N5X A;  4PZF A;  2I0K A;  3PM9 A;  1E8H A;  3PQB A;  4BBY A;  2O3G A;  3DED A;  3AM9 A;  1F0X A;  3I99 A;  5FXP A;  1N5W C;  1QLU A;  2Y4G A;  2VFS A;  1WVF A;  4OAL A;  2RK5 A;  5AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...