2O3GA

Structural genomics, the crystal structure of a conserved putative domain from neisseria meningitidis mc58
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
ESLTVEGALEYVELAPQLNLPQQEEDADFHTVAGLIMEELQTIPDVGDFADFHGWRFEVVEKEGQRIERVKITKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Putative protein
publication title The crystal structure of a conserved putative domain from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2o3gA00
1V97A 4JB1A 4ML8A 5ADZA 2VFRA 1FIQB 2AXRA 2VFSA 3NVWB 2W3SA 1W1MA 2I0KA 5FXEA 4ZOHB 5HQXA 5AE2A 1W1SA 2RK5A 3NRZB 4O95A 4OALA 3JS8A 1N63C 1I19A 1RM6B 2R8DA 4JAYA 3S1CA 3TX1A 1VDVA 2EXRA 2O3GA 2GQTA 1FFUC 3ETRB 5AE1A 1FO4A 1MBTA 1DZNA 2PLSA 1JRPA 4BBYA 1ZR6A 1AHUA 2W55A 5FXDA 1AHVA 1WVFA 3NVZB 2VFVA 1T3QC 1E8FA 2Q85A 3W8WA 1E8HA 2BVHA 2BVFA 1E0YA 3I99A 2Q4WA 3KJMA 1W1KA 4HG0A 2R2ZA 2QPMA 1W1LA 2BVGA 1F0XA 1JROA 1ZXIC 1E8GA 2VFUA 2MBRA 1AHZA 1W1RA 3DQ0A 2P13A 1N5WC 3NS1B 1W1QA 1DIIA 3SR6B 1N62C 3AM9A 2QKNA 2E3TA 3HRDC 2NQWA 1HSKA 2PLIA 2P3HA 3EUB3 5HHZA 2GQUA 3S1DA 3NVVB 1N60C 1W1OA 3C0PA 3W8ZA 4BC7A 1QLTA 4BCAA 3S1FA 4MLAA 1DIQA 1WVEA 2VAOA 3DEDA 5G5HB 2VFTA 5G5GB 1N5XA 3W8XA 3LLBA 3S1EA 4XLOA 1W1JA 1WYGA 1N61C 4BC9A 2W3RA 1MBBA 3B9JB 5HMRA 2OAIA 3AMZA 1UXYA 3BW7A 1VAOA 1QLUA 2YVSA 5FXFA 1SB3B 3PM9A 1FFVC 2W54A 5FXPA 3LAEA 4PYTA 3AN1A 2P4PA 3NVYB 5AE3A
chains in the Genus database with same CATH superfamily
1V97A 4JB1A 4ML8A 5ADZA 2VFRA 1FIQB 2AXRA 2VFSA 3FWAA 2Y4GA 3NVWB 2W3SA 1W1MA 2I0KA 5FXEA 3PQBA 4UD8A 4ZOHB 5AWVA 3VTEA 3RJAA 1W1SA 5AE2A 4PVEA 5HQXA 2RK5A 3NRZB 4O95A 4OALA 3TSHA 3JS8A 1N63C 1I19A 1RM6B 2R8DA 4JAYA 3S1CA 3TX1A 1VDVA 2EXRA 2O3GA 2GQTA 1FFUC 3ETRB 5AE1A 1FO4A 2Y08A 1MBTA 1DZNA 2PLSA 1JRPA 3D2HA 4BBYA 1ZR6A 1AHUA 2W55A 5FXDA 1AHVA 4PWCA 1WVFA 3NVZB 5K8EA 2VFVA 4DNSA 1T3QC 1E8FA 2Q85A 3W8WA 1E8HA 2BVHA 3POPA 2BVFA 1E0YA 3I99A 2Q4WA 3KJMA 1W1KA 3HSUA 3FW7A 2R2ZA 4HG0A 2QPMA 1W1LA 2BVGA 1F0XA 1JROA 2Y3RA 5I1VA 1ZXIC 1E8GA 5L6GA 2VFUA 2MBRA 3FW8A 1AHZA 1W1RA 3DQ0A 2P13A 5L6FA 1N5WC 3NS1B 1W1QA 1DIIA 2UUVA 3SR6B 1N62C 3AM9A 2QKNA 2E3TA 3HRDC 2NQWA 1HSKA 2PLIA 2P3HA 3EUB3 5HHZA 2GQUA 3S1DA 5I1WA 3RJ8A 3NVVB 1N60C 1W1OA 3C0PA 3W8ZA 4BC7A 1QLTA 4EC3A 4BCAA 3S1FA 4MLAA 1DIQA 1WVEA 2VAOA 4PVHA 3DEDA 4PVJA 5G5HB 2VFTA 5G5GB 3D2JA 1N5XA 3W8XA 3LLBA 3S1EA 3D2DA 4XLOA 5D79A 1W1JA 1WYGA 1N61C 4BC9A 2W3RA 1MBBA 2Y3SA 3B9JB 3FW9A 4PVKA 5HMRA 4PWBA 2OAIA 3AMZA 1UXYA 2UUUA 3TSJA 3BW7A 1VAOA 1QLUA 2YVSA 5FXFA 1SB3B 3PM9A 4PZFA 1FFVC 2W54A 5FXPA 2WDWA 3LAEA 4PYTA 3AN1A 2IPIA 3GSYA 2P4PA 3NVYB 5AE3A
chains in the Genus database with same CATH topology
1V97A 4JB1A 4ML8A 5ADZA 2VFRA 1FIQB 2AXRA 2VFSA 3FWAA 2Y4GA 3NVWB 2W3SA 1W1MA 2I0KA 5FXEA 3PQBA 4UD8A 4ZOHB 5AWVA 3VTEA 3RJAA 1W1SA 5AE2A 4PVEA 5HQXA 2RK5A 3NRZB 4O95A 4OALA 3TSHA 3JS8A 1N63C 1I19A 1RM6B 2R8DA 4JAYA 3S1CA 3TX1A 1VDVA 2EXRA 2O3GA 2GQTA 1FFUC 3ETRB 5AE1A 1FO4A 2Y08A 1MBTA 1DZNA 2PLSA 1JRPA 3D2HA 4BBYA 1ZR6A 1AHUA 2W55A 5FXDA 1AHVA 4PWCA 1WVFA 3NVZB 5K8EA 2VFVA 4DNSA 1T3QC 1E8FA 2Q85A 3W8WA 1E8HA 2BVHA 3POPA 2BVFA 1E0YA 3I99A 2Q4WA 3KJMA 1W1KA 3HSUA 3FW7A 2R2ZA 4HG0A 2QPMA 1W1LA 2BVGA 1F0XA 1JROA 2Y3RA 5I1VA 1ZXIC 1E8GA 5L6GA 2VFUA 2MBRA 3FW8A 1AHZA 1W1RA 3DQ0A 2P13A 5L6FA 1N5WC 3NS1B 1W1QA 1DIIA 2UUVA 3SR6B 1N62C 3AM9A 2QKNA 2E3TA 3HRDC 2NQWA 1HSKA 2PLIA 2P3HA 3EUB3 5HHZA 2GQUA 3S1DA 5I1WA 3RJ8A 3NVVB 1N60C 1W1OA 3C0PA 3W8ZA 4BC7A 1QLTA 4EC3A 4BCAA 3S1FA 4MLAA 1DIQA 1WVEA 2VAOA 4PVHA 3DEDA 4PVJA 5G5HB 2VFTA 5G5GB 3D2JA 1N5XA 3W8XA 3LLBA 3S1EA 3D2DA 4XLOA 5D79A 1W1JA 1WYGA 1N61C 4BC9A 2W3RA 1MBBA 2Y3SA 3B9JB 3FW9A 4PVKA 5HMRA 4PWBA 2OAIA 3AMZA 1UXYA 2UUUA 3TSJA 3BW7A 1VAOA 1QLUA 2YVSA 5FXFA 1SB3B 3PM9A 4PZFA 1FFVC 2W54A 5FXPA 2WDWA 3LAEA 4PYTA 3AN1A 2IPIA 3GSYA 2P4PA 3NVYB 5AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  4JB1 A;  4ML8 A;  5ADZ A;  2VFR A;  1FIQ B;  2AXR A;  2VFS A;  3NVW B;  2W3S A;  1W1M A;  2I0K A;  5FXE A;  4ZOH B;  5HQX A;  5AE2 A;  1W1S A;  2RK5 A;  3NRZ B;  4O95 A;  4OAL A;  3JS8 A;  1N63 C;  1I19 A;  1RM6 B;  2R8D A;  4JAY A;  3S1C A;  3TX1 A;  1VDV A;  2EXR A;  2O3G A;  2GQT A;  1FFU C;  3ETR B;  5AE1 A;  1FO4 A;  1MBT A;  1DZN A;  2PLS A;  1JRP A;  4BBY A;  1ZR6 A;  1AHU A;  2W55 A;  5FXD A;  1AHV A;  1WVF A;  3NVZ B;  2VFV A;  1T3Q C;  1E8F A;  2Q85 A;  3W8W A;  1E8H A;  2BVH A;  2BVF A;  1E0Y A;  3I99 A;  2Q4W A;  3KJM A;  1W1K A;  4HG0 A;  2R2Z A;  2QPM A;  1W1L A;  2BVG A;  1F0X A;  1JRO A;  1ZXI C;  1E8G A;  2VFU A;  2MBR A;  1AHZ A;  1W1R A;  3DQ0 A;  2P13 A;  1N5W C;  3NS1 B;  1W1Q A;  1DII A;  3SR6 B;  1N62 C;  3AM9 A;  2QKN A;  2E3T A;  3HRD C;  2NQW A;  1HSK A;  2PLI A;  2P3H A;  3EUB 3;  5HHZ A;  2GQU A;  3S1D A;  3NVV B;  1N60 C;  1W1O A;  3C0P A;  3W8Z A;  4BC7 A;  1QLT A;  4BCA A;  3S1F A;  4MLA A;  1DIQ A;  1WVE A;  2VAO A;  3DED A;  5G5H B;  2VFT A;  5G5G B;  1N5X A;  3W8X A;  3LLB A;  3S1E A;  4XLO A;  1W1J A;  1WYG A;  1N61 C;  4BC9 A;  2W3R A;  1MBB A;  3B9J B;  5HMR A;  2OAI A;  3AMZ A;  1UXY A;  3BW7 A;  1VAO A;  1QLU A;  2YVS A;  5FXF A;  1SB3 B;  3PM9 A;  1FFV C;  2W54 A;  5FXP A;  3LAE A;  4PYT A;  3AN1 A;  2P4P A;  3NVY B;  5AE3 A; 
#chains in the Genus database with same CATH topology
 1V97 A;  4JB1 A;  4ML8 A;  5ADZ A;  2VFR A;  1FIQ B;  2AXR A;  2VFS A;  3FWA A;  2Y4G A;  3NVW B;  2W3S A;  1W1M A;  2I0K A;  5FXE A;  3PQB A;  4UD8 A;  4ZOH B;  5AWV A;  3VTE A;  3RJA A;  1W1S A;  5AE2 A;  4PVE A;  5HQX A;  2RK5 A;  3NRZ B;  4O95 A;  4OAL A;  3TSH A;  3JS8 A;  1N63 C;  1I19 A;  1RM6 B;  2R8D A;  4JAY A;  3S1C A;  3TX1 A;  1VDV A;  2EXR A;  2O3G A;  2GQT A;  1FFU C;  3ETR B;  5AE1 A;  1FO4 A;  2Y08 A;  1MBT A;  1DZN A;  2PLS A;  1JRP A;  3D2H A;  4BBY A;  1ZR6 A;  1AHU A;  2W55 A;  5FXD A;  1AHV A;  4PWC A;  1WVF A;  3NVZ B;  5K8E A;  2VFV A;  4DNS A;  1T3Q C;  1E8F A;  2Q85 A;  3W8W A;  1E8H A;  2BVH A;  3POP A;  2BVF A;  1E0Y A;  3I99 A;  2Q4W A;  3KJM A;  1W1K A;  3HSU A;  3FW7 A;  2R2Z A;  4HG0 A;  2QPM A;  1W1L A;  2BVG A;  1F0X A;  1JRO A;  2Y3R A;  5I1V A;  1ZXI C;  1E8G A;  5L6G A;  2VFU A;  2MBR A;  3FW8 A;  1AHZ A;  1W1R A;  3DQ0 A;  2P13 A;  5L6F A;  1N5W C;  3NS1 B;  1W1Q A;  1DII A;  2UUV A;  3SR6 B;  1N62 C;  3AM9 A;  2QKN A;  2E3T A;  3HRD C;  2NQW A;  1HSK A;  2PLI A;  2P3H A;  3EUB 3;  5HHZ A;  2GQU A;  3S1D A;  5I1W A;  3RJ8 A;  3NVV B;  1N60 C;  1W1O A;  3C0P A;  3W8Z A;  4BC7 A;  1QLT A;  4EC3 A;  4BCA A;  3S1F A;  4MLA A;  1DIQ A;  1WVE A;  2VAO A;  4PVH A;  3DED A;  4PVJ A;  5G5H B;  2VFT A;  5G5G B;  3D2J A;  1N5X A;  3W8X A;  3LLB A;  3S1E A;  3D2D A;  4XLO A;  5D79 A;  1W1J A;  1WYG A;  1N61 C;  4BC9 A;  2W3R A;  1MBB A;  2Y3S A;  3B9J B;  3FW9 A;  4PVK A;  5HMR A;  4PWB A;  2OAI A;  3AMZ A;  1UXY A;  2UUU A;  3TSJ A;  3BW7 A;  1VAO A;  1QLU A;  2YVS A;  5FXF A;  1SB3 B;  3PM9 A;  4PZF A;  1FFV C;  2W54 A;  5FXP A;  2WDW A;  3LAE A;  4PYT A;  3AN1 A;  2IPI A;  3GSY A;  2P4P A;  3NVY B;  5AE3 A; 
#chains in the Genus database with same CATH homology
 1V97 A;  4JB1 A;  4ML8 A;  5ADZ A;  2VFR A;  1FIQ B;  2AXR A;  2VFS A;  3FWA A;  2Y4G A;  3NVW B;  2W3S A;  1W1M A;  2I0K A;  5FXE A;  3PQB A;  4UD8 A;  4ZOH B;  5AWV A;  3VTE A;  3RJA A;  1W1S A;  5AE2 A;  4PVE A;  5HQX A;  2RK5 A;  3NRZ B;  4O95 A;  4OAL A;  3TSH A;  3JS8 A;  1N63 C;  1I19 A;  1RM6 B;  2R8D A;  4JAY A;  3S1C A;  3TX1 A;  1VDV A;  2EXR A;  2O3G A;  2GQT A;  1FFU C;  3ETR B;  5AE1 A;  1FO4 A;  2Y08 A;  1MBT A;  1DZN A;  2PLS A;  1JRP A;  3D2H A;  4BBY A;  1ZR6 A;  1AHU A;  2W55 A;  5FXD A;  1AHV A;  4PWC A;  1WVF A;  3NVZ B;  5K8E A;  2VFV A;  4DNS A;  1T3Q C;  1E8F A;  2Q85 A;  3W8W A;  1E8H A;  2BVH A;  3POP A;  2BVF A;  1E0Y A;  3I99 A;  2Q4W A;  3KJM A;  1W1K A;  3HSU A;  3FW7 A;  2R2Z A;  4HG0 A;  2QPM A;  1W1L A;  2BVG A;  1F0X A;  1JRO A;  2Y3R A;  5I1V A;  1ZXI C;  1E8G A;  5L6G A;  2VFU A;  2MBR A;  3FW8 A;  1AHZ A;  1W1R A;  3DQ0 A;  2P13 A;  5L6F A;  1N5W C;  3NS1 B;  1W1Q A;  1DII A;  2UUV A;  3SR6 B;  1N62 C;  3AM9 A;  2QKN A;  2E3T A;  3HRD C;  2NQW A;  1HSK A;  2PLI A;  2P3H A;  3EUB 3;  5HHZ A;  2GQU A;  3S1D A;  5I1W A;  3RJ8 A;  3NVV B;  1N60 C;  1W1O A;  3C0P A;  3W8Z A;  4BC7 A;  1QLT A;  4EC3 A;  4BCA A;  3S1F A;  4MLA A;  1DIQ A;  1WVE A;  2VAO A;  4PVH A;  3DED A;  4PVJ A;  5G5H B;  2VFT A;  5G5G B;  3D2J A;  1N5X A;  3W8X A;  3LLB A;  3S1E A;  3D2D A;  4XLO A;  5D79 A;  1W1J A;  1WYG A;  1N61 C;  4BC9 A;  2W3R A;  1MBB A;  2Y3S A;  3B9J B;  3FW9 A;  4PVK A;  5HMR A;  4PWB A;  2OAI A;  3AMZ A;  1UXY A;  2UUU A;  3TSJ A;  3BW7 A;  1VAO A;  1QLU A;  2YVS A;  5FXF A;  1SB3 B;  3PM9 A;  4PZF A;  1FFV C;  2W54 A;  5FXP A;  2WDW A;  3LAE A;  4PYT A;  3AN1 A;  2IPI A;  3GSY A;  2P4P A;  3NVY B;  5AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...