2O3GA

Structural genomics, the crystal structure of a conserved putative domain from neisseria meningitidis mc58
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
ESLTVEGALEYVELAPQLNLPQQEEDADFHTVAGLIMEELQTIPDVGDFADFHGWRFEVVEKEGQRIERVKITKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a conserved putative domain from Neisseria meningitidis MC58
rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Putative protein
total genus 15
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2o3gA00
1QLTA 3S1CA 3TX1A 1W1LA 5G5HB 2GQTA 2GQUA 1W1JA 2P3HA 5HMRA 1AHVA 4BCAA 1ZR6A 2PLSA 2VFTA 3NVZB 1E8FA 1V97A 3DEDA 3LLBA 3PM9A 2W55A 3KJMA 2R8DA 3SR6B 3S1FA 1VAOA 2VFRA 1FFVC 2MBRA 4BC9A 3ETRB 3NVVB 5G5GB 4BC7A 4XLOA 3I99A 3BW7A 1UXYA 1W1QA 2BVFA 4PYTA 1N5XA 2QPMA 1E8GA 1MBTA 1WYGA 1E0YA 3NVYB 2E3TA 3C0PA 1N62C 3JS8A 3W8ZA 1WVEA 2RK5A 3AN1A 5AE3A 1FO4A 1DIIA 1FFUC 1W1MA 2QKNA 2O3GA 1QLUA 2VFSA 3W8XA 1AHZA 2I0KA 5FXFA 2VFVA 4ZOHB 5ADZA 1W1SA 1MBBA 4HG0A 4JAYA 1JROA 2Q85A 2P4PA 1E8HA 5AE1A 2BVHA 3HRDC 1DZNA 1SB3B 1I19A 5HQXA 3NRZB 1W1RA 2BVGA 3DQ0A 2AXRA 4JB1A 1RM6B 2W3RA 2NQWA 2VFUA 5FXPA 4MLAA 1N61C 3EUB3 4OALA 2Q4WA 3AMZA 5FXEA 1JRPA 1WVFA 2YVSA 2EXRA 2P13A 5HHZA 3B9JB 3AM9A 3S1DA 3NVWB 2VAOA 2PLIA 1VDVA 1ZXIC 3NS1B 1F0XA 1DIQA 1FIQB 1W1OA 1AHUA 2R2ZA 4O95A 2W54A 1W1KA 5AE2A 2W3SA 4ML8A 3W8WA 1HSKA 2OAIA 3LAEA 1N60C 1T3QC 5FXDA 1N5WC 1N63C 4BBYA 3S1EA
chains in the Genus database with same CATH superfamily
1QLTA 3S1CA 3TX1A 4PZFA 1W1LA 5G5HB 2GQTA 2GQUA 1W1JA 2P3HA 5HMRA 1AHVA 4BCAA 1ZR6A 2PLSA 2VFTA 3NVZB 1E8FA 1V97A 3DEDA 3LLBA 4DNSA 3PM9A 2W55A 4EC3A 3KJMA 2R8DA 3SR6B 3S1FA 1VAOA 2VFRA 1FFVC 2MBRA 3HSUA 3D2HA 4BC9A 3ETRB 3NVVB 5G5GB 4BC7A 4XLOA 3I99A 3BW7A 1UXYA 1W1QA 2BVFA 4PYTA 1N5XA 5I1VA 2QPMA 5AWVA 1E8GA 3D2JA 1MBTA 1WYGA 1E0YA 3NVYB 2Y08A 2E3TA 3C0PA 1N62C 3JS8A 4PVEA 3W8ZA 1WVEA 2Y4GA 2UUVA 2RK5A 3AN1A 5AE3A 1FO4A 1DIIA 1FFUC 1W1MA 2QKNA 2O3GA 1QLUA 2VFSA 2UUUA 3W8XA 1AHZA 2I0KA 5FXFA 2VFVA 4ZOHB 5ADZA 1W1SA 4PVJA 1MBBA 3FWAA 4HG0A 4JAYA 1JROA 2Q85A 5L6GA 2P4PA 1E8HA 2WDWA 5AE1A 2BVHA 4PVKA 3HRDC 1DZNA 1SB3B 1I19A 5HQXA 3NRZB 1W1RA 2BVGA 3DQ0A 2AXRA 4JB1A 1RM6B 2W3RA 2NQWA 2VFUA 5D79A 4PWCA 5FXPA 4MLAA 1N61C 3EUB3 4OALA 2Q4WA 3FW9A 3VTEA 2Y3SA 3D2DA 3AMZA 5FXEA 3TSJA 1JRPA 1WVFA 3FW8A 3POPA 2YVSA 2EXRA 2P13A 5HHZA 3GSYA 5L6FA 3B9JB 3AM9A 3S1DA 5I1WA 3NVWB 2VAOA 2PLIA 1VDVA 4PWBA 1ZXIC 3NS1B 2Y3RA 1F0XA 3FW7A 1DIQA 5K8EA 4PVHA 1FIQB 1W1OA 1AHUA 2R2ZA 4O95A 3TSHA 2W54A 3RJAA 1W1KA 5AE2A 4UD8A 2W3SA 4ML8A 3W8WA 2IPIA 1HSKA 2OAIA 3LAEA 1N60C 1T3QC 5FXDA 1N5WC 3RJ8A 1N63C 4BBYA 3S1EA 3PQBA
chains in the Genus database with same CATH topology
1QLTA 3S1CA 3TX1A 4PZFA 1W1LA 5G5HB 2GQTA 2GQUA 1W1JA 2P3HA 5HMRA 1AHVA 4BCAA 1ZR6A 2PLSA 2VFTA 3NVZB 1E8FA 1V97A 3DEDA 3LLBA 4DNSA 3PM9A 2W55A 4EC3A 3KJMA 2R8DA 3SR6B 3S1FA 1VAOA 2VFRA 1FFVC 2MBRA 3HSUA 3D2HA 4BC9A 3ETRB 3NVVB 5G5GB 4BC7A 4XLOA 3I99A 3BW7A 1UXYA 1W1QA 2BVFA 4PYTA 1N5XA 5I1VA 2QPMA 5AWVA 1E8GA 3D2JA 1MBTA 1WYGA 1E0YA 3NVYB 2Y08A 2E3TA 3C0PA 1N62C 3JS8A 4PVEA 3W8ZA 1WVEA 2Y4GA 2UUVA 2RK5A 3AN1A 5AE3A 1FO4A 1DIIA 1FFUC 1W1MA 2QKNA 2O3GA 1QLUA 2VFSA 2UUUA 3W8XA 1AHZA 2I0KA 5FXFA 2VFVA 4ZOHB 5ADZA 1W1SA 4PVJA 1MBBA 3FWAA 4HG0A 4JAYA 1JROA 2Q85A 5L6GA 2P4PA 1E8HA 2WDWA 5AE1A 2BVHA 4PVKA 3HRDC 1DZNA 1SB3B 1I19A 5HQXA 3NRZB 1W1RA 2BVGA 3DQ0A 2AXRA 4JB1A 1RM6B 2W3RA 2NQWA 2VFUA 5D79A 4PWCA 5FXPA 4MLAA 1N61C 3EUB3 4OALA 2Q4WA 3FW9A 3VTEA 2Y3SA 3D2DA 3AMZA 5FXEA 3TSJA 1JRPA 1WVFA 3FW8A 3POPA 2YVSA 2EXRA 2P13A 5HHZA 3GSYA 5L6FA 3B9JB 3AM9A 3S1DA 5I1WA 3NVWB 2VAOA 2PLIA 1VDVA 4PWBA 1ZXIC 3NS1B 2Y3RA 1F0XA 3FW7A 1DIQA 5K8EA 4PVHA 1FIQB 1W1OA 1AHUA 2R2ZA 4O95A 3TSHA 2W54A 3RJAA 1W1KA 5AE2A 4UD8A 2W3SA 4ML8A 3W8WA 2IPIA 1HSKA 2OAIA 3LAEA 1N60C 1T3QC 5FXDA 1N5WC 3RJ8A 1N63C 4BBYA 3S1EA 3PQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLT A;  3S1C A;  3TX1 A;  1W1L A;  5G5H B;  2GQT A;  2GQU A;  1W1J A;  2P3H A;  5HMR A;  1AHV A;  4BCA A;  1ZR6 A;  2PLS A;  2VFT A;  3NVZ B;  1E8F A;  1V97 A;  3DED A;  3LLB A;  3PM9 A;  2W55 A;  3KJM A;  2R8D A;  3SR6 B;  3S1F A;  1VAO A;  2VFR A;  1FFV C;  2MBR A;  4BC9 A;  3ETR B;  3NVV B;  5G5G B;  4BC7 A;  4XLO A;  3I99 A;  3BW7 A;  1UXY A;  1W1Q A;  2BVF A;  4PYT A;  1N5X A;  2QPM A;  1E8G A;  1MBT A;  1WYG A;  1E0Y A;  3NVY B;  2E3T A;  3C0P A;  1N62 C;  3JS8 A;  3W8Z A;  1WVE A;  2RK5 A;  3AN1 A;  5AE3 A;  1FO4 A;  1DII A;  1FFU C;  1W1M A;  2QKN A;  2O3G A;  1QLU A;  2VFS A;  3W8X A;  1AHZ A;  2I0K A;  5FXF A;  2VFV A;  4ZOH B;  5ADZ A;  1W1S A;  1MBB A;  4HG0 A;  4JAY A;  1JRO A;  2Q85 A;  2P4P A;  1E8H A;  5AE1 A;  2BVH A;  3HRD C;  1DZN A;  1SB3 B;  1I19 A;  5HQX A;  3NRZ B;  1W1R A;  2BVG A;  3DQ0 A;  2AXR A;  4JB1 A;  1RM6 B;  2W3R A;  2NQW A;  2VFU A;  5FXP A;  4MLA A;  1N61 C;  3EUB 3;  4OAL A;  2Q4W A;  3AMZ A;  5FXE A;  1JRP A;  1WVF A;  2YVS A;  2EXR A;  2P13 A;  5HHZ A;  3B9J B;  3AM9 A;  3S1D A;  3NVW B;  2VAO A;  2PLI A;  1VDV A;  1ZXI C;  3NS1 B;  1F0X A;  1DIQ A;  1FIQ B;  1W1O A;  1AHU A;  2R2Z A;  4O95 A;  2W54 A;  1W1K A;  5AE2 A;  2W3S A;  4ML8 A;  3W8W A;  1HSK A;  2OAI A;  3LAE A;  1N60 C;  1T3Q C;  5FXD A;  1N5W C;  1N63 C;  4BBY A;  3S1E A; 
#chains in the Genus database with same CATH topology
 1QLT A;  3S1C A;  3TX1 A;  4PZF A;  1W1L A;  5G5H B;  2GQT A;  2GQU A;  1W1J A;  2P3H A;  5HMR A;  1AHV A;  4BCA A;  1ZR6 A;  2PLS A;  2VFT A;  3NVZ B;  1E8F A;  1V97 A;  3DED A;  3LLB A;  4DNS A;  3PM9 A;  2W55 A;  4EC3 A;  3KJM A;  2R8D A;  3SR6 B;  3S1F A;  1VAO A;  2VFR A;  1FFV C;  2MBR A;  3HSU A;  3D2H A;  4BC9 A;  3ETR B;  3NVV B;  5G5G B;  4BC7 A;  4XLO A;  3I99 A;  3BW7 A;  1UXY A;  1W1Q A;  2BVF A;  4PYT A;  1N5X A;  5I1V A;  2QPM A;  5AWV A;  1E8G A;  3D2J A;  1MBT A;  1WYG A;  1E0Y A;  3NVY B;  2Y08 A;  2E3T A;  3C0P A;  1N62 C;  3JS8 A;  4PVE A;  3W8Z A;  1WVE A;  2Y4G A;  2UUV A;  2RK5 A;  3AN1 A;  5AE3 A;  1FO4 A;  1DII A;  1FFU C;  1W1M A;  2QKN A;  2O3G A;  1QLU A;  2VFS A;  2UUU A;  3W8X A;  1AHZ A;  2I0K A;  5FXF A;  2VFV A;  4ZOH B;  5ADZ A;  1W1S A;  4PVJ A;  1MBB A;  3FWA A;  4HG0 A;  4JAY A;  1JRO A;  2Q85 A;  5L6G A;  2P4P A;  1E8H A;  2WDW A;  5AE1 A;  2BVH A;  4PVK A;  3HRD C;  1DZN A;  1SB3 B;  1I19 A;  5HQX A;  3NRZ B;  1W1R A;  2BVG A;  3DQ0 A;  2AXR A;  4JB1 A;  1RM6 B;  2W3R A;  2NQW A;  2VFU A;  5D79 A;  4PWC A;  5FXP A;  4MLA A;  1N61 C;  3EUB 3;  4OAL A;  2Q4W A;  3FW9 A;  3VTE A;  2Y3S A;  3D2D A;  3AMZ A;  5FXE A;  3TSJ A;  1JRP A;  1WVF A;  3FW8 A;  3POP A;  2YVS A;  2EXR A;  2P13 A;  5HHZ A;  3GSY A;  5L6F A;  3B9J B;  3AM9 A;  3S1D A;  5I1W A;  3NVW B;  2VAO A;  2PLI A;  1VDV A;  4PWB A;  1ZXI C;  3NS1 B;  2Y3R A;  1F0X A;  3FW7 A;  1DIQ A;  5K8E A;  4PVH A;  1FIQ B;  1W1O A;  1AHU A;  2R2Z A;  4O95 A;  3TSH A;  2W54 A;  3RJA A;  1W1K A;  5AE2 A;  4UD8 A;  2W3S A;  4ML8 A;  3W8W A;  2IPI A;  1HSK A;  2OAI A;  3LAE A;  1N60 C;  1T3Q C;  5FXD A;  1N5W C;  3RJ8 A;  1N63 C;  4BBY A;  3S1E A;  3PQB A; 
#chains in the Genus database with same CATH homology
 1QLT A;  3S1C A;  3TX1 A;  4PZF A;  1W1L A;  5G5H B;  2GQT A;  2GQU A;  1W1J A;  2P3H A;  5HMR A;  1AHV A;  4BCA A;  1ZR6 A;  2PLS A;  2VFT A;  3NVZ B;  1E8F A;  1V97 A;  3DED A;  3LLB A;  4DNS A;  3PM9 A;  2W55 A;  4EC3 A;  3KJM A;  2R8D A;  3SR6 B;  3S1F A;  1VAO A;  2VFR A;  1FFV C;  2MBR A;  3HSU A;  3D2H A;  4BC9 A;  3ETR B;  3NVV B;  5G5G B;  4BC7 A;  4XLO A;  3I99 A;  3BW7 A;  1UXY A;  1W1Q A;  2BVF A;  4PYT A;  1N5X A;  5I1V A;  2QPM A;  5AWV A;  1E8G A;  3D2J A;  1MBT A;  1WYG A;  1E0Y A;  3NVY B;  2Y08 A;  2E3T A;  3C0P A;  1N62 C;  3JS8 A;  4PVE A;  3W8Z A;  1WVE A;  2Y4G A;  2UUV A;  2RK5 A;  3AN1 A;  5AE3 A;  1FO4 A;  1DII A;  1FFU C;  1W1M A;  2QKN A;  2O3G A;  1QLU A;  2VFS A;  2UUU A;  3W8X A;  1AHZ A;  2I0K A;  5FXF A;  2VFV A;  4ZOH B;  5ADZ A;  1W1S A;  4PVJ A;  1MBB A;  3FWA A;  4HG0 A;  4JAY A;  1JRO A;  2Q85 A;  5L6G A;  2P4P A;  1E8H A;  2WDW A;  5AE1 A;  2BVH A;  4PVK A;  3HRD C;  1DZN A;  1SB3 B;  1I19 A;  5HQX A;  3NRZ B;  1W1R A;  2BVG A;  3DQ0 A;  2AXR A;  4JB1 A;  1RM6 B;  2W3R A;  2NQW A;  2VFU A;  5D79 A;  4PWC A;  5FXP A;  4MLA A;  1N61 C;  3EUB 3;  4OAL A;  2Q4W A;  3FW9 A;  3VTE A;  2Y3S A;  3D2D A;  3AMZ A;  5FXE A;  3TSJ A;  1JRP A;  1WVF A;  3FW8 A;  3POP A;  2YVS A;  2EXR A;  2P13 A;  5HHZ A;  3GSY A;  5L6F A;  3B9J B;  3AM9 A;  3S1D A;  5I1W A;  3NVW B;  2VAO A;  2PLI A;  1VDV A;  4PWB A;  1ZXI C;  3NS1 B;  2Y3R A;  1F0X A;  3FW7 A;  1DIQ A;  5K8E A;  4PVH A;  1FIQ B;  1W1O A;  1AHU A;  2R2Z A;  4O95 A;  3TSH A;  2W54 A;  3RJA A;  1W1K A;  5AE2 A;  4UD8 A;  2W3S A;  4ML8 A;  3W8W A;  2IPI A;  1HSK A;  2OAI A;  3LAE A;  1N60 C;  1T3Q C;  5FXD A;  1N5W C;  3RJ8 A;  1N63 C;  4BBY A;  3S1E A;  3PQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...