3I99A

The crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
340
structure length
340
Chain Sequence
b'TTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 90
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3i99A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3i99A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3i99A03
4BC7A 1W1JA 1W1OA 1MBBA 1WVFA 3AN1A 2NQWA 2VFSA 2I0KA 5D79A 4PVKA 1I19A 3TSJA 3S1EA 2W54A 2VFRA 3SR6B 2W55A 3W8ZA 1N61C 3W8WA 1AHUA 2VFVA 2W3RA 3S1DA 5FXDA 4JB1A 3NVVB 1E0YA 1V97A 1N62C 1WVEA 2P3HA 5AE3A 1AHVA 2AXRA 4ML8A 5G5HB 2P13A 1DIIA 2E3TA 2BVFA 4DNSA 2VAOA 3FW8A 3EUB3 2EXRA 3AM9A 3FW9A 2R8DA 1FFVC 3PM9A 3NS1B 1E8FA 2W3SA 5ADZA 4PYTA 1HSKA 3FW7A 2QKNA 1N5XA 3HRDC 3BW7A 5FXFA 1N63C 2YVSA 4JAYA 1ZXIC 3TSHA 3ETRB 4PVJA 3LLBA 2PLIA 1W1LA 3AMZA 4MLAA 1SB3B 2BVHA 4ZOHB 3S1FA 4PWCA 2PLSA 1VAOA 3DQ0A 1FFUC 2RK5A 1QLUA 3DEDA 5AE1A 2VFTA 1N5WC 4BCAA 5HHZA 1QLTA 3D2DA 5HQXA 4PZFA 1DIQA 1UXYA 3KJMA 4PWBA 3NVYB 1FO4A 4BC9A 4EC3A 4PVEA 1JROA 1W1KA 3FWAA 3W8XA 3LAEA 3NVWB 3VTEA 4XLOA 1W1SA 1N60C 1MBTA 5FXPA 2R2ZA 5AE2A 1AHZA 1WYGA 1F0XA 3C0PA 5HMRA 2P4PA 2BVGA 3NRZB 2GQTA 1W1QA 3JS8A 3TX1A 1W1MA 2MBRA 4PVHA 3I99A 2Q4WA 3D2HA 2VFUA 1W1RA 3GSYA 3S1CA 4O95A 3NVZB 1RM6B 5FXEA 2QPMA 1JRPA 1ZR6A 4OALA 5G5GB 2Q85A 4BBYA 3D2JA 4UD8A 2O3GA 2OAIA 1E8HA 1E8GA 4HG0A 3B9JB 1FIQB 2GQUA 1T3QC 1VDVA 1DZNA
chains in the Genus database with same CATH superfamily
4BC7A 1W1JA 2Y3RA 1W1OA 1MBBA 1WVFA 3AN1A 2NQWA 2Y3SA 2VFSA 2I0KA 5D79A 4PVKA 1I19A 3TSJA 3S1EA 5K8EA 2W54A 2WDWA 2VFRA 2UUVA 3SR6B 2W55A 3W8ZA 1N61C 3W8WA 1AHUA 2VFVA 5I1VA 2W3RA 3S1DA 5FXDA 4JB1A 3NVVB 1E0YA 1V97A 1N62C 1WVEA 2P3HA 5AE3A 1AHVA 2AXRA 4ML8A 5G5HB 2P13A 1DIIA 2E3TA 2BVFA 4DNSA 2Y08A 2VAOA 3FW8A 3EUB3 2EXRA 3AM9A 3FW9A 2R8DA 1FFVC 3PM9A 3NS1B 1E8FA 3EJEB 2IPIA 2W3SA 5ADZA 4PYTA 1HSKA 3FW7A 2QKNA 1N5XA 3HRDC 3BW7A 5AWVA 5FXFA 1N63C 2YVSA 4JAYA 1ZXIC 3TSHA 3ETRB 4PVJA 3LLBA 2PLIA 1W1LA 3AMZA 4MLAA 1SB3B 2BVHA 4ZOHB 3S1FA 4PWCA 2PLSA 1VAOA 3DQ0A 3EJDB 1FFUC 3RJ8A 2RK5A 1QLUA 3DEDA 5AE1A 3RJAA 3HSUA 2VFTA 1N5WC 4BCAA 5HHZA 1QLTA 3EJBB 2UUUA 3D2DA 5HQXA 4PZFA 1DIQA 1UXYA 3KJMA 4PWBA 3NVYB 1FO4A 4BC9A 4EC3A 4PVEA 1JROA 1W1KA 3FWAA 3W8XA 3LAEA 3NVWB 3VTEA 4XLOA 1W1SA 1N60C 1MBTA 5FXPA 2R2ZA 5AE2A 1AHZA 1WYGA 1F0XA 3C0PA 3PQBA 5HMRA 2P4PA 2BVGA 3NRZB 2GQTA 1W1QA 3JS8A 3TX1A 1W1MA 2MBRA 4PVHA 3POPA 3I99A 2Q4WA 3D2HA 5I1WA 2VFUA 1W1RA 3GSYA 3S1CA 2Y4GA 4O95A 3NVZB 1RM6B 5FXEA 2QPMA 1JRPA 1ZR6A 4OALA 5G5GB 2Q85A 5L6FA 5L6GA 4BBYA 3D2JA 4UD8A 2O3GA 2OAIA 1E8HA 1E8GA 4HG0A 3B9JB 1FIQB 2GQUA 1T3QC 1VDVA 1DZNA
chains in the Genus database with same CATH topology
4BC7A 1W1JA 2Y3RA 1W1OA 1MBBA 1WVFA 3AN1A 2NQWA 2Y3SA 2VFSA 2I0KA 5D79A 4PVKA 1I19A 3TSJA 3S1EA 5K8EA 2W54A 2WDWA 2VFRA 2UUVA 3SR6B 2W55A 3W8ZA 1N61C 3W8WA 1AHUA 2VFVA 5I1VA 2W3RA 3S1DA 5FXDA 4JB1A 3NVVB 1E0YA 1V97A 1N62C 1WVEA 2P3HA 5AE3A 1AHVA 2AXRA 4ML8A 5G5HB 2P13A 1DIIA 2E3TA 2BVFA 4DNSA 2Y08A 2VAOA 3FW8A 3EUB3 2EXRA 3AM9A 3FW9A 2R8DA 1FFVC 3PM9A 3NS1B 1E8FA 2IPIA 2W3SA 5ADZA 4PYTA 1HSKA 3FW7A 2QKNA 1N5XA 3HRDC 3BW7A 5AWVA 5FXFA 1N63C 2YVSA 4JAYA 1ZXIC 3TSHA 3ETRB 4PVJA 3LLBA 2PLIA 1W1LA 3AMZA 4MLAA 1SB3B 2BVHA 4ZOHB 3S1FA 4PWCA 2PLSA 1VAOA 3DQ0A 1FFUC 3RJ8A 2RK5A 1QLUA 3DEDA 5AE1A 3RJAA 3HSUA 2VFTA 1N5WC 4BCAA 5HHZA 1QLTA 2UUUA 3D2DA 5HQXA 4PZFA 1DIQA 1UXYA 3KJMA 4PWBA 3NVYB 1FO4A 4BC9A 4EC3A 4PVEA 1JROA 1W1KA 3FWAA 3W8XA 3LAEA 3NVWB 3VTEA 4XLOA 1W1SA 1N60C 1MBTA 5FXPA 2R2ZA 5AE2A 1AHZA 1WYGA 1F0XA 3C0PA 3PQBA 5HMRA 2P4PA 2BVGA 3NRZB 2GQTA 1W1QA 3JS8A 3TX1A 1W1MA 2MBRA 4PVHA 3POPA 3I99A 2Q4WA 3D2HA 5I1WA 2VFUA 1W1RA 3GSYA 3S1CA 2Y4GA 4O95A 3NVZB 1RM6B 5FXEA 2QPMA 1JRPA 1ZR6A 4OALA 5G5GB 2Q85A 5L6FA 5L6GA 4BBYA 3D2JA 4UD8A 2O3GA 2OAIA 1E8HA 1E8GA 4HG0A 3B9JB 1FIQB 2GQUA 1T3QC 1VDVA 1DZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BC7 A;  1W1J A;  1W1O A;  1MBB A;  1WVF A;  3AN1 A;  2NQW A;  2VFS A;  2I0K A;  5D79 A;  4PVK A;  1I19 A;  3TSJ A;  3S1E A;  2W54 A;  2VFR A;  3SR6 B;  2W55 A;  3W8Z A;  1N61 C;  3W8W A;  1AHU A;  2VFV A;  2W3R A;  3S1D A;  5FXD A;  4JB1 A;  3NVV B;  1E0Y A;  1V97 A;  1N62 C;  1WVE A;  2P3H A;  5AE3 A;  1AHV A;  2AXR A;  4ML8 A;  5G5H B;  2P13 A;  1DII A;  2E3T A;  2BVF A;  4DNS A;  2VAO A;  3FW8 A;  3EUB 3;  2EXR A;  3AM9 A;  3FW9 A;  2R8D A;  1FFV C;  3PM9 A;  3NS1 B;  1E8F A;  2W3S A;  5ADZ A;  4PYT A;  1HSK A;  3FW7 A;  2QKN A;  1N5X A;  3HRD C;  3BW7 A;  5FXF A;  1N63 C;  2YVS A;  4JAY A;  1ZXI C;  3TSH A;  3ETR B;  4PVJ A;  3LLB A;  2PLI A;  1W1L A;  3AMZ A;  4MLA A;  1SB3 B;  2BVH A;  4ZOH B;  3S1F A;  4PWC A;  2PLS A;  1VAO A;  3DQ0 A;  1FFU C;  2RK5 A;  1QLU A;  3DED A;  5AE1 A;  2VFT A;  1N5W C;  4BCA A;  5HHZ A;  1QLT A;  3D2D A;  5HQX A;  4PZF A;  1DIQ A;  1UXY A;  3KJM A;  4PWB A;  3NVY B;  1FO4 A;  4BC9 A;  4EC3 A;  4PVE A;  1JRO A;  1W1K A;  3FWA A;  3W8X A;  3LAE A;  3NVW B;  3VTE A;  4XLO A;  1W1S A;  1N60 C;  1MBT A;  5FXP A;  2R2Z A;  5AE2 A;  1AHZ A;  1WYG A;  1F0X A;  3C0P A;  5HMR A;  2P4P A;  2BVG A;  3NRZ B;  2GQT A;  1W1Q A;  3JS8 A;  3TX1 A;  1W1M A;  2MBR A;  4PVH A;  3I99 A;  2Q4W A;  3D2H A;  2VFU A;  1W1R A;  3GSY A;  3S1C A;  4O95 A;  3NVZ B;  1RM6 B;  5FXE A;  2QPM A;  1JRP A;  1ZR6 A;  4OAL A;  5G5G B;  2Q85 A;  4BBY A;  3D2J A;  4UD8 A;  2O3G A;  2OAI A;  1E8H A;  1E8G A;  4HG0 A;  3B9J B;  1FIQ B;  2GQU A;  1T3Q C;  1VDV A;  1DZN A; 
#chains in the Genus database with same CATH topology
 4BC7 A;  1W1J A;  2Y3R A;  1W1O A;  1MBB A;  1WVF A;  3AN1 A;  2NQW A;  2Y3S A;  2VFS A;  2I0K A;  5D79 A;  4PVK A;  1I19 A;  3TSJ A;  3S1E A;  5K8E A;  2W54 A;  2WDW A;  2VFR A;  2UUV A;  3SR6 B;  2W55 A;  3W8Z A;  1N61 C;  3W8W A;  1AHU A;  2VFV A;  5I1V A;  2W3R A;  3S1D A;  5FXD A;  4JB1 A;  3NVV B;  1E0Y A;  1V97 A;  1N62 C;  1WVE A;  2P3H A;  5AE3 A;  1AHV A;  2AXR A;  4ML8 A;  5G5H B;  2P13 A;  1DII A;  2E3T A;  2BVF A;  4DNS A;  2Y08 A;  2VAO A;  3FW8 A;  3EUB 3;  2EXR A;  3AM9 A;  3FW9 A;  2R8D A;  1FFV C;  3PM9 A;  3NS1 B;  1E8F A;  3EJE B;  2IPI A;  2W3S A;  5ADZ A;  4PYT A;  1HSK A;  3FW7 A;  2QKN A;  1N5X A;  3HRD C;  3BW7 A;  5AWV A;  5FXF A;  1N63 C;  2YVS A;  4JAY A;  1ZXI C;  3TSH A;  3ETR B;  4PVJ A;  3LLB A;  2PLI A;  1W1L A;  3AMZ A;  4MLA A;  1SB3 B;  2BVH A;  4ZOH B;  3S1F A;  4PWC A;  2PLS A;  1VAO A;  3DQ0 A;  3EJD B;  1FFU C;  3RJ8 A;  2RK5 A;  1QLU A;  3DED A;  5AE1 A;  3RJA A;  3HSU A;  2VFT A;  1N5W C;  4BCA A;  5HHZ A;  1QLT A;  3EJB B;  2UUU A;  3D2D A;  5HQX A;  4PZF A;  1DIQ A;  1UXY A;  3KJM A;  4PWB A;  3NVY B;  1FO4 A;  4BC9 A;  4EC3 A;  4PVE A;  1JRO A;  1W1K A;  3FWA A;  3W8X A;  3LAE A;  3NVW B;  3VTE A;  4XLO A;  1W1S A;  1N60 C;  1MBT A;  5FXP A;  2R2Z A;  5AE2 A;  1AHZ A;  1WYG A;  1F0X A;  3C0P A;  3PQB A;  5HMR A;  2P4P A;  2BVG A;  3NRZ B;  2GQT A;  1W1Q A;  3JS8 A;  3TX1 A;  1W1M A;  2MBR A;  4PVH A;  3POP A;  3I99 A;  2Q4W A;  3D2H A;  5I1W A;  2VFU A;  1W1R A;  3GSY A;  3S1C A;  2Y4G A;  4O95 A;  3NVZ B;  1RM6 B;  5FXE A;  2QPM A;  1JRP A;  1ZR6 A;  4OAL A;  5G5G B;  2Q85 A;  5L6F A;  5L6G A;  4BBY A;  3D2J A;  4UD8 A;  2O3G A;  2OAI A;  1E8H A;  1E8G A;  4HG0 A;  3B9J B;  1FIQ B;  2GQU A;  1T3Q C;  1VDV A;  1DZN A; 
#chains in the Genus database with same CATH homology
 4BC7 A;  1W1J A;  2Y3R A;  1W1O A;  1MBB A;  1WVF A;  3AN1 A;  2NQW A;  2Y3S A;  2VFS A;  2I0K A;  5D79 A;  4PVK A;  1I19 A;  3TSJ A;  3S1E A;  5K8E A;  2W54 A;  2WDW A;  2VFR A;  2UUV A;  3SR6 B;  2W55 A;  3W8Z A;  1N61 C;  3W8W A;  1AHU A;  2VFV A;  5I1V A;  2W3R A;  3S1D A;  5FXD A;  4JB1 A;  3NVV B;  1E0Y A;  1V97 A;  1N62 C;  1WVE A;  2P3H A;  5AE3 A;  1AHV A;  2AXR A;  4ML8 A;  5G5H B;  2P13 A;  1DII A;  2E3T A;  2BVF A;  4DNS A;  2Y08 A;  2VAO A;  3FW8 A;  3EUB 3;  2EXR A;  3AM9 A;  3FW9 A;  2R8D A;  1FFV C;  3PM9 A;  3NS1 B;  1E8F A;  2IPI A;  2W3S A;  5ADZ A;  4PYT A;  1HSK A;  3FW7 A;  2QKN A;  1N5X A;  3HRD C;  3BW7 A;  5AWV A;  5FXF A;  1N63 C;  2YVS A;  4JAY A;  1ZXI C;  3TSH A;  3ETR B;  4PVJ A;  3LLB A;  2PLI A;  1W1L A;  3AMZ A;  4MLA A;  1SB3 B;  2BVH A;  4ZOH B;  3S1F A;  4PWC A;  2PLS A;  1VAO A;  3DQ0 A;  1FFU C;  3RJ8 A;  2RK5 A;  1QLU A;  3DED A;  5AE1 A;  3RJA A;  3HSU A;  2VFT A;  1N5W C;  4BCA A;  5HHZ A;  1QLT A;  2UUU A;  3D2D A;  5HQX A;  4PZF A;  1DIQ A;  1UXY A;  3KJM A;  4PWB A;  3NVY B;  1FO4 A;  4BC9 A;  4EC3 A;  4PVE A;  1JRO A;  1W1K A;  3FWA A;  3W8X A;  3LAE A;  3NVW B;  3VTE A;  4XLO A;  1W1S A;  1N60 C;  1MBT A;  5FXP A;  2R2Z A;  5AE2 A;  1AHZ A;  1WYG A;  1F0X A;  3C0P A;  3PQB A;  5HMR A;  2P4P A;  2BVG A;  3NRZ B;  2GQT A;  1W1Q A;  3JS8 A;  3TX1 A;  1W1M A;  2MBR A;  4PVH A;  3POP A;  3I99 A;  2Q4W A;  3D2H A;  5I1W A;  2VFU A;  1W1R A;  3GSY A;  3S1C A;  2Y4G A;  4O95 A;  3NVZ B;  1RM6 B;  5FXE A;  2QPM A;  1JRP A;  1ZR6 A;  4OAL A;  5G5G B;  2Q85 A;  5L6F A;  5L6G A;  4BBY A;  3D2J A;  4UD8 A;  2O3G A;  2OAI A;  1E8H A;  1E8G A;  4HG0 A;  3B9J B;  1FIQ B;  2GQU A;  1T3Q C;  1VDV A;  1DZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...