3I99A

The crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
340
structure length
340
Chain Sequence
b'TTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
molecule tags Oxidoreductase
source organism Vibrio cholerae
publication title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor
rcsb
total genus 90
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3i99A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3i99A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3i99A03
1W1RA 1W1MA 2MBRA 1UXYA 2RK5A 5HHZA 2E3TA 3NVYB 5HQXA 2P3HA 3TX1A 2PLIA 1W1SA 3NVWB 1QLUA 3S1CA 3D2DA 3FW7A 3S1FA 3HRDC 4OALA 4PWCA 2VAOA 1N63C 4ML8A 2NQWA 3NVVB 3W8WA 4HG0A 1N61C 3D2HA 4EC3A 5HMRA 4PWBA 1VDVA 1W1KA 5FXDA 2O3GA 1FIQB 2I0KA 2BVFA 3VTEA 2P13A 2GQUA 4PVKA 1W1JA 1FO4A 3FWAA 3BW7A 3JS8A 1I19A 3TSHA 3NRZB 5AE3A 1FFUC 4BC7A 1N60C 4O95A 1WYGA 2VFTA 2AXRA 1V97A 1HSKA 1FFVC 3GSYA 1N5WC 3PM9A 5FXFA 1N5XA 3AMZA 2QPMA 4BCAA 1RM6B 4BC9A 3LAEA 2EXRA 3AM9A 2W54A 1JRPA 2R2ZA 3W8XA 5G5HB 1VAOA 4XLOA 4PVJA 3C0PA 1W1LA 2YVSA 3B9JB 1DIIA 1JROA 4UD8A 2R8DA 3S1DA 1AHVA 1ZXIC 1W1QA 2BVGA 2VFUA 1AHZA 3DEDA 1ZR6A 1DIQA 5FXEA 2OAIA 1AHUA 4DNSA 4MLAA 1W1OA 1N62C 3FW9A 2PLSA 1MBBA 5G5GB 1SB3B 4PVHA 2W3SA 1MBTA 2VFVA 3DQ0A 2W3RA 3LLBA 4PYTA 1E8FA 1T3QC 3AN1A 5AE1A 3ETRB 3W8ZA 2VFRA 3I99A 4ZOHB 5ADZA 3FW8A 2VFSA 2GQTA 5D79A 5AE2A 4JB1A 3D2JA 3KJMA 3NS1B 4PZFA 2P4PA 1E8HA 2Q85A 2BVHA 3S1EA 4PVEA 2W55A 1WVEA 1DZNA 2Q4WA 1E0YA 4JAYA 4BBYA 1F0XA 1WVFA 5FXPA 3NVZB 3EUB3 1E8GA 1QLTA 2QKNA 3SR6B 3TSJA
chains in the Genus database with same CATH superfamily
1W1RA 1W1MA 2MBRA 1UXYA 2RK5A 5HHZA 3RJAA 2E3TA 3NVYB 5HQXA 2P3HA 3TX1A 3NVWB 1W1SA 2PLIA 3EJDB 2Y4GA 1QLUA 3S1CA 3D2DA 3FW7A 3S1FA 3HRDC 5L6GA 4OALA 4PWCA 2VAOA 1N63C 4ML8A 3NVVB 2NQWA 3W8WA 4HG0A 1N61C 3D2HA 4EC3A 5HMRA 4PWBA 1VDVA 1W1KA 5FXDA 2O3GA 1FIQB 2I0KA 2BVFA 3VTEA 2P13A 2GQUA 4PVKA 1W1JA 1FO4A 3FWAA 3BW7A 3JS8A 1I19A 3EJEB 3TSHA 3NRZB 2WDWA 5AE3A 1FFUC 4BC7A 1N60C 5AWVA 4O95A 1WYGA 2VFTA 2AXRA 2IPIA 1V97A 3RJ8A 1HSKA 1FFVC 3GSYA 1N5WC 3PM9A 5FXFA 2UUUA 1N5XA 2Y3SA 3AMZA 2QPMA 4BCAA 1RM6B 4BC9A 3LAEA 3POPA 2EXRA 3AM9A 2W54A 1JRPA 2R2ZA 3W8XA 5G5HB 1VAOA 4XLOA 4PVJA 3C0PA 1W1LA 2YVSA 3B9JB 1DIIA 1JROA 4UD8A 2R8DA 3S1DA 1AHVA 1ZXIC 1W1QA 2BVGA 2VFUA 5K8EA 1AHZA 3DEDA 1ZR6A 1DIQA 5FXEA 2OAIA 1AHUA 5I1VA 4DNSA 4MLAA 2Y08A 1W1OA 1N62C 3FW9A 2PLSA 1MBBA 2Y3RA 3PQBA 5G5GB 1SB3B 4PVHA 2W3SA 2UUVA 1MBTA 2VFVA 3DQ0A 2W3RA 3LLBA 4PYTA 1E8FA 1T3QC 3AN1A 5AE1A 3ETRB 3W8ZA 2VFRA 3I99A 4ZOHB 3HSUA 5ADZA 3FW8A 2VFSA 2GQTA 3EJBB 5D79A 5AE2A 4JB1A 3D2JA 3KJMA 3NS1B 4PZFA 2P4PA 5I1WA 1E8HA 2Q85A 2BVHA 3S1EA 5L6FA 4PVEA 2W55A 1WVEA 1DZNA 2Q4WA 1E0YA 4JAYA 4BBYA 1F0XA 1WVFA 5FXPA 3NVZB 3EUB3 1E8GA 1QLTA 2QKNA 3SR6B 3TSJA
chains in the Genus database with same CATH topology
1W1RA 1W1MA 2MBRA 1UXYA 2RK5A 5HHZA 3RJAA 2E3TA 3NVYB 5HQXA 2P3HA 3TX1A 2PLIA 1W1SA 3NVWB 2Y4GA 1QLUA 3S1CA 3D2DA 3FW7A 3S1FA 3HRDC 5L6GA 4OALA 4PWCA 2VAOA 1N63C 4ML8A 2NQWA 3NVVB 3W8WA 4HG0A 1N61C 3D2HA 4EC3A 5HMRA 4PWBA 1VDVA 1W1KA 5FXDA 2O3GA 1FIQB 2I0KA 2BVFA 3VTEA 2P13A 2GQUA 4PVKA 1W1JA 1FO4A 3FWAA 3BW7A 3JS8A 1I19A 3TSHA 3NRZB 2WDWA 5AE3A 1FFUC 4BC7A 1N60C 5AWVA 4O95A 1WYGA 2VFTA 2AXRA 2IPIA 1V97A 3RJ8A 1HSKA 1FFVC 3GSYA 1N5WC 3PM9A 5FXFA 2UUUA 1N5XA 2Y3SA 3AMZA 2QPMA 4BCAA 1RM6B 4BC9A 3LAEA 3POPA 2EXRA 3AM9A 2W54A 1JRPA 2R2ZA 3W8XA 5G5HB 1VAOA 4XLOA 4PVJA 3C0PA 1W1LA 2YVSA 3B9JB 1DIIA 1JROA 4UD8A 2R8DA 3S1DA 1AHVA 1ZXIC 1W1QA 2BVGA 2VFUA 5K8EA 1AHZA 3DEDA 1ZR6A 1DIQA 5FXEA 2OAIA 1AHUA 5I1VA 4DNSA 4MLAA 2Y08A 1W1OA 1N62C 3FW9A 2PLSA 1MBBA 2Y3RA 3PQBA 5G5GB 1SB3B 4PVHA 2W3SA 2UUVA 1MBTA 2VFVA 3DQ0A 2W3RA 3LLBA 4PYTA 1E8FA 1T3QC 3AN1A 5AE1A 3ETRB 3W8ZA 2VFRA 3I99A 4ZOHB 3HSUA 5ADZA 3FW8A 2VFSA 2GQTA 5D79A 5AE2A 4JB1A 3D2JA 3KJMA 3NS1B 4PZFA 2P4PA 5I1WA 1E8HA 2Q85A 2BVHA 3S1EA 5L6FA 4PVEA 2W55A 1WVEA 1DZNA 2Q4WA 1E0YA 4JAYA 4BBYA 1F0XA 1WVFA 5FXPA 3NVZB 3EUB3 1E8GA 1QLTA 2QKNA 3SR6B 3TSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1R A;  1W1M A;  2MBR A;  1UXY A;  2RK5 A;  5HHZ A;  2E3T A;  3NVY B;  5HQX A;  2P3H A;  3TX1 A;  2PLI A;  1W1S A;  3NVW B;  1QLU A;  3S1C A;  3D2D A;  3FW7 A;  3S1F A;  3HRD C;  4OAL A;  4PWC A;  2VAO A;  1N63 C;  4ML8 A;  2NQW A;  3NVV B;  3W8W A;  4HG0 A;  1N61 C;  3D2H A;  4EC3 A;  5HMR A;  4PWB A;  1VDV A;  1W1K A;  5FXD A;  2O3G A;  1FIQ B;  2I0K A;  2BVF A;  3VTE A;  2P13 A;  2GQU A;  4PVK A;  1W1J A;  1FO4 A;  3FWA A;  3BW7 A;  3JS8 A;  1I19 A;  3TSH A;  3NRZ B;  5AE3 A;  1FFU C;  4BC7 A;  1N60 C;  4O95 A;  1WYG A;  2VFT A;  2AXR A;  1V97 A;  1HSK A;  1FFV C;  3GSY A;  1N5W C;  3PM9 A;  5FXF A;  1N5X A;  3AMZ A;  2QPM A;  4BCA A;  1RM6 B;  4BC9 A;  3LAE A;  2EXR A;  3AM9 A;  2W54 A;  1JRP A;  2R2Z A;  3W8X A;  5G5H B;  1VAO A;  4XLO A;  4PVJ A;  3C0P A;  1W1L A;  2YVS A;  3B9J B;  1DII A;  1JRO A;  4UD8 A;  2R8D A;  3S1D A;  1AHV A;  1ZXI C;  1W1Q A;  2BVG A;  2VFU A;  1AHZ A;  3DED A;  1ZR6 A;  1DIQ A;  5FXE A;  2OAI A;  1AHU A;  4DNS A;  4MLA A;  1W1O A;  1N62 C;  3FW9 A;  2PLS A;  1MBB A;  5G5G B;  1SB3 B;  4PVH A;  2W3S A;  1MBT A;  2VFV A;  3DQ0 A;  2W3R A;  3LLB A;  4PYT A;  1E8F A;  1T3Q C;  3AN1 A;  5AE1 A;  3ETR B;  3W8Z A;  2VFR A;  3I99 A;  4ZOH B;  5ADZ A;  3FW8 A;  2VFS A;  2GQT A;  5D79 A;  5AE2 A;  4JB1 A;  3D2J A;  3KJM A;  3NS1 B;  4PZF A;  2P4P A;  1E8H A;  2Q85 A;  2BVH A;  3S1E A;  4PVE A;  2W55 A;  1WVE A;  1DZN A;  2Q4W A;  1E0Y A;  4JAY A;  4BBY A;  1F0X A;  1WVF A;  5FXP A;  3NVZ B;  3EUB 3;  1E8G A;  1QLT A;  2QKN A;  3SR6 B;  3TSJ A; 
#chains in the Genus database with same CATH topology
 1W1R A;  1W1M A;  2MBR A;  1UXY A;  2RK5 A;  5HHZ A;  3RJA A;  2E3T A;  3NVY B;  5HQX A;  2P3H A;  3TX1 A;  3NVW B;  1W1S A;  2PLI A;  3EJD B;  2Y4G A;  1QLU A;  3S1C A;  3D2D A;  3FW7 A;  3S1F A;  3HRD C;  5L6G A;  4OAL A;  4PWC A;  2VAO A;  1N63 C;  4ML8 A;  3NVV B;  2NQW A;  3W8W A;  4HG0 A;  1N61 C;  3D2H A;  4EC3 A;  5HMR A;  4PWB A;  1VDV A;  1W1K A;  5FXD A;  2O3G A;  1FIQ B;  2I0K A;  2BVF A;  3VTE A;  2P13 A;  2GQU A;  4PVK A;  1W1J A;  1FO4 A;  3FWA A;  3BW7 A;  3JS8 A;  1I19 A;  3EJE B;  3TSH A;  3NRZ B;  2WDW A;  5AE3 A;  1FFU C;  4BC7 A;  1N60 C;  5AWV A;  4O95 A;  1WYG A;  2VFT A;  2AXR A;  2IPI A;  1V97 A;  3RJ8 A;  1HSK A;  1FFV C;  3GSY A;  1N5W C;  3PM9 A;  5FXF A;  2UUU A;  1N5X A;  2Y3S A;  3AMZ A;  2QPM A;  4BCA A;  1RM6 B;  4BC9 A;  3LAE A;  3POP A;  2EXR A;  3AM9 A;  2W54 A;  1JRP A;  2R2Z A;  3W8X A;  5G5H B;  1VAO A;  4XLO A;  4PVJ A;  3C0P A;  1W1L A;  2YVS A;  3B9J B;  1DII A;  1JRO A;  4UD8 A;  2R8D A;  3S1D A;  1AHV A;  1ZXI C;  1W1Q A;  2BVG A;  2VFU A;  5K8E A;  1AHZ A;  3DED A;  1ZR6 A;  1DIQ A;  5FXE A;  2OAI A;  1AHU A;  5I1V A;  4DNS A;  4MLA A;  2Y08 A;  1W1O A;  1N62 C;  3FW9 A;  2PLS A;  1MBB A;  2Y3R A;  3PQB A;  5G5G B;  1SB3 B;  4PVH A;  2W3S A;  2UUV A;  1MBT A;  2VFV A;  3DQ0 A;  2W3R A;  3LLB A;  4PYT A;  1E8F A;  1T3Q C;  3AN1 A;  5AE1 A;  3ETR B;  3W8Z A;  2VFR A;  3I99 A;  4ZOH B;  3HSU A;  5ADZ A;  3FW8 A;  2VFS A;  2GQT A;  3EJB B;  5D79 A;  5AE2 A;  4JB1 A;  3D2J A;  3KJM A;  3NS1 B;  4PZF A;  2P4P A;  5I1W A;  1E8H A;  2Q85 A;  2BVH A;  3S1E A;  5L6F A;  4PVE A;  2W55 A;  1WVE A;  1DZN A;  2Q4W A;  1E0Y A;  4JAY A;  4BBY A;  1F0X A;  1WVF A;  5FXP A;  3NVZ B;  3EUB 3;  1E8G A;  1QLT A;  2QKN A;  3SR6 B;  3TSJ A; 
#chains in the Genus database with same CATH homology
 1W1R A;  1W1M A;  2MBR A;  1UXY A;  2RK5 A;  5HHZ A;  3RJA A;  2E3T A;  3NVY B;  5HQX A;  2P3H A;  3TX1 A;  2PLI A;  1W1S A;  3NVW B;  2Y4G A;  1QLU A;  3S1C A;  3D2D A;  3FW7 A;  3S1F A;  3HRD C;  5L6G A;  4OAL A;  4PWC A;  2VAO A;  1N63 C;  4ML8 A;  2NQW A;  3NVV B;  3W8W A;  4HG0 A;  1N61 C;  3D2H A;  4EC3 A;  5HMR A;  4PWB A;  1VDV A;  1W1K A;  5FXD A;  2O3G A;  1FIQ B;  2I0K A;  2BVF A;  3VTE A;  2P13 A;  2GQU A;  4PVK A;  1W1J A;  1FO4 A;  3FWA A;  3BW7 A;  3JS8 A;  1I19 A;  3TSH A;  3NRZ B;  2WDW A;  5AE3 A;  1FFU C;  4BC7 A;  1N60 C;  5AWV A;  4O95 A;  1WYG A;  2VFT A;  2AXR A;  2IPI A;  1V97 A;  3RJ8 A;  1HSK A;  1FFV C;  3GSY A;  1N5W C;  3PM9 A;  5FXF A;  2UUU A;  1N5X A;  2Y3S A;  3AMZ A;  2QPM A;  4BCA A;  1RM6 B;  4BC9 A;  3LAE A;  3POP A;  2EXR A;  3AM9 A;  2W54 A;  1JRP A;  2R2Z A;  3W8X A;  5G5H B;  1VAO A;  4XLO A;  4PVJ A;  3C0P A;  1W1L A;  2YVS A;  3B9J B;  1DII A;  1JRO A;  4UD8 A;  2R8D A;  3S1D A;  1AHV A;  1ZXI C;  1W1Q A;  2BVG A;  2VFU A;  5K8E A;  1AHZ A;  3DED A;  1ZR6 A;  1DIQ A;  5FXE A;  2OAI A;  1AHU A;  5I1V A;  4DNS A;  4MLA A;  2Y08 A;  1W1O A;  1N62 C;  3FW9 A;  2PLS A;  1MBB A;  2Y3R A;  3PQB A;  5G5G B;  1SB3 B;  4PVH A;  2W3S A;  2UUV A;  1MBT A;  2VFV A;  3DQ0 A;  2W3R A;  3LLB A;  4PYT A;  1E8F A;  1T3Q C;  3AN1 A;  5AE1 A;  3ETR B;  3W8Z A;  2VFR A;  3I99 A;  4ZOH B;  3HSU A;  5ADZ A;  3FW8 A;  2VFS A;  2GQT A;  5D79 A;  5AE2 A;  4JB1 A;  3D2J A;  3KJM A;  3NS1 B;  4PZF A;  2P4P A;  5I1W A;  1E8H A;  2Q85 A;  2BVH A;  3S1E A;  5L6F A;  4PVE A;  2W55 A;  1WVE A;  1DZN A;  2Q4W A;  1E0Y A;  4JAY A;  4BBY A;  1F0X A;  1WVF A;  5FXP A;  3NVZ B;  3EUB 3;  1E8G A;  1QLT A;  2QKN A;  3SR6 B;  3TSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...