3I99A

The crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
340
structure length
340
Chain Sequence
TTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 90
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3i99A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3i99A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3i99A03
1VAOA 1W1OA 5G5HB 1AHVA 3TSHA 1ZR6A 2BVGA 3AN1A 4PZFA 3FW9A 4HG0A 1AHZA 2MBRA 1DIQA 5AE3A 1W1KA 5AE2A 4PVHA 2W3RA 1FIQB 1ZXIC 2W55A 4JB1A 1N61C 3D2JA 2VFTA 3C0PA 1FFVC 3D2HA 3W8WA 1N63C 3NS1B 4PVEA 1AHUA 3AMZA 4EC3A 3TX1A 1N60C 1UXYA 2P3HA 2VFVA 1W1MA 2O3GA 1F0XA 3VTEA 5D79A 4OALA 1RM6B 1FFUC 1W1JA 1VDVA 2R2ZA 3NVVB 5G5GB 5AE1A 1E0YA 2W3SA 1W1RA 2GQTA 3HRDC 4PWCA 4PVJA 3D2DA 2P4PA 1N62C 1I19A 4PYTA 2I0KA 2R8DA 1E8FA 2W54A 3KJMA 4DNSA 3LLBA 2Q4WA 2NQWA 3AM9A 2VFSA 2QPMA 1N5XA 1MBTA 2Q85A 4O95A 4UD8A 4BCAA 4BC9A 5FXFA 4ML8A 3ETRB 4PWBA 4BC7A 1MBBA 1FO4A 2RK5A 1E8HA 4MLAA 1E8GA 3NVZB 1DZNA 1DIIA 3BW7A 4PVKA 1JRPA 1SB3B 3GSYA 3FW7A 2AXRA 2EXRA 1T3QC 3SR6B 5HMRA 3LAEA 4BBYA 3JS8A 1W1QA 5FXPA 1WVEA 1QLTA 2OAIA 3NVWB 2PLSA 1WVFA 3TSJA 5HHZA 2QKNA 2BVFA 3B9JB 3FW8A 3S1FA 5FXDA 3DEDA 4XLOA 3I99A 3S1CA 3S1EA 3NVYB 5HQXA 2VAOA 2VFUA 3W8XA 1HSKA 5ADZA 1WYGA 3DQ0A 3EUB3 2BVHA 4ZOHB 1QLUA 2E3TA 1V97A 4JAYA 2GQUA 1W1LA 1JROA 2P13A 3NRZB 5FXEA 2PLIA 3S1DA 1N5WC 2VFRA 2YVSA 3FWAA 1W1SA 3W8ZA 3PM9A
chains in the Genus database with same CATH superfamily
1VAOA 1W1OA 5G5HB 1AHVA 5L6FA 3HSUA 3TSHA 1ZR6A 2BVGA 3AN1A 4PZFA 3FW9A 4HG0A 1AHZA 2MBRA 1DIQA 5AE3A 1W1KA 5AE2A 4PVHA 2W3RA 1FIQB 1ZXIC 2W55A 4JB1A 2UUUA 1N61C 3D2JA 2VFTA 3C0PA 1FFVC 3D2HA 5L6GA 5K8EA 3W8WA 1N63C 2Y08A 3NS1B 4PVEA 1AHUA 3AMZA 4EC3A 3TX1A 1N60C 1UXYA 2P3HA 2VFVA 1W1MA 2O3GA 3PQBA 1F0XA 3NVVB 5D79A 4OALA 3VTEA 1FFUC 1W1JA 1VDVA 1RM6B 2R2ZA 5G5GB 2Y3SA 5AE1A 1E0YA 2W3SA 1W1RA 2Y3RA 2GQTA 3HRDC 4PWCA 4PVJA 3D2DA 2P4PA 1N62C 1I19A 4PYTA 5AWVA 2I0KA 2R8DA 1E8FA 2W54A 3KJMA 4DNSA 3EJBB 3LLBA 2Q4WA 2NQWA 3AM9A 2VFSA 2QPMA 1N5XA 1MBTA 2Q85A 4O95A 4UD8A 4BCAA 2IPIA 4BC9A 5FXFA 4ML8A 3ETRB 4PWBA 4BC7A 2WDWA 1MBBA 1FO4A 2RK5A 1E8HA 4MLAA 1E8GA 3NVZB 1DZNA 1DIIA 3BW7A 3EJDB 4PVKA 1JRPA 1SB3B 2UUVA 3GSYA 3FW7A 2AXRA 2EXRA 1T3QC 3SR6B 5HMRA 3POPA 3LAEA 4BBYA 3JS8A 1W1QA 5FXPA 1WVEA 1QLTA 2OAIA 3NVWB 2PLSA 5I1WA 1WVFA 3EJEB 3TSJA 5HHZA 2QKNA 2BVFA 3B9JB 3FW8A 2Y4GA 3S1FA 5FXDA 3DEDA 4XLOA 3I99A 3S1CA 3S1EA 3NVYB 5HQXA 2VAOA 2VFUA 3W8XA 1HSKA 5ADZA 1WYGA 3DQ0A 3EUB3 2BVHA 4ZOHB 1QLUA 2E3TA 1V97A 4JAYA 2GQUA 1W1LA 1JROA 2P13A 3NRZB 5FXEA 2PLIA 3S1DA 1N5WC 2VFRA 2YVSA 3RJAA 3FWAA 1W1SA 3W8ZA 3PM9A 5I1VA 3RJ8A
chains in the Genus database with same CATH topology
1VAOA 1W1OA 5G5HB 1AHVA 5L6FA 3HSUA 3TSHA 1ZR6A 2BVGA 3AN1A 4PZFA 3FW9A 4HG0A 1AHZA 2MBRA 1DIQA 5AE3A 1W1KA 5AE2A 4PVHA 2W3RA 1FIQB 1ZXIC 2W55A 4JB1A 2UUUA 1N61C 3D2JA 2VFTA 3C0PA 1FFVC 3D2HA 5L6GA 5K8EA 3W8WA 1N63C 2Y08A 3NS1B 4PVEA 1AHUA 3AMZA 4EC3A 3TX1A 1N60C 1UXYA 2P3HA 2VFVA 1W1MA 2O3GA 3PQBA 1F0XA 3VTEA 5D79A 4OALA 1RM6B 1FFUC 1W1JA 1VDVA 2R2ZA 3NVVB 5G5GB 2Y3SA 5AE1A 1E0YA 2W3SA 1W1RA 2Y3RA 2GQTA 3HRDC 4PWCA 4PVJA 3D2DA 2P4PA 1N62C 1I19A 4PYTA 5AWVA 2I0KA 2R8DA 1E8FA 2W54A 3KJMA 4DNSA 3LLBA 2Q4WA 2NQWA 3AM9A 2VFSA 2QPMA 1N5XA 1MBTA 2Q85A 4O95A 4UD8A 4BCAA 2IPIA 4BC9A 5FXFA 4ML8A 3ETRB 4PWBA 4BC7A 2WDWA 1MBBA 1FO4A 2RK5A 1E8HA 4MLAA 1E8GA 3NVZB 1DZNA 1DIIA 3BW7A 4PVKA 1JRPA 1SB3B 2UUVA 3GSYA 3FW7A 2AXRA 2EXRA 1T3QC 3SR6B 5HMRA 3POPA 3LAEA 4BBYA 3JS8A 1W1QA 5FXPA 1WVEA 1QLTA 2OAIA 3NVWB 2PLSA 5I1WA 1WVFA 3TSJA 5HHZA 2QKNA 2BVFA 3B9JB 3FW8A 2Y4GA 3S1FA 5FXDA 3DEDA 4XLOA 3I99A 3S1CA 3S1EA 3NVYB 5HQXA 2VAOA 2VFUA 3W8XA 1HSKA 5ADZA 1WYGA 3DQ0A 3EUB3 2BVHA 4ZOHB 1QLUA 2E3TA 1V97A 4JAYA 2GQUA 1W1LA 1JROA 2P13A 3NRZB 5FXEA 2PLIA 3S1DA 1N5WC 2VFRA 2YVSA 3RJAA 3FWAA 1W1SA 3W8ZA 3PM9A 5I1VA 3RJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAO A;  1W1O A;  5G5H B;  1AHV A;  3TSH A;  1ZR6 A;  2BVG A;  3AN1 A;  4PZF A;  3FW9 A;  4HG0 A;  1AHZ A;  2MBR A;  1DIQ A;  5AE3 A;  1W1K A;  5AE2 A;  4PVH A;  2W3R A;  1FIQ B;  1ZXI C;  2W55 A;  4JB1 A;  1N61 C;  3D2J A;  2VFT A;  3C0P A;  1FFV C;  3D2H A;  3W8W A;  1N63 C;  3NS1 B;  4PVE A;  1AHU A;  3AMZ A;  4EC3 A;  3TX1 A;  1N60 C;  1UXY A;  2P3H A;  2VFV A;  1W1M A;  2O3G A;  1F0X A;  3VTE A;  5D79 A;  4OAL A;  1RM6 B;  1FFU C;  1W1J A;  1VDV A;  2R2Z A;  3NVV B;  5G5G B;  5AE1 A;  1E0Y A;  2W3S A;  1W1R A;  2GQT A;  3HRD C;  4PWC A;  4PVJ A;  3D2D A;  2P4P A;  1N62 C;  1I19 A;  4PYT A;  2I0K A;  2R8D A;  1E8F A;  2W54 A;  3KJM A;  4DNS A;  3LLB A;  2Q4W A;  2NQW A;  3AM9 A;  2VFS A;  2QPM A;  1N5X A;  1MBT A;  2Q85 A;  4O95 A;  4UD8 A;  4BCA A;  4BC9 A;  5FXF A;  4ML8 A;  3ETR B;  4PWB A;  4BC7 A;  1MBB A;  1FO4 A;  2RK5 A;  1E8H A;  4MLA A;  1E8G A;  3NVZ B;  1DZN A;  1DII A;  3BW7 A;  4PVK A;  1JRP A;  1SB3 B;  3GSY A;  3FW7 A;  2AXR A;  2EXR A;  1T3Q C;  3SR6 B;  5HMR A;  3LAE A;  4BBY A;  3JS8 A;  1W1Q A;  5FXP A;  1WVE A;  1QLT A;  2OAI A;  3NVW B;  2PLS A;  1WVF A;  3TSJ A;  5HHZ A;  2QKN A;  2BVF A;  3B9J B;  3FW8 A;  3S1F A;  5FXD A;  3DED A;  4XLO A;  3I99 A;  3S1C A;  3S1E A;  3NVY B;  5HQX A;  2VAO A;  2VFU A;  3W8X A;  1HSK A;  5ADZ A;  1WYG A;  3DQ0 A;  3EUB 3;  2BVH A;  4ZOH B;  1QLU A;  2E3T A;  1V97 A;  4JAY A;  2GQU A;  1W1L A;  1JRO A;  2P13 A;  3NRZ B;  5FXE A;  2PLI A;  3S1D A;  1N5W C;  2VFR A;  2YVS A;  3FWA A;  1W1S A;  3W8Z A;  3PM9 A; 
#chains in the Genus database with same CATH topology
 1VAO A;  1W1O A;  5G5H B;  1AHV A;  5L6F A;  3HSU A;  3TSH A;  1ZR6 A;  2BVG A;  3AN1 A;  4PZF A;  3FW9 A;  4HG0 A;  1AHZ A;  2MBR A;  1DIQ A;  5AE3 A;  1W1K A;  5AE2 A;  4PVH A;  2W3R A;  1FIQ B;  1ZXI C;  2W55 A;  4JB1 A;  2UUU A;  1N61 C;  3D2J A;  2VFT A;  3C0P A;  1FFV C;  3D2H A;  5L6G A;  5K8E A;  3W8W A;  1N63 C;  2Y08 A;  3NS1 B;  4PVE A;  1AHU A;  3AMZ A;  4EC3 A;  3TX1 A;  1N60 C;  1UXY A;  2P3H A;  2VFV A;  1W1M A;  2O3G A;  3PQB A;  1F0X A;  3NVV B;  5D79 A;  4OAL A;  3VTE A;  1FFU C;  1W1J A;  1VDV A;  1RM6 B;  2R2Z A;  5G5G B;  2Y3S A;  5AE1 A;  1E0Y A;  2W3S A;  1W1R A;  2Y3R A;  2GQT A;  3HRD C;  4PWC A;  4PVJ A;  3D2D A;  2P4P A;  1N62 C;  1I19 A;  4PYT A;  5AWV A;  2I0K A;  2R8D A;  1E8F A;  2W54 A;  3KJM A;  4DNS A;  3EJB B;  3LLB A;  2Q4W A;  2NQW A;  3AM9 A;  2VFS A;  2QPM A;  1N5X A;  1MBT A;  2Q85 A;  4O95 A;  4UD8 A;  4BCA A;  2IPI A;  4BC9 A;  5FXF A;  4ML8 A;  3ETR B;  4PWB A;  4BC7 A;  2WDW A;  1MBB A;  1FO4 A;  2RK5 A;  1E8H A;  4MLA A;  1E8G A;  3NVZ B;  1DZN A;  1DII A;  3BW7 A;  3EJD B;  4PVK A;  1JRP A;  1SB3 B;  2UUV A;  3GSY A;  3FW7 A;  2AXR A;  2EXR A;  1T3Q C;  3SR6 B;  5HMR A;  3POP A;  3LAE A;  4BBY A;  3JS8 A;  1W1Q A;  5FXP A;  1WVE A;  1QLT A;  2OAI A;  3NVW B;  2PLS A;  5I1W A;  1WVF A;  3EJE B;  3TSJ A;  5HHZ A;  2QKN A;  2BVF A;  3B9J B;  3FW8 A;  2Y4G A;  3S1F A;  5FXD A;  3DED A;  4XLO A;  3I99 A;  3S1C A;  3S1E A;  3NVY B;  5HQX A;  2VAO A;  2VFU A;  3W8X A;  1HSK A;  5ADZ A;  1WYG A;  3DQ0 A;  3EUB 3;  2BVH A;  4ZOH B;  1QLU A;  2E3T A;  1V97 A;  4JAY A;  2GQU A;  1W1L A;  1JRO A;  2P13 A;  3NRZ B;  5FXE A;  2PLI A;  3S1D A;  1N5W C;  2VFR A;  2YVS A;  3RJA A;  3FWA A;  1W1S A;  3W8Z A;  3PM9 A;  5I1V A;  3RJ8 A; 
#chains in the Genus database with same CATH homology
 1VAO A;  1W1O A;  5G5H B;  1AHV A;  5L6F A;  3HSU A;  3TSH A;  1ZR6 A;  2BVG A;  3AN1 A;  4PZF A;  3FW9 A;  4HG0 A;  1AHZ A;  2MBR A;  1DIQ A;  5AE3 A;  1W1K A;  5AE2 A;  4PVH A;  2W3R A;  1FIQ B;  1ZXI C;  2W55 A;  4JB1 A;  2UUU A;  1N61 C;  3D2J A;  2VFT A;  3C0P A;  1FFV C;  3D2H A;  5L6G A;  5K8E A;  3W8W A;  1N63 C;  2Y08 A;  3NS1 B;  4PVE A;  1AHU A;  3AMZ A;  4EC3 A;  3TX1 A;  1N60 C;  1UXY A;  2P3H A;  2VFV A;  1W1M A;  2O3G A;  3PQB A;  1F0X A;  3VTE A;  5D79 A;  4OAL A;  1RM6 B;  1FFU C;  1W1J A;  1VDV A;  2R2Z A;  3NVV B;  5G5G B;  2Y3S A;  5AE1 A;  1E0Y A;  2W3S A;  1W1R A;  2Y3R A;  2GQT A;  3HRD C;  4PWC A;  4PVJ A;  3D2D A;  2P4P A;  1N62 C;  1I19 A;  4PYT A;  5AWV A;  2I0K A;  2R8D A;  1E8F A;  2W54 A;  3KJM A;  4DNS A;  3LLB A;  2Q4W A;  2NQW A;  3AM9 A;  2VFS A;  2QPM A;  1N5X A;  1MBT A;  2Q85 A;  4O95 A;  4UD8 A;  4BCA A;  2IPI A;  4BC9 A;  5FXF A;  4ML8 A;  3ETR B;  4PWB A;  4BC7 A;  2WDW A;  1MBB A;  1FO4 A;  2RK5 A;  1E8H A;  4MLA A;  1E8G A;  3NVZ B;  1DZN A;  1DII A;  3BW7 A;  4PVK A;  1JRP A;  1SB3 B;  2UUV A;  3GSY A;  3FW7 A;  2AXR A;  2EXR A;  1T3Q C;  3SR6 B;  5HMR A;  3POP A;  3LAE A;  4BBY A;  3JS8 A;  1W1Q A;  5FXP A;  1WVE A;  1QLT A;  2OAI A;  3NVW B;  2PLS A;  5I1W A;  1WVF A;  3TSJ A;  5HHZ A;  2QKN A;  2BVF A;  3B9J B;  3FW8 A;  2Y4G A;  3S1F A;  5FXD A;  3DED A;  4XLO A;  3I99 A;  3S1C A;  3S1E A;  3NVY B;  5HQX A;  2VAO A;  2VFU A;  3W8X A;  1HSK A;  5ADZ A;  1WYG A;  3DQ0 A;  3EUB 3;  2BVH A;  4ZOH B;  1QLU A;  2E3T A;  1V97 A;  4JAY A;  2GQU A;  1W1L A;  1JRO A;  2P13 A;  3NRZ B;  5FXE A;  2PLI A;  3S1D A;  1N5W C;  2VFR A;  2YVS A;  3RJA A;  3FWA A;  1W1S A;  3W8Z A;  3PM9 A;  5I1V A;  3RJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...