3I99A

The crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
340
structure length
340
Chain Sequence
TTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
total genus 90
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3i99A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3i99A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3i99A03
2GQTA 2E3TA 1V97A 4PVEA 3NVWB 5AE2A 4PVHA 2AXRA 2EXRA 4XLOA 3DEDA 5D79A 5FXEA 2PLSA 1QLTA 1W1OA 3AM9A 3I99A 3FW7A 2BVHA 1FO4A 3FW8A 1W1QA 1SB3B 5FXFA 1FFUC 3W8ZA 3NS1B 2Q85A 2W55A 2W3SA 1AHZA 5FXDA 3C0PA 3GSYA 1DIQA 1MBTA 3NRZB 1HSKA 3S1CA 1W1JA 1N61C 1VAOA 1T3QC 1N5XA 3W8WA 1N62C 2VFTA 2I0KA 1E0YA 1N60C 3VTEA 3HRDC 4JAYA 3NVYB 2VFUA 2VFSA 4PWCA 3SR6B 3AMZA 3NVVB 4PWBA 5G5HB 5FXPA 3S1FA 2P3HA 1WYGA 1WVFA 1ZR6A 2BVGA 2GQUA 3D2JA 2BVFA 2MBRA 1N5WC 1F0XA 3FW9A 4PYTA 4EC3A 1I19A 1JRPA 5AE1A 1FIQB 3LAEA 1ZXIC 4DNSA 2P4PA 4PVJA 1W1RA 1AHUA 1W1LA 1E8FA 1W1SA 2Q4WA 3D2DA 5HMRA 4PVKA 1UXYA 4MLAA 5AE3A 2R2ZA 2W54A 1E8GA 4O95A 1MBBA 2R8DA 1FFVC 3ETRB 2OAIA 1E8HA 3FWAA 4HG0A 2QPMA 2O3GA 3W8XA 4OALA 4JB1A 3TSJA 1JROA 3EUB3 2RK5A 1AHVA 3PM9A 2VFRA 1QLUA 2VAOA 3S1EA 1RM6B 4ZOHB 1W1MA 3NVZB 3S1DA 5ADZA 4BBYA 3TX1A 3LLBA 4BC9A 3B9JB 3BW7A 2VFVA 2W3RA 4ML8A 1WVEA 1VDVA 5G5GB 3AN1A 1DZNA 1W1KA 2PLIA 2QKNA 3TSHA 4UD8A 4BC7A 3KJMA 3D2HA 5HHZA 3JS8A 1N63C 4BCAA 4PZFA 2P13A 2NQWA 5HQXA 1DIIA 2YVSA 3DQ0A
chains in the Genus database with same CATH superfamily
2GQTA 2E3TA 1V97A 3NVWB 4PVEA 5AE2A 4PVHA 2AXRA 2EXRA 4XLOA 3DEDA 2Y3SA 5D79A 5FXEA 3EJBB 1QLTA 2PLSA 1W1OA 3AM9A 3I99A 3FW7A 2BVHA 1FO4A 3FW8A 1W1QA 1SB3B 5FXFA 2UUVA 1FFUC 3W8ZA 3NS1B 2Q85A 2W55A 2W3SA 1AHZA 5FXDA 3C0PA 3GSYA 1DIQA 1MBTA 3NRZB 1HSKA 3S1CA 1W1JA 1N61C 1VAOA 1T3QC 1N5XA 3W8WA 1N62C 2VFTA 2I0KA 1E0YA 1N60C 3VTEA 3HRDC 3NVYB 4JAYA 2IPIA 2VFUA 2VFSA 4PWCA 3SR6B 3PQBA 2Y3RA 3AMZA 3NVVB 4PWBA 3RJAA 5G5HB 5FXPA 3S1FA 2P3HA 1WYGA 1WVFA 1ZR6A 2BVGA 5L6GA 2GQUA 3D2JA 2BVFA 2MBRA 1N5WC 1F0XA 3FW9A 4PYTA 4EC3A 2Y4GA 1I19A 1JRPA 3POPA 5AE1A 1FIQB 5I1VA 3LAEA 1ZXIC 4DNSA 2P4PA 4PVJA 1W1RA 1AHUA 1W1LA 5L6FA 2UUUA 1E8FA 1W1SA 2Q4WA 3D2DA 5HMRA 4PVKA 1UXYA 3EJDB 4MLAA 5AE3A 2R2ZA 2W54A 1E8GA 4O95A 1MBBA 2R8DA 5K8EA 1FFVC 3ETRB 2OAIA 1E8HA 3FWAA 4HG0A 2QPMA 2O3GA 3W8XA 4OALA 4JB1A 3EJEB 1JROA 3EUB3 3TSJA 2RK5A 1AHVA 3PM9A 2VFRA 1QLUA 2VAOA 3S1EA 1RM6B 4ZOHB 5I1WA 1W1MA 3NVZB 3HSUA 3S1DA 5ADZA 4BBYA 3TX1A 3LLBA 4BC9A 3B9JB 3BW7A 2VFVA 2W3RA 4ML8A 1WVEA 1VDVA 2Y08A 5G5GB 3AN1A 1DZNA 1W1KA 2PLIA 2QKNA 3TSHA 4UD8A 4BC7A 3RJ8A 2WDWA 3KJMA 3D2HA 5HHZA 5AWVA 3JS8A 1N63C 4BCAA 4PZFA 2P13A 2NQWA 5HQXA 1DIIA 2YVSA 3DQ0A
chains in the Genus database with same CATH topology
2GQTA 2E3TA 1V97A 4PVEA 3NVWB 5AE2A 4PVHA 2AXRA 2EXRA 4XLOA 3DEDA 2Y3SA 5D79A 5FXEA 2PLSA 1QLTA 1W1OA 3AM9A 3I99A 3FW7A 2BVHA 1FO4A 3FW8A 1W1QA 1SB3B 5FXFA 2UUVA 1FFUC 3W8ZA 3NS1B 2Q85A 2W55A 2W3SA 1AHZA 5FXDA 3C0PA 3GSYA 1DIQA 1MBTA 3NRZB 1HSKA 3S1CA 1W1JA 1N61C 1VAOA 1T3QC 1N5XA 3W8WA 1N62C 2VFTA 2I0KA 1E0YA 1N60C 3VTEA 3HRDC 4JAYA 2IPIA 3NVYB 2VFUA 2VFSA 4PWCA 3SR6B 3PQBA 2Y3RA 3AMZA 3NVVB 4PWBA 3RJAA 5G5HB 5FXPA 3S1FA 2P3HA 1WYGA 1WVFA 1ZR6A 2BVGA 5L6GA 2GQUA 3D2JA 2BVFA 2MBRA 1N5WC 1F0XA 3FW9A 4PYTA 4EC3A 2Y4GA 1I19A 1JRPA 3POPA 5AE1A 1FIQB 5I1VA 3LAEA 1ZXIC 4DNSA 2P4PA 4PVJA 1W1RA 1AHUA 1W1LA 5L6FA 2UUUA 1E8FA 1W1SA 2Q4WA 3D2DA 5HMRA 4PVKA 1UXYA 4MLAA 5AE3A 2R2ZA 2W54A 1E8GA 4O95A 1MBBA 2R8DA 5K8EA 1FFVC 3ETRB 2OAIA 1E8HA 3FWAA 4HG0A 2QPMA 2O3GA 3W8XA 4OALA 4JB1A 3TSJA 1JROA 3EUB3 2RK5A 1AHVA 3PM9A 2VFRA 1QLUA 2VAOA 3S1EA 1RM6B 4ZOHB 5I1WA 1W1MA 3NVZB 3HSUA 3S1DA 5ADZA 4BBYA 3TX1A 3LLBA 4BC9A 3B9JB 3BW7A 2VFVA 2W3RA 4ML8A 1WVEA 1VDVA 2Y08A 5G5GB 3AN1A 1DZNA 1W1KA 2PLIA 2QKNA 3TSHA 4UD8A 4BC7A 3RJ8A 2WDWA 3KJMA 3D2HA 5HHZA 5AWVA 3JS8A 1N63C 4BCAA 4PZFA 2P13A 2NQWA 5HQXA 1DIIA 2YVSA 3DQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQT A;  2E3T A;  1V97 A;  4PVE A;  3NVW B;  5AE2 A;  4PVH A;  2AXR A;  2EXR A;  4XLO A;  3DED A;  5D79 A;  5FXE A;  2PLS A;  1QLT A;  1W1O A;  3AM9 A;  3I99 A;  3FW7 A;  2BVH A;  1FO4 A;  3FW8 A;  1W1Q A;  1SB3 B;  5FXF A;  1FFU C;  3W8Z A;  3NS1 B;  2Q85 A;  2W55 A;  2W3S A;  1AHZ A;  5FXD A;  3C0P A;  3GSY A;  1DIQ A;  1MBT A;  3NRZ B;  1HSK A;  3S1C A;  1W1J A;  1N61 C;  1VAO A;  1T3Q C;  1N5X A;  3W8W A;  1N62 C;  2VFT A;  2I0K A;  1E0Y A;  1N60 C;  3VTE A;  3HRD C;  4JAY A;  3NVY B;  2VFU A;  2VFS A;  4PWC A;  3SR6 B;  3AMZ A;  3NVV B;  4PWB A;  5G5H B;  5FXP A;  3S1F A;  2P3H A;  1WYG A;  1WVF A;  1ZR6 A;  2BVG A;  2GQU A;  3D2J A;  2BVF A;  2MBR A;  1N5W C;  1F0X A;  3FW9 A;  4PYT A;  4EC3 A;  1I19 A;  1JRP A;  5AE1 A;  1FIQ B;  3LAE A;  1ZXI C;  4DNS A;  2P4P A;  4PVJ A;  1W1R A;  1AHU A;  1W1L A;  1E8F A;  1W1S A;  2Q4W A;  3D2D A;  5HMR A;  4PVK A;  1UXY A;  4MLA A;  5AE3 A;  2R2Z A;  2W54 A;  1E8G A;  4O95 A;  1MBB A;  2R8D A;  1FFV C;  3ETR B;  2OAI A;  1E8H A;  3FWA A;  4HG0 A;  2QPM A;  2O3G A;  3W8X A;  4OAL A;  4JB1 A;  3TSJ A;  1JRO A;  3EUB 3;  2RK5 A;  1AHV A;  3PM9 A;  2VFR A;  1QLU A;  2VAO A;  3S1E A;  1RM6 B;  4ZOH B;  1W1M A;  3NVZ B;  3S1D A;  5ADZ A;  4BBY A;  3TX1 A;  3LLB A;  4BC9 A;  3B9J B;  3BW7 A;  2VFV A;  2W3R A;  4ML8 A;  1WVE A;  1VDV A;  5G5G B;  3AN1 A;  1DZN A;  1W1K A;  2PLI A;  2QKN A;  3TSH A;  4UD8 A;  4BC7 A;  3KJM A;  3D2H A;  5HHZ A;  3JS8 A;  1N63 C;  4BCA A;  4PZF A;  2P13 A;  2NQW A;  5HQX A;  1DII A;  2YVS A;  3DQ0 A; 
#chains in the Genus database with same CATH topology
 2GQT A;  2E3T A;  1V97 A;  3NVW B;  4PVE A;  5AE2 A;  4PVH A;  2AXR A;  2EXR A;  4XLO A;  3DED A;  2Y3S A;  5D79 A;  5FXE A;  3EJB B;  1QLT A;  2PLS A;  1W1O A;  3AM9 A;  3I99 A;  3FW7 A;  2BVH A;  1FO4 A;  3FW8 A;  1W1Q A;  1SB3 B;  5FXF A;  2UUV A;  1FFU C;  3W8Z A;  3NS1 B;  2Q85 A;  2W55 A;  2W3S A;  1AHZ A;  5FXD A;  3C0P A;  3GSY A;  1DIQ A;  1MBT A;  3NRZ B;  1HSK A;  3S1C A;  1W1J A;  1N61 C;  1VAO A;  1T3Q C;  1N5X A;  3W8W A;  1N62 C;  2VFT A;  2I0K A;  1E0Y A;  1N60 C;  3VTE A;  3HRD C;  3NVY B;  4JAY A;  2IPI A;  2VFU A;  2VFS A;  4PWC A;  3SR6 B;  3PQB A;  2Y3R A;  3AMZ A;  3NVV B;  4PWB A;  3RJA A;  5G5H B;  5FXP A;  3S1F A;  2P3H A;  1WYG A;  1WVF A;  1ZR6 A;  2BVG A;  5L6G A;  2GQU A;  3D2J A;  2BVF A;  2MBR A;  1N5W C;  1F0X A;  3FW9 A;  4PYT A;  4EC3 A;  2Y4G A;  1I19 A;  1JRP A;  3POP A;  5AE1 A;  1FIQ B;  5I1V A;  3LAE A;  1ZXI C;  4DNS A;  2P4P A;  4PVJ A;  1W1R A;  1AHU A;  1W1L A;  5L6F A;  2UUU A;  1E8F A;  1W1S A;  2Q4W A;  3D2D A;  5HMR A;  4PVK A;  1UXY A;  3EJD B;  4MLA A;  5AE3 A;  2R2Z A;  2W54 A;  1E8G A;  4O95 A;  1MBB A;  2R8D A;  5K8E A;  1FFV C;  3ETR B;  2OAI A;  1E8H A;  3FWA A;  4HG0 A;  2QPM A;  2O3G A;  3W8X A;  4OAL A;  4JB1 A;  3EJE B;  1JRO A;  3EUB 3;  3TSJ A;  2RK5 A;  1AHV A;  3PM9 A;  2VFR A;  1QLU A;  2VAO A;  3S1E A;  1RM6 B;  4ZOH B;  5I1W A;  1W1M A;  3NVZ B;  3HSU A;  3S1D A;  5ADZ A;  4BBY A;  3TX1 A;  3LLB A;  4BC9 A;  3B9J B;  3BW7 A;  2VFV A;  2W3R A;  4ML8 A;  1WVE A;  1VDV A;  2Y08 A;  5G5G B;  3AN1 A;  1DZN A;  1W1K A;  2PLI A;  2QKN A;  3TSH A;  4UD8 A;  4BC7 A;  3RJ8 A;  2WDW A;  3KJM A;  3D2H A;  5HHZ A;  5AWV A;  3JS8 A;  1N63 C;  4BCA A;  4PZF A;  2P13 A;  2NQW A;  5HQX A;  1DII A;  2YVS A;  3DQ0 A; 
#chains in the Genus database with same CATH homology
 2GQT A;  2E3T A;  1V97 A;  4PVE A;  3NVW B;  5AE2 A;  4PVH A;  2AXR A;  2EXR A;  4XLO A;  3DED A;  2Y3S A;  5D79 A;  5FXE A;  2PLS A;  1QLT A;  1W1O A;  3AM9 A;  3I99 A;  3FW7 A;  2BVH A;  1FO4 A;  3FW8 A;  1W1Q A;  1SB3 B;  5FXF A;  2UUV A;  1FFU C;  3W8Z A;  3NS1 B;  2Q85 A;  2W55 A;  2W3S A;  1AHZ A;  5FXD A;  3C0P A;  3GSY A;  1DIQ A;  1MBT A;  3NRZ B;  1HSK A;  3S1C A;  1W1J A;  1N61 C;  1VAO A;  1T3Q C;  1N5X A;  3W8W A;  1N62 C;  2VFT A;  2I0K A;  1E0Y A;  1N60 C;  3VTE A;  3HRD C;  4JAY A;  2IPI A;  3NVY B;  2VFU A;  2VFS A;  4PWC A;  3SR6 B;  3PQB A;  2Y3R A;  3AMZ A;  3NVV B;  4PWB A;  3RJA A;  5G5H B;  5FXP A;  3S1F A;  2P3H A;  1WYG A;  1WVF A;  1ZR6 A;  2BVG A;  5L6G A;  2GQU A;  3D2J A;  2BVF A;  2MBR A;  1N5W C;  1F0X A;  3FW9 A;  4PYT A;  4EC3 A;  2Y4G A;  1I19 A;  1JRP A;  3POP A;  5AE1 A;  1FIQ B;  5I1V A;  3LAE A;  1ZXI C;  4DNS A;  2P4P A;  4PVJ A;  1W1R A;  1AHU A;  1W1L A;  5L6F A;  2UUU A;  1E8F A;  1W1S A;  2Q4W A;  3D2D A;  5HMR A;  4PVK A;  1UXY A;  4MLA A;  5AE3 A;  2R2Z A;  2W54 A;  1E8G A;  4O95 A;  1MBB A;  2R8D A;  5K8E A;  1FFV C;  3ETR B;  2OAI A;  1E8H A;  3FWA A;  4HG0 A;  2QPM A;  2O3G A;  3W8X A;  4OAL A;  4JB1 A;  3TSJ A;  1JRO A;  3EUB 3;  2RK5 A;  1AHV A;  3PM9 A;  2VFR A;  1QLU A;  2VAO A;  3S1E A;  1RM6 B;  4ZOH B;  5I1W A;  1W1M A;  3NVZ B;  3HSU A;  3S1D A;  5ADZ A;  4BBY A;  3TX1 A;  3LLB A;  4BC9 A;  3B9J B;  3BW7 A;  2VFV A;  2W3R A;  4ML8 A;  1WVE A;  1VDV A;  2Y08 A;  5G5G B;  3AN1 A;  1DZN A;  1W1K A;  2PLI A;  2QKN A;  3TSH A;  4UD8 A;  4BC7 A;  3RJ8 A;  2WDW A;  3KJM A;  3D2H A;  5HHZ A;  5AWV A;  3JS8 A;  1N63 C;  4BCA A;  4PZF A;  2P13 A;  2NQW A;  5HQX A;  1DII A;  2YVS A;  3DQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...