3I99A

The crystal structure of the udp-n-acetylenolpyruvoylglucosamine reductase from the vibrio cholerae o1 biovar tor
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
340
structure length
340
Chain Sequence
TTMQIQLGANLKPYHTFGIEQLAAQLVVAESIDDLKALYCSAEWASLPKLIIGKGSNMLFTCHYTGMIVVNRLNGIEHQQDDDYHRLHVAGGEDWPSLVSWCVEQGIGGLENLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEYLCLETGTVKRLTMEECQFGYRDSIFKHQLYQKAVVTAVGLKFAKAWQPIIQYGPLKDLSSDCAIHDVYQRVCATRMEKLPDPAVMGNAGSFFKNPVISQQAFARLQIEHPDVVAYPAEQGVKVAAGWLIDQAGLKGHQIGGAKVHPKQALVIVNTGDASAQDVLMLAADIQQRVFNCYGIELEHEVRFIGESEETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title The crystal structure of the UDP-N-acetylenolpyruvoylglucosamine reductase from the Vibrio cholerae O1 biovar Tor
rcsb
source organism Vibrio cholerae
total genus 90
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 3i99A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 3i99A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 3i99A03
2VFTA 5FXFA 1SB3B 5FXEA 2W55A 2Q85A 2BVHA 3LAEA 3C0PA 5AE1A 1E0YA 2BVFA 1MBBA 3D2DA 4PVJA 1WYGA 3BW7A 1RM6B 3FW9A 4PZFA 1N60C 3SR6B 2Q4WA 3TSHA 4MLAA 4BC9A 3AN1A 2P3HA 5AE3A 1AHZA 1QLTA 5AE2A 2P4PA 2QPMA 1WVEA 4PWCA 1DIIA 3FWAA 1HSKA 4UD8A 3AM9A 3W8WA 5D79A 2VFUA 1AHUA 2W54A 3LLBA 3D2JA 3D2HA 1W1LA 3I99A 3TX1A 1W1QA 2GQTA 2VFSA 5ADZA 5HHZA 4ZOHB 5HQXA 2AXRA 3FW8A 5G5GB 1ZXIC 1E8HA 4BC7A 2VFVA 3NRZB 1W1OA 4PVEA 1T3QC 3B9JB 2PLIA 1MBTA 1FFVC 1JROA 3HRDC 5FXDA 1F0XA 2MBRA 1I19A 3PM9A 1W1JA 1FO4A 1FIQB 1N5WC 1N61C 5HMRA 4PVKA 1E8GA 2EXRA 1W1MA 3S1DA 3NS1B 4O95A 3DQ0A 4XLOA 2YVSA 3S1EA 2BVGA 1N62C 4PVHA 3W8ZA 3VTEA 1N63C 2W3RA 3TSJA 1UXYA 1W1KA 4JB1A 4JAYA 3GSYA 4HG0A 5G5HB 1WVFA 2QKNA 1AHVA 2GQUA 1VAOA 1DZNA 2R2ZA 1ZR6A 2RK5A 4OALA 3DEDA 3NVYB 2R8DA 3W8XA 4BCAA 1FFUC 4PWBA 1E8FA 4ML8A 3FW7A 5FXPA 2NQWA 3NVWB 1W1SA 3S1FA 3EUB3 3S1CA 3NVVB 2VFRA 2P13A 4BBYA 3NVZB 2O3GA 4DNSA 2W3SA 4EC3A 2OAIA 3KJMA 1N5XA 3AMZA 4PYTA 1QLUA 3ETRB 1V97A 1JRPA 2PLSA 3JS8A 1DIQA 2I0KA 2E3TA 1VDVA 1W1RA 2VAOA
chains in the Genus database with same CATH superfamily
5K8EA 2VFTA 5FXFA 1SB3B 5FXEA 2W55A 2Q85A 3POPA 2BVHA 3LAEA 3C0PA 5AE1A 1E0YA 2BVFA 1MBBA 3D2DA 5L6GA 2Y08A 4PVJA 1WYGA 3BW7A 1RM6B 3FW9A 4PZFA 3RJAA 1N60C 3SR6B 2WDWA 2Q4WA 3TSHA 4MLAA 4BC9A 3RJ8A 3AN1A 2P3HA 5AE3A 1AHZA 2UUUA 1QLTA 5AE2A 2P4PA 2QPMA 1WVEA 4PWCA 1DIIA 3FWAA 1HSKA 4UD8A 3AM9A 3W8WA 5D79A 2VFUA 1AHUA 2W54A 3LLBA 3D2JA 3D2HA 1W1LA 3I99A 5L6FA 3TX1A 1W1QA 2GQTA 2VFSA 5ADZA 5HHZA 4ZOHB 5HQXA 2AXRA 3FW8A 5G5GB 1ZXIC 1E8HA 4BC7A 2VFVA 3NRZB 1W1OA 4PVEA 1T3QC 3B9JB 2PLIA 1MBTA 1FFVC 1JROA 3HRDC 5FXDA 1F0XA 2MBRA 1I19A 3PM9A 5I1VA 1W1JA 1FO4A 1FIQB 2Y3SA 1N5WC 1N61C 5HMRA 2Y3RA 4PVKA 1E8GA 2EXRA 1W1MA 3S1DA 3NS1B 4O95A 3DQ0A 4XLOA 2YVSA 3EJDB 3S1EA 2BVGA 5AWVA 1N62C 4PVHA 3W8ZA 3VTEA 1N63C 2W3RA 3EJBB 3TSJA 1UXYA 1W1KA 4JB1A 4JAYA 3GSYA 4HG0A 5G5HB 1WVFA 2IPIA 5I1WA 2QKNA 1AHVA 2GQUA 1VAOA 1DZNA 2R2ZA 1ZR6A 2RK5A 4OALA 3DEDA 3NVYB 2R8DA 3W8XA 3HSUA 4BCAA 1FFUC 4PWBA 1E8FA 4ML8A 3FW7A 5FXPA 3NVWB 2NQWA 1W1SA 2Y4GA 3S1FA 3EUB3 3S1CA 3NVVB 2VFRA 2P13A 4BBYA 3NVZB 2O3GA 4DNSA 2W3SA 4EC3A 2OAIA 3KJMA 1N5XA 3AMZA 4PYTA 1QLUA 3PQBA 2UUVA 3ETRB 1V97A 3EJEB 1JRPA 2PLSA 3JS8A 1DIQA 2I0KA 2E3TA 1VDVA 1W1RA 2VAOA
chains in the Genus database with same CATH topology
5K8EA 2VFTA 5FXFA 1SB3B 5FXEA 2W55A 2Q85A 3POPA 2BVHA 3LAEA 3C0PA 5AE1A 1E0YA 2BVFA 1MBBA 3D2DA 5L6GA 2Y08A 4PVJA 1WYGA 3BW7A 1RM6B 3FW9A 4PZFA 3RJAA 1N60C 3SR6B 2WDWA 2Q4WA 3TSHA 4MLAA 4BC9A 3RJ8A 3AN1A 2P3HA 5AE3A 1AHZA 2UUUA 1QLTA 5AE2A 2P4PA 2QPMA 1WVEA 4PWCA 1DIIA 3FWAA 1HSKA 4UD8A 3AM9A 3W8WA 5D79A 2VFUA 1AHUA 2W54A 3LLBA 3D2JA 3D2HA 1W1LA 3I99A 5L6FA 3TX1A 1W1QA 2GQTA 2VFSA 5ADZA 5HHZA 4ZOHB 5HQXA 2AXRA 3FW8A 5G5GB 1ZXIC 1E8HA 4BC7A 2VFVA 3NRZB 1W1OA 4PVEA 1T3QC 3B9JB 2PLIA 1MBTA 1FFVC 1JROA 3HRDC 5FXDA 1F0XA 2MBRA 1I19A 3PM9A 5I1VA 1W1JA 1FO4A 1FIQB 2Y3SA 1N5WC 1N61C 5HMRA 2Y3RA 4PVKA 1E8GA 2EXRA 1W1MA 3S1DA 3NS1B 4O95A 3DQ0A 4XLOA 2YVSA 3S1EA 2BVGA 5AWVA 1N62C 4PVHA 3W8ZA 3VTEA 1N63C 2W3RA 3TSJA 1UXYA 1W1KA 4JB1A 4JAYA 3GSYA 4HG0A 5G5HB 1WVFA 2IPIA 5I1WA 2QKNA 1AHVA 2GQUA 1VAOA 1DZNA 2R2ZA 1ZR6A 2RK5A 4OALA 3DEDA 3NVYB 2R8DA 3W8XA 3HSUA 4BCAA 1FFUC 4PWBA 1E8FA 4ML8A 3FW7A 5FXPA 2NQWA 3NVWB 1W1SA 2Y4GA 3S1FA 3EUB3 3S1CA 3NVVB 2VFRA 2P13A 4BBYA 3NVZB 2O3GA 4DNSA 2W3SA 4EC3A 2OAIA 3KJMA 1N5XA 3AMZA 4PYTA 1QLUA 3PQBA 2UUVA 3ETRB 1V97A 1JRPA 2PLSA 3JS8A 1DIQA 2I0KA 2E3TA 1VDVA 1W1RA 2VAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFT A;  5FXF A;  1SB3 B;  5FXE A;  2W55 A;  2Q85 A;  2BVH A;  3LAE A;  3C0P A;  5AE1 A;  1E0Y A;  2BVF A;  1MBB A;  3D2D A;  4PVJ A;  1WYG A;  3BW7 A;  1RM6 B;  3FW9 A;  4PZF A;  1N60 C;  3SR6 B;  2Q4W A;  3TSH A;  4MLA A;  4BC9 A;  3AN1 A;  2P3H A;  5AE3 A;  1AHZ A;  1QLT A;  5AE2 A;  2P4P A;  2QPM A;  1WVE A;  4PWC A;  1DII A;  3FWA A;  1HSK A;  4UD8 A;  3AM9 A;  3W8W A;  5D79 A;  2VFU A;  1AHU A;  2W54 A;  3LLB A;  3D2J A;  3D2H A;  1W1L A;  3I99 A;  3TX1 A;  1W1Q A;  2GQT A;  2VFS A;  5ADZ A;  5HHZ A;  4ZOH B;  5HQX A;  2AXR A;  3FW8 A;  5G5G B;  1ZXI C;  1E8H A;  4BC7 A;  2VFV A;  3NRZ B;  1W1O A;  4PVE A;  1T3Q C;  3B9J B;  2PLI A;  1MBT A;  1FFV C;  1JRO A;  3HRD C;  5FXD A;  1F0X A;  2MBR A;  1I19 A;  3PM9 A;  1W1J A;  1FO4 A;  1FIQ B;  1N5W C;  1N61 C;  5HMR A;  4PVK A;  1E8G A;  2EXR A;  1W1M A;  3S1D A;  3NS1 B;  4O95 A;  3DQ0 A;  4XLO A;  2YVS A;  3S1E A;  2BVG A;  1N62 C;  4PVH A;  3W8Z A;  3VTE A;  1N63 C;  2W3R A;  3TSJ A;  1UXY A;  1W1K A;  4JB1 A;  4JAY A;  3GSY A;  4HG0 A;  5G5H B;  1WVF A;  2QKN A;  1AHV A;  2GQU A;  1VAO A;  1DZN A;  2R2Z A;  1ZR6 A;  2RK5 A;  4OAL A;  3DED A;  3NVY B;  2R8D A;  3W8X A;  4BCA A;  1FFU C;  4PWB A;  1E8F A;  4ML8 A;  3FW7 A;  5FXP A;  2NQW A;  3NVW B;  1W1S A;  3S1F A;  3EUB 3;  3S1C A;  3NVV B;  2VFR A;  2P13 A;  4BBY A;  3NVZ B;  2O3G A;  4DNS A;  2W3S A;  4EC3 A;  2OAI A;  3KJM A;  1N5X A;  3AMZ A;  4PYT A;  1QLU A;  3ETR B;  1V97 A;  1JRP A;  2PLS A;  3JS8 A;  1DIQ A;  2I0K A;  2E3T A;  1VDV A;  1W1R A;  2VAO A; 
#chains in the Genus database with same CATH topology
 5K8E A;  2VFT A;  5FXF A;  1SB3 B;  5FXE A;  2W55 A;  2Q85 A;  3POP A;  2BVH A;  3LAE A;  3C0P A;  5AE1 A;  1E0Y A;  2BVF A;  1MBB A;  3D2D A;  5L6G A;  2Y08 A;  4PVJ A;  1WYG A;  3BW7 A;  1RM6 B;  3FW9 A;  4PZF A;  3RJA A;  1N60 C;  3SR6 B;  2WDW A;  2Q4W A;  3TSH A;  4MLA A;  4BC9 A;  3RJ8 A;  3AN1 A;  2P3H A;  5AE3 A;  1AHZ A;  2UUU A;  1QLT A;  5AE2 A;  2P4P A;  2QPM A;  1WVE A;  4PWC A;  1DII A;  3FWA A;  1HSK A;  4UD8 A;  3AM9 A;  3W8W A;  5D79 A;  2VFU A;  1AHU A;  2W54 A;  3LLB A;  3D2J A;  3D2H A;  1W1L A;  3I99 A;  5L6F A;  3TX1 A;  1W1Q A;  2GQT A;  2VFS A;  5ADZ A;  5HHZ A;  4ZOH B;  5HQX A;  2AXR A;  3FW8 A;  5G5G B;  1ZXI C;  1E8H A;  4BC7 A;  2VFV A;  3NRZ B;  1W1O A;  4PVE A;  1T3Q C;  3B9J B;  2PLI A;  1MBT A;  1FFV C;  1JRO A;  3HRD C;  5FXD A;  1F0X A;  2MBR A;  1I19 A;  3PM9 A;  5I1V A;  1W1J A;  1FO4 A;  1FIQ B;  2Y3S A;  1N5W C;  1N61 C;  5HMR A;  2Y3R A;  4PVK A;  1E8G A;  2EXR A;  1W1M A;  3S1D A;  3NS1 B;  4O95 A;  3DQ0 A;  4XLO A;  2YVS A;  3EJD B;  3S1E A;  2BVG A;  5AWV A;  1N62 C;  4PVH A;  3W8Z A;  3VTE A;  1N63 C;  2W3R A;  3EJB B;  3TSJ A;  1UXY A;  1W1K A;  4JB1 A;  4JAY A;  3GSY A;  4HG0 A;  5G5H B;  1WVF A;  2IPI A;  5I1W A;  2QKN A;  1AHV A;  2GQU A;  1VAO A;  1DZN A;  2R2Z A;  1ZR6 A;  2RK5 A;  4OAL A;  3DED A;  3NVY B;  2R8D A;  3W8X A;  3HSU A;  4BCA A;  1FFU C;  4PWB A;  1E8F A;  4ML8 A;  3FW7 A;  5FXP A;  3NVW B;  2NQW A;  1W1S A;  2Y4G A;  3S1F A;  3EUB 3;  3S1C A;  3NVV B;  2VFR A;  2P13 A;  4BBY A;  3NVZ B;  2O3G A;  4DNS A;  2W3S A;  4EC3 A;  2OAI A;  3KJM A;  1N5X A;  3AMZ A;  4PYT A;  1QLU A;  3PQB A;  2UUV A;  3ETR B;  1V97 A;  3EJE B;  1JRP A;  2PLS A;  3JS8 A;  1DIQ A;  2I0K A;  2E3T A;  1VDV A;  1W1R A;  2VAO A; 
#chains in the Genus database with same CATH homology
 5K8E A;  2VFT A;  5FXF A;  1SB3 B;  5FXE A;  2W55 A;  2Q85 A;  3POP A;  2BVH A;  3LAE A;  3C0P A;  5AE1 A;  1E0Y A;  2BVF A;  1MBB A;  3D2D A;  5L6G A;  2Y08 A;  4PVJ A;  1WYG A;  3BW7 A;  1RM6 B;  3FW9 A;  4PZF A;  3RJA A;  1N60 C;  3SR6 B;  2WDW A;  2Q4W A;  3TSH A;  4MLA A;  4BC9 A;  3RJ8 A;  3AN1 A;  2P3H A;  5AE3 A;  1AHZ A;  2UUU A;  1QLT A;  5AE2 A;  2P4P A;  2QPM A;  1WVE A;  4PWC A;  1DII A;  3FWA A;  1HSK A;  4UD8 A;  3AM9 A;  3W8W A;  5D79 A;  2VFU A;  1AHU A;  2W54 A;  3LLB A;  3D2J A;  3D2H A;  1W1L A;  3I99 A;  5L6F A;  3TX1 A;  1W1Q A;  2GQT A;  2VFS A;  5ADZ A;  5HHZ A;  4ZOH B;  5HQX A;  2AXR A;  3FW8 A;  5G5G B;  1ZXI C;  1E8H A;  4BC7 A;  2VFV A;  3NRZ B;  1W1O A;  4PVE A;  1T3Q C;  3B9J B;  2PLI A;  1MBT A;  1FFV C;  1JRO A;  3HRD C;  5FXD A;  1F0X A;  2MBR A;  1I19 A;  3PM9 A;  5I1V A;  1W1J A;  1FO4 A;  1FIQ B;  2Y3S A;  1N5W C;  1N61 C;  5HMR A;  2Y3R A;  4PVK A;  1E8G A;  2EXR A;  1W1M A;  3S1D A;  3NS1 B;  4O95 A;  3DQ0 A;  4XLO A;  2YVS A;  3S1E A;  2BVG A;  5AWV A;  1N62 C;  4PVH A;  3W8Z A;  3VTE A;  1N63 C;  2W3R A;  3TSJ A;  1UXY A;  1W1K A;  4JB1 A;  4JAY A;  3GSY A;  4HG0 A;  5G5H B;  1WVF A;  2IPI A;  5I1W A;  2QKN A;  1AHV A;  2GQU A;  1VAO A;  1DZN A;  2R2Z A;  1ZR6 A;  2RK5 A;  4OAL A;  3DED A;  3NVY B;  2R8D A;  3W8X A;  3HSU A;  4BCA A;  1FFU C;  4PWB A;  1E8F A;  4ML8 A;  3FW7 A;  5FXP A;  2NQW A;  3NVW B;  1W1S A;  2Y4G A;  3S1F A;  3EUB 3;  3S1C A;  3NVV B;  2VFR A;  2P13 A;  4BBY A;  3NVZ B;  2O3G A;  4DNS A;  2W3S A;  4EC3 A;  2OAI A;  3KJM A;  1N5X A;  3AMZ A;  4PYT A;  1QLU A;  3PQB A;  2UUV A;  3ETR B;  1V97 A;  1JRP A;  2PLS A;  3JS8 A;  1DIQ A;  2I0K A;  2E3T A;  1VDV A;  1W1R A;  2VAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...