1UXYA

Murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGAFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 107
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1uxyA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1uxyA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1uxyA01
3DQ0A 2P4PA 3D2HA 3S1FA 4UD8A 2Q85A 1F0XA 4PWBA 2VFUA 5AE1A 1DIIA 2VFSA 4BBYA 1AHVA 1QLUA 3PM9A 2P13A 2E3TA 1UXYA 4JB1A 3FW7A 1N5WC 3GSYA 3HRDC 3NS1B 3W8ZA 1W1KA 3NVVB 4PVKA 4DNSA 3AN1A 2VAOA 4ZOHB 1WVEA 3EUB3 1E8GA 4PWCA 2BVFA 5FXEA 1ZR6A 1SB3B 4PVJA 4HG0A 2I0KA 3FW9A 1W1RA 1JRPA 4JAYA 4EC3A 3NVZB 2VFVA 5ADZA 3NRZB 2OAIA 1MBBA 3D2JA 3I99A 2EXRA 4PYTA 1V97A 2VFTA 3ETRB 1VDVA 3W8WA 1N63C 4BC7A 3D2DA 1JROA 4XLOA 2GQTA 1DZNA 3BW7A 1N5XA 3JS8A 2BVHA 3AM9A 5AE3A 4O95A 2YVSA 3S1DA 4OALA 1WVFA 5FXDA 4BC9A 2QKNA 1E0YA 5HHZA 5G5HB 2W3SA 3FWAA 2W3RA 2QPMA 1E8FA 1W1OA 3C0PA 4PZFA 3AMZA 1WYGA 1N62C 3KJMA 2P3HA 2R2ZA 4ML8A 1T3QC 5HMRA 1AHZA 3W8XA 1N60C 2W54A 5HQXA 3LAEA 1FIQB 3SR6B 4PVHA 1MBTA 1I19A 3VTEA 4BCAA 2R8DA 1W1QA 2VFRA 1HSKA 5FXPA 3FW8A 1DIQA 2W55A 5G5GB 5AE2A 3TSHA 2MBRA 3NVYB 1W1MA 1RM6B 1FFVC 1W1SA 3TSJA 4MLAA 2GQUA 2Q4WA 2PLIA 1AHUA 1FFUC 1N61C 2PLSA 3TX1A 1QLTA 2AXRA 2RK5A 3B9JB 5D79A 5FXFA 2O3GA 1FO4A 1VAOA 3DEDA 3NVWB 1E8HA 2BVGA 1W1JA 2NQWA 1W1LA 1ZXIC 3S1CA 4PVEA 3LLBA 3S1EA
chains in the Genus database with same CATH superfamily
5L6FA 3DQ0A 2P4PA 3D2HA 3S1FA 4UD8A 5K8EA 2Q85A 1F0XA 4PWBA 2VFUA 5AE1A 3HSUA 1DIIA 2VFSA 4BBYA 2Y08A 1AHVA 1QLUA 3PM9A 2P13A 2E3TA 1UXYA 4JB1A 3FW7A 1N5WC 3GSYA 3HRDC 3NS1B 3W8ZA 2Y3SA 1W1KA 3NVVB 2Y4GA 4PVKA 4DNSA 3AN1A 2VAOA 4ZOHB 1WVEA 3EUB3 1E8GA 4PWCA 2UUUA 2BVFA 5FXEA 1ZR6A 1SB3B 4PVJA 4HG0A 2I0KA 5I1VA 3FW9A 1W1RA 1JRPA 4JAYA 4EC3A 3NVZB 2VFVA 5ADZA 3NRZB 2OAIA 1MBBA 3D2JA 3I99A 2EXRA 4PYTA 1V97A 2VFTA 3ETRB 3RJAA 1VDVA 3W8WA 2WDWA 3EJEB 1N63C 4BC7A 3D2DA 1JROA 4XLOA 2GQTA 1DZNA 3BW7A 1N5XA 3JS8A 2BVHA 3AM9A 5AE3A 4O95A 2YVSA 3S1DA 4OALA 1WVFA 5FXDA 4BC9A 2QKNA 1E0YA 5HHZA 2Y3RA 5G5HB 2W3SA 3FWAA 2W3RA 2QPMA 1E8FA 1W1OA 3C0PA 4PZFA 3POPA 5AWVA 3AMZA 5I1WA 1WYGA 1N62C 3KJMA 2P3HA 2IPIA 2R2ZA 3EJDB 2UUVA 4ML8A 1T3QC 5HMRA 1AHZA 3W8XA 1N60C 2W54A 5HQXA 3LAEA 5L6GA 1FIQB 3SR6B 4PVHA 1MBTA 3RJ8A 1I19A 3VTEA 4BCAA 3EJBB 2R8DA 1W1QA 2VFRA 1HSKA 5FXPA 3FW8A 1DIQA 2W55A 5G5GB 5AE2A 3TSHA 2MBRA 3NVYB 1W1MA 1RM6B 1FFVC 1W1SA 3TSJA 4MLAA 2GQUA 2Q4WA 2PLIA 1AHUA 1FFUC 1N61C 2PLSA 3TX1A 1QLTA 2AXRA 2RK5A 3B9JB 3PQBA 5D79A 5FXFA 2O3GA 1FO4A 1VAOA 3DEDA 3NVWB 1E8HA 2BVGA 1W1JA 2NQWA 1W1LA 1ZXIC 3S1CA 4PVEA 3LLBA 3S1EA
chains in the Genus database with same CATH topology
5L6FA 3DQ0A 2P4PA 3D2HA 3S1FA 4UD8A 5K8EA 2Q85A 1F0XA 4PWBA 2VFUA 5AE1A 3HSUA 1DIIA 2VFSA 4BBYA 2Y08A 1AHVA 1QLUA 3PM9A 2P13A 2E3TA 1UXYA 4JB1A 3FW7A 1N5WC 3GSYA 3HRDC 3NS1B 3W8ZA 2Y3SA 1W1KA 3NVVB 2Y4GA 4PVKA 4DNSA 3AN1A 2VAOA 4ZOHB 1WVEA 3EUB3 1E8GA 4PWCA 2UUUA 2BVFA 5FXEA 1ZR6A 1SB3B 4PVJA 4HG0A 2I0KA 5I1VA 3FW9A 1W1RA 1JRPA 4JAYA 4EC3A 3NVZB 2VFVA 5ADZA 3NRZB 2OAIA 1MBBA 3D2JA 3I99A 2EXRA 4PYTA 1V97A 2VFTA 3ETRB 3RJAA 1VDVA 3W8WA 2WDWA 1N63C 4BC7A 3D2DA 1JROA 4XLOA 2GQTA 1DZNA 3BW7A 1N5XA 3JS8A 2BVHA 3AM9A 5AE3A 4O95A 2YVSA 3S1DA 4OALA 1WVFA 5FXDA 4BC9A 2QKNA 1E0YA 5HHZA 2Y3RA 5G5HB 2W3SA 3FWAA 2W3RA 2QPMA 1E8FA 1W1OA 3C0PA 4PZFA 3POPA 5AWVA 3AMZA 5I1WA 1WYGA 1N62C 3KJMA 2P3HA 2IPIA 2R2ZA 2UUVA 4ML8A 1T3QC 5HMRA 1AHZA 3W8XA 1N60C 2W54A 5HQXA 3LAEA 5L6GA 1FIQB 3SR6B 4PVHA 1MBTA 3RJ8A 1I19A 3VTEA 4BCAA 2R8DA 1W1QA 2VFRA 1HSKA 5FXPA 3FW8A 1DIQA 2W55A 5G5GB 5AE2A 3TSHA 2MBRA 3NVYB 1W1MA 1RM6B 1FFVC 1W1SA 3TSJA 4MLAA 2GQUA 2Q4WA 2PLIA 1AHUA 1FFUC 1N61C 2PLSA 3TX1A 1QLTA 2AXRA 2RK5A 3B9JB 3PQBA 5D79A 5FXFA 2O3GA 1FO4A 1VAOA 3DEDA 3NVWB 1E8HA 2BVGA 1W1JA 2NQWA 1W1LA 1ZXIC 3S1CA 4PVEA 3LLBA 3S1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ0 A;  2P4P A;  3D2H A;  3S1F A;  4UD8 A;  2Q85 A;  1F0X A;  4PWB A;  2VFU A;  5AE1 A;  1DII A;  2VFS A;  4BBY A;  1AHV A;  1QLU A;  3PM9 A;  2P13 A;  2E3T A;  1UXY A;  4JB1 A;  3FW7 A;  1N5W C;  3GSY A;  3HRD C;  3NS1 B;  3W8Z A;  1W1K A;  3NVV B;  4PVK A;  4DNS A;  3AN1 A;  2VAO A;  4ZOH B;  1WVE A;  3EUB 3;  1E8G A;  4PWC A;  2BVF A;  5FXE A;  1ZR6 A;  1SB3 B;  4PVJ A;  4HG0 A;  2I0K A;  3FW9 A;  1W1R A;  1JRP A;  4JAY A;  4EC3 A;  3NVZ B;  2VFV A;  5ADZ A;  3NRZ B;  2OAI A;  1MBB A;  3D2J A;  3I99 A;  2EXR A;  4PYT A;  1V97 A;  2VFT A;  3ETR B;  1VDV A;  3W8W A;  1N63 C;  4BC7 A;  3D2D A;  1JRO A;  4XLO A;  2GQT A;  1DZN A;  3BW7 A;  1N5X A;  3JS8 A;  2BVH A;  3AM9 A;  5AE3 A;  4O95 A;  2YVS A;  3S1D A;  4OAL A;  1WVF A;  5FXD A;  4BC9 A;  2QKN A;  1E0Y A;  5HHZ A;  5G5H B;  2W3S A;  3FWA A;  2W3R A;  2QPM A;  1E8F A;  1W1O A;  3C0P A;  4PZF A;  3AMZ A;  1WYG A;  1N62 C;  3KJM A;  2P3H A;  2R2Z A;  4ML8 A;  1T3Q C;  5HMR A;  1AHZ A;  3W8X A;  1N60 C;  2W54 A;  5HQX A;  3LAE A;  1FIQ B;  3SR6 B;  4PVH A;  1MBT A;  1I19 A;  3VTE A;  4BCA A;  2R8D A;  1W1Q A;  2VFR A;  1HSK A;  5FXP A;  3FW8 A;  1DIQ A;  2W55 A;  5G5G B;  5AE2 A;  3TSH A;  2MBR A;  3NVY B;  1W1M A;  1RM6 B;  1FFV C;  1W1S A;  3TSJ A;  4MLA A;  2GQU A;  2Q4W A;  2PLI A;  1AHU A;  1FFU C;  1N61 C;  2PLS A;  3TX1 A;  1QLT A;  2AXR A;  2RK5 A;  3B9J B;  5D79 A;  5FXF A;  2O3G A;  1FO4 A;  1VAO A;  3DED A;  3NVW B;  1E8H A;  2BVG A;  1W1J A;  2NQW A;  1W1L A;  1ZXI C;  3S1C A;  4PVE A;  3LLB A;  3S1E A; 
#chains in the Genus database with same CATH topology
 5L6F A;  3DQ0 A;  2P4P A;  3D2H A;  3S1F A;  4UD8 A;  5K8E A;  2Q85 A;  1F0X A;  4PWB A;  2VFU A;  5AE1 A;  3HSU A;  1DII A;  2VFS A;  4BBY A;  2Y08 A;  1AHV A;  1QLU A;  3PM9 A;  2P13 A;  2E3T A;  1UXY A;  4JB1 A;  3FW7 A;  1N5W C;  3GSY A;  3HRD C;  3NS1 B;  3W8Z A;  2Y3S A;  1W1K A;  3NVV B;  2Y4G A;  4PVK A;  4DNS A;  3AN1 A;  2VAO A;  4ZOH B;  1WVE A;  3EUB 3;  1E8G A;  4PWC A;  2UUU A;  2BVF A;  5FXE A;  1ZR6 A;  1SB3 B;  4PVJ A;  4HG0 A;  2I0K A;  5I1V A;  3FW9 A;  1W1R A;  1JRP A;  4JAY A;  4EC3 A;  3NVZ B;  2VFV A;  5ADZ A;  3NRZ B;  2OAI A;  1MBB A;  3D2J A;  3I99 A;  2EXR A;  4PYT A;  1V97 A;  2VFT A;  3ETR B;  3RJA A;  1VDV A;  3W8W A;  2WDW A;  3EJE B;  1N63 C;  4BC7 A;  3D2D A;  1JRO A;  4XLO A;  2GQT A;  1DZN A;  3BW7 A;  1N5X A;  3JS8 A;  2BVH A;  3AM9 A;  5AE3 A;  4O95 A;  2YVS A;  3S1D A;  4OAL A;  1WVF A;  5FXD A;  4BC9 A;  2QKN A;  1E0Y A;  5HHZ A;  2Y3R A;  5G5H B;  2W3S A;  3FWA A;  2W3R A;  2QPM A;  1E8F A;  1W1O A;  3C0P A;  4PZF A;  3POP A;  5AWV A;  3AMZ A;  5I1W A;  1WYG A;  1N62 C;  3KJM A;  2P3H A;  2IPI A;  2R2Z A;  3EJD B;  2UUV A;  4ML8 A;  1T3Q C;  5HMR A;  1AHZ A;  3W8X A;  1N60 C;  2W54 A;  5HQX A;  3LAE A;  5L6G A;  1FIQ B;  3SR6 B;  4PVH A;  1MBT A;  3RJ8 A;  1I19 A;  3VTE A;  4BCA A;  3EJB B;  2R8D A;  1W1Q A;  2VFR A;  1HSK A;  5FXP A;  3FW8 A;  1DIQ A;  2W55 A;  5G5G B;  5AE2 A;  3TSH A;  2MBR A;  3NVY B;  1W1M A;  1RM6 B;  1FFV C;  1W1S A;  3TSJ A;  4MLA A;  2GQU A;  2Q4W A;  2PLI A;  1AHU A;  1FFU C;  1N61 C;  2PLS A;  3TX1 A;  1QLT A;  2AXR A;  2RK5 A;  3B9J B;  3PQB A;  5D79 A;  5FXF A;  2O3G A;  1FO4 A;  1VAO A;  3DED A;  3NVW B;  1E8H A;  2BVG A;  1W1J A;  2NQW A;  1W1L A;  1ZXI C;  3S1C A;  4PVE A;  3LLB A;  3S1E A; 
#chains in the Genus database with same CATH homology
 5L6F A;  3DQ0 A;  2P4P A;  3D2H A;  3S1F A;  4UD8 A;  5K8E A;  2Q85 A;  1F0X A;  4PWB A;  2VFU A;  5AE1 A;  3HSU A;  1DII A;  2VFS A;  4BBY A;  2Y08 A;  1AHV A;  1QLU A;  3PM9 A;  2P13 A;  2E3T A;  1UXY A;  4JB1 A;  3FW7 A;  1N5W C;  3GSY A;  3HRD C;  3NS1 B;  3W8Z A;  2Y3S A;  1W1K A;  3NVV B;  2Y4G A;  4PVK A;  4DNS A;  3AN1 A;  2VAO A;  4ZOH B;  1WVE A;  3EUB 3;  1E8G A;  4PWC A;  2UUU A;  2BVF A;  5FXE A;  1ZR6 A;  1SB3 B;  4PVJ A;  4HG0 A;  2I0K A;  5I1V A;  3FW9 A;  1W1R A;  1JRP A;  4JAY A;  4EC3 A;  3NVZ B;  2VFV A;  5ADZ A;  3NRZ B;  2OAI A;  1MBB A;  3D2J A;  3I99 A;  2EXR A;  4PYT A;  1V97 A;  2VFT A;  3ETR B;  3RJA A;  1VDV A;  3W8W A;  2WDW A;  1N63 C;  4BC7 A;  3D2D A;  1JRO A;  4XLO A;  2GQT A;  1DZN A;  3BW7 A;  1N5X A;  3JS8 A;  2BVH A;  3AM9 A;  5AE3 A;  4O95 A;  2YVS A;  3S1D A;  4OAL A;  1WVF A;  5FXD A;  4BC9 A;  2QKN A;  1E0Y A;  5HHZ A;  2Y3R A;  5G5H B;  2W3S A;  3FWA A;  2W3R A;  2QPM A;  1E8F A;  1W1O A;  3C0P A;  4PZF A;  3POP A;  5AWV A;  3AMZ A;  5I1W A;  1WYG A;  1N62 C;  3KJM A;  2P3H A;  2IPI A;  2R2Z A;  2UUV A;  4ML8 A;  1T3Q C;  5HMR A;  1AHZ A;  3W8X A;  1N60 C;  2W54 A;  5HQX A;  3LAE A;  5L6G A;  1FIQ B;  3SR6 B;  4PVH A;  1MBT A;  3RJ8 A;  1I19 A;  3VTE A;  4BCA A;  2R8D A;  1W1Q A;  2VFR A;  1HSK A;  5FXP A;  3FW8 A;  1DIQ A;  2W55 A;  5G5G B;  5AE2 A;  3TSH A;  2MBR A;  3NVY B;  1W1M A;  1RM6 B;  1FFV C;  1W1S A;  3TSJ A;  4MLA A;  2GQU A;  2Q4W A;  2PLI A;  1AHU A;  1FFU C;  1N61 C;  2PLS A;  3TX1 A;  1QLT A;  2AXR A;  2RK5 A;  3B9J B;  3PQB A;  5D79 A;  5FXF A;  2O3G A;  1FO4 A;  1VAO A;  3DED A;  3NVW B;  1E8H A;  2BVG A;  1W1J A;  2NQW A;  1W1L A;  1ZXI C;  3S1C A;  4PVE A;  3LLB A;  3S1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...