1UXYA

Murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGAFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
total genus 107
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1uxyA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1uxyA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1uxyA01
3C0PA 1RM6B 3BW7A 1N5WC 4PVKA 3DEDA 3S1CA 1MBBA 2MBRA 5FXEA 1E8GA 5FXFA 2EXRA 4DNSA 5AE3A 1N63C 1W1MA 2O3GA 3TSHA 4UD8A 2VFUA 2W54A 3TSJA 3KJMA 2E3TA 1FFVC 2GQUA 1T3QC 3FW8A 1AHZA 1UXYA 3B9JB 3AN1A 3D2DA 2BVFA 2OAIA 4BCAA 1W1SA 1FIQB 3ETRB 5HQXA 1E8FA 3LAEA 2QPMA 3I99A 1WVEA 4EC3A 3HRDC 3D2HA 4PVHA 2VFTA 2NQWA 3W8WA 5AE1A 1E0YA 5FXPA 1ZR6A 5G5GB 1F0XA 2RK5A 1W1KA 1VDVA 1W1QA 1JRPA 3W8XA 2W3SA 1WYGA 4OALA 4O95A 1WVFA 4JB1A 1SB3B 3FW9A 4HG0A 2AXRA 3NVYB 2R8DA 2BVGA 2PLSA 3JS8A 2VFSA 3FW7A 3GSYA 4JAYA 4BC7A 3S1EA 3NRZB 1I19A 5D79A 1MBTA 3AM9A 2BVHA 2QKNA 2P3HA 5FXDA 3S1DA 1N60C 2W55A 2P4PA 2I0KA 2W3RA 1VAOA 3S1FA 3NVZB 1V97A 2YVSA 3NVVB 4ML8A 4BBYA 3W8ZA 1HSKA 3LLBA 1N5XA 1W1JA 4ZOHB 1W1RA 1DIIA 1QLUA 1AHUA 3PM9A 4MLAA 2PLIA 1N62C 1W1OA 3NVWB 1W1LA 4PWBA 4XLOA 3FWAA 3VTEA 2VFRA 4BC9A 4PYTA 5AE2A 1E8HA 1DZNA 1FFUC 1AHVA 5HHZA 1N61C 3EUB3 2R2ZA 5G5HB 2Q4WA 2VFVA 2VAOA 5HMRA 4PVJA 3SR6B 2GQTA 4PZFA 1DIQA 3DQ0A 1QLTA 5ADZA 1JROA 3TX1A 1ZXIC 3AMZA 4PVEA 3NS1B 2Q85A 3D2JA 4PWCA 1FO4A 2P13A
chains in the Genus database with same CATH superfamily
3C0PA 1RM6B 3BW7A 1N5WC 4PVKA 3DEDA 3S1CA 1MBBA 2MBRA 5FXEA 1E8GA 5FXFA 2EXRA 4DNSA 5AE3A 1N63C 1W1MA 2O3GA 3PQBA 3TSHA 4UD8A 2VFUA 2W54A 3TSJA 3KJMA 5L6FA 2E3TA 1FFVC 2GQUA 5K8EA 2UUUA 2IPIA 1T3QC 3FW8A 3RJAA 1AHZA 1UXYA 3B9JB 3AN1A 3D2DA 2BVFA 2OAIA 4BCAA 1W1SA 1FIQB 3ETRB 5HQXA 1E8FA 3LAEA 2QPMA 3I99A 1WVEA 4EC3A 3HRDC 3D2HA 4PVHA 2VFTA 2NQWA 2WDWA 3W8WA 5AE1A 1E0YA 5FXPA 1ZR6A 5G5GB 1F0XA 2RK5A 1W1KA 1VDVA 1W1QA 5I1VA 1JRPA 3EJEB 3W8XA 2W3SA 1WYGA 4OALA 2Y3SA 5I1WA 4O95A 1WVFA 4JB1A 1SB3B 3FW9A 3EJDB 4HG0A 2AXRA 3NVYB 3HSUA 2R8DA 2BVGA 2PLSA 3JS8A 2VFSA 3FW7A 3GSYA 4JAYA 4BC7A 5AWVA 3S1EA 3NRZB 1I19A 5D79A 1MBTA 3AM9A 2BVHA 2QKNA 2P3HA 2UUVA 5FXDA 3S1DA 3POPA 1N60C 2W55A 2P4PA 2I0KA 2W3RA 1VAOA 3EJBB 3S1FA 3NVZB 1V97A 3NVVB 2YVSA 5L6GA 4ML8A 4BBYA 3W8ZA 1HSKA 2Y3RA 3LLBA 1N5XA 1W1JA 4ZOHB 1W1RA 1DIIA 1QLUA 1AHUA 3PM9A 3RJ8A 4MLAA 2Y08A 2PLIA 1N62C 1W1OA 3NVWB 1W1LA 2Y4GA 4PWBA 4XLOA 3FWAA 3VTEA 2VFRA 4BC9A 4PYTA 5AE2A 1E8HA 1DZNA 1FFUC 1AHVA 5HHZA 1N61C 3EUB3 2R2ZA 5G5HB 2Q4WA 2VFVA 2VAOA 5HMRA 4PVJA 3SR6B 2GQTA 4PZFA 1DIQA 3DQ0A 1QLTA 5ADZA 1JROA 3TX1A 1ZXIC 3AMZA 4PVEA 3NS1B 2Q85A 3D2JA 4PWCA 1FO4A 2P13A
chains in the Genus database with same CATH topology
3C0PA 1RM6B 3BW7A 1N5WC 4PVKA 3DEDA 3S1CA 1MBBA 2MBRA 5FXEA 1E8GA 5FXFA 2EXRA 4DNSA 5AE3A 1N63C 1W1MA 2O3GA 3PQBA 3TSHA 4UD8A 2VFUA 2W54A 3TSJA 3KJMA 5L6FA 2E3TA 1FFVC 2GQUA 5K8EA 2UUUA 2IPIA 1T3QC 3FW8A 3RJAA 1AHZA 1UXYA 3B9JB 3AN1A 3D2DA 2BVFA 2OAIA 4BCAA 1W1SA 1FIQB 3ETRB 5HQXA 1E8FA 3LAEA 2QPMA 3I99A 1WVEA 4EC3A 3HRDC 3D2HA 4PVHA 2VFTA 2NQWA 2WDWA 3W8WA 5AE1A 1E0YA 5FXPA 1ZR6A 5G5GB 1F0XA 2RK5A 1W1KA 1VDVA 1W1QA 5I1VA 1JRPA 3W8XA 2W3SA 1WYGA 4OALA 2Y3SA 5I1WA 4O95A 1WVFA 4JB1A 1SB3B 3FW9A 4HG0A 2AXRA 3NVYB 3HSUA 2R8DA 2BVGA 2PLSA 3JS8A 2VFSA 3FW7A 3GSYA 4JAYA 4BC7A 5AWVA 3S1EA 3NRZB 1I19A 5D79A 1MBTA 3AM9A 2BVHA 2QKNA 2P3HA 2UUVA 5FXDA 3S1DA 3POPA 1N60C 2W55A 2P4PA 2I0KA 2W3RA 1VAOA 3S1FA 3NVZB 1V97A 2YVSA 3NVVB 5L6GA 4ML8A 4BBYA 3W8ZA 1HSKA 2Y3RA 3LLBA 1N5XA 1W1JA 4ZOHB 1W1RA 1DIIA 1QLUA 1AHUA 3PM9A 3RJ8A 4MLAA 2Y08A 2PLIA 1N62C 1W1OA 3NVWB 1W1LA 2Y4GA 4PWBA 4XLOA 3FWAA 3VTEA 2VFRA 4BC9A 4PYTA 5AE2A 1E8HA 1DZNA 1FFUC 1AHVA 5HHZA 1N61C 3EUB3 2R2ZA 5G5HB 2Q4WA 2VFVA 2VAOA 5HMRA 4PVJA 3SR6B 2GQTA 4PZFA 1DIQA 3DQ0A 1QLTA 5ADZA 1JROA 3TX1A 1ZXIC 3AMZA 4PVEA 3NS1B 2Q85A 3D2JA 4PWCA 1FO4A 2P13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C0P A;  1RM6 B;  3BW7 A;  1N5W C;  4PVK A;  3DED A;  3S1C A;  1MBB A;  2MBR A;  5FXE A;  1E8G A;  5FXF A;  2EXR A;  4DNS A;  5AE3 A;  1N63 C;  1W1M A;  2O3G A;  3TSH A;  4UD8 A;  2VFU A;  2W54 A;  3TSJ A;  3KJM A;  2E3T A;  1FFV C;  2GQU A;  1T3Q C;  3FW8 A;  1AHZ A;  1UXY A;  3B9J B;  3AN1 A;  3D2D A;  2BVF A;  2OAI A;  4BCA A;  1W1S A;  1FIQ B;  3ETR B;  5HQX A;  1E8F A;  3LAE A;  2QPM A;  3I99 A;  1WVE A;  4EC3 A;  3HRD C;  3D2H A;  4PVH A;  2VFT A;  2NQW A;  3W8W A;  5AE1 A;  1E0Y A;  5FXP A;  1ZR6 A;  5G5G B;  1F0X A;  2RK5 A;  1W1K A;  1VDV A;  1W1Q A;  1JRP A;  3W8X A;  2W3S A;  1WYG A;  4OAL A;  4O95 A;  1WVF A;  4JB1 A;  1SB3 B;  3FW9 A;  4HG0 A;  2AXR A;  3NVY B;  2R8D A;  2BVG A;  2PLS A;  3JS8 A;  2VFS A;  3FW7 A;  3GSY A;  4JAY A;  4BC7 A;  3S1E A;  3NRZ B;  1I19 A;  5D79 A;  1MBT A;  3AM9 A;  2BVH A;  2QKN A;  2P3H A;  5FXD A;  3S1D A;  1N60 C;  2W55 A;  2P4P A;  2I0K A;  2W3R A;  1VAO A;  3S1F A;  3NVZ B;  1V97 A;  2YVS A;  3NVV B;  4ML8 A;  4BBY A;  3W8Z A;  1HSK A;  3LLB A;  1N5X A;  1W1J A;  4ZOH B;  1W1R A;  1DII A;  1QLU A;  1AHU A;  3PM9 A;  4MLA A;  2PLI A;  1N62 C;  1W1O A;  3NVW B;  1W1L A;  4PWB A;  4XLO A;  3FWA A;  3VTE A;  2VFR A;  4BC9 A;  4PYT A;  5AE2 A;  1E8H A;  1DZN A;  1FFU C;  1AHV A;  5HHZ A;  1N61 C;  3EUB 3;  2R2Z A;  5G5H B;  2Q4W A;  2VFV A;  2VAO A;  5HMR A;  4PVJ A;  3SR6 B;  2GQT A;  4PZF A;  1DIQ A;  3DQ0 A;  1QLT A;  5ADZ A;  1JRO A;  3TX1 A;  1ZXI C;  3AMZ A;  4PVE A;  3NS1 B;  2Q85 A;  3D2J A;  4PWC A;  1FO4 A;  2P13 A; 
#chains in the Genus database with same CATH topology
 3C0P A;  1RM6 B;  3BW7 A;  1N5W C;  4PVK A;  3DED A;  3S1C A;  1MBB A;  2MBR A;  5FXE A;  1E8G A;  5FXF A;  2EXR A;  4DNS A;  5AE3 A;  1N63 C;  1W1M A;  2O3G A;  3PQB A;  3TSH A;  4UD8 A;  2VFU A;  2W54 A;  3TSJ A;  3KJM A;  5L6F A;  2E3T A;  1FFV C;  2GQU A;  5K8E A;  2UUU A;  2IPI A;  1T3Q C;  3FW8 A;  3RJA A;  1AHZ A;  1UXY A;  3B9J B;  3AN1 A;  3D2D A;  2BVF A;  2OAI A;  4BCA A;  1W1S A;  1FIQ B;  3ETR B;  5HQX A;  1E8F A;  3LAE A;  2QPM A;  3I99 A;  1WVE A;  4EC3 A;  3HRD C;  3D2H A;  4PVH A;  2VFT A;  2NQW A;  2WDW A;  3W8W A;  5AE1 A;  1E0Y A;  5FXP A;  1ZR6 A;  5G5G B;  1F0X A;  2RK5 A;  1W1K A;  1VDV A;  1W1Q A;  5I1V A;  1JRP A;  3EJE B;  3W8X A;  2W3S A;  1WYG A;  4OAL A;  2Y3S A;  5I1W A;  4O95 A;  1WVF A;  4JB1 A;  1SB3 B;  3FW9 A;  3EJD B;  4HG0 A;  2AXR A;  3NVY B;  3HSU A;  2R8D A;  2BVG A;  2PLS A;  3JS8 A;  2VFS A;  3FW7 A;  3GSY A;  4JAY A;  4BC7 A;  5AWV A;  3S1E A;  3NRZ B;  1I19 A;  5D79 A;  1MBT A;  3AM9 A;  2BVH A;  2QKN A;  2P3H A;  2UUV A;  5FXD A;  3S1D A;  3POP A;  1N60 C;  2W55 A;  2P4P A;  2I0K A;  2W3R A;  1VAO A;  3EJB B;  3S1F A;  3NVZ B;  1V97 A;  3NVV B;  2YVS A;  5L6G A;  4ML8 A;  4BBY A;  3W8Z A;  1HSK A;  2Y3R A;  3LLB A;  1N5X A;  1W1J A;  4ZOH B;  1W1R A;  1DII A;  1QLU A;  1AHU A;  3PM9 A;  3RJ8 A;  4MLA A;  2Y08 A;  2PLI A;  1N62 C;  1W1O A;  3NVW B;  1W1L A;  2Y4G A;  4PWB A;  4XLO A;  3FWA A;  3VTE A;  2VFR A;  4BC9 A;  4PYT A;  5AE2 A;  1E8H A;  1DZN A;  1FFU C;  1AHV A;  5HHZ A;  1N61 C;  3EUB 3;  2R2Z A;  5G5H B;  2Q4W A;  2VFV A;  2VAO A;  5HMR A;  4PVJ A;  3SR6 B;  2GQT A;  4PZF A;  1DIQ A;  3DQ0 A;  1QLT A;  5ADZ A;  1JRO A;  3TX1 A;  1ZXI C;  3AMZ A;  4PVE A;  3NS1 B;  2Q85 A;  3D2J A;  4PWC A;  1FO4 A;  2P13 A; 
#chains in the Genus database with same CATH homology
 3C0P A;  1RM6 B;  3BW7 A;  1N5W C;  4PVK A;  3DED A;  3S1C A;  1MBB A;  2MBR A;  5FXE A;  1E8G A;  5FXF A;  2EXR A;  4DNS A;  5AE3 A;  1N63 C;  1W1M A;  2O3G A;  3PQB A;  3TSH A;  4UD8 A;  2VFU A;  2W54 A;  3TSJ A;  3KJM A;  5L6F A;  2E3T A;  1FFV C;  2GQU A;  5K8E A;  2UUU A;  2IPI A;  1T3Q C;  3FW8 A;  3RJA A;  1AHZ A;  1UXY A;  3B9J B;  3AN1 A;  3D2D A;  2BVF A;  2OAI A;  4BCA A;  1W1S A;  1FIQ B;  3ETR B;  5HQX A;  1E8F A;  3LAE A;  2QPM A;  3I99 A;  1WVE A;  4EC3 A;  3HRD C;  3D2H A;  4PVH A;  2VFT A;  2NQW A;  2WDW A;  3W8W A;  5AE1 A;  1E0Y A;  5FXP A;  1ZR6 A;  5G5G B;  1F0X A;  2RK5 A;  1W1K A;  1VDV A;  1W1Q A;  5I1V A;  1JRP A;  3W8X A;  2W3S A;  1WYG A;  4OAL A;  2Y3S A;  5I1W A;  4O95 A;  1WVF A;  4JB1 A;  1SB3 B;  3FW9 A;  4HG0 A;  2AXR A;  3NVY B;  3HSU A;  2R8D A;  2BVG A;  2PLS A;  3JS8 A;  2VFS A;  3FW7 A;  3GSY A;  4JAY A;  4BC7 A;  5AWV A;  3S1E A;  3NRZ B;  1I19 A;  5D79 A;  1MBT A;  3AM9 A;  2BVH A;  2QKN A;  2P3H A;  2UUV A;  5FXD A;  3S1D A;  3POP A;  1N60 C;  2W55 A;  2P4P A;  2I0K A;  2W3R A;  1VAO A;  3S1F A;  3NVZ B;  1V97 A;  2YVS A;  3NVV B;  5L6G A;  4ML8 A;  4BBY A;  3W8Z A;  1HSK A;  2Y3R A;  3LLB A;  1N5X A;  1W1J A;  4ZOH B;  1W1R A;  1DII A;  1QLU A;  1AHU A;  3PM9 A;  3RJ8 A;  4MLA A;  2Y08 A;  2PLI A;  1N62 C;  1W1O A;  3NVW B;  1W1L A;  2Y4G A;  4PWB A;  4XLO A;  3FWA A;  3VTE A;  2VFR A;  4BC9 A;  4PYT A;  5AE2 A;  1E8H A;  1DZN A;  1FFU C;  1AHV A;  5HHZ A;  1N61 C;  3EUB 3;  2R2Z A;  5G5H B;  2Q4W A;  2VFV A;  2VAO A;  5HMR A;  4PVJ A;  3SR6 B;  2GQT A;  4PZF A;  1DIQ A;  3DQ0 A;  1QLT A;  5ADZ A;  1JRO A;  3TX1 A;  1ZXI C;  3AMZ A;  4PVE A;  3NS1 B;  2Q85 A;  3D2J A;  4PWC A;  1FO4 A;  2P13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...