1UXYA

Murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGAFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 107
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1uxyA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1uxyA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1uxyA01
1AHVA 3AN1A 3TSHA 1ZR6A 1FO4A 1V97A 2YVSA 1E0YA 3PM9A 3S1DA 2BVHA 2P3HA 2QKNA 1I19A 3NVWB 3W8XA 1WVFA 1VAOA 2RK5A 3KJMA 3LAEA 3S1CA 2O3GA 3DEDA 4BC7A 3D2HA 3NVVB 3B9JB 1F0XA 4O95A 2P4PA 2VFVA 3TX1A 2E3TA 2VAOA 2OAIA 4PVHA 5HHZA 5D79A 1AHZA 1E8HA 5FXEA 4BCAA 1DIQA 1N5XA 2NQWA 1N63C 1W1MA 1QLTA 1JROA 2GQTA 3C0PA 1FIQB 2AXRA 1AHUA 2VFSA 2PLIA 5ADZA 1W1QA 1W1OA 1RM6B 1VDVA 3S1FA 4JAYA 1W1RA 2Q85A 3AM9A 2Q4WA 5FXFA 5FXPA 4HG0A 2I0KA 4PVJA 1DIIA 4JB1A 2W3RA 3W8ZA 3D2JA 3TSJA 3NVYB 5HMRA 3FW9A 2R2ZA 4ML8A 4PZFA 3SR6B 1JRPA 2W3SA 4PWBA 4OALA 2W54A 1E8GA 3GSYA 5FXDA 3VTEA 4DNSA 1W1JA 1N61C 1W1LA 3EUB3 1MBTA 3HRDC 1WVEA 1FFUC 1UXYA 1DZNA 4PWCA 2P13A 3NRZB 3FW7A 1W1KA 2VFTA 3I99A 3D2DA 4XLOA 3DQ0A 2VFRA 3AMZA 3FWAA 3NVZB 3S1EA 4BBYA 4EC3A 5G5GB 3JS8A 1QLUA 1SB3B 2BVGA 1HSKA 5AE3A 1N60C 4MLAA 3W8WA 3BW7A 1E8FA 4ZOHB 2W55A 1ZXIC 1W1SA 2QPMA 5AE1A 1FFVC 2GQUA 2BVFA 4PVEA 1MBBA 1T3QC 3NS1B 2PLSA 1N62C 2R8DA 2MBRA 2VFUA 4BC9A 3FW8A 1N5WC 3LLBA 5HQXA 1WYGA 4UD8A 4PVKA 3ETRB 2EXRA 4PYTA 5G5HB 5AE2A
chains in the Genus database with same CATH superfamily
1AHVA 3AN1A 3TSHA 1ZR6A 1FO4A 1V97A 2YVSA 1E0YA 3PM9A 3S1DA 2BVHA 2P3HA 2QKNA 1I19A 3NVWB 3W8XA 1WVFA 1VAOA 2RK5A 3KJMA 3LAEA 3S1CA 2O3GA 5AWVA 3DEDA 4BC7A 3D2HA 3NVVB 3B9JB 1F0XA 4O95A 2P4PA 5L6GA 3POPA 2VFVA 3TX1A 2E3TA 2VAOA 2OAIA 4PVHA 5HHZA 5D79A 1AHZA 2Y3RA 1E8HA 5FXEA 4BCAA 1DIQA 1N5XA 2NQWA 1N63C 1W1MA 1QLTA 1JROA 2GQTA 3C0PA 2Y08A 1FIQB 2AXRA 1AHUA 2VFSA 2PLIA 2WDWA 5ADZA 1W1QA 1W1OA 1RM6B 1VDVA 3S1FA 4JAYA 1W1RA 2IPIA 2Q85A 3AM9A 2Q4WA 5FXFA 5FXPA 4HG0A 5L6FA 2I0KA 4PVJA 1DIIA 4JB1A 2W3RA 3W8ZA 3D2JA 3TSJA 3NVYB 5HMRA 3FW9A 2R2ZA 4ML8A 4PZFA 3SR6B 1JRPA 2W3SA 4PWBA 4OALA 2W54A 1E8GA 3HSUA 3GSYA 5I1VA 5FXDA 3VTEA 2Y3SA 4DNSA 1W1JA 3RJAA 1N61C 1W1LA 3EUB3 1MBTA 2Y4GA 3HRDC 1WVEA 1FFUC 1UXYA 1DZNA 3EJBB 4PWCA 2P13A 3NRZB 3RJ8A 3FW7A 1W1KA 2VFTA 3I99A 3D2DA 4XLOA 3DQ0A 2VFRA 3AMZA 3FWAA 3NVZB 3S1EA 4BBYA 4EC3A 5G5GB 3EJDB 3JS8A 1QLUA 1SB3B 3PQBA 2BVGA 1HSKA 5AE3A 1N60C 4MLAA 3W8WA 3BW7A 1E8FA 4ZOHB 2W55A 1ZXIC 1W1SA 2QPMA 5AE1A 1FFVC 2GQUA 2BVFA 2UUUA 4PVEA 1MBBA 1T3QC 5I1WA 3NS1B 2PLSA 1N62C 2R8DA 5K8EA 2MBRA 2VFUA 4BC9A 3FW8A 1N5WC 3LLBA 3EJEB 5HQXA 1WYGA 4UD8A 2UUVA 4PVKA 3ETRB 2EXRA 4PYTA 5G5HB 5AE2A
chains in the Genus database with same CATH topology
1AHVA 3AN1A 3TSHA 1ZR6A 1FO4A 1V97A 2YVSA 1E0YA 3PM9A 3S1DA 2BVHA 2P3HA 2QKNA 1I19A 3NVWB 3W8XA 1WVFA 1VAOA 2RK5A 3KJMA 3LAEA 3S1CA 2O3GA 5AWVA 3DEDA 4BC7A 3D2HA 3NVVB 3B9JB 1F0XA 4O95A 2P4PA 5L6GA 3POPA 2VFVA 3TX1A 2E3TA 2VAOA 2OAIA 4PVHA 5HHZA 5D79A 1AHZA 2Y3RA 1E8HA 5FXEA 4BCAA 1DIQA 1N5XA 2NQWA 1N63C 1W1MA 1QLTA 1JROA 2GQTA 3C0PA 2Y08A 1FIQB 2AXRA 1AHUA 2VFSA 2PLIA 2WDWA 5ADZA 1W1QA 1W1OA 1RM6B 1VDVA 3S1FA 4JAYA 1W1RA 2IPIA 2Q85A 3AM9A 2Q4WA 5FXFA 5FXPA 4HG0A 5L6FA 2I0KA 4PVJA 1DIIA 4JB1A 2W3RA 3W8ZA 3D2JA 3TSJA 3NVYB 5HMRA 3FW9A 2R2ZA 4ML8A 4PZFA 3SR6B 1JRPA 2W3SA 4PWBA 4OALA 2W54A 1E8GA 3HSUA 3GSYA 5I1VA 5FXDA 3VTEA 2Y3SA 4DNSA 1W1JA 3RJAA 1N61C 1W1LA 3EUB3 1MBTA 2Y4GA 3HRDC 1WVEA 1FFUC 1UXYA 1DZNA 4PWCA 2P13A 3NRZB 3RJ8A 3FW7A 1W1KA 2VFTA 3I99A 3D2DA 4XLOA 3DQ0A 2VFRA 3AMZA 3FWAA 3NVZB 3S1EA 4BBYA 4EC3A 5G5GB 3JS8A 1QLUA 1SB3B 3PQBA 2BVGA 1HSKA 5AE3A 1N60C 4MLAA 3W8WA 3BW7A 1E8FA 4ZOHB 2W55A 1ZXIC 1W1SA 2QPMA 5AE1A 1FFVC 2GQUA 2BVFA 2UUUA 4PVEA 1MBBA 1T3QC 5I1WA 3NS1B 2PLSA 1N62C 2R8DA 5K8EA 2MBRA 2VFUA 4BC9A 3FW8A 1N5WC 3LLBA 5HQXA 1WYGA 4UD8A 2UUVA 4PVKA 3ETRB 2EXRA 4PYTA 5G5HB 5AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHV A;  3AN1 A;  3TSH A;  1ZR6 A;  1FO4 A;  1V97 A;  2YVS A;  1E0Y A;  3PM9 A;  3S1D A;  2BVH A;  2P3H A;  2QKN A;  1I19 A;  3NVW B;  3W8X A;  1WVF A;  1VAO A;  2RK5 A;  3KJM A;  3LAE A;  3S1C A;  2O3G A;  3DED A;  4BC7 A;  3D2H A;  3NVV B;  3B9J B;  1F0X A;  4O95 A;  2P4P A;  2VFV A;  3TX1 A;  2E3T A;  2VAO A;  2OAI A;  4PVH A;  5HHZ A;  5D79 A;  1AHZ A;  1E8H A;  5FXE A;  4BCA A;  1DIQ A;  1N5X A;  2NQW A;  1N63 C;  1W1M A;  1QLT A;  1JRO A;  2GQT A;  3C0P A;  1FIQ B;  2AXR A;  1AHU A;  2VFS A;  2PLI A;  5ADZ A;  1W1Q A;  1W1O A;  1RM6 B;  1VDV A;  3S1F A;  4JAY A;  1W1R A;  2Q85 A;  3AM9 A;  2Q4W A;  5FXF A;  5FXP A;  4HG0 A;  2I0K A;  4PVJ A;  1DII A;  4JB1 A;  2W3R A;  3W8Z A;  3D2J A;  3TSJ A;  3NVY B;  5HMR A;  3FW9 A;  2R2Z A;  4ML8 A;  4PZF A;  3SR6 B;  1JRP A;  2W3S A;  4PWB A;  4OAL A;  2W54 A;  1E8G A;  3GSY A;  5FXD A;  3VTE A;  4DNS A;  1W1J A;  1N61 C;  1W1L A;  3EUB 3;  1MBT A;  3HRD C;  1WVE A;  1FFU C;  1UXY A;  1DZN A;  4PWC A;  2P13 A;  3NRZ B;  3FW7 A;  1W1K A;  2VFT A;  3I99 A;  3D2D A;  4XLO A;  3DQ0 A;  2VFR A;  3AMZ A;  3FWA A;  3NVZ B;  3S1E A;  4BBY A;  4EC3 A;  5G5G B;  3JS8 A;  1QLU A;  1SB3 B;  2BVG A;  1HSK A;  5AE3 A;  1N60 C;  4MLA A;  3W8W A;  3BW7 A;  1E8F A;  4ZOH B;  2W55 A;  1ZXI C;  1W1S A;  2QPM A;  5AE1 A;  1FFV C;  2GQU A;  2BVF A;  4PVE A;  1MBB A;  1T3Q C;  3NS1 B;  2PLS A;  1N62 C;  2R8D A;  2MBR A;  2VFU A;  4BC9 A;  3FW8 A;  1N5W C;  3LLB A;  5HQX A;  1WYG A;  4UD8 A;  4PVK A;  3ETR B;  2EXR A;  4PYT A;  5G5H B;  5AE2 A; 
#chains in the Genus database with same CATH topology
 1AHV A;  3AN1 A;  3TSH A;  1ZR6 A;  1FO4 A;  1V97 A;  2YVS A;  1E0Y A;  3PM9 A;  3S1D A;  2BVH A;  2P3H A;  2QKN A;  1I19 A;  3NVW B;  3W8X A;  1WVF A;  1VAO A;  2RK5 A;  3KJM A;  3LAE A;  3S1C A;  2O3G A;  5AWV A;  3DED A;  4BC7 A;  3D2H A;  3NVV B;  3B9J B;  1F0X A;  4O95 A;  2P4P A;  5L6G A;  3POP A;  2VFV A;  3TX1 A;  2E3T A;  2VAO A;  2OAI A;  4PVH A;  5HHZ A;  5D79 A;  1AHZ A;  2Y3R A;  1E8H A;  5FXE A;  4BCA A;  1DIQ A;  1N5X A;  2NQW A;  1N63 C;  1W1M A;  1QLT A;  1JRO A;  2GQT A;  3C0P A;  2Y08 A;  1FIQ B;  2AXR A;  1AHU A;  2VFS A;  2PLI A;  2WDW A;  5ADZ A;  1W1Q A;  1W1O A;  1RM6 B;  1VDV A;  3S1F A;  4JAY A;  1W1R A;  2IPI A;  2Q85 A;  3AM9 A;  2Q4W A;  5FXF A;  5FXP A;  4HG0 A;  5L6F A;  2I0K A;  4PVJ A;  1DII A;  4JB1 A;  2W3R A;  3W8Z A;  3D2J A;  3TSJ A;  3NVY B;  5HMR A;  3FW9 A;  2R2Z A;  4ML8 A;  4PZF A;  3SR6 B;  1JRP A;  2W3S A;  4PWB A;  4OAL A;  2W54 A;  1E8G A;  3HSU A;  3GSY A;  5I1V A;  5FXD A;  3VTE A;  2Y3S A;  4DNS A;  1W1J A;  3RJA A;  1N61 C;  1W1L A;  3EUB 3;  1MBT A;  2Y4G A;  3HRD C;  1WVE A;  1FFU C;  1UXY A;  1DZN A;  3EJB B;  4PWC A;  2P13 A;  3NRZ B;  3RJ8 A;  3FW7 A;  1W1K A;  2VFT A;  3I99 A;  3D2D A;  4XLO A;  3DQ0 A;  2VFR A;  3AMZ A;  3FWA A;  3NVZ B;  3S1E A;  4BBY A;  4EC3 A;  5G5G B;  3EJD B;  3JS8 A;  1QLU A;  1SB3 B;  3PQB A;  2BVG A;  1HSK A;  5AE3 A;  1N60 C;  4MLA A;  3W8W A;  3BW7 A;  1E8F A;  4ZOH B;  2W55 A;  1ZXI C;  1W1S A;  2QPM A;  5AE1 A;  1FFV C;  2GQU A;  2BVF A;  2UUU A;  4PVE A;  1MBB A;  1T3Q C;  5I1W A;  3NS1 B;  2PLS A;  1N62 C;  2R8D A;  5K8E A;  2MBR A;  2VFU A;  4BC9 A;  3FW8 A;  1N5W C;  3LLB A;  3EJE B;  5HQX A;  1WYG A;  4UD8 A;  2UUV A;  4PVK A;  3ETR B;  2EXR A;  4PYT A;  5G5H B;  5AE2 A; 
#chains in the Genus database with same CATH homology
 1AHV A;  3AN1 A;  3TSH A;  1ZR6 A;  1FO4 A;  1V97 A;  2YVS A;  1E0Y A;  3PM9 A;  3S1D A;  2BVH A;  2P3H A;  2QKN A;  1I19 A;  3NVW B;  3W8X A;  1WVF A;  1VAO A;  2RK5 A;  3KJM A;  3LAE A;  3S1C A;  2O3G A;  5AWV A;  3DED A;  4BC7 A;  3D2H A;  3NVV B;  3B9J B;  1F0X A;  4O95 A;  2P4P A;  5L6G A;  3POP A;  2VFV A;  3TX1 A;  2E3T A;  2VAO A;  2OAI A;  4PVH A;  5HHZ A;  5D79 A;  1AHZ A;  2Y3R A;  1E8H A;  5FXE A;  4BCA A;  1DIQ A;  1N5X A;  2NQW A;  1N63 C;  1W1M A;  1QLT A;  1JRO A;  2GQT A;  3C0P A;  2Y08 A;  1FIQ B;  2AXR A;  1AHU A;  2VFS A;  2PLI A;  2WDW A;  5ADZ A;  1W1Q A;  1W1O A;  1RM6 B;  1VDV A;  3S1F A;  4JAY A;  1W1R A;  2IPI A;  2Q85 A;  3AM9 A;  2Q4W A;  5FXF A;  5FXP A;  4HG0 A;  5L6F A;  2I0K A;  4PVJ A;  1DII A;  4JB1 A;  2W3R A;  3W8Z A;  3D2J A;  3TSJ A;  3NVY B;  5HMR A;  3FW9 A;  2R2Z A;  4ML8 A;  4PZF A;  3SR6 B;  1JRP A;  2W3S A;  4PWB A;  4OAL A;  2W54 A;  1E8G A;  3HSU A;  3GSY A;  5I1V A;  5FXD A;  3VTE A;  2Y3S A;  4DNS A;  1W1J A;  3RJA A;  1N61 C;  1W1L A;  3EUB 3;  1MBT A;  2Y4G A;  3HRD C;  1WVE A;  1FFU C;  1UXY A;  1DZN A;  4PWC A;  2P13 A;  3NRZ B;  3RJ8 A;  3FW7 A;  1W1K A;  2VFT A;  3I99 A;  3D2D A;  4XLO A;  3DQ0 A;  2VFR A;  3AMZ A;  3FWA A;  3NVZ B;  3S1E A;  4BBY A;  4EC3 A;  5G5G B;  3JS8 A;  1QLU A;  1SB3 B;  3PQB A;  2BVG A;  1HSK A;  5AE3 A;  1N60 C;  4MLA A;  3W8W A;  3BW7 A;  1E8F A;  4ZOH B;  2W55 A;  1ZXI C;  1W1S A;  2QPM A;  5AE1 A;  1FFV C;  2GQU A;  2BVF A;  2UUU A;  4PVE A;  1MBB A;  1T3Q C;  5I1W A;  3NS1 B;  2PLS A;  1N62 C;  2R8D A;  5K8E A;  2MBR A;  2VFU A;  4BC9 A;  3FW8 A;  1N5W C;  3LLB A;  5HQX A;  1WYG A;  4UD8 A;  2UUV A;  4PVK A;  3ETR B;  2EXR A;  4PYT A;  5G5H B;  5AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...