1UXYA

Murb mutant with ser 229 replaced by ala, complex with enolpyruvyl-udp-n-acetylglucosamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
340
structure length
340
Chain Sequence
HSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGAFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of the S229A mutant and wild-type MurB in the presence of the substrate enolpyruvyl-UDP-N-acetylglucosamine at 1.8-A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE REDUCTASE
total genus 107
structure length 340
sequence length 340
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 1996-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1uxyA02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1uxyA03
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 1uxyA01
1JRPA 1DZNA 4BC7A 3LLBA 2AXRA 1N5XA 1W1QA 1FO4A 3DEDA 2VFSA 1MBBA 3FW8A 1N5WC 2VFTA 2W3SA 2YVSA 3D2HA 2VFVA 2PLIA 3GSYA 2W55A 4XLOA 2W54A 5HMRA 3TSJA 5G5GB 2R8DA 4O95A 3C0PA 5D79A 4PVEA 1FIQB 4PZFA 2I0KA 1W1JA 1WYGA 2BVGA 3I99A 3AMZA 4MLAA 3W8WA 1VDVA 4BCAA 1ZR6A 1I19A 4EC3A 3FWAA 2PLSA 2GQUA 4BC9A 5AE3A 1WVFA 5AE2A 1AHVA 3JS8A 2QKNA 3NVYB 4UD8A 2MBRA 2P3HA 3S1DA 1JROA 3NVWB 2VAOA 3PM9A 4OALA 2VFUA 2R2ZA 3ETRB 4PYTA 2OAIA 4PVKA 4PVHA 1QLTA 4DNSA 5FXPA 1V97A 1F0XA 4PVJA 3W8XA 1RM6B 1W1OA 1QLUA 3D2JA 2P4PA 2E3TA 3BW7A 4JB1A 2EXRA 4BBYA 3SR6B 1N62C 1FFUC 3B9JB 3S1CA 1ZXIC 2W3RA 1W1LA 2Q85A 2RK5A 3AN1A 1HSKA 5ADZA 1UXYA 1W1KA 2GQTA 5FXFA 3KJMA 3S1FA 1VAOA 5HQXA 3VTEA 1W1RA 4ZOHB 1N60C 2Q4WA 5FXEA 2O3GA 1WVEA 1SB3B 4PWBA 3D2DA 1DIQA 3NVZB 1E8GA 1AHUA 3AM9A 5HHZA 2VFRA 3DQ0A 5G5HB 3S1EA 1FFVC 3FW9A 3NRZB 4ML8A 2BVFA 1E8HA 3NS1B 1N63C 1E8FA 1N61C 3EUB3 3TX1A 2QPMA 3NVVB 1W1MA 2BVHA 2NQWA 5FXDA 2P13A 3W8ZA 1MBTA 1T3QC 1DIIA 3FW7A 4PWCA 5AE1A 1AHZA 3LAEA 3TSHA 4HG0A 1W1SA 3HRDC 1E0YA 4JAYA
chains in the Genus database with same CATH superfamily
2UUVA 1JRPA 1DZNA 4BC7A 3LLBA 2AXRA 1N5XA 1W1QA 1FO4A 3DEDA 2VFSA 1MBBA 3FW8A 1N5WC 2VFTA 2W3SA 2YVSA 3D2HA 2VFVA 3HSUA 2PLIA 3GSYA 2W55A 4XLOA 2W54A 5HMRA 3TSJA 5G5GB 2R8DA 2Y4GA 4O95A 3C0PA 5D79A 5L6GA 4PVEA 1FIQB 4PZFA 2I0KA 1W1JA 1WYGA 2BVGA 3I99A 3AMZA 4MLAA 3W8WA 1VDVA 4BCAA 1ZR6A 1I19A 4EC3A 3EJBB 3FWAA 2PLSA 2GQUA 4BC9A 5AE3A 1WVFA 5AE2A 1AHVA 3JS8A 2QKNA 3NVYB 4UD8A 2MBRA 2P3HA 3RJ8A 3S1DA 1JROA 2WDWA 3NVWB 2VAOA 3PM9A 3RJAA 4OALA 5K8EA 3PQBA 2VFUA 2R2ZA 3ETRB 4PYTA 2Y3RA 2OAIA 4PVKA 4PVHA 1QLTA 4DNSA 5FXPA 5I1WA 1V97A 1F0XA 4PVJA 3W8XA 1RM6B 1W1OA 1QLUA 3POPA 3D2JA 2P4PA 2E3TA 3BW7A 4JB1A 2EXRA 4BBYA 2UUUA 3SR6B 1N62C 1FFUC 3B9JB 3S1CA 1ZXIC 2W3RA 1W1LA 2Q85A 2Y08A 2IPIA 3EJDB 2RK5A 3AN1A 1HSKA 5ADZA 1UXYA 5AWVA 1W1KA 2GQTA 5FXFA 3KJMA 2Y3SA 3S1FA 1VAOA 5HQXA 3VTEA 1W1RA 4ZOHB 1N60C 2Q4WA 5FXEA 2O3GA 1WVEA 1SB3B 4PWBA 3D2DA 1DIQA 3NVZB 1E8GA 1AHUA 3AM9A 5HHZA 2VFRA 3DQ0A 5G5HB 3S1EA 1FFVC 3FW9A 5L6FA 3NRZB 4ML8A 2BVFA 1E8HA 3NS1B 1N63C 1E8FA 1N61C 3EUB3 3TX1A 2QPMA 3NVVB 1W1MA 2BVHA 2NQWA 5FXDA 2P13A 3W8ZA 1MBTA 1T3QC 1DIIA 5I1VA 3EJEB 3FW7A 4PWCA 5AE1A 1AHZA 3LAEA 3TSHA 4HG0A 1W1SA 3HRDC 1E0YA 4JAYA
chains in the Genus database with same CATH topology
2UUVA 1JRPA 1DZNA 4BC7A 3LLBA 2AXRA 1N5XA 1W1QA 1FO4A 3DEDA 2VFSA 1MBBA 3FW8A 1N5WC 2VFTA 2W3SA 2YVSA 3D2HA 2VFVA 3HSUA 2PLIA 3GSYA 2W55A 4XLOA 2W54A 5HMRA 3TSJA 5G5GB 2R8DA 2Y4GA 4O95A 3C0PA 5D79A 5L6GA 4PVEA 1FIQB 4PZFA 2I0KA 1W1JA 1WYGA 2BVGA 3I99A 3AMZA 4MLAA 3W8WA 1VDVA 4BCAA 1ZR6A 1I19A 4EC3A 3FWAA 2PLSA 2GQUA 4BC9A 5AE3A 1WVFA 5AE2A 1AHVA 3JS8A 2QKNA 3NVYB 4UD8A 2MBRA 2P3HA 3RJ8A 3S1DA 1JROA 2WDWA 3NVWB 2VAOA 3PM9A 3RJAA 4OALA 5K8EA 3PQBA 2VFUA 2R2ZA 3ETRB 4PYTA 2Y3RA 2OAIA 4PVKA 4PVHA 1QLTA 4DNSA 5FXPA 5I1WA 1V97A 1F0XA 4PVJA 3W8XA 1RM6B 1W1OA 1QLUA 3POPA 3D2JA 2P4PA 2E3TA 3BW7A 4JB1A 2EXRA 4BBYA 2UUUA 3SR6B 1N62C 1FFUC 3B9JB 3S1CA 1ZXIC 2W3RA 1W1LA 2Q85A 2Y08A 2IPIA 2RK5A 3AN1A 1HSKA 5ADZA 1UXYA 5AWVA 1W1KA 2GQTA 5FXFA 3KJMA 2Y3SA 3S1FA 1VAOA 5HQXA 3VTEA 1W1RA 4ZOHB 1N60C 2Q4WA 5FXEA 2O3GA 1WVEA 1SB3B 4PWBA 3D2DA 1DIQA 3NVZB 1E8GA 1AHUA 3AM9A 5HHZA 2VFRA 3DQ0A 5G5HB 3S1EA 1FFVC 3FW9A 5L6FA 3NRZB 4ML8A 2BVFA 1E8HA 3NS1B 1N63C 1E8FA 1N61C 3EUB3 3TX1A 2QPMA 3NVVB 1W1MA 2BVHA 2NQWA 5FXDA 2P13A 3W8ZA 1MBTA 1T3QC 1DIIA 5I1VA 3FW7A 4PWCA 5AE1A 1AHZA 3LAEA 3TSHA 4HG0A 1W1SA 3HRDC 1E0YA 4JAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  1DZN A;  4BC7 A;  3LLB A;  2AXR A;  1N5X A;  1W1Q A;  1FO4 A;  3DED A;  2VFS A;  1MBB A;  3FW8 A;  1N5W C;  2VFT A;  2W3S A;  2YVS A;  3D2H A;  2VFV A;  2PLI A;  3GSY A;  2W55 A;  4XLO A;  2W54 A;  5HMR A;  3TSJ A;  5G5G B;  2R8D A;  4O95 A;  3C0P A;  5D79 A;  4PVE A;  1FIQ B;  4PZF A;  2I0K A;  1W1J A;  1WYG A;  2BVG A;  3I99 A;  3AMZ A;  4MLA A;  3W8W A;  1VDV A;  4BCA A;  1ZR6 A;  1I19 A;  4EC3 A;  3FWA A;  2PLS A;  2GQU A;  4BC9 A;  5AE3 A;  1WVF A;  5AE2 A;  1AHV A;  3JS8 A;  2QKN A;  3NVY B;  4UD8 A;  2MBR A;  2P3H A;  3S1D A;  1JRO A;  3NVW B;  2VAO A;  3PM9 A;  4OAL A;  2VFU A;  2R2Z A;  3ETR B;  4PYT A;  2OAI A;  4PVK A;  4PVH A;  1QLT A;  4DNS A;  5FXP A;  1V97 A;  1F0X A;  4PVJ A;  3W8X A;  1RM6 B;  1W1O A;  1QLU A;  3D2J A;  2P4P A;  2E3T A;  3BW7 A;  4JB1 A;  2EXR A;  4BBY A;  3SR6 B;  1N62 C;  1FFU C;  3B9J B;  3S1C A;  1ZXI C;  2W3R A;  1W1L A;  2Q85 A;  2RK5 A;  3AN1 A;  1HSK A;  5ADZ A;  1UXY A;  1W1K A;  2GQT A;  5FXF A;  3KJM A;  3S1F A;  1VAO A;  5HQX A;  3VTE A;  1W1R A;  4ZOH B;  1N60 C;  2Q4W A;  5FXE A;  2O3G A;  1WVE A;  1SB3 B;  4PWB A;  3D2D A;  1DIQ A;  3NVZ B;  1E8G A;  1AHU A;  3AM9 A;  5HHZ A;  2VFR A;  3DQ0 A;  5G5H B;  3S1E A;  1FFV C;  3FW9 A;  3NRZ B;  4ML8 A;  2BVF A;  1E8H A;  3NS1 B;  1N63 C;  1E8F A;  1N61 C;  3EUB 3;  3TX1 A;  2QPM A;  3NVV B;  1W1M A;  2BVH A;  2NQW A;  5FXD A;  2P13 A;  3W8Z A;  1MBT A;  1T3Q C;  1DII A;  3FW7 A;  4PWC A;  5AE1 A;  1AHZ A;  3LAE A;  3TSH A;  4HG0 A;  1W1S A;  3HRD C;  1E0Y A;  4JAY A; 
#chains in the Genus database with same CATH topology
 2UUV A;  1JRP A;  1DZN A;  4BC7 A;  3LLB A;  2AXR A;  1N5X A;  1W1Q A;  1FO4 A;  3DED A;  2VFS A;  1MBB A;  3FW8 A;  1N5W C;  2VFT A;  2W3S A;  2YVS A;  3D2H A;  2VFV A;  3HSU A;  2PLI A;  3GSY A;  2W55 A;  4XLO A;  2W54 A;  5HMR A;  3TSJ A;  5G5G B;  2R8D A;  2Y4G A;  4O95 A;  3C0P A;  5D79 A;  5L6G A;  4PVE A;  1FIQ B;  4PZF A;  2I0K A;  1W1J A;  1WYG A;  2BVG A;  3I99 A;  3AMZ A;  4MLA A;  3W8W A;  1VDV A;  4BCA A;  1ZR6 A;  1I19 A;  4EC3 A;  3EJB B;  3FWA A;  2PLS A;  2GQU A;  4BC9 A;  5AE3 A;  1WVF A;  5AE2 A;  1AHV A;  3JS8 A;  2QKN A;  3NVY B;  4UD8 A;  2MBR A;  2P3H A;  3RJ8 A;  3S1D A;  1JRO A;  2WDW A;  3NVW B;  2VAO A;  3PM9 A;  3RJA A;  4OAL A;  5K8E A;  3PQB A;  2VFU A;  2R2Z A;  3ETR B;  4PYT A;  2Y3R A;  2OAI A;  4PVK A;  4PVH A;  1QLT A;  4DNS A;  5FXP A;  5I1W A;  1V97 A;  1F0X A;  4PVJ A;  3W8X A;  1RM6 B;  1W1O A;  1QLU A;  3POP A;  3D2J A;  2P4P A;  2E3T A;  3BW7 A;  4JB1 A;  2EXR A;  4BBY A;  2UUU A;  3SR6 B;  1N62 C;  1FFU C;  3B9J B;  3S1C A;  1ZXI C;  2W3R A;  1W1L A;  2Q85 A;  2Y08 A;  2IPI A;  3EJD B;  2RK5 A;  3AN1 A;  1HSK A;  5ADZ A;  1UXY A;  5AWV A;  1W1K A;  2GQT A;  5FXF A;  3KJM A;  2Y3S A;  3S1F A;  1VAO A;  5HQX A;  3VTE A;  1W1R A;  4ZOH B;  1N60 C;  2Q4W A;  5FXE A;  2O3G A;  1WVE A;  1SB3 B;  4PWB A;  3D2D A;  1DIQ A;  3NVZ B;  1E8G A;  1AHU A;  3AM9 A;  5HHZ A;  2VFR A;  3DQ0 A;  5G5H B;  3S1E A;  1FFV C;  3FW9 A;  5L6F A;  3NRZ B;  4ML8 A;  2BVF A;  1E8H A;  3NS1 B;  1N63 C;  1E8F A;  1N61 C;  3EUB 3;  3TX1 A;  2QPM A;  3NVV B;  1W1M A;  2BVH A;  2NQW A;  5FXD A;  2P13 A;  3W8Z A;  1MBT A;  1T3Q C;  1DII A;  5I1V A;  3EJE B;  3FW7 A;  4PWC A;  5AE1 A;  1AHZ A;  3LAE A;  3TSH A;  4HG0 A;  1W1S A;  3HRD C;  1E0Y A;  4JAY A; 
#chains in the Genus database with same CATH homology
 2UUV A;  1JRP A;  1DZN A;  4BC7 A;  3LLB A;  2AXR A;  1N5X A;  1W1Q A;  1FO4 A;  3DED A;  2VFS A;  1MBB A;  3FW8 A;  1N5W C;  2VFT A;  2W3S A;  2YVS A;  3D2H A;  2VFV A;  3HSU A;  2PLI A;  3GSY A;  2W55 A;  4XLO A;  2W54 A;  5HMR A;  3TSJ A;  5G5G B;  2R8D A;  2Y4G A;  4O95 A;  3C0P A;  5D79 A;  5L6G A;  4PVE A;  1FIQ B;  4PZF A;  2I0K A;  1W1J A;  1WYG A;  2BVG A;  3I99 A;  3AMZ A;  4MLA A;  3W8W A;  1VDV A;  4BCA A;  1ZR6 A;  1I19 A;  4EC3 A;  3FWA A;  2PLS A;  2GQU A;  4BC9 A;  5AE3 A;  1WVF A;  5AE2 A;  1AHV A;  3JS8 A;  2QKN A;  3NVY B;  4UD8 A;  2MBR A;  2P3H A;  3RJ8 A;  3S1D A;  1JRO A;  2WDW A;  3NVW B;  2VAO A;  3PM9 A;  3RJA A;  4OAL A;  5K8E A;  3PQB A;  2VFU A;  2R2Z A;  3ETR B;  4PYT A;  2Y3R A;  2OAI A;  4PVK A;  4PVH A;  1QLT A;  4DNS A;  5FXP A;  5I1W A;  1V97 A;  1F0X A;  4PVJ A;  3W8X A;  1RM6 B;  1W1O A;  1QLU A;  3POP A;  3D2J A;  2P4P A;  2E3T A;  3BW7 A;  4JB1 A;  2EXR A;  4BBY A;  2UUU A;  3SR6 B;  1N62 C;  1FFU C;  3B9J B;  3S1C A;  1ZXI C;  2W3R A;  1W1L A;  2Q85 A;  2Y08 A;  2IPI A;  2RK5 A;  3AN1 A;  1HSK A;  5ADZ A;  1UXY A;  5AWV A;  1W1K A;  2GQT A;  5FXF A;  3KJM A;  2Y3S A;  3S1F A;  1VAO A;  5HQX A;  3VTE A;  1W1R A;  4ZOH B;  1N60 C;  2Q4W A;  5FXE A;  2O3G A;  1WVE A;  1SB3 B;  4PWB A;  3D2D A;  1DIQ A;  3NVZ B;  1E8G A;  1AHU A;  3AM9 A;  5HHZ A;  2VFR A;  3DQ0 A;  5G5H B;  3S1E A;  1FFV C;  3FW9 A;  5L6F A;  3NRZ B;  4ML8 A;  2BVF A;  1E8H A;  3NS1 B;  1N63 C;  1E8F A;  1N61 C;  3EUB 3;  3TX1 A;  2QPM A;  3NVV B;  1W1M A;  2BVH A;  2NQW A;  5FXD A;  2P13 A;  3W8Z A;  1MBT A;  1T3Q C;  1DII A;  5I1V A;  3FW7 A;  4PWC A;  5AE1 A;  1AHZ A;  3LAE A;  3TSH A;  4HG0 A;  1W1S A;  3HRD C;  1E0Y A;  4JAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...