4PWBA

Phl p 4 i153v variant, a glucose oxidase, pressurized with xenon
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
total genus 164
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwbA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwbA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwbA03
3S1DA 5ADZA 2WDWA 1N61C 1AHZA 3B9JB 3FW7A 2Y3SA 1DZNA 1V97A 4BBYA 5L6GA 1N62C 1I19A 3C0PA 4UD8A 1FO4A 5AWVA 2I0KA 4BC7A 4PYTA 2E3TA 1ZXIC 2W54A 1F0XA 1UXYA 5AE2A 4PZFA 4PVHA 1FIQB 2VFUA 1DIQA 1N60C 2BVHA 1N5XA 4JAYA 4PVEA 2QPMA 4ZOHB 3PM9A 4JB1A 4EC3A 1W1MA 4ML8A 5K8EA 1JROA 4O95A 1T3QC 1QLTA 3D2JA 1VAOA 3TSJA 5FXPA 2VAOA 3HSUA 2BVFA 5L6FA 1W1LA 5AE1A 2Y4GA 4PVKA 5FXFA 3RJ8A 3NS1B 1VDVA 1FFUC 1MBTA 3FWAA 1E8HA 2VFVA 3EUB3 3W8WA 4BC9A 1N63C 5FXEA 3GSYA 1W1OA 1AHVA 1WVFA 3BW7A 2Q85A 2IPIA 2QKNA 3ETRB 3I99A 4PVJA 2MBRA 3AM9A 2W3SA 2AXRA 3NRZB 1N5WC 3TSHA 2Q4WA 2VFTA 3PQBA 2BVGA 2W55A 2Y3RA 5FXDA 1E0YA 1E8FA 3SR6B 3VTEA 1W1KA 2VFRA 1W1RA 3S1FA 3FW8A 5HHZA 2Y08A 1WVEA 3KJMA 3AMZA 3FW9A 4MLAA 1ZR6A 2GQTA 1MBBA 1DIIA 5HMRA 3S1CA 1QLUA 1W1JA 1HSKA 5I1VA 3D2HA 5AE3A 1WYGA 1E8GA 1W1SA 5D79A 3AN1A 3DQ0A 3RJAA 4PWCA 1FFVC 2EXRA 3S1EA 2VFSA 4OALA 4BCAA 3W8XA 1W1QA 2GQUA 5I1WA 3W8ZA 4PWBA 1AHUA 3NVZB 4DNSA 4XLOA 5HQXA 3POPA 3JS8A 3TX1A 3D2DA 2W3RA
chains in the Genus database with same CATH superfamily
3S1DA 5ADZA 2WDWA 1N61C 1AHZA 3B9JB 3FW7A 2Y3SA 1DZNA 5G5GB 2P13A 2RK5A 1V97A 4BBYA 5L6GA 1N62C 1I19A 3C0PA 4UD8A 1FO4A 5AWVA 2I0KA 4BC7A 2NQWA 4PYTA 2E3TA 5G5HB 1ZXIC 2W54A 1F0XA 1UXYA 5AE2A 4PZFA 4PVHA 1FIQB 2VFUA 2O3GA 1DIQA 1N60C 2BVHA 1N5XA 4JAYA 4PVEA 3EJBB 1SB3B 2QPMA 2PLSA 4ZOHB 1RM6B 3PM9A 4JB1A 4EC3A 1W1MA 4ML8A 3LAEA 5K8EA 1JROA 4O95A 2UUUA 2P4PA 1T3QC 1QLTA 3D2JA 1VAOA 3TSJA 5FXPA 2VAOA 3HSUA 2R8DA 2BVFA 5L6FA 1W1LA 5AE1A 2Y4GA 4PVKA 5FXFA 3RJ8A 3NS1B 1VDVA 1FFUC 4HG0A 1MBTA 3FWAA 2YVSA 1E8HA 2VFVA 3EUB3 3W8WA 3NVWB 4BC9A 1N63C 5FXEA 3GSYA 1W1OA 1AHVA 1WVFA 3BW7A 2Q85A 3NVYB 2QKNA 2IPIA 3ETRB 3I99A 3EJDB 4PVJA 2MBRA 3AM9A 2W3SA 2AXRA 3NRZB 2R2ZA 1N5WC 3TSHA 2Q4WA 2VFTA 3PQBA 2BVGA 2W55A 2Y3RA 5FXDA 1E0YA 1E8FA 3SR6B 3VTEA 1W1KA 2VFRA 3NVVB 1W1RA 3DEDA 2PLIA 3S1FA 3FW8A 5HHZA 2Y08A 1WVEA 3KJMA 3AMZA 3FW9A 4MLAA 1ZR6A 2GQTA 1MBBA 1DIIA 3HRDC 5HMRA 3S1CA 1QLUA 1W1JA 1HSKA 5I1VA 2UUVA 3D2HA 5AE3A 1WYGA 1E8GA 1W1SA 5D79A 3AN1A 3DQ0A 3RJAA 4PWCA 1FFVC 2OAIA 2EXRA 3LLBA 3S1EA 2VFSA 4OALA 4BCAA 3W8XA 1W1QA 2GQUA 5I1WA 3W8ZA 4PWBA 1AHUA 3NVZB 4DNSA 2P3HA 4XLOA 5HQXA 3POPA 3EJEB 3JS8A 1JRPA 3TX1A 3D2DA 2W3RA
chains in the Genus database with same CATH topology
3S1DA 5ADZA 2WDWA 1N61C 1AHZA 3B9JB 3FW7A 2Y3SA 1DZNA 5G5GB 2P13A 2RK5A 1V97A 4BBYA 5L6GA 1N62C 1I19A 3C0PA 4UD8A 1FO4A 5AWVA 2I0KA 4BC7A 2NQWA 4PYTA 2E3TA 5G5HB 1ZXIC 2W54A 1F0XA 1UXYA 5AE2A 4PZFA 4PVHA 1FIQB 2VFUA 2O3GA 1DIQA 1N60C 2BVHA 1N5XA 4JAYA 4PVEA 1SB3B 2QPMA 2PLSA 4ZOHB 1RM6B 3PM9A 4JB1A 4EC3A 1W1MA 4ML8A 3LAEA 5K8EA 1JROA 4O95A 2UUUA 2P4PA 1T3QC 1QLTA 3D2JA 1VAOA 3TSJA 5FXPA 2VAOA 3HSUA 2R8DA 2BVFA 5L6FA 1W1LA 5AE1A 2Y4GA 4PVKA 5FXFA 3RJ8A 3NS1B 1VDVA 1FFUC 4HG0A 1MBTA 3FWAA 2YVSA 1E8HA 2VFVA 3EUB3 3W8WA 3NVWB 4BC9A 1N63C 5FXEA 3GSYA 1W1OA 1AHVA 1WVFA 3BW7A 2Q85A 2IPIA 2QKNA 3NVYB 3ETRB 3I99A 4PVJA 2MBRA 3AM9A 2W3SA 2AXRA 3NRZB 2R2ZA 1N5WC 3TSHA 2Q4WA 2VFTA 3PQBA 2BVGA 2W55A 2Y3RA 5FXDA 1E0YA 1E8FA 3SR6B 3VTEA 1W1KA 2VFRA 3NVVB 1W1RA 3DEDA 2PLIA 3S1FA 3FW8A 5HHZA 2Y08A 1WVEA 3KJMA 3AMZA 3FW9A 4MLAA 1ZR6A 2GQTA 1MBBA 1DIIA 3HRDC 5HMRA 3S1CA 1QLUA 1W1JA 1HSKA 5I1VA 2UUVA 3D2HA 5AE3A 1WYGA 1E8GA 1W1SA 5D79A 3AN1A 3DQ0A 3RJAA 4PWCA 1FFVC 2OAIA 2EXRA 3LLBA 3S1EA 2VFSA 4OALA 4BCAA 3W8XA 1W1QA 2GQUA 5I1WA 3W8ZA 4PWBA 1AHUA 3NVZB 4DNSA 2P3HA 4XLOA 5HQXA 3POPA 3JS8A 1JRPA 3TX1A 3D2DA 2W3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1D A;  5ADZ A;  2WDW A;  1N61 C;  1AHZ A;  3B9J B;  3FW7 A;  2Y3S A;  1DZN A;  1V97 A;  4BBY A;  5L6G A;  1N62 C;  1I19 A;  3C0P A;  4UD8 A;  1FO4 A;  5AWV A;  2I0K A;  4BC7 A;  4PYT A;  2E3T A;  1ZXI C;  2W54 A;  1F0X A;  1UXY A;  5AE2 A;  4PZF A;  4PVH A;  1FIQ B;  2VFU A;  1DIQ A;  1N60 C;  2BVH A;  1N5X A;  4JAY A;  4PVE A;  2QPM A;  4ZOH B;  3PM9 A;  4JB1 A;  4EC3 A;  1W1M A;  4ML8 A;  5K8E A;  1JRO A;  4O95 A;  1T3Q C;  1QLT A;  3D2J A;  1VAO A;  3TSJ A;  5FXP A;  2VAO A;  3HSU A;  2BVF A;  5L6F A;  1W1L A;  5AE1 A;  2Y4G A;  4PVK A;  5FXF A;  3RJ8 A;  3NS1 B;  1VDV A;  1FFU C;  1MBT A;  3FWA A;  1E8H A;  2VFV A;  3EUB 3;  3W8W A;  4BC9 A;  1N63 C;  5FXE A;  3GSY A;  1W1O A;  1AHV A;  1WVF A;  3BW7 A;  2Q85 A;  2IPI A;  2QKN A;  3ETR B;  3I99 A;  4PVJ A;  2MBR A;  3AM9 A;  2W3S A;  2AXR A;  3NRZ B;  1N5W C;  3TSH A;  2Q4W A;  2VFT A;  3PQB A;  2BVG A;  2W55 A;  2Y3R A;  5FXD A;  1E0Y A;  1E8F A;  3SR6 B;  3VTE A;  1W1K A;  2VFR A;  1W1R A;  3S1F A;  3FW8 A;  5HHZ A;  2Y08 A;  1WVE A;  3KJM A;  3AMZ A;  3FW9 A;  4MLA A;  1ZR6 A;  2GQT A;  1MBB A;  1DII A;  5HMR A;  3S1C A;  1QLU A;  1W1J A;  1HSK A;  5I1V A;  3D2H A;  5AE3 A;  1WYG A;  1E8G A;  1W1S A;  5D79 A;  3AN1 A;  3DQ0 A;  3RJA A;  4PWC A;  1FFV C;  2EXR A;  3S1E A;  2VFS A;  4OAL A;  4BCA A;  3W8X A;  1W1Q A;  2GQU A;  5I1W A;  3W8Z A;  4PWB A;  1AHU A;  3NVZ B;  4DNS A;  4XLO A;  5HQX A;  3POP A;  3JS8 A;  3TX1 A;  3D2D A;  2W3R A; 
#chains in the Genus database with same CATH topology
 3S1D A;  5ADZ A;  2WDW A;  1N61 C;  1AHZ A;  3B9J B;  3FW7 A;  2Y3S A;  1DZN A;  5G5G B;  2P13 A;  2RK5 A;  1V97 A;  4BBY A;  5L6G A;  1N62 C;  1I19 A;  3C0P A;  4UD8 A;  1FO4 A;  5AWV A;  2I0K A;  4BC7 A;  2NQW A;  4PYT A;  2E3T A;  5G5H B;  1ZXI C;  2W54 A;  1F0X A;  1UXY A;  5AE2 A;  4PZF A;  4PVH A;  1FIQ B;  2VFU A;  2O3G A;  1DIQ A;  1N60 C;  2BVH A;  1N5X A;  4JAY A;  4PVE A;  3EJB B;  1SB3 B;  2QPM A;  2PLS A;  4ZOH B;  1RM6 B;  3PM9 A;  4JB1 A;  4EC3 A;  1W1M A;  4ML8 A;  3LAE A;  5K8E A;  1JRO A;  4O95 A;  2UUU A;  2P4P A;  1T3Q C;  1QLT A;  3D2J A;  1VAO A;  3TSJ A;  5FXP A;  2VAO A;  3HSU A;  2R8D A;  2BVF A;  5L6F A;  1W1L A;  5AE1 A;  2Y4G A;  4PVK A;  5FXF A;  3RJ8 A;  3NS1 B;  1VDV A;  1FFU C;  4HG0 A;  1MBT A;  3FWA A;  2YVS A;  1E8H A;  2VFV A;  3EUB 3;  3W8W A;  3NVW B;  4BC9 A;  1N63 C;  5FXE A;  3GSY A;  1W1O A;  1AHV A;  1WVF A;  3BW7 A;  2Q85 A;  3NVY B;  2QKN A;  2IPI A;  3ETR B;  3I99 A;  3EJD B;  4PVJ A;  2MBR A;  3AM9 A;  2W3S A;  2AXR A;  3NRZ B;  2R2Z A;  1N5W C;  3TSH A;  2Q4W A;  2VFT A;  3PQB A;  2BVG A;  2W55 A;  2Y3R A;  5FXD A;  1E0Y A;  1E8F A;  3SR6 B;  3VTE A;  1W1K A;  2VFR A;  3NVV B;  1W1R A;  3DED A;  2PLI A;  3S1F A;  3FW8 A;  5HHZ A;  2Y08 A;  1WVE A;  3KJM A;  3AMZ A;  3FW9 A;  4MLA A;  1ZR6 A;  2GQT A;  1MBB A;  1DII A;  3HRD C;  5HMR A;  3S1C A;  1QLU A;  1W1J A;  1HSK A;  5I1V A;  2UUV A;  3D2H A;  5AE3 A;  1WYG A;  1E8G A;  1W1S A;  5D79 A;  3AN1 A;  3DQ0 A;  3RJA A;  4PWC A;  1FFV C;  2OAI A;  2EXR A;  3LLB A;  3S1E A;  2VFS A;  4OAL A;  4BCA A;  3W8X A;  1W1Q A;  2GQU A;  5I1W A;  3W8Z A;  4PWB A;  1AHU A;  3NVZ B;  4DNS A;  2P3H A;  4XLO A;  5HQX A;  3POP A;  3EJE B;  3JS8 A;  1JRP A;  3TX1 A;  3D2D A;  2W3R A; 
#chains in the Genus database with same CATH homology
 3S1D A;  5ADZ A;  2WDW A;  1N61 C;  1AHZ A;  3B9J B;  3FW7 A;  2Y3S A;  1DZN A;  5G5G B;  2P13 A;  2RK5 A;  1V97 A;  4BBY A;  5L6G A;  1N62 C;  1I19 A;  3C0P A;  4UD8 A;  1FO4 A;  5AWV A;  2I0K A;  4BC7 A;  2NQW A;  4PYT A;  2E3T A;  5G5H B;  1ZXI C;  2W54 A;  1F0X A;  1UXY A;  5AE2 A;  4PZF A;  4PVH A;  1FIQ B;  2VFU A;  2O3G A;  1DIQ A;  1N60 C;  2BVH A;  1N5X A;  4JAY A;  4PVE A;  1SB3 B;  2QPM A;  2PLS A;  4ZOH B;  1RM6 B;  3PM9 A;  4JB1 A;  4EC3 A;  1W1M A;  4ML8 A;  3LAE A;  5K8E A;  1JRO A;  4O95 A;  2UUU A;  2P4P A;  1T3Q C;  1QLT A;  3D2J A;  1VAO A;  3TSJ A;  5FXP A;  2VAO A;  3HSU A;  2R8D A;  2BVF A;  5L6F A;  1W1L A;  5AE1 A;  2Y4G A;  4PVK A;  5FXF A;  3RJ8 A;  3NS1 B;  1VDV A;  1FFU C;  4HG0 A;  1MBT A;  3FWA A;  2YVS A;  1E8H A;  2VFV A;  3EUB 3;  3W8W A;  3NVW B;  4BC9 A;  1N63 C;  5FXE A;  3GSY A;  1W1O A;  1AHV A;  1WVF A;  3BW7 A;  2Q85 A;  2IPI A;  2QKN A;  3NVY B;  3ETR B;  3I99 A;  4PVJ A;  2MBR A;  3AM9 A;  2W3S A;  2AXR A;  3NRZ B;  2R2Z A;  1N5W C;  3TSH A;  2Q4W A;  2VFT A;  3PQB A;  2BVG A;  2W55 A;  2Y3R A;  5FXD A;  1E0Y A;  1E8F A;  3SR6 B;  3VTE A;  1W1K A;  2VFR A;  3NVV B;  1W1R A;  3DED A;  2PLI A;  3S1F A;  3FW8 A;  5HHZ A;  2Y08 A;  1WVE A;  3KJM A;  3AMZ A;  3FW9 A;  4MLA A;  1ZR6 A;  2GQT A;  1MBB A;  1DII A;  3HRD C;  5HMR A;  3S1C A;  1QLU A;  1W1J A;  1HSK A;  5I1V A;  2UUV A;  3D2H A;  5AE3 A;  1WYG A;  1E8G A;  1W1S A;  5D79 A;  3AN1 A;  3DQ0 A;  3RJA A;  4PWC A;  1FFV C;  2OAI A;  2EXR A;  3LLB A;  3S1E A;  2VFS A;  4OAL A;  4BCA A;  3W8X A;  1W1Q A;  2GQU A;  5I1W A;  3W8Z A;  4PWB A;  1AHU A;  3NVZ B;  4DNS A;  2P3H A;  4XLO A;  5HQX A;  3POP A;  3JS8 A;  1JRP A;  3TX1 A;  3D2D A;  2W3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...