4PWBA

Phl p 4 i153v variant, a glucose oxidase, pressurized with xenon
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTVGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 164
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pwbA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pwbA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pwbA03
4UD8A 2GQUA 3FW9A 1DZNA 3W8XA 1W1LA 2VFSA 3W8WA 4JB1A 4OALA 2Y4GA 3BW7A 2BVGA 1N62C 2W3SA 3S1DA 2W3RA 3D2DA 5FXPA 4PWCA 4PWBA 4BC7A 4MLAA 4PVKA 1WYGA 2I0KA 5ADZA 5I1VA 1W1OA 5I1WA 1FFUC 2Y3SA 3FWAA 5FXFA 1QLTA 3AN1A 1T3QC 3RJ8A 1E8GA 1FFVC 1N60C 3I99A 1VDVA 2VAOA 4BC9A 4EC3A 2E3TA 5AWVA 5HQXA 4DNSA 3B9JB 2BVHA 1W1RA 2VFVA 2Y08A 5L6GA 2QKNA 3S1FA 3ETRB 5AE2A 1WVEA 3NRZB 2WDWA 5HHZA 4BBYA 3HSUA 2Y3RA 2GQTA 1W1JA 5L6FA 3TX1A 3NS1B 1W1KA 4PVHA 1ZR6A 4PZFA 1ZXIC 1UXYA 1W1QA 3RJAA 2IPIA 4PVJA 4BCAA 3EUB3 1N5XA 2W55A 1VAOA 1HSKA 3S1CA 2EXRA 3VTEA 2Q4WA 3FW7A 5D79A 3TSHA 4PVEA 3PQBA 3DQ0A 1V97A 2AXRA 3AMZA 5FXDA 3FW8A 1E8HA 2Q85A 3JS8A 3NVZB 5K8EA 3W8ZA 1I19A 4JAYA 3KJMA 4XLOA 1AHZA 1QLUA 1N63C 1N5WC 5FXEA 3TSJA 1FO4A 3C0PA 1W1SA 2VFUA 1E8FA 1WVFA 2QPMA 1AHUA 1N61C 3PM9A 1DIQA 2W54A 4PYTA 1E0YA 1F0XA 4ZOHB 3POPA 5HMRA 1MBBA 1DIIA 2MBRA 4ML8A 1JROA 5AE1A 3D2HA 3S1EA 2BVFA 2VFRA 3D2JA 1AHVA 5AE3A 1FIQB 3SR6B 2VFTA 1MBTA 4O95A 1W1MA 3AM9A 3GSYA
chains in the Genus database with same CATH superfamily
4UD8A 2PLSA 2GQUA 3FW9A 2P13A 1DZNA 3W8XA 1W1LA 2VFSA 3W8WA 4JB1A 4OALA 2Y4GA 3BW7A 2BVGA 1N62C 2W3SA 3S1DA 2W3RA 3D2DA 5FXPA 4PWCA 3EJDB 4PWBA 4BC7A 4MLAA 1JRPA 4PVKA 1WYGA 2I0KA 5ADZA 5I1VA 1W1OA 5I1WA 1FFUC 2Y3SA 3FWAA 5FXFA 1QLTA 3AN1A 1T3QC 3RJ8A 1E8GA 3LLBA 1FFVC 1N60C 3I99A 1VDVA 3NVVB 2VAOA 4BC9A 1RM6B 4EC3A 3HRDC 2E3TA 5AWVA 5HQXA 4DNSA 3B9JB 2BVHA 1W1RA 2VFVA 2Y08A 5L6GA 2QKNA 2RK5A 3S1FA 3ETRB 5AE2A 1WVEA 3NRZB 2WDWA 5HHZA 3EJEB 4BBYA 3HSUA 2Y3RA 2GQTA 1W1JA 5L6FA 3TX1A 3NS1B 1W1KA 4PVHA 1ZR6A 4PZFA 1ZXIC 1UXYA 1W1QA 3RJAA 2IPIA 4PVJA 4BCAA 2UUVA 3EUB3 1N5XA 2W55A 3EJBB 1VAOA 1HSKA 3S1CA 2P4PA 2EXRA 3VTEA 2YVSA 2Q4WA 3FW7A 3NVWB 5D79A 3TSHA 4PVEA 2O3GA 3PQBA 3DQ0A 1V97A 2AXRA 3AMZA 3DEDA 3LAEA 5FXDA 3FW8A 1E8HA 2Q85A 3JS8A 3NVZB 5G5HB 5K8EA 2UUUA 3W8ZA 1I19A 4JAYA 3KJMA 4XLOA 1AHZA 1QLUA 2P3HA 1N63C 4HG0A 1N5WC 5FXEA 3TSJA 3NVYB 1FO4A 2R8DA 2NQWA 3C0PA 1W1SA 2VFUA 2PLIA 1E8FA 1WVFA 2QPMA 1AHUA 1N61C 3PM9A 1DIQA 2W54A 4PYTA 1E0YA 1F0XA 4ZOHB 3POPA 5HMRA 1MBBA 1DIIA 2MBRA 5G5GB 4ML8A 1JROA 5AE1A 3D2HA 3S1EA 1SB3B 2R2ZA 2BVFA 2VFRA 3D2JA 2OAIA 1AHVA 5AE3A 1FIQB 3SR6B 2VFTA 1MBTA 4O95A 1W1MA 3AM9A 3GSYA
chains in the Genus database with same CATH topology
4UD8A 2PLSA 2GQUA 3FW9A 2P13A 1DZNA 3W8XA 1W1LA 2VFSA 3W8WA 4JB1A 4OALA 2Y4GA 3BW7A 2BVGA 1N62C 2W3SA 3S1DA 2W3RA 3D2DA 5FXPA 4PWCA 4PWBA 4BC7A 4MLAA 1JRPA 4PVKA 1WYGA 2I0KA 5ADZA 5I1VA 1W1OA 5I1WA 1FFUC 2Y3SA 3FWAA 5FXFA 1QLTA 3AN1A 1T3QC 3RJ8A 1E8GA 3LLBA 1FFVC 1N60C 3I99A 1VDVA 1RM6B 2VAOA 4BC9A 3NVVB 4EC3A 3HRDC 2E3TA 5AWVA 5HQXA 4DNSA 3B9JB 2BVHA 1W1RA 2VFVA 2Y08A 5L6GA 2QKNA 2RK5A 3S1FA 3ETRB 5AE2A 1WVEA 3NRZB 2WDWA 5HHZA 4BBYA 3HSUA 2Y3RA 2GQTA 1W1JA 5L6FA 3TX1A 3NS1B 1W1KA 4PVHA 1ZR6A 4PZFA 1ZXIC 1UXYA 1W1QA 3RJAA 2IPIA 4PVJA 4BCAA 2UUVA 3EUB3 1N5XA 2W55A 1VAOA 1HSKA 3S1CA 2P4PA 2EXRA 3VTEA 2YVSA 2Q4WA 3FW7A 3NVWB 5D79A 3TSHA 4PVEA 2O3GA 3PQBA 3DQ0A 1V97A 2AXRA 3AMZA 3DEDA 3LAEA 5FXDA 3FW8A 1E8HA 2Q85A 3JS8A 3NVZB 5G5HB 5K8EA 2UUUA 3W8ZA 1I19A 4JAYA 3KJMA 4XLOA 1AHZA 1QLUA 2P3HA 1N63C 4HG0A 1N5WC 5FXEA 3TSJA 3NVYB 1FO4A 2R8DA 2NQWA 3C0PA 1W1SA 2VFUA 2PLIA 1E8FA 1WVFA 2QPMA 1AHUA 1N61C 3PM9A 1DIQA 2W54A 4PYTA 1E0YA 1F0XA 4ZOHB 3POPA 5HMRA 1MBBA 1DIIA 2MBRA 5G5GB 4ML8A 1JROA 5AE1A 3D2HA 3S1EA 1SB3B 2R2ZA 2BVFA 2VFRA 3D2JA 2OAIA 1AHVA 5AE3A 1FIQB 3SR6B 2VFTA 1MBTA 4O95A 1W1MA 3AM9A 3GSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UD8 A;  2GQU A;  3FW9 A;  1DZN A;  3W8X A;  1W1L A;  2VFS A;  3W8W A;  4JB1 A;  4OAL A;  2Y4G A;  3BW7 A;  2BVG A;  1N62 C;  2W3S A;  3S1D A;  2W3R A;  3D2D A;  5FXP A;  4PWC A;  4PWB A;  4BC7 A;  4MLA A;  4PVK A;  1WYG A;  2I0K A;  5ADZ A;  5I1V A;  1W1O A;  5I1W A;  1FFU C;  2Y3S A;  3FWA A;  5FXF A;  1QLT A;  3AN1 A;  1T3Q C;  3RJ8 A;  1E8G A;  1FFV C;  1N60 C;  3I99 A;  1VDV A;  2VAO A;  4BC9 A;  4EC3 A;  2E3T A;  5AWV A;  5HQX A;  4DNS A;  3B9J B;  2BVH A;  1W1R A;  2VFV A;  2Y08 A;  5L6G A;  2QKN A;  3S1F A;  3ETR B;  5AE2 A;  1WVE A;  3NRZ B;  2WDW A;  5HHZ A;  4BBY A;  3HSU A;  2Y3R A;  2GQT A;  1W1J A;  5L6F A;  3TX1 A;  3NS1 B;  1W1K A;  4PVH A;  1ZR6 A;  4PZF A;  1ZXI C;  1UXY A;  1W1Q A;  3RJA A;  2IPI A;  4PVJ A;  4BCA A;  3EUB 3;  1N5X A;  2W55 A;  1VAO A;  1HSK A;  3S1C A;  2EXR A;  3VTE A;  2Q4W A;  3FW7 A;  5D79 A;  3TSH A;  4PVE A;  3PQB A;  3DQ0 A;  1V97 A;  2AXR A;  3AMZ A;  5FXD A;  3FW8 A;  1E8H A;  2Q85 A;  3JS8 A;  3NVZ B;  5K8E A;  3W8Z A;  1I19 A;  4JAY A;  3KJM A;  4XLO A;  1AHZ A;  1QLU A;  1N63 C;  1N5W C;  5FXE A;  3TSJ A;  1FO4 A;  3C0P A;  1W1S A;  2VFU A;  1E8F A;  1WVF A;  2QPM A;  1AHU A;  1N61 C;  3PM9 A;  1DIQ A;  2W54 A;  4PYT A;  1E0Y A;  1F0X A;  4ZOH B;  3POP A;  5HMR A;  1MBB A;  1DII A;  2MBR A;  4ML8 A;  1JRO A;  5AE1 A;  3D2H A;  3S1E A;  2BVF A;  2VFR A;  3D2J A;  1AHV A;  5AE3 A;  1FIQ B;  3SR6 B;  2VFT A;  1MBT A;  4O95 A;  1W1M A;  3AM9 A;  3GSY A; 
#chains in the Genus database with same CATH topology
 4UD8 A;  2PLS A;  2GQU A;  3FW9 A;  2P13 A;  1DZN A;  3W8X A;  1W1L A;  2VFS A;  3W8W A;  4JB1 A;  4OAL A;  2Y4G A;  3BW7 A;  2BVG A;  1N62 C;  2W3S A;  3S1D A;  2W3R A;  3D2D A;  5FXP A;  4PWC A;  3EJD B;  4PWB A;  4BC7 A;  4MLA A;  1JRP A;  4PVK A;  1WYG A;  2I0K A;  5ADZ A;  5I1V A;  1W1O A;  5I1W A;  1FFU C;  2Y3S A;  3FWA A;  5FXF A;  1QLT A;  3AN1 A;  1T3Q C;  3RJ8 A;  1E8G A;  3LLB A;  1FFV C;  1N60 C;  3I99 A;  1VDV A;  3NVV B;  2VAO A;  4BC9 A;  1RM6 B;  4EC3 A;  3HRD C;  2E3T A;  5AWV A;  5HQX A;  4DNS A;  3B9J B;  2BVH A;  1W1R A;  2VFV A;  2Y08 A;  5L6G A;  2QKN A;  2RK5 A;  3S1F A;  3ETR B;  5AE2 A;  1WVE A;  3NRZ B;  2WDW A;  5HHZ A;  3EJE B;  4BBY A;  3HSU A;  2Y3R A;  2GQT A;  1W1J A;  5L6F A;  3TX1 A;  3NS1 B;  1W1K A;  4PVH A;  1ZR6 A;  4PZF A;  1ZXI C;  1UXY A;  1W1Q A;  3RJA A;  2IPI A;  4PVJ A;  4BCA A;  2UUV A;  3EUB 3;  1N5X A;  2W55 A;  3EJB B;  1VAO A;  1HSK A;  3S1C A;  2P4P A;  2EXR A;  3VTE A;  2YVS A;  2Q4W A;  3FW7 A;  3NVW B;  5D79 A;  3TSH A;  4PVE A;  2O3G A;  3PQB A;  3DQ0 A;  1V97 A;  2AXR A;  3AMZ A;  3DED A;  3LAE A;  5FXD A;  3FW8 A;  1E8H A;  2Q85 A;  3JS8 A;  3NVZ B;  5G5H B;  5K8E A;  2UUU A;  3W8Z A;  1I19 A;  4JAY A;  3KJM A;  4XLO A;  1AHZ A;  1QLU A;  2P3H A;  1N63 C;  4HG0 A;  1N5W C;  5FXE A;  3TSJ A;  3NVY B;  1FO4 A;  2R8D A;  2NQW A;  3C0P A;  1W1S A;  2VFU A;  2PLI A;  1E8F A;  1WVF A;  2QPM A;  1AHU A;  1N61 C;  3PM9 A;  1DIQ A;  2W54 A;  4PYT A;  1E0Y A;  1F0X A;  4ZOH B;  3POP A;  5HMR A;  1MBB A;  1DII A;  2MBR A;  5G5G B;  4ML8 A;  1JRO A;  5AE1 A;  3D2H A;  3S1E A;  1SB3 B;  2R2Z A;  2BVF A;  2VFR A;  3D2J A;  2OAI A;  1AHV A;  5AE3 A;  1FIQ B;  3SR6 B;  2VFT A;  1MBT A;  4O95 A;  1W1M A;  3AM9 A;  3GSY A; 
#chains in the Genus database with same CATH homology
 4UD8 A;  2PLS A;  2GQU A;  3FW9 A;  2P13 A;  1DZN A;  3W8X A;  1W1L A;  2VFS A;  3W8W A;  4JB1 A;  4OAL A;  2Y4G A;  3BW7 A;  2BVG A;  1N62 C;  2W3S A;  3S1D A;  2W3R A;  3D2D A;  5FXP A;  4PWC A;  4PWB A;  4BC7 A;  4MLA A;  1JRP A;  4PVK A;  1WYG A;  2I0K A;  5ADZ A;  5I1V A;  1W1O A;  5I1W A;  1FFU C;  2Y3S A;  3FWA A;  5FXF A;  1QLT A;  3AN1 A;  1T3Q C;  3RJ8 A;  1E8G A;  3LLB A;  1FFV C;  1N60 C;  3I99 A;  1VDV A;  1RM6 B;  2VAO A;  4BC9 A;  3NVV B;  4EC3 A;  3HRD C;  2E3T A;  5AWV A;  5HQX A;  4DNS A;  3B9J B;  2BVH A;  1W1R A;  2VFV A;  2Y08 A;  5L6G A;  2QKN A;  2RK5 A;  3S1F A;  3ETR B;  5AE2 A;  1WVE A;  3NRZ B;  2WDW A;  5HHZ A;  4BBY A;  3HSU A;  2Y3R A;  2GQT A;  1W1J A;  5L6F A;  3TX1 A;  3NS1 B;  1W1K A;  4PVH A;  1ZR6 A;  4PZF A;  1ZXI C;  1UXY A;  1W1Q A;  3RJA A;  2IPI A;  4PVJ A;  4BCA A;  2UUV A;  3EUB 3;  1N5X A;  2W55 A;  1VAO A;  1HSK A;  3S1C A;  2P4P A;  2EXR A;  3VTE A;  2YVS A;  2Q4W A;  3FW7 A;  3NVW B;  5D79 A;  3TSH A;  4PVE A;  2O3G A;  3PQB A;  3DQ0 A;  1V97 A;  2AXR A;  3AMZ A;  3DED A;  3LAE A;  5FXD A;  3FW8 A;  1E8H A;  2Q85 A;  3JS8 A;  3NVZ B;  5G5H B;  5K8E A;  2UUU A;  3W8Z A;  1I19 A;  4JAY A;  3KJM A;  4XLO A;  1AHZ A;  1QLU A;  2P3H A;  1N63 C;  4HG0 A;  1N5W C;  5FXE A;  3TSJ A;  3NVY B;  1FO4 A;  2R8D A;  2NQW A;  3C0P A;  1W1S A;  2VFU A;  2PLI A;  1E8F A;  1WVF A;  2QPM A;  1AHU A;  1N61 C;  3PM9 A;  1DIQ A;  2W54 A;  4PYT A;  1E0Y A;  1F0X A;  4ZOH B;  3POP A;  5HMR A;  1MBB A;  1DII A;  2MBR A;  5G5G B;  4ML8 A;  1JRO A;  5AE1 A;  3D2H A;  3S1E A;  1SB3 B;  2R2Z A;  2BVF A;  2VFR A;  3D2J A;  2OAI A;  1AHV A;  5AE3 A;  1FIQ B;  3SR6 B;  2VFT A;  1MBT A;  4O95 A;  1W1M A;  3AM9 A;  3GSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...