2Q85A

Crystal structure of e. coli mur b bound to a naphthyl tetronic acid inihibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
NHSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title Crystal Structure of E. Coli Mur B bound to a napthyl tetronic acid inhibitor
rcsb
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2q85A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2q85A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 2q85A03
5AE2A 1AHUA 1VAOA 1DIQA 3TSJA 3B9JB 2Q4WA 1N5XA 1W1RA 5FXPA 1QLUA 4ML8A 1E8HA 1FIQB 3NVVB 5FXEA 2QPMA 3D2DA 1MBBA 2PLSA 4PVKA 5HHZA 1ZXIC 1QLTA 1N5WC 3I99A 3DEDA 3FW7A 3D2JA 1V97A 2EXRA 3W8WA 1WVEA 3AM9A 2RK5A 3KJMA 1N60C 1I19A 2QKNA 2W3SA 5D79A 3ETRB 2Q85A 4ZOHB 1JROA 3TX1A 3NRZB 3S1DA 1MBTA 2GQTA 2PLIA 4BC7A 2R8DA 1WYGA 1HSKA 4PVJA 1FFVC 4JB1A 4PWCA 3VTEA 1N62C 1T3QC 1VDVA 3NVWB 3FW8A 1FO4A 4XLOA 3GSYA 3S1CA 5AE1A 1DZNA 3HRDC 2O3GA 3FWAA 1WVFA 2BVFA 3FW9A 1W1QA 2OAIA 4O95A 4BC9A 3NVYB 1E0YA 2VFUA 5FXDA 3BW7A 5G5HB 1ZR6A 2VAOA 2YVSA 2P3HA 1RM6B 2W54A 3D2HA 2E3TA 1W1JA 1UXYA 3W8ZA 1W1MA 3PM9A 4PVEA 3SR6B 1W1LA 2VFSA 2P4PA 2GQUA 1AHVA 1JRPA 5G5GB 4JAYA 3S1FA 1AHZA 1E8GA 1W1KA 4PZFA 1DIIA 3NVZB 4UD8A 3TSHA 1SB3B 3DQ0A 2MBRA 2W55A 1W1OA 4PYTA 2R2ZA 2BVHA 3AMZA 5FXFA 1W1SA 1N63C 1N61C 2VFTA 5HMRA 3C0PA 4PVHA 2W3RA 3W8XA 3AN1A 2VFVA 5AE3A 2I0KA 3JS8A 4DNSA 4EC3A 3EUB3 4PWBA 2AXRA 4BCAA 4OALA 2BVGA 1F0XA 4BBYA 2VFRA 4MLAA 1FFUC 3NS1B 4HG0A 2NQWA 5HQXA 3S1EA 5ADZA 2P13A 3LAEA 1E8FA 3LLBA
chains in the Genus database with same CATH superfamily
5AE2A 1AHUA 2Y3RA 1VAOA 1DIQA 3TSJA 3B9JB 2Q4WA 1N5XA 1W1RA 5FXPA 1QLUA 4ML8A 1E8HA 1FIQB 3NVVB 5FXEA 2QPMA 3D2DA 1MBBA 2PLSA 4PVKA 3RJAA 5HHZA 3EJEB 1ZXIC 1QLTA 1N5WC 3I99A 3DEDA 5I1WA 3FW7A 3D2JA 1V97A 2EXRA 3W8WA 2WDWA 1WVEA 3AM9A 2RK5A 3KJMA 1N60C 1I19A 2QKNA 2W3SA 5D79A 3ETRB 2Q85A 4ZOHB 1JROA 3TX1A 3NRZB 3S1DA 1MBTA 2GQTA 5L6FA 2PLIA 3PQBA 4BC7A 2R8DA 1WYGA 1HSKA 4PVJA 1FFVC 4JB1A 2Y4GA 4PWCA 3VTEA 1N62C 1T3QC 1VDVA 3NVWB 3FW8A 1FO4A 4XLOA 3GSYA 3S1CA 5AE1A 5K8EA 1DZNA 2Y08A 3HRDC 2O3GA 3FWAA 2UUUA 1WVFA 2BVFA 3FW9A 1W1QA 2OAIA 5L6GA 4O95A 2IPIA 4BC9A 3NVYB 1E0YA 2VFUA 5FXDA 3BW7A 5G5HB 1ZR6A 2VAOA 2YVSA 2P3HA 1RM6B 2W54A 3EJBB 3D2HA 2E3TA 1W1JA 1UXYA 3W8ZA 1W1MA 3PM9A 4PVEA 3SR6B 1W1LA 2VFSA 2P4PA 2GQUA 1AHVA 3RJ8A 1JRPA 5G5GB 4JAYA 3S1FA 1AHZA 1E8GA 1W1KA 3EJDB 4PZFA 5I1VA 1DIIA 3NVZB 4UD8A 3TSHA 1SB3B 3DQ0A 2MBRA 2W55A 1W1OA 4PYTA 2R2ZA 2BVHA 2Y3SA 2UUVA 3AMZA 5FXFA 1W1SA 1N63C 1N61C 2VFTA 5HMRA 3C0PA 4PVHA 2W3RA 3W8XA 3HSUA 3AN1A 2VFVA 5AWVA 5AE3A 2I0KA 3JS8A 4DNSA 4EC3A 3EUB3 4PWBA 2AXRA 4BCAA 4OALA 2BVGA 1F0XA 4BBYA 2VFRA 4MLAA 3POPA 1FFUC 3NS1B 4HG0A 2NQWA 5HQXA 3S1EA 5ADZA 2P13A 3LAEA 1E8FA 3LLBA
chains in the Genus database with same CATH topology
5AE2A 1AHUA 2Y3RA 1VAOA 1DIQA 3TSJA 3B9JB 2Q4WA 1N5XA 1W1RA 5FXPA 1QLUA 4ML8A 1E8HA 1FIQB 3NVVB 5FXEA 2QPMA 3D2DA 1MBBA 2PLSA 4PVKA 3RJAA 5HHZA 1ZXIC 1QLTA 1N5WC 3I99A 3DEDA 5I1WA 3FW7A 3D2JA 1V97A 2EXRA 3W8WA 2WDWA 1WVEA 3AM9A 2RK5A 3KJMA 1N60C 1I19A 2QKNA 2W3SA 5D79A 3ETRB 2Q85A 4ZOHB 1JROA 3TX1A 3NRZB 3S1DA 1MBTA 2GQTA 5L6FA 2PLIA 3PQBA 4BC7A 2R8DA 1WYGA 1HSKA 4PVJA 1FFVC 4JB1A 2Y4GA 4PWCA 3VTEA 1N62C 1T3QC 1VDVA 3NVWB 3FW8A 1FO4A 4XLOA 3GSYA 3S1CA 5AE1A 5K8EA 1DZNA 2Y08A 3HRDC 2O3GA 3FWAA 2UUUA 1WVFA 2BVFA 3FW9A 1W1QA 2OAIA 5L6GA 4O95A 2IPIA 4BC9A 3NVYB 1E0YA 2VFUA 5FXDA 3BW7A 5G5HB 1ZR6A 2VAOA 2YVSA 2P3HA 1RM6B 2W54A 3D2HA 2E3TA 1W1JA 1UXYA 3W8ZA 1W1MA 3PM9A 4PVEA 3SR6B 1W1LA 2VFSA 2P4PA 2GQUA 1AHVA 3RJ8A 1JRPA 5G5GB 4JAYA 3S1FA 1AHZA 1E8GA 1W1KA 4PZFA 5I1VA 1DIIA 3NVZB 4UD8A 3TSHA 1SB3B 3DQ0A 2MBRA 2W55A 1W1OA 4PYTA 2R2ZA 2BVHA 2Y3SA 2UUVA 3AMZA 5FXFA 1W1SA 1N63C 1N61C 2VFTA 5HMRA 3C0PA 4PVHA 2W3RA 3W8XA 3HSUA 3AN1A 2VFVA 5AWVA 5AE3A 2I0KA 3JS8A 4DNSA 4EC3A 3EUB3 4PWBA 2AXRA 4BCAA 4OALA 2BVGA 1F0XA 4BBYA 2VFRA 4MLAA 3POPA 1FFUC 3NS1B 4HG0A 2NQWA 5HQXA 3S1EA 5ADZA 2P13A 3LAEA 1E8FA 3LLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AE2 A;  1AHU A;  1VAO A;  1DIQ A;  3TSJ A;  3B9J B;  2Q4W A;  1N5X A;  1W1R A;  5FXP A;  1QLU A;  4ML8 A;  1E8H A;  1FIQ B;  3NVV B;  5FXE A;  2QPM A;  3D2D A;  1MBB A;  2PLS A;  4PVK A;  5HHZ A;  1ZXI C;  1QLT A;  1N5W C;  3I99 A;  3DED A;  3FW7 A;  3D2J A;  1V97 A;  2EXR A;  3W8W A;  1WVE A;  3AM9 A;  2RK5 A;  3KJM A;  1N60 C;  1I19 A;  2QKN A;  2W3S A;  5D79 A;  3ETR B;  2Q85 A;  4ZOH B;  1JRO A;  3TX1 A;  3NRZ B;  3S1D A;  1MBT A;  2GQT A;  2PLI A;  4BC7 A;  2R8D A;  1WYG A;  1HSK A;  4PVJ A;  1FFV C;  4JB1 A;  4PWC A;  3VTE A;  1N62 C;  1T3Q C;  1VDV A;  3NVW B;  3FW8 A;  1FO4 A;  4XLO A;  3GSY A;  3S1C A;  5AE1 A;  1DZN A;  3HRD C;  2O3G A;  3FWA A;  1WVF A;  2BVF A;  3FW9 A;  1W1Q A;  2OAI A;  4O95 A;  4BC9 A;  3NVY B;  1E0Y A;  2VFU A;  5FXD A;  3BW7 A;  5G5H B;  1ZR6 A;  2VAO A;  2YVS A;  2P3H A;  1RM6 B;  2W54 A;  3D2H A;  2E3T A;  1W1J A;  1UXY A;  3W8Z A;  1W1M A;  3PM9 A;  4PVE A;  3SR6 B;  1W1L A;  2VFS A;  2P4P A;  2GQU A;  1AHV A;  1JRP A;  5G5G B;  4JAY A;  3S1F A;  1AHZ A;  1E8G A;  1W1K A;  4PZF A;  1DII A;  3NVZ B;  4UD8 A;  3TSH A;  1SB3 B;  3DQ0 A;  2MBR A;  2W55 A;  1W1O A;  4PYT A;  2R2Z A;  2BVH A;  3AMZ A;  5FXF A;  1W1S A;  1N63 C;  1N61 C;  2VFT A;  5HMR A;  3C0P A;  4PVH A;  2W3R A;  3W8X A;  3AN1 A;  2VFV A;  5AE3 A;  2I0K A;  3JS8 A;  4DNS A;  4EC3 A;  3EUB 3;  4PWB A;  2AXR A;  4BCA A;  4OAL A;  2BVG A;  1F0X A;  4BBY A;  2VFR A;  4MLA A;  1FFU C;  3NS1 B;  4HG0 A;  2NQW A;  5HQX A;  3S1E A;  5ADZ A;  2P13 A;  3LAE A;  1E8F A;  3LLB A; 
#chains in the Genus database with same CATH topology
 5AE2 A;  1AHU A;  2Y3R A;  1VAO A;  1DIQ A;  3TSJ A;  3B9J B;  2Q4W A;  1N5X A;  1W1R A;  5FXP A;  1QLU A;  4ML8 A;  1E8H A;  1FIQ B;  3NVV B;  5FXE A;  2QPM A;  3D2D A;  1MBB A;  2PLS A;  4PVK A;  3RJA A;  5HHZ A;  3EJE B;  1ZXI C;  1QLT A;  1N5W C;  3I99 A;  3DED A;  5I1W A;  3FW7 A;  3D2J A;  1V97 A;  2EXR A;  3W8W A;  2WDW A;  1WVE A;  3AM9 A;  2RK5 A;  3KJM A;  1N60 C;  1I19 A;  2QKN A;  2W3S A;  5D79 A;  3ETR B;  2Q85 A;  4ZOH B;  1JRO A;  3TX1 A;  3NRZ B;  3S1D A;  1MBT A;  2GQT A;  5L6F A;  2PLI A;  3PQB A;  4BC7 A;  2R8D A;  1WYG A;  1HSK A;  4PVJ A;  1FFV C;  4JB1 A;  2Y4G A;  4PWC A;  3VTE A;  1N62 C;  1T3Q C;  1VDV A;  3NVW B;  3FW8 A;  1FO4 A;  4XLO A;  3GSY A;  3S1C A;  5AE1 A;  5K8E A;  1DZN A;  2Y08 A;  3HRD C;  2O3G A;  3FWA A;  2UUU A;  1WVF A;  2BVF A;  3FW9 A;  1W1Q A;  2OAI A;  5L6G A;  4O95 A;  2IPI A;  4BC9 A;  3NVY B;  1E0Y A;  2VFU A;  5FXD A;  3BW7 A;  5G5H B;  1ZR6 A;  2VAO A;  2YVS A;  2P3H A;  1RM6 B;  2W54 A;  3EJB B;  3D2H A;  2E3T A;  1W1J A;  1UXY A;  3W8Z A;  1W1M A;  3PM9 A;  4PVE A;  3SR6 B;  1W1L A;  2VFS A;  2P4P A;  2GQU A;  1AHV A;  3RJ8 A;  1JRP A;  5G5G B;  4JAY A;  3S1F A;  1AHZ A;  1E8G A;  1W1K A;  3EJD B;  4PZF A;  5I1V A;  1DII A;  3NVZ B;  4UD8 A;  3TSH A;  1SB3 B;  3DQ0 A;  2MBR A;  2W55 A;  1W1O A;  4PYT A;  2R2Z A;  2BVH A;  2Y3S A;  2UUV A;  3AMZ A;  5FXF A;  1W1S A;  1N63 C;  1N61 C;  2VFT A;  5HMR A;  3C0P A;  4PVH A;  2W3R A;  3W8X A;  3HSU A;  3AN1 A;  2VFV A;  5AWV A;  5AE3 A;  2I0K A;  3JS8 A;  4DNS A;  4EC3 A;  3EUB 3;  4PWB A;  2AXR A;  4BCA A;  4OAL A;  2BVG A;  1F0X A;  4BBY A;  2VFR A;  4MLA A;  3POP A;  1FFU C;  3NS1 B;  4HG0 A;  2NQW A;  5HQX A;  3S1E A;  5ADZ A;  2P13 A;  3LAE A;  1E8F A;  3LLB A; 
#chains in the Genus database with same CATH homology
 5AE2 A;  1AHU A;  2Y3R A;  1VAO A;  1DIQ A;  3TSJ A;  3B9J B;  2Q4W A;  1N5X A;  1W1R A;  5FXP A;  1QLU A;  4ML8 A;  1E8H A;  1FIQ B;  3NVV B;  5FXE A;  2QPM A;  3D2D A;  1MBB A;  2PLS A;  4PVK A;  3RJA A;  5HHZ A;  1ZXI C;  1QLT A;  1N5W C;  3I99 A;  3DED A;  5I1W A;  3FW7 A;  3D2J A;  1V97 A;  2EXR A;  3W8W A;  2WDW A;  1WVE A;  3AM9 A;  2RK5 A;  3KJM A;  1N60 C;  1I19 A;  2QKN A;  2W3S A;  5D79 A;  3ETR B;  2Q85 A;  4ZOH B;  1JRO A;  3TX1 A;  3NRZ B;  3S1D A;  1MBT A;  2GQT A;  5L6F A;  2PLI A;  3PQB A;  4BC7 A;  2R8D A;  1WYG A;  1HSK A;  4PVJ A;  1FFV C;  4JB1 A;  2Y4G A;  4PWC A;  3VTE A;  1N62 C;  1T3Q C;  1VDV A;  3NVW B;  3FW8 A;  1FO4 A;  4XLO A;  3GSY A;  3S1C A;  5AE1 A;  5K8E A;  1DZN A;  2Y08 A;  3HRD C;  2O3G A;  3FWA A;  2UUU A;  1WVF A;  2BVF A;  3FW9 A;  1W1Q A;  2OAI A;  5L6G A;  4O95 A;  2IPI A;  4BC9 A;  3NVY B;  1E0Y A;  2VFU A;  5FXD A;  3BW7 A;  5G5H B;  1ZR6 A;  2VAO A;  2YVS A;  2P3H A;  1RM6 B;  2W54 A;  3D2H A;  2E3T A;  1W1J A;  1UXY A;  3W8Z A;  1W1M A;  3PM9 A;  4PVE A;  3SR6 B;  1W1L A;  2VFS A;  2P4P A;  2GQU A;  1AHV A;  3RJ8 A;  1JRP A;  5G5G B;  4JAY A;  3S1F A;  1AHZ A;  1E8G A;  1W1K A;  4PZF A;  5I1V A;  1DII A;  3NVZ B;  4UD8 A;  3TSH A;  1SB3 B;  3DQ0 A;  2MBR A;  2W55 A;  1W1O A;  4PYT A;  2R2Z A;  2BVH A;  2Y3S A;  2UUV A;  3AMZ A;  5FXF A;  1W1S A;  1N63 C;  1N61 C;  2VFT A;  5HMR A;  3C0P A;  4PVH A;  2W3R A;  3W8X A;  3HSU A;  3AN1 A;  2VFV A;  5AWV A;  5AE3 A;  2I0K A;  3JS8 A;  4DNS A;  4EC3 A;  3EUB 3;  4PWB A;  2AXR A;  4BCA A;  4OAL A;  2BVG A;  1F0X A;  4BBY A;  2VFR A;  4MLA A;  3POP A;  1FFU C;  3NS1 B;  4HG0 A;  2NQW A;  5HQX A;  3S1E A;  5ADZ A;  2P13 A;  3LAE A;  1E8F A;  3LLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...