2Q85A

Crystal structure of e. coli mur b bound to a naphthyl tetronic acid inihibitor
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
341
structure length
341
Chain Sequence
b'NHSLKPWNTFGIDHNAQHIVCAEDEQQLLNAWQYATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDAWYLHVGAGENWHRLVKYTLQEGMPGLENLALIPGCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRLTAKECRFGYRDSIFKHEYQDRFAIVAVGLRLPKEWQPVLTYGDLTRLDPTTVTPQQVFNAVCHMRTTKLPDPKVNGNAGSFFKNPVVSAETAKALLSQFPTAPNYPQADGSVKLAAGWLIDQCQLKGMQIGGAAVHRQQALVLINEDNAKSEDVVQLAHHVRQKVGEKFNVWLEPEVRFIGASGEVSAVETIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-N-acetylenolpyruvoylglucosamine reductase
publication title Crystal Structure of E. Coli Mur B bound to a napthyl tetronic acid inhibitor
rcsb
molecule tags Oxidoreductase
total genus 101
structure length 341
sequence length 341
ec nomenclature ec 1.3.1.98: UDP-N-acetylmuramate dehydrogenase.
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF02873 MurB_C UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2q85A01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2q85A02
3.90.78.10 Alpha Beta Alpha-Beta Complex Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 1 UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain 2q85A03
1V97A 4O95A 1E8GA 2I0KA 1UXYA 2AXRA 5FXFA 3KJMA 2EXRA 1W1JA 3EUB3 5G5GB 3BW7A 1MBBA 1FFUC 5FXDA 1WYGA 4BC7A 2Q85A 3AM9A 4PWBA 5AE2A 3VTEA 2W3SA 1W1RA 2P3HA 4HG0A 1E8HA 4PWCA 2NQWA 3FW8A 4OALA 3TX1A 2VFVA 1VDVA 3W8XA 1SB3B 4ZOHB 1T3QC 2QPMA 3NVVB 1DIIA 1DIQA 3AMZA 1N5WC 2MBRA 4XLOA 2PLIA 5G5HB 3FW7A 2VFSA 2R2ZA 3NVYB 1E8FA 2W54A 1N5XA 5D79A 2QKNA 4MLAA 3AN1A 4JB1A 4PYTA 5HMRA 5FXPA 2VFUA 1ZXIC 1QLUA 3W8WA 1FO4A 2BVFA 3NRZB 4ML8A 3C0PA 3B9JB 2PLSA 3PM9A 3TSHA 1JRPA 4BCAA 2VFTA 2GQTA 2O3GA 4UD8A 1W1OA 1AHZA 1W1KA 1AHUA 2VFRA 2W55A 2VAOA 4PVEA 1VAOA 2OAIA 2R8DA 1W1SA 1MBTA 3NS1B 5FXEA 3NVZB 4PVHA 5HHZA 2P4PA 2GQUA 3W8ZA 1N63C 1W1MA 3GSYA 2E3TA 3TSJA 3NVWB 3D2DA 3FWAA 1ZR6A 3S1FA 2RK5A 2BVHA 3LAEA 1I19A 5AE3A 1HSKA 3ETRB 3SR6B 1F0XA 1QLTA 3FW9A 1DZNA 1N62C 1N61C 1WVFA 4EC3A 1JROA 1FFVC 4JAYA 1N60C 2YVSA 2W3RA 1W1QA 3D2HA 2Q4WA 3DQ0A 5ADZA 3LLBA 4PZFA 2P13A 3S1CA 4PVJA 1W1LA 5AE1A 1AHVA 1WVEA 4BBYA 3D2JA 5HQXA 3DEDA 3HRDC 4DNSA 1E0YA 4PVKA 1RM6B 1FIQB 3S1DA 2BVGA 3S1EA 4BC9A 3I99A 3JS8A
chains in the Genus database with same CATH superfamily
5I1VA 1V97A 4O95A 5L6FA 1E8GA 2I0KA 1UXYA 2AXRA 5FXFA 3KJMA 2EXRA 2Y3RA 1W1JA 3EUB3 5G5GB 3BW7A 1MBBA 1FFUC 5FXDA 2UUVA 1WYGA 4BC7A 2Q85A 3AM9A 4PWBA 5AE2A 3VTEA 3HSUA 2W3SA 1W1RA 2P3HA 4HG0A 5AWVA 1E8HA 4PWCA 2NQWA 3FW8A 4OALA 3TX1A 2VFVA 1VDVA 3W8XA 1SB3B 4ZOHB 1T3QC 2QPMA 3NVVB 3PQBA 1DIIA 1DIQA 3AMZA 1N5WC 2MBRA 4XLOA 2UUUA 2PLIA 5G5HB 3FW7A 2VFSA 3NVYB 2R2ZA 2Y08A 1E8FA 5K8EA 2W54A 1N5XA 5D79A 5L6GA 3EJDB 2QKNA 4MLAA 3AN1A 4JB1A 4PYTA 5HMRA 5FXPA 2VFUA 1ZXIC 1QLUA 3W8WA 3POPA 1FO4A 2BVFA 3NRZB 4ML8A 3C0PA 3B9JB 2PLSA 3PM9A 3TSHA 1JRPA 4BCAA 2VFTA 2GQTA 2O3GA 4UD8A 1W1OA 1AHZA 1W1KA 1AHUA 2VFRA 2W55A 2VAOA 4PVEA 1VAOA 2OAIA 2R8DA 1W1SA 1MBTA 2Y4GA 3NS1B 5FXEA 3NVZB 4PVHA 5HHZA 2P4PA 2GQUA 3W8ZA 2IPIA 1N63C 1W1MA 3GSYA 2E3TA 3TSJA 3NVWB 3D2DA 3FWAA 1ZR6A 3S1FA 2RK5A 2BVHA 3LAEA 1I19A 3EJBB 5AE3A 1HSKA 3ETRB 3SR6B 1F0XA 1QLTA 2WDWA 3FW9A 1DZNA 1N62C 1N61C 3RJAA 1WVFA 4EC3A 1JROA 1FFVC 4JAYA 1N60C 2YVSA 2W3RA 1W1QA 3D2HA 2Q4WA 3DQ0A 5ADZA 3LLBA 4PZFA 2P13A 3S1CA 4PVJA 1W1LA 3RJ8A 5AE1A 1AHVA 1WVEA 4BBYA 3D2JA 5HQXA 3DEDA 3EJEB 3HRDC 4DNSA 5I1WA 1E0YA 4PVKA 1RM6B 1FIQB 3S1DA 2BVGA 3S1EA 4BC9A 3I99A 3JS8A 2Y3SA
chains in the Genus database with same CATH topology
5I1VA 1V97A 4O95A 5L6FA 1E8GA 2I0KA 1UXYA 2AXRA 5FXFA 3KJMA 2EXRA 2Y3RA 1W1JA 3EUB3 5G5GB 3BW7A 1MBBA 1FFUC 5FXDA 2UUVA 1WYGA 4BC7A 2Q85A 3AM9A 4PWBA 5AE2A 3VTEA 3HSUA 2W3SA 1W1RA 2P3HA 4HG0A 5AWVA 1E8HA 4PWCA 2NQWA 3FW8A 4OALA 3TX1A 2VFVA 1VDVA 3W8XA 1SB3B 4ZOHB 1T3QC 2QPMA 3NVVB 3PQBA 1DIIA 1DIQA 3AMZA 1N5WC 2MBRA 4XLOA 2UUUA 2PLIA 5G5HB 3FW7A 2VFSA 2R2ZA 2Y08A 3NVYB 1E8FA 5K8EA 2W54A 1N5XA 5D79A 5L6GA 2QKNA 4MLAA 3AN1A 4JB1A 4PYTA 5HMRA 5FXPA 2VFUA 1ZXIC 1QLUA 3W8WA 3POPA 1FO4A 2BVFA 3NRZB 4ML8A 3C0PA 3B9JB 2PLSA 3PM9A 3TSHA 1JRPA 4BCAA 2VFTA 2GQTA 2O3GA 4UD8A 1W1OA 1AHZA 1W1KA 1AHUA 2VFRA 2W55A 2VAOA 4PVEA 1VAOA 2OAIA 2R8DA 1W1SA 1MBTA 2Y4GA 3NS1B 5FXEA 3NVZB 4PVHA 5HHZA 2P4PA 2GQUA 3W8ZA 2IPIA 1N63C 1W1MA 3GSYA 2E3TA 3TSJA 3NVWB 3D2DA 3FWAA 1ZR6A 3S1FA 2RK5A 2BVHA 3LAEA 1I19A 5AE3A 1HSKA 3ETRB 3SR6B 1F0XA 1QLTA 2WDWA 3FW9A 1DZNA 1N62C 1N61C 3RJAA 1WVFA 4EC3A 1JROA 1FFVC 4JAYA 1N60C 2YVSA 2W3RA 1W1QA 3D2HA 2Q4WA 3DQ0A 5ADZA 3LLBA 4PZFA 2P13A 3S1CA 4PVJA 1W1LA 3RJ8A 5AE1A 1AHVA 1WVEA 4BBYA 3D2JA 5HQXA 3DEDA 3HRDC 4DNSA 5I1WA 1E0YA 4PVKA 1RM6B 1FIQB 3S1DA 2BVGA 3S1EA 4BC9A 3I99A 3JS8A 2Y3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  4O95 A;  1E8G A;  2I0K A;  1UXY A;  2AXR A;  5FXF A;  3KJM A;  2EXR A;  1W1J A;  3EUB 3;  5G5G B;  3BW7 A;  1MBB A;  1FFU C;  5FXD A;  1WYG A;  4BC7 A;  2Q85 A;  3AM9 A;  4PWB A;  5AE2 A;  3VTE A;  2W3S A;  1W1R A;  2P3H A;  4HG0 A;  1E8H A;  4PWC A;  2NQW A;  3FW8 A;  4OAL A;  3TX1 A;  2VFV A;  1VDV A;  3W8X A;  1SB3 B;  4ZOH B;  1T3Q C;  2QPM A;  3NVV B;  1DII A;  1DIQ A;  3AMZ A;  1N5W C;  2MBR A;  4XLO A;  2PLI A;  5G5H B;  3FW7 A;  2VFS A;  2R2Z A;  3NVY B;  1E8F A;  2W54 A;  1N5X A;  5D79 A;  2QKN A;  4MLA A;  3AN1 A;  4JB1 A;  4PYT A;  5HMR A;  5FXP A;  2VFU A;  1ZXI C;  1QLU A;  3W8W A;  1FO4 A;  2BVF A;  3NRZ B;  4ML8 A;  3C0P A;  3B9J B;  2PLS A;  3PM9 A;  3TSH A;  1JRP A;  4BCA A;  2VFT A;  2GQT A;  2O3G A;  4UD8 A;  1W1O A;  1AHZ A;  1W1K A;  1AHU A;  2VFR A;  2W55 A;  2VAO A;  4PVE A;  1VAO A;  2OAI A;  2R8D A;  1W1S A;  1MBT A;  3NS1 B;  5FXE A;  3NVZ B;  4PVH A;  5HHZ A;  2P4P A;  2GQU A;  3W8Z A;  1N63 C;  1W1M A;  3GSY A;  2E3T A;  3TSJ A;  3NVW B;  3D2D A;  3FWA A;  1ZR6 A;  3S1F A;  2RK5 A;  2BVH A;  3LAE A;  1I19 A;  5AE3 A;  1HSK A;  3ETR B;  3SR6 B;  1F0X A;  1QLT A;  3FW9 A;  1DZN A;  1N62 C;  1N61 C;  1WVF A;  4EC3 A;  1JRO A;  1FFV C;  4JAY A;  1N60 C;  2YVS A;  2W3R A;  1W1Q A;  3D2H A;  2Q4W A;  3DQ0 A;  5ADZ A;  3LLB A;  4PZF A;  2P13 A;  3S1C A;  4PVJ A;  1W1L A;  5AE1 A;  1AHV A;  1WVE A;  4BBY A;  3D2J A;  5HQX A;  3DED A;  3HRD C;  4DNS A;  1E0Y A;  4PVK A;  1RM6 B;  1FIQ B;  3S1D A;  2BVG A;  3S1E A;  4BC9 A;  3I99 A;  3JS8 A; 
#chains in the Genus database with same CATH topology
 5I1V A;  1V97 A;  4O95 A;  5L6F A;  1E8G A;  2I0K A;  1UXY A;  2AXR A;  5FXF A;  3KJM A;  2EXR A;  2Y3R A;  1W1J A;  3EUB 3;  5G5G B;  3BW7 A;  1MBB A;  1FFU C;  5FXD A;  2UUV A;  1WYG A;  4BC7 A;  2Q85 A;  3AM9 A;  4PWB A;  5AE2 A;  3VTE A;  3HSU A;  2W3S A;  1W1R A;  2P3H A;  4HG0 A;  5AWV A;  1E8H A;  4PWC A;  2NQW A;  3FW8 A;  4OAL A;  3TX1 A;  2VFV A;  1VDV A;  3W8X A;  1SB3 B;  4ZOH B;  1T3Q C;  2QPM A;  3NVV B;  3PQB A;  1DII A;  1DIQ A;  3AMZ A;  1N5W C;  2MBR A;  4XLO A;  2UUU A;  2PLI A;  5G5H B;  3FW7 A;  2VFS A;  3NVY B;  2R2Z A;  2Y08 A;  1E8F A;  5K8E A;  2W54 A;  1N5X A;  5D79 A;  5L6G A;  3EJD B;  2QKN A;  4MLA A;  3AN1 A;  4JB1 A;  4PYT A;  5HMR A;  5FXP A;  2VFU A;  1ZXI C;  1QLU A;  3W8W A;  3POP A;  1FO4 A;  2BVF A;  3NRZ B;  4ML8 A;  3C0P A;  3B9J B;  2PLS A;  3PM9 A;  3TSH A;  1JRP A;  4BCA A;  2VFT A;  2GQT A;  2O3G A;  4UD8 A;  1W1O A;  1AHZ A;  1W1K A;  1AHU A;  2VFR A;  2W55 A;  2VAO A;  4PVE A;  1VAO A;  2OAI A;  2R8D A;  1W1S A;  1MBT A;  2Y4G A;  3NS1 B;  5FXE A;  3NVZ B;  4PVH A;  5HHZ A;  2P4P A;  2GQU A;  3W8Z A;  2IPI A;  1N63 C;  1W1M A;  3GSY A;  2E3T A;  3TSJ A;  3NVW B;  3D2D A;  3FWA A;  1ZR6 A;  3S1F A;  2RK5 A;  2BVH A;  3LAE A;  1I19 A;  3EJB B;  5AE3 A;  1HSK A;  3ETR B;  3SR6 B;  1F0X A;  1QLT A;  2WDW A;  3FW9 A;  1DZN A;  1N62 C;  1N61 C;  3RJA A;  1WVF A;  4EC3 A;  1JRO A;  1FFV C;  4JAY A;  1N60 C;  2YVS A;  2W3R A;  1W1Q A;  3D2H A;  2Q4W A;  3DQ0 A;  5ADZ A;  3LLB A;  4PZF A;  2P13 A;  3S1C A;  4PVJ A;  1W1L A;  3RJ8 A;  5AE1 A;  1AHV A;  1WVE A;  4BBY A;  3D2J A;  5HQX A;  3DED A;  3EJE B;  3HRD C;  4DNS A;  5I1W A;  1E0Y A;  4PVK A;  1RM6 B;  1FIQ B;  3S1D A;  2BVG A;  3S1E A;  4BC9 A;  3I99 A;  3JS8 A;  2Y3S A; 
#chains in the Genus database with same CATH homology
 5I1V A;  1V97 A;  4O95 A;  5L6F A;  1E8G A;  2I0K A;  1UXY A;  2AXR A;  5FXF A;  3KJM A;  2EXR A;  2Y3R A;  1W1J A;  3EUB 3;  5G5G B;  3BW7 A;  1MBB A;  1FFU C;  5FXD A;  2UUV A;  1WYG A;  4BC7 A;  2Q85 A;  3AM9 A;  4PWB A;  5AE2 A;  3VTE A;  3HSU A;  2W3S A;  1W1R A;  2P3H A;  4HG0 A;  5AWV A;  1E8H A;  4PWC A;  2NQW A;  3FW8 A;  4OAL A;  3TX1 A;  2VFV A;  1VDV A;  3W8X A;  1SB3 B;  4ZOH B;  1T3Q C;  2QPM A;  3NVV B;  3PQB A;  1DII A;  1DIQ A;  3AMZ A;  1N5W C;  2MBR A;  4XLO A;  2UUU A;  2PLI A;  5G5H B;  3FW7 A;  2VFS A;  2R2Z A;  2Y08 A;  3NVY B;  1E8F A;  5K8E A;  2W54 A;  1N5X A;  5D79 A;  5L6G A;  2QKN A;  4MLA A;  3AN1 A;  4JB1 A;  4PYT A;  5HMR A;  5FXP A;  2VFU A;  1ZXI C;  1QLU A;  3W8W A;  3POP A;  1FO4 A;  2BVF A;  3NRZ B;  4ML8 A;  3C0P A;  3B9J B;  2PLS A;  3PM9 A;  3TSH A;  1JRP A;  4BCA A;  2VFT A;  2GQT A;  2O3G A;  4UD8 A;  1W1O A;  1AHZ A;  1W1K A;  1AHU A;  2VFR A;  2W55 A;  2VAO A;  4PVE A;  1VAO A;  2OAI A;  2R8D A;  1W1S A;  1MBT A;  2Y4G A;  3NS1 B;  5FXE A;  3NVZ B;  4PVH A;  5HHZ A;  2P4P A;  2GQU A;  3W8Z A;  2IPI A;  1N63 C;  1W1M A;  3GSY A;  2E3T A;  3TSJ A;  3NVW B;  3D2D A;  3FWA A;  1ZR6 A;  3S1F A;  2RK5 A;  2BVH A;  3LAE A;  1I19 A;  5AE3 A;  1HSK A;  3ETR B;  3SR6 B;  1F0X A;  1QLT A;  2WDW A;  3FW9 A;  1DZN A;  1N62 C;  1N61 C;  3RJA A;  1WVF A;  4EC3 A;  1JRO A;  1FFV C;  4JAY A;  1N60 C;  2YVS A;  2W3R A;  1W1Q A;  3D2H A;  2Q4W A;  3DQ0 A;  5ADZ A;  3LLB A;  4PZF A;  2P13 A;  3S1C A;  4PVJ A;  1W1L A;  3RJ8 A;  5AE1 A;  1AHV A;  1WVE A;  4BBY A;  3D2J A;  5HQX A;  3DED A;  3HRD C;  4DNS A;  5I1W A;  1E0Y A;  4PVK A;  1RM6 B;  1FIQ B;  3S1D A;  2BVG A;  3S1E A;  4BC9 A;  3I99 A;  3JS8 A;  2Y3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...