5D79A

Structure of bbe-like #28 from arabidopsis thaliana
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
503
structure length
498
Chain Sequence
HEDFLKCLSYTVEPKVIHTSKDSSFFSILDSSIQNPRFSVSETPKPVSIITPVKASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIAYNKPFAVIDLRNLRSISLDVDNRTGWVQTGATAGELYYEIGKTTKSLAFPAGIHPTVGVGGQFSGGGYGTLLRKYGLAADNIIDALVVDASGRILDRQAMGEDYFWAIRGGGGSSFGVILSWKVKLVDVPSTITVFKVQKTSKKEAVRIIKKWQYAADKVPDDLFIRTTLERSNKNAVHALFTGLYIGPVNNLLALMEEKFPELGLEKEGCEEMSWIESVLWFADFPKGESLGVLTNRERTSLSFKGKDDFVQEPIPEAAIQEIWRRLEAPEARLGKIILTPFGGKMSEMAEYETPFPHRGGNLYEIQYVAYWREEEDKNKTETDKYLKWVDSVYEFMTPYVSKSPRGAYVNFKDMDLGMYLGKKKTKYEEGKSWGVKYFKNNFERLVRVKTRVDPTDFFCDEQSIPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Berberine bridge enzyme-like protein
publication title Structure of a Berberine Bridge Enzyme-Like Enzyme with an Active Site Specific to the Plant Family Brassicaceae.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 167
structure length 498
sequence length 503
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5d79A01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5d79A02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5d79A03
2VFVA 2BVFA 4BC7A 3POPA 3GSYA 3RJAA 4JB1A 3FW7A 5AWVA 1N63C 1MBBA 3D2JA 5AE1A 2IPIA 3C0PA 3AM9A 5HQXA 4BBYA 4MLAA 2VAOA 1W1SA 5FXFA 2QPMA 3SR6B 3NRZB 1N5XA 4O95A 2W55A 1W1QA 4XLOA 5D79A 3W8ZA 5L6GA 2Q85A 3D2DA 3HSUA 3VTEA 3PM9A 2AXRA 4PZFA 1E8HA 3JS8A 1E8FA 2GQTA 1DIIA 4JAYA 1W1MA 3W8WA 2E3TA 1I19A 4PWCA 1JROA 1T3QC 5AE2A 3S1CA 5FXPA 1WVEA 1W1KA 3TSJA 1MBTA 1V97A 5AE3A 4DNSA 2Y08A 4PVEA 1W1RA 1FIQB 5ADZA 1QLUA 4BCAA 1N60C 1QLTA 3B9JB 3W8XA 1FFUC 2Y3SA 3S1DA 1DIQA 2WDWA 1AHUA 1E0YA 3NVZB 3S1EA 1WVFA 2BVGA 3EUB3 5HMRA 4ZOHB 4ML8A 5I1VA 1AHZA 3TSHA 3FWAA 1AHVA 1F0XA 1N5WC 3RJ8A 1ZXIC 3FW8A 3DQ0A 1W1LA 1N62C 3BW7A 3I99A 1FO4A 5HHZA 4OALA 5L6FA 1FFVC 1WYGA 2GQUA 5I1WA 2I0KA 2VFRA 2VFTA 2Y4GA 1E8GA 1ZR6A 2QKNA 1W1OA 1VDVA 2VFSA 4PWBA 3S1FA 3AMZA 4PVJA 3FW9A 3D2HA 1UXYA 1HSKA 3NS1B 5K8EA 1DZNA 2MBRA 3AN1A 2W54A 4EC3A 2Q4WA 4BC9A 1N61C 5FXEA 3ETRB 4UD8A 2EXRA 4PVHA 3PQBA 5FXDA 1VAOA 2VFUA 2BVHA 1W1JA 4PYTA 3TX1A 2W3SA 2W3RA 3KJMA 4PVKA 2Y3RA
chains in the Genus database with same CATH superfamily
2VFVA 2BVFA 4BC7A 3POPA 3GSYA 2OAIA 3RJAA 4JB1A 3FW7A 5AWVA 1N63C 1MBBA 2P4PA 3D2JA 5AE1A 1JRPA 3EJBB 2IPIA 3EJDB 3C0PA 3AM9A 5HQXA 1SB3B 3NVVB 4BBYA 4MLAA 2VAOA 1W1SA 5FXFA 3DEDA 3LAEA 2QPMA 3SR6B 3NRZB 1N5XA 4O95A 2W55A 2P3HA 1W1QA 4XLOA 2PLSA 1RM6B 5D79A 3W8ZA 5L6GA 2Q85A 3D2DA 2UUVA 3HSUA 2R8DA 3NVYB 3VTEA 3PM9A 2AXRA 4PZFA 1E8HA 3JS8A 1E8FA 2PLIA 2GQTA 1DIIA 4JAYA 1W1MA 3W8WA 2E3TA 1I19A 4PWCA 1JROA 1T3QC 5AE2A 3S1CA 5G5GB 5FXPA 1WVEA 1W1KA 3TSJA 1MBTA 1V97A 5AE3A 4DNSA 2Y08A 4PVEA 1W1RA 1FIQB 3HRDC 5ADZA 1QLUA 4BCAA 1N60C 1QLTA 3B9JB 3W8XA 1FFUC 5G5HB 2Y3SA 2P13A 3S1DA 4HG0A 1DIQA 2WDWA 2NQWA 1AHUA 1E0YA 3NVZB 3S1EA 1WVFA 2BVGA 3EUB3 2RK5A 5HMRA 4ZOHB 4ML8A 5I1VA 1AHZA 3NVWB 3TSHA 3FWAA 1AHVA 1F0XA 1N5WC 3RJ8A 1ZXIC 3FW8A 3DQ0A 2R2ZA 1W1LA 1N62C 3BW7A 3I99A 1FO4A 5HHZA 4OALA 5L6FA 2O3GA 1FFVC 1WYGA 2GQUA 5I1WA 2I0KA 2VFRA 2VFTA 3EJEB 2Y4GA 1E8GA 1ZR6A 2QKNA 1W1OA 1VDVA 2VFSA 4PWBA 2YVSA 3S1FA 3AMZA 4PVJA 3FW9A 3D2HA 3LLBA 1UXYA 1HSKA 3NS1B 5K8EA 1DZNA 2MBRA 3AN1A 2W54A 4EC3A 2Q4WA 4BC9A 1N61C 5FXEA 3ETRB 4UD8A 2EXRA 4PVHA 3PQBA 5FXDA 1VAOA 2VFUA 2BVHA 1W1JA 4PYTA 3TX1A 2UUUA 2W3SA 2W3RA 3KJMA 4PVKA 2Y3RA
chains in the Genus database with same CATH topology
2VFVA 2BVFA 4BC7A 3POPA 3GSYA 2OAIA 3RJAA 4JB1A 3FW7A 5AWVA 1N63C 1MBBA 2P4PA 3D2JA 5AE1A 1JRPA 2IPIA 3C0PA 3AM9A 5HQXA 1SB3B 3NVVB 4BBYA 4MLAA 2VAOA 1W1SA 5FXFA 3DEDA 3LAEA 2QPMA 3SR6B 3NRZB 1N5XA 4O95A 2W55A 2P3HA 1W1QA 4XLOA 2PLSA 1RM6B 5D79A 3W8ZA 5L6GA 2Q85A 3D2DA 2UUVA 3HSUA 2R8DA 3NVYB 3VTEA 3PM9A 2AXRA 4PZFA 1E8HA 3JS8A 1E8FA 2PLIA 2GQTA 1DIIA 4JAYA 1W1MA 3W8WA 2E3TA 1I19A 4PWCA 1JROA 1T3QC 5AE2A 3S1CA 5G5GB 5FXPA 1WVEA 1W1KA 3TSJA 1MBTA 1V97A 5AE3A 4DNSA 2Y08A 4PVEA 1W1RA 1FIQB 3HRDC 5ADZA 1QLUA 4BCAA 1N60C 1QLTA 3B9JB 3W8XA 1FFUC 5G5HB 2Y3SA 2P13A 3S1DA 4HG0A 1DIQA 2WDWA 2NQWA 1AHUA 1E0YA 3NVZB 3S1EA 1WVFA 2BVGA 3EUB3 2RK5A 5HMRA 4ZOHB 4ML8A 5I1VA 1AHZA 3TSHA 3NVWB 3FWAA 1AHVA 1F0XA 1N5WC 3RJ8A 1ZXIC 3FW8A 3DQ0A 2R2ZA 1W1LA 1N62C 3BW7A 3I99A 1FO4A 5HHZA 4OALA 5L6FA 2O3GA 1FFVC 1WYGA 2GQUA 5I1WA 2I0KA 2VFRA 2VFTA 2Y4GA 1E8GA 1ZR6A 2QKNA 1W1OA 1VDVA 2VFSA 4PWBA 2YVSA 3S1FA 3AMZA 4PVJA 3FW9A 3D2HA 3LLBA 1UXYA 1HSKA 3NS1B 5K8EA 1DZNA 2MBRA 3AN1A 2W54A 4EC3A 2Q4WA 4BC9A 1N61C 5FXEA 3ETRB 4UD8A 2EXRA 4PVHA 3PQBA 5FXDA 1VAOA 2VFUA 2BVHA 1W1JA 4PYTA 3TX1A 2UUUA 2W3SA 2W3RA 3KJMA 4PVKA 2Y3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFV A;  2BVF A;  4BC7 A;  3POP A;  3GSY A;  3RJA A;  4JB1 A;  3FW7 A;  5AWV A;  1N63 C;  1MBB A;  3D2J A;  5AE1 A;  2IPI A;  3C0P A;  3AM9 A;  5HQX A;  4BBY A;  4MLA A;  2VAO A;  1W1S A;  5FXF A;  2QPM A;  3SR6 B;  3NRZ B;  1N5X A;  4O95 A;  2W55 A;  1W1Q A;  4XLO A;  5D79 A;  3W8Z A;  5L6G A;  2Q85 A;  3D2D A;  3HSU A;  3VTE A;  3PM9 A;  2AXR A;  4PZF A;  1E8H A;  3JS8 A;  1E8F A;  2GQT A;  1DII A;  4JAY A;  1W1M A;  3W8W A;  2E3T A;  1I19 A;  4PWC A;  1JRO A;  1T3Q C;  5AE2 A;  3S1C A;  5FXP A;  1WVE A;  1W1K A;  3TSJ A;  1MBT A;  1V97 A;  5AE3 A;  4DNS A;  2Y08 A;  4PVE A;  1W1R A;  1FIQ B;  5ADZ A;  1QLU A;  4BCA A;  1N60 C;  1QLT A;  3B9J B;  3W8X A;  1FFU C;  2Y3S A;  3S1D A;  1DIQ A;  2WDW A;  1AHU A;  1E0Y A;  3NVZ B;  3S1E A;  1WVF A;  2BVG A;  3EUB 3;  5HMR A;  4ZOH B;  4ML8 A;  5I1V A;  1AHZ A;  3TSH A;  3FWA A;  1AHV A;  1F0X A;  1N5W C;  3RJ8 A;  1ZXI C;  3FW8 A;  3DQ0 A;  1W1L A;  1N62 C;  3BW7 A;  3I99 A;  1FO4 A;  5HHZ A;  4OAL A;  5L6F A;  1FFV C;  1WYG A;  2GQU A;  5I1W A;  2I0K A;  2VFR A;  2VFT A;  2Y4G A;  1E8G A;  1ZR6 A;  2QKN A;  1W1O A;  1VDV A;  2VFS A;  4PWB A;  3S1F A;  3AMZ A;  4PVJ A;  3FW9 A;  3D2H A;  1UXY A;  1HSK A;  3NS1 B;  5K8E A;  1DZN A;  2MBR A;  3AN1 A;  2W54 A;  4EC3 A;  2Q4W A;  4BC9 A;  1N61 C;  5FXE A;  3ETR B;  4UD8 A;  2EXR A;  4PVH A;  3PQB A;  5FXD A;  1VAO A;  2VFU A;  2BVH A;  1W1J A;  4PYT A;  3TX1 A;  2W3S A;  2W3R A;  3KJM A;  4PVK A;  2Y3R A; 
#chains in the Genus database with same CATH topology
 2VFV A;  2BVF A;  4BC7 A;  3POP A;  3GSY A;  2OAI A;  3RJA A;  4JB1 A;  3FW7 A;  5AWV A;  1N63 C;  1MBB A;  2P4P A;  3D2J A;  5AE1 A;  1JRP A;  3EJB B;  2IPI A;  3EJD B;  3C0P A;  3AM9 A;  5HQX A;  1SB3 B;  3NVV B;  4BBY A;  4MLA A;  2VAO A;  1W1S A;  5FXF A;  3DED A;  3LAE A;  2QPM A;  3SR6 B;  3NRZ B;  1N5X A;  4O95 A;  2W55 A;  2P3H A;  1W1Q A;  4XLO A;  2PLS A;  1RM6 B;  5D79 A;  3W8Z A;  5L6G A;  2Q85 A;  3D2D A;  2UUV A;  3HSU A;  2R8D A;  3NVY B;  3VTE A;  3PM9 A;  2AXR A;  4PZF A;  1E8H A;  3JS8 A;  1E8F A;  2PLI A;  2GQT A;  1DII A;  4JAY A;  1W1M A;  3W8W A;  2E3T A;  1I19 A;  4PWC A;  1JRO A;  1T3Q C;  5AE2 A;  3S1C A;  5G5G B;  5FXP A;  1WVE A;  1W1K A;  3TSJ A;  1MBT A;  1V97 A;  5AE3 A;  4DNS A;  2Y08 A;  4PVE A;  1W1R A;  1FIQ B;  3HRD C;  5ADZ A;  1QLU A;  4BCA A;  1N60 C;  1QLT A;  3B9J B;  3W8X A;  1FFU C;  5G5H B;  2Y3S A;  2P13 A;  3S1D A;  4HG0 A;  1DIQ A;  2WDW A;  2NQW A;  1AHU A;  1E0Y A;  3NVZ B;  3S1E A;  1WVF A;  2BVG A;  3EUB 3;  2RK5 A;  5HMR A;  4ZOH B;  4ML8 A;  5I1V A;  1AHZ A;  3NVW B;  3TSH A;  3FWA A;  1AHV A;  1F0X A;  1N5W C;  3RJ8 A;  1ZXI C;  3FW8 A;  3DQ0 A;  2R2Z A;  1W1L A;  1N62 C;  3BW7 A;  3I99 A;  1FO4 A;  5HHZ A;  4OAL A;  5L6F A;  2O3G A;  1FFV C;  1WYG A;  2GQU A;  5I1W A;  2I0K A;  2VFR A;  2VFT A;  3EJE B;  2Y4G A;  1E8G A;  1ZR6 A;  2QKN A;  1W1O A;  1VDV A;  2VFS A;  4PWB A;  2YVS A;  3S1F A;  3AMZ A;  4PVJ A;  3FW9 A;  3D2H A;  3LLB A;  1UXY A;  1HSK A;  3NS1 B;  5K8E A;  1DZN A;  2MBR A;  3AN1 A;  2W54 A;  4EC3 A;  2Q4W A;  4BC9 A;  1N61 C;  5FXE A;  3ETR B;  4UD8 A;  2EXR A;  4PVH A;  3PQB A;  5FXD A;  1VAO A;  2VFU A;  2BVH A;  1W1J A;  4PYT A;  3TX1 A;  2UUU A;  2W3S A;  2W3R A;  3KJM A;  4PVK A;  2Y3R A; 
#chains in the Genus database with same CATH homology
 2VFV A;  2BVF A;  4BC7 A;  3POP A;  3GSY A;  2OAI A;  3RJA A;  4JB1 A;  3FW7 A;  5AWV A;  1N63 C;  1MBB A;  2P4P A;  3D2J A;  5AE1 A;  1JRP A;  2IPI A;  3C0P A;  3AM9 A;  5HQX A;  1SB3 B;  3NVV B;  4BBY A;  4MLA A;  2VAO A;  1W1S A;  5FXF A;  3DED A;  3LAE A;  2QPM A;  3SR6 B;  3NRZ B;  1N5X A;  4O95 A;  2W55 A;  2P3H A;  1W1Q A;  4XLO A;  2PLS A;  1RM6 B;  5D79 A;  3W8Z A;  5L6G A;  2Q85 A;  3D2D A;  2UUV A;  3HSU A;  2R8D A;  3NVY B;  3VTE A;  3PM9 A;  2AXR A;  4PZF A;  1E8H A;  3JS8 A;  1E8F A;  2PLI A;  2GQT A;  1DII A;  4JAY A;  1W1M A;  3W8W A;  2E3T A;  1I19 A;  4PWC A;  1JRO A;  1T3Q C;  5AE2 A;  3S1C A;  5G5G B;  5FXP A;  1WVE A;  1W1K A;  3TSJ A;  1MBT A;  1V97 A;  5AE3 A;  4DNS A;  2Y08 A;  4PVE A;  1W1R A;  1FIQ B;  3HRD C;  5ADZ A;  1QLU A;  4BCA A;  1N60 C;  1QLT A;  3B9J B;  3W8X A;  1FFU C;  5G5H B;  2Y3S A;  2P13 A;  3S1D A;  4HG0 A;  1DIQ A;  2WDW A;  2NQW A;  1AHU A;  1E0Y A;  3NVZ B;  3S1E A;  1WVF A;  2BVG A;  3EUB 3;  2RK5 A;  5HMR A;  4ZOH B;  4ML8 A;  5I1V A;  1AHZ A;  3TSH A;  3NVW B;  3FWA A;  1AHV A;  1F0X A;  1N5W C;  3RJ8 A;  1ZXI C;  3FW8 A;  3DQ0 A;  2R2Z A;  1W1L A;  1N62 C;  3BW7 A;  3I99 A;  1FO4 A;  5HHZ A;  4OAL A;  5L6F A;  2O3G A;  1FFV C;  1WYG A;  2GQU A;  5I1W A;  2I0K A;  2VFR A;  2VFT A;  2Y4G A;  1E8G A;  1ZR6 A;  2QKN A;  1W1O A;  1VDV A;  2VFS A;  4PWB A;  2YVS A;  3S1F A;  3AMZ A;  4PVJ A;  3FW9 A;  3D2H A;  3LLB A;  1UXY A;  1HSK A;  3NS1 B;  5K8E A;  1DZN A;  2MBR A;  3AN1 A;  2W54 A;  4EC3 A;  2Q4W A;  4BC9 A;  1N61 C;  5FXE A;  3ETR B;  4UD8 A;  2EXR A;  4PVH A;  3PQB A;  5FXD A;  1VAO A;  2VFU A;  2BVH A;  1W1J A;  4PYT A;  3TX1 A;  2UUU A;  2W3S A;  2W3R A;  3KJM A;  4PVK A;  2Y3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...