5D79A

Structure of bbe-like #28 from arabidopsis thaliana
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
503
structure length
498
Chain Sequence
HEDFLKCLSYTVEPKVIHTSKDSSFFSILDSSIQNPRFSVSETPKPVSIITPVKASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIAYNKPFAVIDLRNLRSISLDVDNRTGWVQTGATAGELYYEIGKTTKSLAFPAGIHPTVGVGGQFSGGGYGTLLRKYGLAADNIIDALVVDASGRILDRQAMGEDYFWAIRGGGGSSFGVILSWKVKLVDVPSTITVFKVQKTSKKEAVRIIKKWQYAADKVPDDLFIRTTLERSNKNAVHALFTGLYIGPVNNLLALMEEKFPELGLEKEGCEEMSWIESVLWFADFPKGESLGVLTNRERTSLSFKGKDDFVQEPIPEAAIQEIWRRLEAPEARLGKIILTPFGGKMSEMAEYETPFPHRGGNLYEIQYVAYWREEEDKNKTETDKYLKWVDSVYEFMTPYVSKSPRGAYVNFKDMDLGMYLGKKKTKYEEGKSWGVKYFKNNFERLVRVKTRVDPTDFFCDEQSIPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Berberine bridge enzyme-like protein
publication title Structure of a Berberine Bridge Enzyme-Like Enzyme with an Active Site Specific to the Plant Family Brassicaceae.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 167
structure length 498
sequence length 503
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5d79A01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5d79A02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5d79A03
2W54A 3W8XA 1AHVA 2Q4WA 3D2JA 1W1OA 1WYGA 4PVJA 1VDVA 3RJAA 1E8GA 1N5WC 1W1QA 3FW9A 3TSHA 1UXYA 3EUB3 1FIQB 2Y3SA 1ZR6A 5I1WA 4PVKA 1QLTA 2GQUA 3C0PA 5D79A 4BC9A 2QPMA 1DIQA 5AE2A 1AHZA 4MLAA 5L6GA 3W8WA 3SR6B 2VFTA 4JAYA 3POPA 2W3RA 3S1CA 2MBRA 2GQTA 3NRZB 2Q85A 3S1FA 2Y08A 2VAOA 1W1RA 2VFUA 3D2DA 5K8EA 3S1DA 5FXEA 2QKNA 3NS1B 1FFUC 3W8ZA 1N5XA 3S1EA 5FXPA 1W1JA 2Y3RA 1AHUA 1QLUA 1WVEA 1ZXIC 3AMZA 3KJMA 2EXRA 4BBYA 5HHZA 1T3QC 3B9JB 5ADZA 5L6FA 1V97A 2Y4GA 5HMRA 2BVFA 4DNSA 4PVHA 3DQ0A 1WVFA 3TSJA 2VFRA 4ML8A 3ETRB 3PM9A 4PWCA 3FW7A 5AWVA 4XLOA 1W1SA 4UD8A 2IPIA 3NVZB 3AN1A 4O95A 5I1VA 5AE3A 2E3TA 1DIIA 3FWAA 4ZOHB 3D2HA 3GSYA 3I99A 1FO4A 1HSKA 4PVEA 1JROA 1E8FA 5FXFA 1N63C 4OALA 4PZFA 1MBTA 4BC7A 3VTEA 1F0XA 2W55A 5FXDA 3BW7A 1E8HA 1N61C 3RJ8A 2W3SA 4PWBA 3PQBA 1N60C 1DZNA 1VAOA 4EC3A 2AXRA 3JS8A 3HSUA 2WDWA 1W1MA 1E0YA 1W1LA 2BVHA 1I19A 1W1KA 3AM9A 1MBBA 2VFSA 3TX1A 2VFVA 4PYTA 5AE1A 1FFVC 4JB1A 2BVGA 2I0KA 5HQXA 3FW8A 4BCAA 1N62C
chains in the Genus database with same CATH superfamily
3LAEA 2W54A 3W8XA 1AHVA 2Q4WA 3EJEB 3D2JA 2UUVA 1W1OA 1WYGA 4PVJA 1VDVA 3NVVB 3RJAA 2YVSA 1E8GA 1N5WC 1W1QA 3FW9A 3TSHA 1UXYA 3HRDC 3EUB3 1FIQB 2Y3SA 1ZR6A 5I1WA 4PVKA 1QLTA 2GQUA 3C0PA 5D79A 4BC9A 2QPMA 1DIQA 5AE2A 1AHZA 4MLAA 5L6GA 3W8WA 3SR6B 2VFTA 4JAYA 3POPA 2W3RA 3S1CA 2MBRA 2GQTA 3NRZB 2Q85A 3S1FA 2OAIA 2Y08A 2VAOA 1W1RA 2P4PA 2VFUA 3D2DA 3EJBB 2O3GA 5K8EA 3S1DA 5FXEA 2QKNA 3NS1B 1FFUC 3W8ZA 1N5XA 3S1EA 5FXPA 1W1JA 2Y3RA 1AHUA 1QLUA 1WVEA 5G5GB 1ZXIC 3AMZA 3KJMA 2EXRA 3EJDB 4BBYA 5HHZA 1T3QC 3B9JB 5ADZA 5L6FA 1V97A 2Y4GA 5HMRA 2R2ZA 2RK5A 2BVFA 4DNSA 4PVHA 2UUUA 3DQ0A 1WVFA 3TSJA 2VFRA 4ML8A 3ETRB 3PM9A 4PWCA 3FW7A 5AWVA 2P13A 4XLOA 1W1SA 4UD8A 2PLSA 2IPIA 3NVZB 3AN1A 4O95A 5I1VA 5AE3A 2E3TA 2NQWA 1DIIA 3FWAA 4ZOHB 3D2HA 3GSYA 2PLIA 2P3HA 3I99A 1FO4A 1HSKA 4PVEA 1JROA 1JRPA 1E8FA 5FXFA 1N63C 4OALA 5G5HB 4PZFA 1MBTA 3NVWB 4BC7A 3VTEA 1F0XA 2W55A 5FXDA 3BW7A 1E8HA 1N61C 3RJ8A 3NVYB 2W3SA 1SB3B 4PWBA 3PQBA 3DEDA 3LLBA 1N60C 1DZNA 1VAOA 4EC3A 2AXRA 3JS8A 3HSUA 2WDWA 1W1MA 1E0YA 1W1LA 2BVHA 1I19A 1W1KA 3AM9A 1MBBA 2VFSA 3TX1A 2R8DA 2VFVA 4PYTA 5AE1A 1FFVC 4JB1A 2BVGA 2I0KA 1RM6B 5HQXA 3FW8A 4HG0A 4BCAA 1N62C
chains in the Genus database with same CATH topology
3LAEA 2W54A 3W8XA 1AHVA 2Q4WA 3D2JA 2UUVA 1W1OA 1WYGA 4PVJA 1VDVA 3NVVB 3RJAA 2YVSA 1E8GA 1N5WC 1W1QA 3FW9A 3TSHA 1UXYA 3HRDC 3EUB3 1FIQB 2Y3SA 1ZR6A 5I1WA 4PVKA 1QLTA 2GQUA 3C0PA 5D79A 4BC9A 2QPMA 1DIQA 5AE2A 1AHZA 4MLAA 5L6GA 3W8WA 3SR6B 2VFTA 4JAYA 3POPA 2W3RA 3S1CA 2MBRA 2GQTA 3NRZB 2Q85A 3S1FA 2OAIA 2Y08A 2VAOA 1W1RA 2P4PA 2VFUA 3D2DA 2O3GA 5K8EA 3S1DA 5FXEA 2QKNA 3NS1B 1FFUC 3W8ZA 1N5XA 3S1EA 5FXPA 1W1JA 2Y3RA 1AHUA 1QLUA 1WVEA 5G5GB 1ZXIC 3AMZA 3KJMA 2EXRA 4BBYA 5HHZA 1T3QC 3B9JB 5ADZA 5L6FA 1V97A 2Y4GA 5HMRA 2R2ZA 2RK5A 2BVFA 4DNSA 4PVHA 2UUUA 3DQ0A 1WVFA 3TSJA 2VFRA 4ML8A 3ETRB 3PM9A 4PWCA 3FW7A 5AWVA 2P13A 4XLOA 1W1SA 4UD8A 2PLSA 2IPIA 3NVZB 3AN1A 4O95A 5I1VA 5AE3A 2E3TA 2NQWA 1DIIA 3FWAA 4ZOHB 3D2HA 3GSYA 2PLIA 2P3HA 3I99A 1FO4A 1HSKA 4PVEA 1JROA 1JRPA 1E8FA 5FXFA 1N63C 4OALA 5G5HB 4PZFA 1MBTA 3NVWB 4BC7A 3VTEA 1F0XA 2W55A 5FXDA 3BW7A 1E8HA 1N61C 3RJ8A 1SB3B 2W3SA 3NVYB 4PWBA 3PQBA 3DEDA 3LLBA 1N60C 1DZNA 1VAOA 4EC3A 2AXRA 3JS8A 3HSUA 2WDWA 1W1MA 1E0YA 1W1LA 2BVHA 1I19A 1W1KA 3AM9A 1MBBA 2VFSA 3TX1A 2R8DA 2VFVA 4PYTA 5AE1A 1FFVC 4JB1A 2BVGA 2I0KA 1RM6B 5HQXA 3FW8A 4HG0A 4BCAA 1N62C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W54 A;  3W8X A;  1AHV A;  2Q4W A;  3D2J A;  1W1O A;  1WYG A;  4PVJ A;  1VDV A;  3RJA A;  1E8G A;  1N5W C;  1W1Q A;  3FW9 A;  3TSH A;  1UXY A;  3EUB 3;  1FIQ B;  2Y3S A;  1ZR6 A;  5I1W A;  4PVK A;  1QLT A;  2GQU A;  3C0P A;  5D79 A;  4BC9 A;  2QPM A;  1DIQ A;  5AE2 A;  1AHZ A;  4MLA A;  5L6G A;  3W8W A;  3SR6 B;  2VFT A;  4JAY A;  3POP A;  2W3R A;  3S1C A;  2MBR A;  2GQT A;  3NRZ B;  2Q85 A;  3S1F A;  2Y08 A;  2VAO A;  1W1R A;  2VFU A;  3D2D A;  5K8E A;  3S1D A;  5FXE A;  2QKN A;  3NS1 B;  1FFU C;  3W8Z A;  1N5X A;  3S1E A;  5FXP A;  1W1J A;  2Y3R A;  1AHU A;  1QLU A;  1WVE A;  1ZXI C;  3AMZ A;  3KJM A;  2EXR A;  4BBY A;  5HHZ A;  1T3Q C;  3B9J B;  5ADZ A;  5L6F A;  1V97 A;  2Y4G A;  5HMR A;  2BVF A;  4DNS A;  4PVH A;  3DQ0 A;  1WVF A;  3TSJ A;  2VFR A;  4ML8 A;  3ETR B;  3PM9 A;  4PWC A;  3FW7 A;  5AWV A;  4XLO A;  1W1S A;  4UD8 A;  2IPI A;  3NVZ B;  3AN1 A;  4O95 A;  5I1V A;  5AE3 A;  2E3T A;  1DII A;  3FWA A;  4ZOH B;  3D2H A;  3GSY A;  3I99 A;  1FO4 A;  1HSK A;  4PVE A;  1JRO A;  1E8F A;  5FXF A;  1N63 C;  4OAL A;  4PZF A;  1MBT A;  4BC7 A;  3VTE A;  1F0X A;  2W55 A;  5FXD A;  3BW7 A;  1E8H A;  1N61 C;  3RJ8 A;  2W3S A;  4PWB A;  3PQB A;  1N60 C;  1DZN A;  1VAO A;  4EC3 A;  2AXR A;  3JS8 A;  3HSU A;  2WDW A;  1W1M A;  1E0Y A;  1W1L A;  2BVH A;  1I19 A;  1W1K A;  3AM9 A;  1MBB A;  2VFS A;  3TX1 A;  2VFV A;  4PYT A;  5AE1 A;  1FFV C;  4JB1 A;  2BVG A;  2I0K A;  5HQX A;  3FW8 A;  4BCA A;  1N62 C; 
#chains in the Genus database with same CATH topology
 3LAE A;  2W54 A;  3W8X A;  1AHV A;  2Q4W A;  3EJE B;  3D2J A;  2UUV A;  1W1O A;  1WYG A;  4PVJ A;  1VDV A;  3NVV B;  3RJA A;  2YVS A;  1E8G A;  1N5W C;  1W1Q A;  3FW9 A;  3TSH A;  1UXY A;  3HRD C;  3EUB 3;  1FIQ B;  2Y3S A;  1ZR6 A;  5I1W A;  4PVK A;  1QLT A;  2GQU A;  3C0P A;  5D79 A;  4BC9 A;  2QPM A;  1DIQ A;  5AE2 A;  1AHZ A;  4MLA A;  5L6G A;  3W8W A;  3SR6 B;  2VFT A;  4JAY A;  3POP A;  2W3R A;  3S1C A;  2MBR A;  2GQT A;  3NRZ B;  2Q85 A;  3S1F A;  2OAI A;  2Y08 A;  2VAO A;  1W1R A;  2P4P A;  2VFU A;  3D2D A;  3EJB B;  2O3G A;  5K8E A;  3S1D A;  5FXE A;  2QKN A;  3NS1 B;  1FFU C;  3W8Z A;  1N5X A;  3S1E A;  5FXP A;  1W1J A;  2Y3R A;  1AHU A;  1QLU A;  1WVE A;  5G5G B;  1ZXI C;  3AMZ A;  3KJM A;  2EXR A;  3EJD B;  4BBY A;  5HHZ A;  1T3Q C;  3B9J B;  5ADZ A;  5L6F A;  1V97 A;  2Y4G A;  5HMR A;  2R2Z A;  2RK5 A;  2BVF A;  4DNS A;  4PVH A;  2UUU A;  3DQ0 A;  1WVF A;  3TSJ A;  2VFR A;  4ML8 A;  3ETR B;  3PM9 A;  4PWC A;  3FW7 A;  5AWV A;  2P13 A;  4XLO A;  1W1S A;  4UD8 A;  2PLS A;  2IPI A;  3NVZ B;  3AN1 A;  4O95 A;  5I1V A;  5AE3 A;  2E3T A;  2NQW A;  1DII A;  3FWA A;  4ZOH B;  3D2H A;  3GSY A;  2PLI A;  2P3H A;  3I99 A;  1FO4 A;  1HSK A;  4PVE A;  1JRO A;  1JRP A;  1E8F A;  5FXF A;  1N63 C;  4OAL A;  5G5H B;  4PZF A;  1MBT A;  3NVW B;  4BC7 A;  3VTE A;  1F0X A;  2W55 A;  5FXD A;  3BW7 A;  1E8H A;  1N61 C;  3RJ8 A;  3NVY B;  2W3S A;  1SB3 B;  4PWB A;  3PQB A;  3DED A;  3LLB A;  1N60 C;  1DZN A;  1VAO A;  4EC3 A;  2AXR A;  3JS8 A;  3HSU A;  2WDW A;  1W1M A;  1E0Y A;  1W1L A;  2BVH A;  1I19 A;  1W1K A;  3AM9 A;  1MBB A;  2VFS A;  3TX1 A;  2R8D A;  2VFV A;  4PYT A;  5AE1 A;  1FFV C;  4JB1 A;  2BVG A;  2I0K A;  1RM6 B;  5HQX A;  3FW8 A;  4HG0 A;  4BCA A;  1N62 C; 
#chains in the Genus database with same CATH homology
 3LAE A;  2W54 A;  3W8X A;  1AHV A;  2Q4W A;  3D2J A;  2UUV A;  1W1O A;  1WYG A;  4PVJ A;  1VDV A;  3NVV B;  3RJA A;  2YVS A;  1E8G A;  1N5W C;  1W1Q A;  3FW9 A;  3TSH A;  1UXY A;  3HRD C;  3EUB 3;  1FIQ B;  2Y3S A;  1ZR6 A;  5I1W A;  4PVK A;  1QLT A;  2GQU A;  3C0P A;  5D79 A;  4BC9 A;  2QPM A;  1DIQ A;  5AE2 A;  1AHZ A;  4MLA A;  5L6G A;  3W8W A;  3SR6 B;  2VFT A;  4JAY A;  3POP A;  2W3R A;  3S1C A;  2MBR A;  2GQT A;  3NRZ B;  2Q85 A;  3S1F A;  2OAI A;  2Y08 A;  2VAO A;  1W1R A;  2P4P A;  2VFU A;  3D2D A;  2O3G A;  5K8E A;  3S1D A;  5FXE A;  2QKN A;  3NS1 B;  1FFU C;  3W8Z A;  1N5X A;  3S1E A;  5FXP A;  1W1J A;  2Y3R A;  1AHU A;  1QLU A;  1WVE A;  5G5G B;  1ZXI C;  3AMZ A;  3KJM A;  2EXR A;  4BBY A;  5HHZ A;  1T3Q C;  3B9J B;  5ADZ A;  5L6F A;  1V97 A;  2Y4G A;  5HMR A;  2R2Z A;  2RK5 A;  2BVF A;  4DNS A;  4PVH A;  2UUU A;  3DQ0 A;  1WVF A;  3TSJ A;  2VFR A;  4ML8 A;  3ETR B;  3PM9 A;  4PWC A;  3FW7 A;  5AWV A;  2P13 A;  4XLO A;  1W1S A;  4UD8 A;  2PLS A;  2IPI A;  3NVZ B;  3AN1 A;  4O95 A;  5I1V A;  5AE3 A;  2E3T A;  2NQW A;  1DII A;  3FWA A;  4ZOH B;  3D2H A;  3GSY A;  2PLI A;  2P3H A;  3I99 A;  1FO4 A;  1HSK A;  4PVE A;  1JRO A;  1JRP A;  1E8F A;  5FXF A;  1N63 C;  4OAL A;  5G5H B;  4PZF A;  1MBT A;  3NVW B;  4BC7 A;  3VTE A;  1F0X A;  2W55 A;  5FXD A;  3BW7 A;  1E8H A;  1N61 C;  3RJ8 A;  1SB3 B;  2W3S A;  3NVY B;  4PWB A;  3PQB A;  3DED A;  3LLB A;  1N60 C;  1DZN A;  1VAO A;  4EC3 A;  2AXR A;  3JS8 A;  3HSU A;  2WDW A;  1W1M A;  1E0Y A;  1W1L A;  2BVH A;  1I19 A;  1W1K A;  3AM9 A;  1MBB A;  2VFS A;  3TX1 A;  2R8D A;  2VFV A;  4PYT A;  5AE1 A;  1FFV C;  4JB1 A;  2BVG A;  2I0K A;  1RM6 B;  5HQX A;  3FW8 A;  4HG0 A;  4BCA A;  1N62 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...