5D79A

Structure of bbe-like #28 from arabidopsis thaliana
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
503
structure length
498
Chain Sequence
HEDFLKCLSYTVEPKVIHTSKDSSFFSILDSSIQNPRFSVSETPKPVSIITPVKASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIAYNKPFAVIDLRNLRSISLDVDNRTGWVQTGATAGELYYEIGKTTKSLAFPAGIHPTVGVGGQFSGGGYGTLLRKYGLAADNIIDALVVDASGRILDRQAMGEDYFWAIRGGGGSSFGVILSWKVKLVDVPSTITVFKVQKTSKKEAVRIIKKWQYAADKVPDDLFIRTTLERSNKNAVHALFTGLYIGPVNNLLALMEEKFPELGLEKEGCEEMSWIESVLWFADFPKGESLGVLTNRERTSLSFKGKDDFVQEPIPEAAIQEIWRRLEAPEARLGKIILTPFGGKMSEMAEYETPFPHRGGNLYEIQYVAYWREEEDKNKTETDKYLKWVDSVYEFMTPYVSKSPRGAYVNFKDMDLGMYLGKKKTKYEEGKSWGVKYFKNNFERLVRVKTRVDPTDFFCDEQSIPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Berberine bridge enzyme-like protein
publication title Structure of a Berberine Bridge Enzyme-Like Enzyme with an Active Site Specific to the Plant Family Brassicaceae.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
total genus 167
structure length 498
sequence length 503
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5d79A01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5d79A02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5d79A03
3DQ0A 2AXRA 3JS8A 2E3TA 1FO4A 1WVFA 1T3QC 2W54A 3FW7A 3RJ8A 3FW8A 3NS1B 1FFUC 3C0PA 2BVGA 3PM9A 3TSJA 1W1RA 2Y4GA 1N63C 5AE3A 3D2JA 1FIQB 5ADZA 5FXDA 5I1VA 1QLTA 2Y3SA 2VAOA 4XLOA 4PWCA 2BVHA 4PVJA 1V97A 1E8HA 1E8FA 2EXRA 4JB1A 3AM9A 3W8WA 2IPIA 3D2DA 1MBBA 2MBRA 3FWAA 3B9JB 4DNSA 2Q4WA 1W1JA 5D79A 5HHZA 1ZR6A 4PVHA 2Y08A 1N5XA 3RJAA 1FFVC 1UXYA 3FW9A 2WDWA 1N62C 4UD8A 1DZNA 1VAOA 1HSKA 4BBYA 5AWVA 3NRZB 1VDVA 2VFTA 3BW7A 4BCAA 3SR6B 4ZOHB 1JROA 2W55A 4MLAA 4PVEA 5FXEA 3S1CA 3AMZA 2QPMA 2GQTA 2VFRA 4PZFA 2W3RA 1N60C 2W3SA 3KJMA 1W1MA 5HQXA 4PVKA 1QLUA 1W1QA 3S1DA 1W1SA 2BVFA 4OALA 1MBTA 2Q85A 4BC7A 1W1KA 3I99A 4ML8A 4PWBA 3POPA 5K8EA 3GSYA 1F0XA 2VFSA 1N61C 3W8XA 3S1FA 5HMRA 4JAYA 3HSUA 5L6GA 5I1WA 1I19A 1ZXIC 5AE1A 5FXFA 2VFUA 1E0YA 2GQUA 5FXPA 4PYTA 1DIQA 1E8GA 4EC3A 3W8ZA 2VFVA 3NVZB 2I0KA 1DIIA 2Y3RA 3PQBA 5L6FA 1WVEA 3ETRB 3AN1A 3S1EA 4BC9A 1AHUA 3VTEA 2QKNA 3EUB3 3TSHA 1AHZA 1AHVA 3TX1A 1W1LA 5AE2A 1N5WC 4O95A 3D2HA 1W1OA 1WYGA
chains in the Genus database with same CATH superfamily
3DQ0A 2AXRA 3JS8A 2YVSA 2E3TA 1FO4A 4HG0A 1WVFA 1T3QC 2W54A 3FW7A 3RJ8A 3FW8A 3NS1B 2RK5A 2PLIA 1FFUC 3C0PA 2BVGA 3PM9A 3TSJA 1W1RA 2P3HA 2Y4GA 1N63C 5AE3A 3D2JA 1FIQB 5ADZA 5FXDA 5I1VA 1QLTA 2P13A 3EJBB 2Y3SA 2VAOA 3NVVB 1JRPA 4XLOA 4PWCA 2BVHA 4PVJA 1V97A 1E8HA 1E8FA 2EXRA 4JB1A 3AM9A 3W8WA 2IPIA 3D2DA 1MBBA 2MBRA 3EJDB 3FWAA 3B9JB 4DNSA 2PLSA 2Q4WA 1W1JA 5D79A 5HHZA 1ZR6A 5G5HB 4PVHA 2Y08A 1N5XA 3RJAA 1FFVC 1UXYA 1RM6B 2O3GA 3FW9A 2R2ZA 2WDWA 1N62C 4UD8A 1DZNA 1VAOA 1HSKA 4BBYA 5AWVA 3NRZB 1VDVA 2VFTA 3BW7A 2UUUA 4BCAA 3SR6B 4ZOHB 1JROA 2W55A 4MLAA 2P4PA 4PVEA 2UUVA 5FXEA 3S1CA 3AMZA 2QPMA 2GQTA 2VFRA 4PZFA 2W3RA 1N60C 2W3SA 3KJMA 1W1MA 5HQXA 1SB3B 4PVKA 1QLUA 1W1QA 3S1DA 1W1SA 2BVFA 4OALA 3NVWB 1MBTA 2Q85A 4BC7A 1W1KA 3I99A 4ML8A 4PWBA 3POPA 5K8EA 3GSYA 1F0XA 2VFSA 1N61C 3W8XA 2NQWA 3S1FA 5HMRA 4JAYA 3HSUA 5L6GA 2R8DA 5I1WA 1I19A 1ZXIC 5AE1A 5FXFA 2OAIA 2VFUA 1E0YA 2GQUA 5FXPA 4PYTA 1DIQA 1E8GA 4EC3A 3HRDC 3W8ZA 2VFVA 3NVZB 2I0KA 1DIIA 2Y3RA 3PQBA 5L6FA 1WVEA 3ETRB 3AN1A 3S1EA 3EJEB 3DEDA 3LAEA 4BC9A 1AHUA 3VTEA 2QKNA 3EUB3 3LLBA 3TSHA 1AHZA 1AHVA 3TX1A 1W1LA 5AE2A 1N5WC 4O95A 3D2HA 3NVYB 1W1OA 5G5GB 1WYGA
chains in the Genus database with same CATH topology
3DQ0A 2AXRA 3JS8A 2YVSA 2E3TA 1FO4A 4HG0A 1WVFA 1T3QC 2W54A 3FW7A 3RJ8A 3FW8A 3NS1B 2RK5A 2PLIA 1FFUC 3C0PA 2BVGA 3PM9A 3TSJA 1W1RA 2P3HA 2Y4GA 1N63C 5AE3A 3D2JA 1FIQB 5ADZA 5FXDA 5I1VA 1QLTA 2P13A 2Y3SA 2VAOA 3NVVB 1JRPA 4XLOA 4PWCA 2BVHA 4PVJA 1V97A 1E8HA 1E8FA 2EXRA 4JB1A 3AM9A 3W8WA 2IPIA 3D2DA 1MBBA 2MBRA 3FWAA 3B9JB 4DNSA 2PLSA 2Q4WA 1W1JA 5D79A 5HHZA 1ZR6A 5G5HB 4PVHA 2Y08A 1N5XA 3RJAA 1FFVC 1UXYA 1RM6B 2O3GA 3FW9A 2R2ZA 2WDWA 1N62C 4UD8A 1DZNA 1VAOA 1HSKA 4BBYA 5AWVA 3NRZB 1VDVA 2VFTA 3BW7A 2UUUA 4BCAA 3SR6B 4ZOHB 1JROA 2W55A 4MLAA 2P4PA 4PVEA 2UUVA 5FXEA 3S1CA 3AMZA 2QPMA 2GQTA 2VFRA 4PZFA 2W3RA 1N60C 2W3SA 3KJMA 1W1MA 5HQXA 1SB3B 4PVKA 1QLUA 1W1QA 3S1DA 1W1SA 2BVFA 4OALA 3NVWB 1MBTA 2Q85A 4BC7A 1W1KA 3I99A 4ML8A 4PWBA 3POPA 5K8EA 3GSYA 1F0XA 2VFSA 1N61C 3W8XA 2NQWA 3S1FA 5HMRA 4JAYA 3HSUA 5L6GA 2R8DA 5I1WA 1I19A 1ZXIC 5AE1A 5FXFA 2OAIA 2VFUA 1E0YA 2GQUA 5FXPA 4PYTA 1DIQA 1E8GA 4EC3A 3HRDC 3W8ZA 2VFVA 3NVZB 2I0KA 1DIIA 2Y3RA 3PQBA 5L6FA 1WVEA 3ETRB 3AN1A 3S1EA 3DEDA 3LAEA 4BC9A 1AHUA 3VTEA 2QKNA 3EUB3 3LLBA 3TSHA 1AHZA 1AHVA 3TX1A 1W1LA 5AE2A 1N5WC 4O95A 3D2HA 3NVYB 1W1OA 5G5GB 1WYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DQ0 A;  2AXR A;  3JS8 A;  2E3T A;  1FO4 A;  1WVF A;  1T3Q C;  2W54 A;  3FW7 A;  3RJ8 A;  3FW8 A;  3NS1 B;  1FFU C;  3C0P A;  2BVG A;  3PM9 A;  3TSJ A;  1W1R A;  2Y4G A;  1N63 C;  5AE3 A;  3D2J A;  1FIQ B;  5ADZ A;  5FXD A;  5I1V A;  1QLT A;  2Y3S A;  2VAO A;  4XLO A;  4PWC A;  2BVH A;  4PVJ A;  1V97 A;  1E8H A;  1E8F A;  2EXR A;  4JB1 A;  3AM9 A;  3W8W A;  2IPI A;  3D2D A;  1MBB A;  2MBR A;  3FWA A;  3B9J B;  4DNS A;  2Q4W A;  1W1J A;  5D79 A;  5HHZ A;  1ZR6 A;  4PVH A;  2Y08 A;  1N5X A;  3RJA A;  1FFV C;  1UXY A;  3FW9 A;  2WDW A;  1N62 C;  4UD8 A;  1DZN A;  1VAO A;  1HSK A;  4BBY A;  5AWV A;  3NRZ B;  1VDV A;  2VFT A;  3BW7 A;  4BCA A;  3SR6 B;  4ZOH B;  1JRO A;  2W55 A;  4MLA A;  4PVE A;  5FXE A;  3S1C A;  3AMZ A;  2QPM A;  2GQT A;  2VFR A;  4PZF A;  2W3R A;  1N60 C;  2W3S A;  3KJM A;  1W1M A;  5HQX A;  4PVK A;  1QLU A;  1W1Q A;  3S1D A;  1W1S A;  2BVF A;  4OAL A;  1MBT A;  2Q85 A;  4BC7 A;  1W1K A;  3I99 A;  4ML8 A;  4PWB A;  3POP A;  5K8E A;  3GSY A;  1F0X A;  2VFS A;  1N61 C;  3W8X A;  3S1F A;  5HMR A;  4JAY A;  3HSU A;  5L6G A;  5I1W A;  1I19 A;  1ZXI C;  5AE1 A;  5FXF A;  2VFU A;  1E0Y A;  2GQU A;  5FXP A;  4PYT A;  1DIQ A;  1E8G A;  4EC3 A;  3W8Z A;  2VFV A;  3NVZ B;  2I0K A;  1DII A;  2Y3R A;  3PQB A;  5L6F A;  1WVE A;  3ETR B;  3AN1 A;  3S1E A;  4BC9 A;  1AHU A;  3VTE A;  2QKN A;  3EUB 3;  3TSH A;  1AHZ A;  1AHV A;  3TX1 A;  1W1L A;  5AE2 A;  1N5W C;  4O95 A;  3D2H A;  1W1O A;  1WYG A; 
#chains in the Genus database with same CATH topology
 3DQ0 A;  2AXR A;  3JS8 A;  2YVS A;  2E3T A;  1FO4 A;  4HG0 A;  1WVF A;  1T3Q C;  2W54 A;  3FW7 A;  3RJ8 A;  3FW8 A;  3NS1 B;  2RK5 A;  2PLI A;  1FFU C;  3C0P A;  2BVG A;  3PM9 A;  3TSJ A;  1W1R A;  2P3H A;  2Y4G A;  1N63 C;  5AE3 A;  3D2J A;  1FIQ B;  5ADZ A;  5FXD A;  5I1V A;  1QLT A;  2P13 A;  3EJB B;  2Y3S A;  2VAO A;  3NVV B;  1JRP A;  4XLO A;  4PWC A;  2BVH A;  4PVJ A;  1V97 A;  1E8H A;  1E8F A;  2EXR A;  4JB1 A;  3AM9 A;  3W8W A;  2IPI A;  3D2D A;  1MBB A;  2MBR A;  3EJD B;  3FWA A;  3B9J B;  4DNS A;  2PLS A;  2Q4W A;  1W1J A;  5D79 A;  5HHZ A;  1ZR6 A;  5G5H B;  4PVH A;  2Y08 A;  1N5X A;  3RJA A;  1FFV C;  1UXY A;  1RM6 B;  2O3G A;  3FW9 A;  2R2Z A;  2WDW A;  1N62 C;  4UD8 A;  1DZN A;  1VAO A;  1HSK A;  4BBY A;  5AWV A;  3NRZ B;  1VDV A;  2VFT A;  3BW7 A;  2UUU A;  4BCA A;  3SR6 B;  4ZOH B;  1JRO A;  2W55 A;  4MLA A;  2P4P A;  4PVE A;  2UUV A;  5FXE A;  3S1C A;  3AMZ A;  2QPM A;  2GQT A;  2VFR A;  4PZF A;  2W3R A;  1N60 C;  2W3S A;  3KJM A;  1W1M A;  5HQX A;  1SB3 B;  4PVK A;  1QLU A;  1W1Q A;  3S1D A;  1W1S A;  2BVF A;  4OAL A;  3NVW B;  1MBT A;  2Q85 A;  4BC7 A;  1W1K A;  3I99 A;  4ML8 A;  4PWB A;  3POP A;  5K8E A;  3GSY A;  1F0X A;  2VFS A;  1N61 C;  3W8X A;  2NQW A;  3S1F A;  5HMR A;  4JAY A;  3HSU A;  5L6G A;  2R8D A;  5I1W A;  1I19 A;  1ZXI C;  5AE1 A;  5FXF A;  2OAI A;  2VFU A;  1E0Y A;  2GQU A;  5FXP A;  4PYT A;  1DIQ A;  1E8G A;  4EC3 A;  3HRD C;  3W8Z A;  2VFV A;  3NVZ B;  2I0K A;  1DII A;  2Y3R A;  3PQB A;  5L6F A;  1WVE A;  3ETR B;  3AN1 A;  3S1E A;  3EJE B;  3DED A;  3LAE A;  4BC9 A;  1AHU A;  3VTE A;  2QKN A;  3EUB 3;  3LLB A;  3TSH A;  1AHZ A;  1AHV A;  3TX1 A;  1W1L A;  5AE2 A;  1N5W C;  4O95 A;  3D2H A;  3NVY B;  1W1O A;  5G5G B;  1WYG A; 
#chains in the Genus database with same CATH homology
 3DQ0 A;  2AXR A;  3JS8 A;  2YVS A;  2E3T A;  1FO4 A;  4HG0 A;  1WVF A;  1T3Q C;  2W54 A;  3FW7 A;  3RJ8 A;  3FW8 A;  3NS1 B;  2RK5 A;  2PLI A;  1FFU C;  3C0P A;  2BVG A;  3PM9 A;  3TSJ A;  1W1R A;  2P3H A;  2Y4G A;  1N63 C;  5AE3 A;  3D2J A;  1FIQ B;  5ADZ A;  5FXD A;  5I1V A;  1QLT A;  2P13 A;  2Y3S A;  2VAO A;  3NVV B;  1JRP A;  4XLO A;  4PWC A;  2BVH A;  4PVJ A;  1V97 A;  1E8H A;  1E8F A;  2EXR A;  4JB1 A;  3AM9 A;  3W8W A;  2IPI A;  3D2D A;  1MBB A;  2MBR A;  3FWA A;  3B9J B;  4DNS A;  2PLS A;  2Q4W A;  1W1J A;  5D79 A;  5HHZ A;  1ZR6 A;  5G5H B;  4PVH A;  2Y08 A;  1N5X A;  3RJA A;  1FFV C;  1UXY A;  1RM6 B;  2O3G A;  3FW9 A;  2R2Z A;  2WDW A;  1N62 C;  4UD8 A;  1DZN A;  1VAO A;  1HSK A;  4BBY A;  5AWV A;  3NRZ B;  1VDV A;  2VFT A;  3BW7 A;  2UUU A;  4BCA A;  3SR6 B;  4ZOH B;  1JRO A;  2W55 A;  4MLA A;  2P4P A;  4PVE A;  2UUV A;  5FXE A;  3S1C A;  3AMZ A;  2QPM A;  2GQT A;  2VFR A;  4PZF A;  2W3R A;  1N60 C;  2W3S A;  3KJM A;  1W1M A;  5HQX A;  1SB3 B;  4PVK A;  1QLU A;  1W1Q A;  3S1D A;  1W1S A;  2BVF A;  4OAL A;  3NVW B;  1MBT A;  2Q85 A;  4BC7 A;  1W1K A;  3I99 A;  4ML8 A;  4PWB A;  3POP A;  5K8E A;  3GSY A;  1F0X A;  2VFS A;  1N61 C;  3W8X A;  2NQW A;  3S1F A;  5HMR A;  4JAY A;  3HSU A;  5L6G A;  2R8D A;  5I1W A;  1I19 A;  1ZXI C;  5AE1 A;  5FXF A;  2OAI A;  2VFU A;  1E0Y A;  2GQU A;  5FXP A;  4PYT A;  1DIQ A;  1E8G A;  4EC3 A;  3HRD C;  3W8Z A;  2VFV A;  3NVZ B;  2I0K A;  1DII A;  2Y3R A;  3PQB A;  5L6F A;  1WVE A;  3ETR B;  3AN1 A;  3S1E A;  3DED A;  3LAE A;  4BC9 A;  1AHU A;  3VTE A;  2QKN A;  3EUB 3;  3LLB A;  3TSH A;  1AHZ A;  1AHV A;  3TX1 A;  1W1L A;  5AE2 A;  1N5W C;  4O95 A;  3D2H A;  3NVY B;  1W1O A;  5G5G B;  1WYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...