5D79A

Structure of bbe-like #28 from arabidopsis thaliana
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
503
structure length
498
Chain Sequence
HEDFLKCLSYTVEPKVIHTSKDSSFFSILDSSIQNPRFSVSETPKPVSIITPVKASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIAYNKPFAVIDLRNLRSISLDVDNRTGWVQTGATAGELYYEIGKTTKSLAFPAGIHPTVGVGGQFSGGGYGTLLRKYGLAADNIIDALVVDASGRILDRQAMGEDYFWAIRGGGGSSFGVILSWKVKLVDVPSTITVFKVQKTSKKEAVRIIKKWQYAADKVPDDLFIRTTLERSNKNAVHALFTGLYIGPVNNLLALMEEKFPELGLEKEGCEEMSWIESVLWFADFPKGESLGVLTNRERTSLSFKGKDDFVQEPIPEAAIQEIWRRLEAPEARLGKIILTPFGGKMSEMAEYETPFPHRGGNLYEIQYVAYWREEEDKNKTETDKYLKWVDSVYEFMTPYVSKSPRGAYVNFKDMDLGMYLGKKKTKYEEGKSWGVKYFKNNFERLVRVKTRVDPTDFFCDEQSIPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Berberine Bridge Enzyme-Like Enzyme with an Active Site Specific to the Plant Family Brassicaceae.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Berberine bridge enzyme-like protein
total genus 167
structure length 498
sequence length 503
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5d79A01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5d79A02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5d79A03
1VAOA 4PZFA 1DIQA 1F0XA 5AE1A 2W55A 1HSKA 1JROA 2VFTA 5D79A 3BW7A 2Y3RA 4ZOHB 2Y4GA 1E0YA 3AMZA 5FXPA 3PQBA 3SR6B 4PWCA 1T3QC 1DZNA 5AWVA 1DIIA 1AHZA 1MBBA 1MBTA 3C0PA 1E8HA 2W3RA 4BC9A 2I0KA 4OALA 2BVGA 2EXRA 4BCAA 5AE3A 3RJAA 1W1OA 5AE2A 1V97A 1WVFA 1ZR6A 5HHZA 4MLAA 5I1WA 5ADZA 4BBYA 1N62C 1AHUA 1N60C 3PM9A 3W8WA 3NVZB 1W1RA 3FW7A 5I1VA 3NRZB 2VFRA 3S1FA 1E8FA 1FFVC 4PYTA 2Y08A 3D2DA 1UXYA 4BC7A 1W1QA 2QPMA 4PVHA 3AN1A 2Q4WA 2GQTA 3W8XA 5FXFA 3FW9A 3JS8A 2GQUA 3GSYA 5L6FA 1I19A 3D2JA 2VFVA 1VDVA 3FWAA 1AHVA 1N5WC 5L6GA 3VTEA 3S1DA 2VAOA 2AXRA 2Y3SA 3RJ8A 3S1EA 4PWBA 3TSHA 1FIQB 1QLUA 1WYGA 5FXDA 2BVFA 3D2HA 4DNSA 2VFSA 2BVHA 5HMRA 1FFUC 4JAYA 1W1JA 4XLOA 4EC3A 4UD8A 3B9JB 3TX1A 2Q85A 1N63C 3TSJA 3HSUA 5FXEA 3KJMA 3DQ0A 2MBRA 1WVEA 4O95A 2VFUA 2E3TA 1QLTA 5K8EA 4JB1A 1N5XA 1ZXIC 1W1KA 1N61C 1W1LA 2WDWA 3EUB3 1E8GA 1FO4A 4PVEA 1W1MA 2QKNA 2W54A 1W1SA 3POPA 3NS1B 3I99A 2IPIA 3FW8A 3W8ZA 5HQXA 4PVKA 3AM9A 4PVJA 2W3SA 3S1CA 4ML8A 3ETRB
chains in the Genus database with same CATH superfamily
1VAOA 4PZFA 2RK5A 2O3GA 1DIQA 1F0XA 5AE1A 2W55A 1HSKA 1JROA 2VFTA 5D79A 3BW7A 2Y3RA 4ZOHB 2Y4GA 1E0YA 3AMZA 5FXPA 3PQBA 3SR6B 4PWCA 2PLIA 1T3QC 1DZNA 3HRDC 5AWVA 1DIIA 1AHZA 1MBBA 1MBTA 3C0PA 1E8HA 2W3RA 3NVYB 4BC9A 2I0KA 4OALA 2BVGA 2EXRA 4BCAA 5AE3A 3RJAA 1W1OA 2OAIA 5AE2A 4HG0A 1V97A 1WVFA 1ZR6A 5HHZA 1SB3B 3DEDA 4MLAA 5I1WA 5ADZA 4BBYA 3LLBA 1N62C 2NQWA 1AHUA 1N60C 2R8DA 3PM9A 3W8WA 3NVZB 1W1RA 3FW7A 5I1VA 3NRZB 2VFRA 3S1FA 1E8FA 1FFVC 3EJEB 4PYTA 2UUVA 2Y08A 3D2DA 1UXYA 3EJBB 4BC7A 1W1QA 2QPMA 4PVHA 3AN1A 2Q4WA 5G5GB 2GQTA 3W8XA 5FXFA 3FW9A 3JS8A 2GQUA 3GSYA 5L6FA 1I19A 3D2JA 2VFVA 1VDVA 3FWAA 1AHVA 1N5WC 5L6GA 3VTEA 3S1DA 2VAOA 2AXRA 3EJDB 2Y3SA 3RJ8A 3S1EA 2R2ZA 4PWBA 3TSHA 1FIQB 3NVVB 1QLUA 1WYGA 5FXDA 2BVFA 3D2HA 4DNSA 2VFSA 2BVHA 5HMRA 1FFUC 4JAYA 1W1JA 4XLOA 4EC3A 4UD8A 3B9JB 3TX1A 2Q85A 1N63C 3TSJA 3HSUA 5FXEA 3KJMA 3DQ0A 2MBRA 1WVEA 4O95A 2VFUA 5G5HB 2E3TA 1QLTA 5K8EA 4JB1A 1N5XA 1ZXIC 1W1KA 1N61C 1W1LA 2WDWA 2YVSA 3NVWB 3EUB3 1E8GA 1FO4A 2P4PA 4PVEA 1W1MA 2QKNA 2W54A 1RM6B 1W1SA 2P3HA 2PLSA 3POPA 3NS1B 3I99A 2IPIA 3FW8A 1JRPA 2P13A 3W8ZA 5HQXA 4PVKA 3AM9A 4PVJA 2W3SA 3S1CA 3LAEA 4ML8A 3ETRB 2UUUA
chains in the Genus database with same CATH topology
1VAOA 4PZFA 2RK5A 2O3GA 1DIQA 1F0XA 5AE1A 2W55A 1HSKA 1JROA 2VFTA 5D79A 3BW7A 2Y3RA 4ZOHB 2Y4GA 1E0YA 3AMZA 5FXPA 3PQBA 3SR6B 4PWCA 2PLIA 1T3QC 1DZNA 3HRDC 5AWVA 1DIIA 1AHZA 1MBBA 1MBTA 3C0PA 1E8HA 2W3RA 3NVYB 4BC9A 2I0KA 4OALA 2BVGA 2EXRA 4BCAA 5AE3A 3RJAA 1W1OA 2OAIA 5AE2A 4HG0A 1V97A 1WVFA 1ZR6A 5HHZA 1SB3B 3DEDA 4MLAA 5I1WA 5ADZA 4BBYA 3LLBA 1N62C 2NQWA 1AHUA 1N60C 2R8DA 3PM9A 3W8WA 3NVZB 1W1RA 3FW7A 5I1VA 3NRZB 2VFRA 3S1FA 1E8FA 1FFVC 4PYTA 2UUVA 2Y08A 3D2DA 1UXYA 4BC7A 1W1QA 2QPMA 4PVHA 3AN1A 2Q4WA 5G5GB 2GQTA 3W8XA 5FXFA 3FW9A 3JS8A 2GQUA 3GSYA 5L6FA 1I19A 3D2JA 2VFVA 1VDVA 3FWAA 1AHVA 1N5WC 5L6GA 3VTEA 3S1DA 2VAOA 2AXRA 2Y3SA 3RJ8A 3S1EA 2R2ZA 4PWBA 3TSHA 1FIQB 3NVVB 1QLUA 1WYGA 5FXDA 2BVFA 3D2HA 4DNSA 2VFSA 2BVHA 5HMRA 1FFUC 4JAYA 1W1JA 4XLOA 4EC3A 4UD8A 3B9JB 3TX1A 2Q85A 1N63C 3TSJA 3HSUA 5FXEA 3KJMA 3DQ0A 2MBRA 1WVEA 4O95A 2VFUA 5G5HB 2E3TA 1QLTA 5K8EA 4JB1A 1N5XA 1ZXIC 1W1KA 1N61C 1W1LA 2WDWA 2YVSA 3NVWB 3EUB3 1E8GA 1FO4A 2P4PA 4PVEA 1W1MA 2QKNA 2W54A 1RM6B 1W1SA 2P3HA 2PLSA 3POPA 3NS1B 3I99A 2IPIA 3FW8A 1JRPA 2P13A 3W8ZA 5HQXA 4PVKA 3AM9A 4PVJA 2W3SA 3S1CA 3LAEA 4ML8A 3ETRB 2UUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAO A;  4PZF A;  1DIQ A;  1F0X A;  5AE1 A;  2W55 A;  1HSK A;  1JRO A;  2VFT A;  5D79 A;  3BW7 A;  2Y3R A;  4ZOH B;  2Y4G A;  1E0Y A;  3AMZ A;  5FXP A;  3PQB A;  3SR6 B;  4PWC A;  1T3Q C;  1DZN A;  5AWV A;  1DII A;  1AHZ A;  1MBB A;  1MBT A;  3C0P A;  1E8H A;  2W3R A;  4BC9 A;  2I0K A;  4OAL A;  2BVG A;  2EXR A;  4BCA A;  5AE3 A;  3RJA A;  1W1O A;  5AE2 A;  1V97 A;  1WVF A;  1ZR6 A;  5HHZ A;  4MLA A;  5I1W A;  5ADZ A;  4BBY A;  1N62 C;  1AHU A;  1N60 C;  3PM9 A;  3W8W A;  3NVZ B;  1W1R A;  3FW7 A;  5I1V A;  3NRZ B;  2VFR A;  3S1F A;  1E8F A;  1FFV C;  4PYT A;  2Y08 A;  3D2D A;  1UXY A;  4BC7 A;  1W1Q A;  2QPM A;  4PVH A;  3AN1 A;  2Q4W A;  2GQT A;  3W8X A;  5FXF A;  3FW9 A;  3JS8 A;  2GQU A;  3GSY A;  5L6F A;  1I19 A;  3D2J A;  2VFV A;  1VDV A;  3FWA A;  1AHV A;  1N5W C;  5L6G A;  3VTE A;  3S1D A;  2VAO A;  2AXR A;  2Y3S A;  3RJ8 A;  3S1E A;  4PWB A;  3TSH A;  1FIQ B;  1QLU A;  1WYG A;  5FXD A;  2BVF A;  3D2H A;  4DNS A;  2VFS A;  2BVH A;  5HMR A;  1FFU C;  4JAY A;  1W1J A;  4XLO A;  4EC3 A;  4UD8 A;  3B9J B;  3TX1 A;  2Q85 A;  1N63 C;  3TSJ A;  3HSU A;  5FXE A;  3KJM A;  3DQ0 A;  2MBR A;  1WVE A;  4O95 A;  2VFU A;  2E3T A;  1QLT A;  5K8E A;  4JB1 A;  1N5X A;  1ZXI C;  1W1K A;  1N61 C;  1W1L A;  2WDW A;  3EUB 3;  1E8G A;  1FO4 A;  4PVE A;  1W1M A;  2QKN A;  2W54 A;  1W1S A;  3POP A;  3NS1 B;  3I99 A;  2IPI A;  3FW8 A;  3W8Z A;  5HQX A;  4PVK A;  3AM9 A;  4PVJ A;  2W3S A;  3S1C A;  4ML8 A;  3ETR B; 
#chains in the Genus database with same CATH topology
 1VAO A;  4PZF A;  2RK5 A;  2O3G A;  1DIQ A;  1F0X A;  5AE1 A;  2W55 A;  1HSK A;  1JRO A;  2VFT A;  5D79 A;  3BW7 A;  2Y3R A;  4ZOH B;  2Y4G A;  1E0Y A;  3AMZ A;  5FXP A;  3PQB A;  3SR6 B;  4PWC A;  2PLI A;  1T3Q C;  1DZN A;  3HRD C;  5AWV A;  1DII A;  1AHZ A;  1MBB A;  1MBT A;  3C0P A;  1E8H A;  2W3R A;  3NVY B;  4BC9 A;  2I0K A;  4OAL A;  2BVG A;  2EXR A;  4BCA A;  5AE3 A;  3RJA A;  1W1O A;  2OAI A;  5AE2 A;  4HG0 A;  1V97 A;  1WVF A;  1ZR6 A;  5HHZ A;  1SB3 B;  3DED A;  4MLA A;  5I1W A;  5ADZ A;  4BBY A;  3LLB A;  1N62 C;  2NQW A;  1AHU A;  1N60 C;  2R8D A;  3PM9 A;  3W8W A;  3NVZ B;  1W1R A;  3FW7 A;  5I1V A;  3NRZ B;  2VFR A;  3S1F A;  1E8F A;  1FFV C;  3EJE B;  4PYT A;  2UUV A;  2Y08 A;  3D2D A;  1UXY A;  3EJB B;  4BC7 A;  1W1Q A;  2QPM A;  4PVH A;  3AN1 A;  2Q4W A;  5G5G B;  2GQT A;  3W8X A;  5FXF A;  3FW9 A;  3JS8 A;  2GQU A;  3GSY A;  5L6F A;  1I19 A;  3D2J A;  2VFV A;  1VDV A;  3FWA A;  1AHV A;  1N5W C;  5L6G A;  3VTE A;  3S1D A;  2VAO A;  2AXR A;  3EJD B;  2Y3S A;  3RJ8 A;  3S1E A;  2R2Z A;  4PWB A;  3TSH A;  1FIQ B;  3NVV B;  1QLU A;  1WYG A;  5FXD A;  2BVF A;  3D2H A;  4DNS A;  2VFS A;  2BVH A;  5HMR A;  1FFU C;  4JAY A;  1W1J A;  4XLO A;  4EC3 A;  4UD8 A;  3B9J B;  3TX1 A;  2Q85 A;  1N63 C;  3TSJ A;  3HSU A;  5FXE A;  3KJM A;  3DQ0 A;  2MBR A;  1WVE A;  4O95 A;  2VFU A;  5G5H B;  2E3T A;  1QLT A;  5K8E A;  4JB1 A;  1N5X A;  1ZXI C;  1W1K A;  1N61 C;  1W1L A;  2WDW A;  2YVS A;  3NVW B;  3EUB 3;  1E8G A;  1FO4 A;  2P4P A;  4PVE A;  1W1M A;  2QKN A;  2W54 A;  1RM6 B;  1W1S A;  2P3H A;  2PLS A;  3POP A;  3NS1 B;  3I99 A;  2IPI A;  3FW8 A;  1JRP A;  2P13 A;  3W8Z A;  5HQX A;  4PVK A;  3AM9 A;  4PVJ A;  2W3S A;  3S1C A;  3LAE A;  4ML8 A;  3ETR B;  2UUU A; 
#chains in the Genus database with same CATH homology
 1VAO A;  4PZF A;  2RK5 A;  2O3G A;  1DIQ A;  1F0X A;  5AE1 A;  2W55 A;  1HSK A;  1JRO A;  2VFT A;  5D79 A;  3BW7 A;  2Y3R A;  4ZOH B;  2Y4G A;  1E0Y A;  3AMZ A;  5FXP A;  3PQB A;  3SR6 B;  4PWC A;  2PLI A;  1T3Q C;  1DZN A;  3HRD C;  5AWV A;  1DII A;  1AHZ A;  1MBB A;  1MBT A;  3C0P A;  1E8H A;  2W3R A;  3NVY B;  4BC9 A;  2I0K A;  4OAL A;  2BVG A;  2EXR A;  4BCA A;  5AE3 A;  3RJA A;  1W1O A;  2OAI A;  5AE2 A;  4HG0 A;  1V97 A;  1WVF A;  1ZR6 A;  5HHZ A;  1SB3 B;  3DED A;  4MLA A;  5I1W A;  5ADZ A;  4BBY A;  3LLB A;  1N62 C;  2NQW A;  1AHU A;  1N60 C;  2R8D A;  3PM9 A;  3W8W A;  3NVZ B;  1W1R A;  3FW7 A;  5I1V A;  3NRZ B;  2VFR A;  3S1F A;  1E8F A;  1FFV C;  4PYT A;  2UUV A;  2Y08 A;  3D2D A;  1UXY A;  4BC7 A;  1W1Q A;  2QPM A;  4PVH A;  3AN1 A;  2Q4W A;  5G5G B;  2GQT A;  3W8X A;  5FXF A;  3FW9 A;  3JS8 A;  2GQU A;  3GSY A;  5L6F A;  1I19 A;  3D2J A;  2VFV A;  1VDV A;  3FWA A;  1AHV A;  1N5W C;  5L6G A;  3VTE A;  3S1D A;  2VAO A;  2AXR A;  2Y3S A;  3RJ8 A;  3S1E A;  2R2Z A;  4PWB A;  3TSH A;  1FIQ B;  3NVV B;  1QLU A;  1WYG A;  5FXD A;  2BVF A;  3D2H A;  4DNS A;  2VFS A;  2BVH A;  5HMR A;  1FFU C;  4JAY A;  1W1J A;  4XLO A;  4EC3 A;  4UD8 A;  3B9J B;  3TX1 A;  2Q85 A;  1N63 C;  3TSJ A;  3HSU A;  5FXE A;  3KJM A;  3DQ0 A;  2MBR A;  1WVE A;  4O95 A;  2VFU A;  5G5H B;  2E3T A;  1QLT A;  5K8E A;  4JB1 A;  1N5X A;  1ZXI C;  1W1K A;  1N61 C;  1W1L A;  2WDW A;  2YVS A;  3NVW B;  3EUB 3;  1E8G A;  1FO4 A;  2P4P A;  4PVE A;  1W1M A;  2QKN A;  2W54 A;  1RM6 B;  1W1S A;  2P3H A;  2PLS A;  3POP A;  3NS1 B;  3I99 A;  2IPI A;  3FW8 A;  1JRP A;  2P13 A;  3W8Z A;  5HQX A;  4PVK A;  3AM9 A;  4PVJ A;  2W3S A;  3S1C A;  3LAE A;  4ML8 A;  3ETR B;  2UUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...