5D79A

Structure of bbe-like #28 from arabidopsis thaliana
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
503
structure length
498
Chain Sequence
HEDFLKCLSYTVEPKVIHTSKDSSFFSILDSSIQNPRFSVSETPKPVSIITPVKASDVQTVIRCAQLHGIHVRTRSAGHCYEGLSYIAYNKPFAVIDLRNLRSISLDVDNRTGWVQTGATAGELYYEIGKTTKSLAFPAGIHPTVGVGGQFSGGGYGTLLRKYGLAADNIIDALVVDASGRILDRQAMGEDYFWAIRGGGGSSFGVILSWKVKLVDVPSTITVFKVQKTSKKEAVRIIKKWQYAADKVPDDLFIRTTLERSNKNAVHALFTGLYIGPVNNLLALMEEKFPELGLEKEGCEEMSWIESVLWFADFPKGESLGVLTNRERTSLSFKGKDDFVQEPIPEAAIQEIWRRLEAPEARLGKIILTPFGGKMSEMAEYETPFPHRGGNLYEIQYVAYWREEEDKNKTETDKYLKWVDSVYEFMTPYVSKSPRGAYVNFKDMDLGMYLGKKKTKYEEGKSWGVKYFKNNFERLVRVKTRVDPTDFFCDEQSIPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Berberine Bridge Enzyme-Like Enzyme with an Active Site Specific to the Plant Family Brassicaceae.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Oxidoreductase
molecule keywords Berberine bridge enzyme-like protein
total genus 167
structure length 498
sequence length 503
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5d79A01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5d79A02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5d79A03
2W55A 4ZOHB 1FFVC 2Y3SA 4UD8A 5I1WA 3W8ZA 2Y08A 5FXFA 4EC3A 2AXRA 2W54A 3GSYA 2GQTA 2EXRA 2Q85A 3JS8A 4PYTA 4XLOA 5D79A 1MBBA 4BBYA 3NVZB 2BVGA 2QPMA 1JROA 5AE1A 4BC7A 4JAYA 3C0PA 5FXDA 1N5XA 3S1DA 3FW8A 1FIQB 1W1SA 4MLAA 5AE3A 2Y3RA 1MBTA 3FW7A 1AHZA 2QKNA 3I99A 1W1OA 1W1RA 5L6GA 2MBRA 4PVKA 2BVFA 3FW9A 4BCAA 1ZXIC 5K8EA 1QLTA 4PVJA 3TSHA 3FWAA 1VDVA 2BVHA 1N61C 4PWCA 5FXEA 1N63C 3PQBA 5HMRA 3D2JA 1ZR6A 1W1JA 2VFRA 5FXPA 5HHZA 3RJ8A 1W1KA 1N5WC 3ETRB 2Y4GA 1WYGA 3DQ0A 3TX1A 1AHVA 3BW7A 3EUB3 2VFSA 3S1FA 1I19A 3AMZA 1W1MA 5HQXA 1T3QC 1DIQA 2I0KA 1DIIA 2VFTA 2W3SA 4PVEA 3KJMA 3D2DA 4JB1A 1F0XA 5AWVA 5I1VA 4PVHA 3SR6B 5ADZA 2VFUA 3AN1A 4PWBA 3RJAA 4OALA 3NRZB 1VAOA 3D2HA 3S1EA 1QLUA 5L6FA 3AM9A 1W1LA 2W3RA 4O95A 1WVFA 3POPA 1W1QA 2GQUA 2IPIA 2VFVA 1FO4A 1N62C 3HSUA 3S1CA 4ML8A 3VTEA 1HSKA 3NS1B 1E8HA 1E8GA 2E3TA 3PM9A 2WDWA 1WVEA 4PZFA 5AE2A 2VAOA 1E8FA 2Q4WA 1E0YA 3W8XA 1FFUC 4DNSA 1UXYA 1DZNA 1N60C 3B9JB 3W8WA 1AHUA 3TSJA 4BC9A 1V97A
chains in the Genus database with same CATH superfamily
2W55A 4ZOHB 3EJDB 1FFVC 2Y3SA 4UD8A 5I1WA 3W8ZA 2Y08A 5FXFA 4EC3A 2R2ZA 2AXRA 2O3GA 3LAEA 2W54A 3GSYA 2GQTA 2EXRA 2Q85A 3JS8A 4PYTA 4XLOA 5D79A 1MBBA 4BBYA 3NVZB 2BVGA 2QPMA 3NVYB 2OAIA 1JROA 5AE1A 4BC7A 4JAYA 1SB3B 3C0PA 5FXDA 1N5XA 3S1DA 3FW8A 1FIQB 3HRDC 1W1SA 4MLAA 3EJEB 5AE3A 5G5GB 2Y3RA 1MBTA 1AHZA 3FW7A 2R8DA 2QKNA 3I99A 1W1OA 1W1RA 5L6GA 2MBRA 4PVKA 2BVFA 2PLIA 3FW9A 4BCAA 1ZXIC 5K8EA 1QLTA 4PVJA 2NQWA 3TSHA 3NVWB 3FWAA 1VDVA 2BVHA 1N61C 4PWCA 5FXEA 1N63C 3PQBA 5HMRA 3D2JA 2RK5A 1ZR6A 1W1JA 2VFRA 5FXPA 5HHZA 3RJ8A 1W1KA 1N5WC 3ETRB 2Y4GA 3DEDA 1WYGA 3DQ0A 3TX1A 1AHVA 3BW7A 3EUB3 2VFSA 3S1FA 5G5HB 1I19A 3AMZA 1W1MA 5HQXA 1T3QC 1DIQA 2I0KA 1DIIA 2VFTA 2W3SA 4PVEA 3KJMA 3D2DA 4JB1A 1F0XA 5AWVA 5I1VA 4PVHA 3SR6B 5ADZA 2P13A 2VFUA 2P4PA 3AN1A 4PWBA 3LLBA 3RJAA 4OALA 3NRZB 1VAOA 3D2HA 2PLSA 3S1EA 1QLUA 5L6FA 3AM9A 1W1LA 2W3RA 4O95A 1WVFA 3NVVB 2P3HA 3POPA 1W1QA 2GQUA 2IPIA 2VFVA 1FO4A 1N62C 2UUUA 3HSUA 3S1CA 4ML8A 3VTEA 1HSKA 3NS1B 1E8HA 1E8GA 2E3TA 3PM9A 1RM6B 2UUVA 1WVEA 2WDWA 4PZFA 2YVSA 5AE2A 2VAOA 1E8FA 2Q4WA 1E0YA 3W8XA 1FFUC 4DNSA 1UXYA 1DZNA 4HG0A 1N60C 3EJBB 3B9JB 3W8WA 1AHUA 3TSJA 1JRPA 4BC9A 1V97A
chains in the Genus database with same CATH topology
2W55A 4ZOHB 1FFVC 2Y3SA 4UD8A 5I1WA 3W8ZA 2Y08A 5FXFA 4EC3A 2R2ZA 2AXRA 2O3GA 3LAEA 2W54A 3GSYA 2GQTA 2EXRA 2Q85A 3JS8A 4PYTA 4XLOA 5D79A 1MBBA 4BBYA 3NVZB 2BVGA 2QPMA 2OAIA 3NVYB 1JROA 5AE1A 4BC7A 4JAYA 1SB3B 3C0PA 5FXDA 1N5XA 3S1DA 3FW8A 1FIQB 3HRDC 1W1SA 4MLAA 5AE3A 5G5GB 2Y3RA 1MBTA 3FW7A 1AHZA 2R8DA 2QKNA 3I99A 1W1OA 1W1RA 5L6GA 2MBRA 4PVKA 2BVFA 2PLIA 3FW9A 4BCAA 1ZXIC 5K8EA 1QLTA 4PVJA 2NQWA 3TSHA 3NVWB 3FWAA 1VDVA 2BVHA 1N61C 4PWCA 5FXEA 1N63C 3PQBA 5HMRA 3D2JA 2RK5A 1ZR6A 1W1JA 2VFRA 5FXPA 5HHZA 3RJ8A 1W1KA 1N5WC 3ETRB 2Y4GA 3DEDA 1WYGA 3DQ0A 3TX1A 1AHVA 3BW7A 3EUB3 2VFSA 3S1FA 5G5HB 1I19A 3AMZA 1W1MA 5HQXA 1T3QC 1DIQA 2I0KA 1DIIA 2VFTA 2W3SA 4PVEA 3KJMA 3D2DA 4JB1A 1F0XA 5AWVA 5I1VA 4PVHA 3SR6B 5ADZA 2P13A 2VFUA 2P4PA 3AN1A 4PWBA 3LLBA 3RJAA 4OALA 3NRZB 1VAOA 3D2HA 2PLSA 3S1EA 1QLUA 5L6FA 3AM9A 1W1LA 2W3RA 4O95A 1WVFA 3NVVB 2P3HA 3POPA 1W1QA 2GQUA 2IPIA 2VFVA 1FO4A 1N62C 2UUUA 3HSUA 3S1CA 4ML8A 3VTEA 1HSKA 3NS1B 1E8HA 1E8GA 2E3TA 3PM9A 1RM6B 2UUVA 1WVEA 2WDWA 4PZFA 2YVSA 5AE2A 2VAOA 1E8FA 2Q4WA 1E0YA 3W8XA 1FFUC 4DNSA 1UXYA 1DZNA 4HG0A 1N60C 3B9JB 3W8WA 1AHUA 3TSJA 1JRPA 4BC9A 1V97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W55 A;  4ZOH B;  1FFV C;  2Y3S A;  4UD8 A;  5I1W A;  3W8Z A;  2Y08 A;  5FXF A;  4EC3 A;  2AXR A;  2W54 A;  3GSY A;  2GQT A;  2EXR A;  2Q85 A;  3JS8 A;  4PYT A;  4XLO A;  5D79 A;  1MBB A;  4BBY A;  3NVZ B;  2BVG A;  2QPM A;  1JRO A;  5AE1 A;  4BC7 A;  4JAY A;  3C0P A;  5FXD A;  1N5X A;  3S1D A;  3FW8 A;  1FIQ B;  1W1S A;  4MLA A;  5AE3 A;  2Y3R A;  1MBT A;  3FW7 A;  1AHZ A;  2QKN A;  3I99 A;  1W1O A;  1W1R A;  5L6G A;  2MBR A;  4PVK A;  2BVF A;  3FW9 A;  4BCA A;  1ZXI C;  5K8E A;  1QLT A;  4PVJ A;  3TSH A;  3FWA A;  1VDV A;  2BVH A;  1N61 C;  4PWC A;  5FXE A;  1N63 C;  3PQB A;  5HMR A;  3D2J A;  1ZR6 A;  1W1J A;  2VFR A;  5FXP A;  5HHZ A;  3RJ8 A;  1W1K A;  1N5W C;  3ETR B;  2Y4G A;  1WYG A;  3DQ0 A;  3TX1 A;  1AHV A;  3BW7 A;  3EUB 3;  2VFS A;  3S1F A;  1I19 A;  3AMZ A;  1W1M A;  5HQX A;  1T3Q C;  1DIQ A;  2I0K A;  1DII A;  2VFT A;  2W3S A;  4PVE A;  3KJM A;  3D2D A;  4JB1 A;  1F0X A;  5AWV A;  5I1V A;  4PVH A;  3SR6 B;  5ADZ A;  2VFU A;  3AN1 A;  4PWB A;  3RJA A;  4OAL A;  3NRZ B;  1VAO A;  3D2H A;  3S1E A;  1QLU A;  5L6F A;  3AM9 A;  1W1L A;  2W3R A;  4O95 A;  1WVF A;  3POP A;  1W1Q A;  2GQU A;  2IPI A;  2VFV A;  1FO4 A;  1N62 C;  3HSU A;  3S1C A;  4ML8 A;  3VTE A;  1HSK A;  3NS1 B;  1E8H A;  1E8G A;  2E3T A;  3PM9 A;  2WDW A;  1WVE A;  4PZF A;  5AE2 A;  2VAO A;  1E8F A;  2Q4W A;  1E0Y A;  3W8X A;  1FFU C;  4DNS A;  1UXY A;  1DZN A;  1N60 C;  3B9J B;  3W8W A;  1AHU A;  3TSJ A;  4BC9 A;  1V97 A; 
#chains in the Genus database with same CATH topology
 2W55 A;  4ZOH B;  3EJD B;  1FFV C;  2Y3S A;  4UD8 A;  5I1W A;  3W8Z A;  2Y08 A;  5FXF A;  4EC3 A;  2R2Z A;  2AXR A;  2O3G A;  3LAE A;  2W54 A;  3GSY A;  2GQT A;  2EXR A;  2Q85 A;  3JS8 A;  4PYT A;  4XLO A;  5D79 A;  1MBB A;  4BBY A;  3NVZ B;  2BVG A;  2QPM A;  3NVY B;  2OAI A;  1JRO A;  5AE1 A;  4BC7 A;  4JAY A;  1SB3 B;  3C0P A;  5FXD A;  1N5X A;  3S1D A;  3FW8 A;  1FIQ B;  3HRD C;  1W1S A;  4MLA A;  3EJE B;  5AE3 A;  5G5G B;  2Y3R A;  1MBT A;  1AHZ A;  3FW7 A;  2R8D A;  2QKN A;  3I99 A;  1W1O A;  1W1R A;  5L6G A;  2MBR A;  4PVK A;  2BVF A;  2PLI A;  3FW9 A;  4BCA A;  1ZXI C;  5K8E A;  1QLT A;  4PVJ A;  2NQW A;  3TSH A;  3NVW B;  3FWA A;  1VDV A;  2BVH A;  1N61 C;  4PWC A;  5FXE A;  1N63 C;  3PQB A;  5HMR A;  3D2J A;  2RK5 A;  1ZR6 A;  1W1J A;  2VFR A;  5FXP A;  5HHZ A;  3RJ8 A;  1W1K A;  1N5W C;  3ETR B;  2Y4G A;  3DED A;  1WYG A;  3DQ0 A;  3TX1 A;  1AHV A;  3BW7 A;  3EUB 3;  2VFS A;  3S1F A;  5G5H B;  1I19 A;  3AMZ A;  1W1M A;  5HQX A;  1T3Q C;  1DIQ A;  2I0K A;  1DII A;  2VFT A;  2W3S A;  4PVE A;  3KJM A;  3D2D A;  4JB1 A;  1F0X A;  5AWV A;  5I1V A;  4PVH A;  3SR6 B;  5ADZ A;  2P13 A;  2VFU A;  2P4P A;  3AN1 A;  4PWB A;  3LLB A;  3RJA A;  4OAL A;  3NRZ B;  1VAO A;  3D2H A;  2PLS A;  3S1E A;  1QLU A;  5L6F A;  3AM9 A;  1W1L A;  2W3R A;  4O95 A;  1WVF A;  3NVV B;  2P3H A;  3POP A;  1W1Q A;  2GQU A;  2IPI A;  2VFV A;  1FO4 A;  1N62 C;  2UUU A;  3HSU A;  3S1C A;  4ML8 A;  3VTE A;  1HSK A;  3NS1 B;  1E8H A;  1E8G A;  2E3T A;  3PM9 A;  1RM6 B;  2UUV A;  1WVE A;  2WDW A;  4PZF A;  2YVS A;  5AE2 A;  2VAO A;  1E8F A;  2Q4W A;  1E0Y A;  3W8X A;  1FFU C;  4DNS A;  1UXY A;  1DZN A;  4HG0 A;  1N60 C;  3EJB B;  3B9J B;  3W8W A;  1AHU A;  3TSJ A;  1JRP A;  4BC9 A;  1V97 A; 
#chains in the Genus database with same CATH homology
 2W55 A;  4ZOH B;  1FFV C;  2Y3S A;  4UD8 A;  5I1W A;  3W8Z A;  2Y08 A;  5FXF A;  4EC3 A;  2R2Z A;  2AXR A;  2O3G A;  3LAE A;  2W54 A;  3GSY A;  2GQT A;  2EXR A;  2Q85 A;  3JS8 A;  4PYT A;  4XLO A;  5D79 A;  1MBB A;  4BBY A;  3NVZ B;  2BVG A;  2QPM A;  2OAI A;  3NVY B;  1JRO A;  5AE1 A;  4BC7 A;  4JAY A;  1SB3 B;  3C0P A;  5FXD A;  1N5X A;  3S1D A;  3FW8 A;  1FIQ B;  3HRD C;  1W1S A;  4MLA A;  5AE3 A;  5G5G B;  2Y3R A;  1MBT A;  3FW7 A;  1AHZ A;  2R8D A;  2QKN A;  3I99 A;  1W1O A;  1W1R A;  5L6G A;  2MBR A;  4PVK A;  2BVF A;  2PLI A;  3FW9 A;  4BCA A;  1ZXI C;  5K8E A;  1QLT A;  4PVJ A;  2NQW A;  3TSH A;  3NVW B;  3FWA A;  1VDV A;  2BVH A;  1N61 C;  4PWC A;  5FXE A;  1N63 C;  3PQB A;  5HMR A;  3D2J A;  2RK5 A;  1ZR6 A;  1W1J A;  2VFR A;  5FXP A;  5HHZ A;  3RJ8 A;  1W1K A;  1N5W C;  3ETR B;  2Y4G A;  3DED A;  1WYG A;  3DQ0 A;  3TX1 A;  1AHV A;  3BW7 A;  3EUB 3;  2VFS A;  3S1F A;  5G5H B;  1I19 A;  3AMZ A;  1W1M A;  5HQX A;  1T3Q C;  1DIQ A;  2I0K A;  1DII A;  2VFT A;  2W3S A;  4PVE A;  3KJM A;  3D2D A;  4JB1 A;  1F0X A;  5AWV A;  5I1V A;  4PVH A;  3SR6 B;  5ADZ A;  2P13 A;  2VFU A;  2P4P A;  3AN1 A;  4PWB A;  3LLB A;  3RJA A;  4OAL A;  3NRZ B;  1VAO A;  3D2H A;  2PLS A;  3S1E A;  1QLU A;  5L6F A;  3AM9 A;  1W1L A;  2W3R A;  4O95 A;  1WVF A;  3NVV B;  2P3H A;  3POP A;  1W1Q A;  2GQU A;  2IPI A;  2VFV A;  1FO4 A;  1N62 C;  2UUU A;  3HSU A;  3S1C A;  4ML8 A;  3VTE A;  1HSK A;  3NS1 B;  1E8H A;  1E8G A;  2E3T A;  3PM9 A;  1RM6 B;  2UUV A;  1WVE A;  2WDW A;  4PZF A;  2YVS A;  5AE2 A;  2VAO A;  1E8F A;  2Q4W A;  1E0Y A;  3W8X A;  1FFU C;  4DNS A;  1UXY A;  1DZN A;  4HG0 A;  1N60 C;  3B9J B;  3W8W A;  1AHU A;  3TSJ A;  1JRP A;  4BC9 A;  1V97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...