2WDWA

The native crystal structure of the primary hexose oxidase (dbv29) in antibiotic a40926 biosynthesis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interception of Teicoplanin Oxidation Intermediates Yields New Antimicrobial Scaffolds
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
molecule tags Oxidoreductase
molecule keywords PUTATIVE HEXOSE OXIDASE
total genus 139
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 1.1.3.13: Alcohol oxidase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2wdwA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2wdwA02
5AWVA 2UUUA 5L6GA 3W8ZA 3TSJA 3HSUA 4XLOA 3GSYA 4PVKA 3D2HA 5K8EA 3FW9A 4PZFA 2BVHA 4PWCA 2Y08A 3D2DA 4EC3A 3RJ8A 4DNSA 4PWBA 2Y4GA 5I1WA 5L6FA 4PVHA 3W8XA 3RJAA 2Y3SA 2Y3RA 2BVFA 4UD8A 3PQBA 3FW7A 5D79A 4PVJA 3FW8A 2AXRA 3D2JA 4PVEA 2UUVA 3POPA 3TSHA 3W8WA 2BVGA 1ZR6A 3VTEA 2IPIA 2WDWA 3FWAA 5I1VA
chains in the Genus database with same CATH superfamily
5FXFA 1VDVA 1VAOA 4O95A 3W8ZA 5L6GA 1N61C 1MBTA 4JAYA 1AHZA 1SB3B 2O3GA 3LLBA 5K8EA 3KJMA 2W54A 2Y08A 1DIQA 3EUB3 1QLTA 1N5XA 4PYTA 4BC9A 2Y3SA 2E3TA 3NVZB 1N60C 3NVYB 3FW8A 2VFVA 3AM9A 1AHVA 3S1FA 1W1MA 1N62C 3JS8A 3POPA 4ZOHB 2W55A 1E8GA 1E8FA 3FWAA 1F0XA 5AWVA 2Q85A 2OAIA 3DQ0A 3AMZA 3TSJA 5HQXA 1FO4A 4XLOA 3S1EA 3B9JB 1W1QA 2PLIA 1QLUA 4BC7A 1FIQB 3S1CA 4PWCA 1WVEA 3RJ8A 2Y4GA 3NS1B 3W8XA 2Y3RA 4UD8A 4MLAA 3LAEA 2I0KA 1JRPA 1I19A 2YVSA 1W1RA 3AN1A 1V97A 5FXEA 1W1JA 1W1LA 2UUVA 4OALA 2R2ZA 2VFUA 2BVGA 3W8WA 2IPIA 1ZXIC 5I1VA 2P4PA 1W1OA 2Q4WA 2R8DA 5ADZA 2MBRA 1W1SA 3D2HA 2VFSA 3FW9A 3ETRB 4PZFA 5AE1A 1N5WC 2RK5A 3D2DA 1N63C 1W1KA 4EC3A 3S1DA 1FFVC 1T3QC 2GQTA 2P13A 4PWBA 4JB1A 5I1WA 3PM9A 5L6FA 5HMRA 1E0YA 2VFRA 3DEDA 3PQBA 3NVWB 1UXYA 2NQWA 2AXRA 2P3HA 3D2JA 3C0PA 3BW7A 4PVEA 4BBYA 4ML8A 2QKNA 1FFUC 1ZR6A 1E8HA 3NRZB 2UUUA 1AHUA 3HSUA 4HG0A 3GSYA 4PVKA 3SR6B 5HHZA 2BVHA 1WVFA 3HRDC 2GQUA 5AE2A 2VAOA 4DNSA 1HSKA 2W3SA 2PLSA 1DIIA 5G5HB 4PVHA 3RJAA 1MBBA 2BVFA 2VFTA 5FXDA 5G5GB 3FW7A 5D79A 2EXRA 1WYGA 3NVVB 4PVJA 3TX1A 1JROA 3I99A 4BCAA 5FXPA 2W3RA 1DZNA 5AE3A 3TSHA 3VTEA 1RM6B 2WDWA 2QPMA
chains in the Genus database with same CATH topology
5FXFA 1VDVA 1VAOA 4O95A 3W8ZA 5L6GA 1N61C 1MBTA 4JAYA 1AHZA 1SB3B 2O3GA 3LLBA 5K8EA 3KJMA 2W54A 2Y08A 1DIQA 3EUB3 1QLTA 1N5XA 4PYTA 4BC9A 2Y3SA 2E3TA 3NVZB 1N60C 3NVYB 3FW8A 2VFVA 3AM9A 1AHVA 3S1FA 1W1MA 1N62C 3JS8A 3POPA 4ZOHB 2W55A 1E8GA 1E8FA 3FWAA 1F0XA 5AWVA 2Q85A 2OAIA 3DQ0A 3AMZA 3TSJA 5HQXA 1FO4A 4XLOA 3S1EA 3B9JB 1W1QA 2PLIA 1QLUA 4BC7A 1FIQB 3S1CA 4PWCA 1WVEA 3RJ8A 2Y4GA 3NS1B 3W8XA 2Y3RA 4UD8A 4MLAA 3LAEA 2I0KA 1JRPA 1I19A 2YVSA 1W1RA 3AN1A 1V97A 5FXEA 1W1JA 1W1LA 2UUVA 4OALA 2R2ZA 2VFUA 2BVGA 3W8WA 2IPIA 1ZXIC 5I1VA 2P4PA 1W1OA 2Q4WA 2R8DA 5ADZA 2MBRA 1W1SA 3D2HA 2VFSA 3FW9A 3ETRB 4PZFA 5AE1A 1N5WC 2RK5A 3D2DA 1N63C 1W1KA 4EC3A 3S1DA 1FFVC 1T3QC 2GQTA 2P13A 4PWBA 4JB1A 5I1WA 3PM9A 5L6FA 5HMRA 1E0YA 2VFRA 3DEDA 3PQBA 3NVWB 1UXYA 2NQWA 2AXRA 2P3HA 3D2JA 3C0PA 3BW7A 4PVEA 4BBYA 4ML8A 2QKNA 1FFUC 1ZR6A 1E8HA 3NRZB 2UUUA 1AHUA 3HSUA 4HG0A 3GSYA 4PVKA 3SR6B 5HHZA 2BVHA 1WVFA 3HRDC 2GQUA 5AE2A 2VAOA 4DNSA 1HSKA 2W3SA 2PLSA 1DIIA 5G5HB 4PVHA 3RJAA 1MBBA 2BVFA 2VFTA 5FXDA 5G5GB 3FW7A 5D79A 2EXRA 1WYGA 3NVVB 4PVJA 3TX1A 1JROA 3I99A 4BCAA 5FXPA 2W3RA 1DZNA 5AE3A 3TSHA 3VTEA 1RM6B 2WDWA 2QPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AWV A;  2UUU A;  5L6G A;  3W8Z A;  3TSJ A;  3HSU A;  4XLO A;  3GSY A;  4PVK A;  3D2H A;  5K8E A;  3FW9 A;  4PZF A;  2BVH A;  4PWC A;  2Y08 A;  3D2D A;  4EC3 A;  3RJ8 A;  4DNS A;  4PWB A;  2Y4G A;  5I1W A;  5L6F A;  4PVH A;  3W8X A;  3RJA A;  2Y3S A;  2Y3R A;  2BVF A;  4UD8 A;  3PQB A;  3FW7 A;  5D79 A;  4PVJ A;  3FW8 A;  2AXR A;  3D2J A;  4PVE A;  2UUV A;  3POP A;  3TSH A;  3W8W A;  2BVG A;  1ZR6 A;  3VTE A;  2IPI A;  2WDW A;  3FWA A;  5I1V A; 
#chains in the Genus database with same CATH topology
 5FXF A;  1VDV A;  1VAO A;  4O95 A;  3W8Z A;  5L6G A;  1N61 C;  1MBT A;  4JAY A;  1AHZ A;  1SB3 B;  2O3G A;  3LLB A;  5K8E A;  3KJM A;  2W54 A;  2Y08 A;  1DIQ A;  3EUB 3;  1QLT A;  1N5X A;  4PYT A;  4BC9 A;  2Y3S A;  2E3T A;  3NVZ B;  1N60 C;  3NVY B;  3FW8 A;  2VFV A;  3AM9 A;  1AHV A;  3S1F A;  1W1M A;  1N62 C;  3JS8 A;  3POP A;  4ZOH B;  2W55 A;  1E8G A;  1E8F A;  3FWA A;  1F0X A;  5AWV A;  2Q85 A;  2OAI A;  3DQ0 A;  3AMZ A;  3TSJ A;  5HQX A;  1FO4 A;  4XLO A;  3S1E A;  3B9J B;  1W1Q A;  2PLI A;  1QLU A;  4BC7 A;  1FIQ B;  3S1C A;  4PWC A;  1WVE A;  3RJ8 A;  2Y4G A;  3NS1 B;  3W8X A;  2Y3R A;  4UD8 A;  4MLA A;  3LAE A;  2I0K A;  1JRP A;  1I19 A;  2YVS A;  1W1R A;  3AN1 A;  1V97 A;  5FXE A;  1W1J A;  1W1L A;  2UUV A;  4OAL A;  2R2Z A;  2VFU A;  2BVG A;  3W8W A;  2IPI A;  1ZXI C;  5I1V A;  2P4P A;  1W1O A;  2Q4W A;  2R8D A;  5ADZ A;  2MBR A;  1W1S A;  3D2H A;  2VFS A;  3FW9 A;  3ETR B;  4PZF A;  5AE1 A;  1N5W C;  2RK5 A;  3D2D A;  1N63 C;  1W1K A;  4EC3 A;  3S1D A;  1FFV C;  1T3Q C;  2GQT A;  2P13 A;  4PWB A;  4JB1 A;  5I1W A;  3PM9 A;  5L6F A;  5HMR A;  1E0Y A;  2VFR A;  3DED A;  3PQB A;  3NVW B;  1UXY A;  2NQW A;  2AXR A;  2P3H A;  3D2J A;  3C0P A;  3BW7 A;  4PVE A;  4BBY A;  4ML8 A;  2QKN A;  1FFU C;  1ZR6 A;  1E8H A;  3NRZ B;  2UUU A;  1AHU A;  3HSU A;  4HG0 A;  3GSY A;  4PVK A;  3SR6 B;  5HHZ A;  2BVH A;  1WVF A;  3HRD C;  2GQU A;  5AE2 A;  2VAO A;  4DNS A;  1HSK A;  2W3S A;  2PLS A;  1DII A;  5G5H B;  4PVH A;  3RJA A;  1MBB A;  2BVF A;  2VFT A;  5FXD A;  5G5G B;  3FW7 A;  5D79 A;  2EXR A;  1WYG A;  3NVV B;  4PVJ A;  3TX1 A;  1JRO A;  3I99 A;  4BCA A;  5FXP A;  2W3R A;  1DZN A;  5AE3 A;  3TSH A;  3VTE A;  1RM6 B;  2WDW A;  2QPM A; 
#chains in the Genus database with same CATH homology
 5FXF A;  1VDV A;  1VAO A;  4O95 A;  3W8Z A;  5L6G A;  1N61 C;  1MBT A;  4JAY A;  1AHZ A;  1SB3 B;  2O3G A;  3LLB A;  5K8E A;  3KJM A;  2W54 A;  2Y08 A;  1DIQ A;  3EUB 3;  1QLT A;  1N5X A;  4PYT A;  4BC9 A;  2Y3S A;  2E3T A;  3NVZ B;  1N60 C;  3NVY B;  3FW8 A;  2VFV A;  3AM9 A;  1AHV A;  3S1F A;  1W1M A;  1N62 C;  3JS8 A;  3POP A;  4ZOH B;  2W55 A;  1E8G A;  1E8F A;  3FWA A;  1F0X A;  5AWV A;  2Q85 A;  2OAI A;  3DQ0 A;  3AMZ A;  3TSJ A;  5HQX A;  1FO4 A;  4XLO A;  3S1E A;  3B9J B;  1W1Q A;  2PLI A;  1QLU A;  4BC7 A;  1FIQ B;  3S1C A;  4PWC A;  1WVE A;  3RJ8 A;  2Y4G A;  3NS1 B;  3W8X A;  2Y3R A;  4UD8 A;  4MLA A;  3LAE A;  2I0K A;  1JRP A;  1I19 A;  2YVS A;  1W1R A;  3AN1 A;  1V97 A;  5FXE A;  1W1J A;  1W1L A;  2UUV A;  4OAL A;  2R2Z A;  2VFU A;  2BVG A;  3W8W A;  2IPI A;  1ZXI C;  5I1V A;  2P4P A;  1W1O A;  2Q4W A;  2R8D A;  5ADZ A;  2MBR A;  1W1S A;  3D2H A;  2VFS A;  3FW9 A;  3ETR B;  4PZF A;  5AE1 A;  1N5W C;  2RK5 A;  3D2D A;  1N63 C;  1W1K A;  4EC3 A;  3S1D A;  1FFV C;  1T3Q C;  2GQT A;  2P13 A;  4PWB A;  4JB1 A;  5I1W A;  3PM9 A;  5L6F A;  5HMR A;  1E0Y A;  2VFR A;  3DED A;  3PQB A;  3NVW B;  1UXY A;  2NQW A;  2AXR A;  2P3H A;  3D2J A;  3C0P A;  3BW7 A;  4PVE A;  4BBY A;  4ML8 A;  2QKN A;  1FFU C;  1ZR6 A;  1E8H A;  3NRZ B;  2UUU A;  1AHU A;  3HSU A;  4HG0 A;  3GSY A;  4PVK A;  3SR6 B;  5HHZ A;  2BVH A;  1WVF A;  3HRD C;  2GQU A;  5AE2 A;  2VAO A;  4DNS A;  1HSK A;  2W3S A;  2PLS A;  1DII A;  5G5H B;  4PVH A;  3RJA A;  1MBB A;  2BVF A;  2VFT A;  5FXD A;  5G5G B;  3FW7 A;  5D79 A;  2EXR A;  1WYG A;  3NVV B;  4PVJ A;  3TX1 A;  1JRO A;  3I99 A;  4BCA A;  5FXP A;  2W3R A;  1DZN A;  5AE3 A;  3TSH A;  3VTE A;  1RM6 B;  2WDW A;  2QPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...