2WDWA

The native crystal structure of the primary hexose oxidase (dbv29) in antibiotic a40926 biosynthesis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PUTATIVE HEXOSE OXIDASE
publication title Interception of Teicoplanin Oxidation Intermediates Yields New Antimicrobial Scaffolds
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
total genus 139
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 1.1.3.13: Alcohol oxidase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2wdwA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2wdwA02
3D2DA 3POPA 5D79A 3W8WA 2BVGA 4PWBA 2Y3SA 3W8XA 5AWVA 2UUUA 5K8EA 3HSUA 3FWAA 3TSHA 5L6GA 2Y4GA 1ZR6A 2AXRA 4PWCA 3RJ8A 3PQBA 4PVJA 3FW7A 2WDWA 3D2HA 3GSYA 4UD8A 3RJAA 3W8ZA 4PZFA 5I1VA 5I1WA 3FW8A 2BVFA 4PVKA 2UUVA 2BVHA 4EC3A 4PVHA 4PVEA 3D2JA 2Y08A 2IPIA 4DNSA 3FW9A 2Y3RA 3VTEA 4XLOA 3TSJA 5L6FA
chains in the Genus database with same CATH superfamily
3I99A 1N63C 1I19A 4O95A 1W1QA 1MBBA 2RK5A 2UUUA 5AWVA 4BC9A 5K8EA 1VDVA 1W1OA 1ZR6A 4JAYA 3PQBA 1JROA 1F0XA 4ZOHB 3AM9A 3S1DA 1DIIA 2WDWA 3NVZB 3TX1A 1HSKA 3GSYA 2R8DA 1V97A 3PM9A 2QPMA 3LLBA 3W8ZA 5I1VA 4HG0A 3FW8A 4PVKA 2UUVA 4EC3A 1W1KA 1SB3B 2W3RA 3HRDC 4BC7A 1MBTA 5G5GB 3BW7A 3NS1B 1N60C 3NVYB 3TSJA 1W1SA 5FXEA 1E0YA 1W1RA 1N61C 5D79A 1W1MA 3AMZA 4PWBA 3W8XA 5HMRA 1FFUC 4ML8A 3TSHA 5ADZA 2AXRA 4PWCA 5HQXA 1WVEA 2VFUA 2Q85A 1T3QC 4MLAA 1WYGA 1N5XA 2PLIA 4BCAA 3NRZB 3DQ0A 2VFSA 2BVHA 2P13A 2QKNA 4PVEA 3D2JA 2MBRA 2W3SA 2P4PA 2R2ZA 2Y3RA 5G5HB 1AHZA 3D2DA 1AHUA 3POPA 1RM6B 2P3HA 3DEDA 3LAEA 3W8WA 2Y3SA 1W1JA 1UXYA 2VFRA 1QLUA 2EXRA 3FWAA 2O3GA 2OAIA 3RJ8A 4PVJA 3AN1A 5FXFA 4JB1A 3D2HA 1E8HA 2GQTA 5FXPA 3EUB3 2VFTA 1FO4A 2BVFA 2YVSA 3SR6B 3S1FA 3B9JB 4PVHA 1FFVC 5AE3A 4BBYA 1W1LA 2Y08A 2IPIA 4DNSA 1DZNA 1WVFA 3ETRB 5AE1A 3JS8A 5L6FA 2NQWA 1E8GA 2PLSA 4OALA 2BVGA 2W55A 1QLTA 3HSUA 1VAOA 2Y4GA 5L6GA 1FIQB 2E3TA 3C0PA 3FW7A 1N62C 1N5WC 2VFVA 2VAOA 5FXDA 1JRPA 4UD8A 3RJAA 4PZFA 5I1WA 2I0KA 4PYTA 1ZXIC 1DIQA 3S1EA 4XLOA 2Q4WA 2W54A 1E8FA 3FW9A 3NVVB 3NVWB 5AE2A 3KJMA 1AHVA 3VTEA 3S1CA 5HHZA 2GQUA
chains in the Genus database with same CATH topology
3I99A 1N63C 1I19A 4O95A 1W1QA 1MBBA 2RK5A 2UUUA 5AWVA 4BC9A 5K8EA 1VDVA 1W1OA 1ZR6A 4JAYA 3PQBA 1JROA 1F0XA 4ZOHB 3AM9A 3S1DA 1DIIA 2WDWA 3NVZB 3TX1A 1HSKA 3GSYA 2R8DA 1V97A 3PM9A 2QPMA 3LLBA 3W8ZA 5I1VA 4HG0A 3FW8A 4PVKA 2UUVA 4EC3A 1W1KA 1SB3B 2W3RA 3HRDC 4BC7A 1MBTA 5G5GB 3BW7A 3NS1B 1N60C 3NVYB 3TSJA 1W1SA 5FXEA 1E0YA 1W1RA 1N61C 5D79A 1W1MA 3AMZA 4PWBA 3W8XA 5HMRA 1FFUC 4ML8A 3TSHA 5ADZA 2AXRA 4PWCA 5HQXA 1WVEA 2VFUA 2Q85A 1T3QC 4MLAA 1WYGA 1N5XA 2PLIA 4BCAA 3NRZB 3DQ0A 2VFSA 2BVHA 2P13A 2QKNA 4PVEA 3D2JA 2MBRA 2W3SA 2P4PA 2R2ZA 2Y3RA 5G5HB 1AHZA 3D2DA 1AHUA 3POPA 1RM6B 2P3HA 3DEDA 3LAEA 3W8WA 2Y3SA 1W1JA 1UXYA 2VFRA 1QLUA 2EXRA 3FWAA 2O3GA 2OAIA 3RJ8A 4PVJA 3AN1A 5FXFA 4JB1A 3D2HA 1E8HA 2GQTA 5FXPA 3EUB3 2VFTA 1FO4A 2BVFA 2YVSA 3SR6B 3S1FA 3B9JB 4PVHA 1FFVC 5AE3A 4BBYA 1W1LA 2Y08A 2IPIA 4DNSA 1DZNA 1WVFA 3ETRB 5AE1A 3JS8A 5L6FA 2NQWA 1E8GA 2PLSA 4OALA 2BVGA 2W55A 1QLTA 3HSUA 1VAOA 2Y4GA 5L6GA 1FIQB 2E3TA 3C0PA 3FW7A 1N62C 1N5WC 2VFVA 2VAOA 5FXDA 1JRPA 4UD8A 3RJAA 4PZFA 5I1WA 2I0KA 4PYTA 1ZXIC 1DIQA 3S1EA 4XLOA 2Q4WA 2W54A 1E8FA 3FW9A 3NVVB 3NVWB 5AE2A 3KJMA 1AHVA 3VTEA 3S1CA 5HHZA 2GQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D2D A;  3POP A;  5D79 A;  3W8W A;  2BVG A;  4PWB A;  2Y3S A;  3W8X A;  5AWV A;  2UUU A;  5K8E A;  3HSU A;  3FWA A;  3TSH A;  5L6G A;  2Y4G A;  1ZR6 A;  2AXR A;  4PWC A;  3RJ8 A;  3PQB A;  4PVJ A;  3FW7 A;  2WDW A;  3D2H A;  3GSY A;  4UD8 A;  3RJA A;  3W8Z A;  4PZF A;  5I1V A;  5I1W A;  3FW8 A;  2BVF A;  4PVK A;  2UUV A;  2BVH A;  4EC3 A;  4PVH A;  4PVE A;  3D2J A;  2Y08 A;  2IPI A;  4DNS A;  3FW9 A;  2Y3R A;  3VTE A;  4XLO A;  3TSJ A;  5L6F A; 
#chains in the Genus database with same CATH topology
 3I99 A;  1N63 C;  1I19 A;  4O95 A;  1W1Q A;  1MBB A;  2RK5 A;  2UUU A;  5AWV A;  4BC9 A;  5K8E A;  1VDV A;  1W1O A;  1ZR6 A;  4JAY A;  3PQB A;  1JRO A;  1F0X A;  4ZOH B;  3AM9 A;  3S1D A;  1DII A;  2WDW A;  3NVZ B;  3TX1 A;  1HSK A;  3GSY A;  2R8D A;  1V97 A;  3PM9 A;  2QPM A;  3LLB A;  3W8Z A;  5I1V A;  4HG0 A;  3FW8 A;  4PVK A;  2UUV A;  4EC3 A;  1W1K A;  1SB3 B;  2W3R A;  3HRD C;  4BC7 A;  1MBT A;  5G5G B;  3BW7 A;  3NS1 B;  1N60 C;  3NVY B;  3TSJ A;  1W1S A;  5FXE A;  1E0Y A;  1W1R A;  1N61 C;  5D79 A;  1W1M A;  3AMZ A;  4PWB A;  3W8X A;  5HMR A;  1FFU C;  4ML8 A;  3TSH A;  5ADZ A;  2AXR A;  4PWC A;  5HQX A;  1WVE A;  2VFU A;  2Q85 A;  1T3Q C;  4MLA A;  1WYG A;  1N5X A;  2PLI A;  4BCA A;  3NRZ B;  3DQ0 A;  2VFS A;  2BVH A;  2P13 A;  2QKN A;  4PVE A;  3D2J A;  2MBR A;  2W3S A;  2P4P A;  2R2Z A;  2Y3R A;  5G5H B;  1AHZ A;  3D2D A;  1AHU A;  3POP A;  1RM6 B;  2P3H A;  3DED A;  3LAE A;  3W8W A;  2Y3S A;  1W1J A;  1UXY A;  2VFR A;  1QLU A;  2EXR A;  3FWA A;  2O3G A;  2OAI A;  3RJ8 A;  4PVJ A;  3AN1 A;  5FXF A;  4JB1 A;  3D2H A;  1E8H A;  2GQT A;  5FXP A;  3EUB 3;  2VFT A;  1FO4 A;  2BVF A;  2YVS A;  3SR6 B;  3S1F A;  3B9J B;  4PVH A;  1FFV C;  5AE3 A;  4BBY A;  1W1L A;  2Y08 A;  2IPI A;  4DNS A;  1DZN A;  1WVF A;  3ETR B;  5AE1 A;  3JS8 A;  5L6F A;  2NQW A;  1E8G A;  2PLS A;  4OAL A;  2BVG A;  2W55 A;  1QLT A;  3HSU A;  1VAO A;  2Y4G A;  5L6G A;  1FIQ B;  2E3T A;  3C0P A;  3FW7 A;  1N62 C;  1N5W C;  2VFV A;  2VAO A;  5FXD A;  1JRP A;  4UD8 A;  3RJA A;  4PZF A;  5I1W A;  2I0K A;  4PYT A;  1ZXI C;  1DIQ A;  3S1E A;  4XLO A;  2Q4W A;  2W54 A;  1E8F A;  3FW9 A;  3NVV B;  3NVW B;  5AE2 A;  3KJM A;  1AHV A;  3VTE A;  3S1C A;  5HHZ A;  2GQU A; 
#chains in the Genus database with same CATH homology
 3I99 A;  1N63 C;  1I19 A;  4O95 A;  1W1Q A;  1MBB A;  2RK5 A;  2UUU A;  5AWV A;  4BC9 A;  5K8E A;  1VDV A;  1W1O A;  1ZR6 A;  4JAY A;  3PQB A;  1JRO A;  1F0X A;  4ZOH B;  3AM9 A;  3S1D A;  1DII A;  2WDW A;  3NVZ B;  3TX1 A;  1HSK A;  3GSY A;  2R8D A;  1V97 A;  3PM9 A;  2QPM A;  3LLB A;  3W8Z A;  5I1V A;  4HG0 A;  3FW8 A;  4PVK A;  2UUV A;  4EC3 A;  1W1K A;  1SB3 B;  2W3R A;  3HRD C;  4BC7 A;  1MBT A;  5G5G B;  3BW7 A;  3NS1 B;  1N60 C;  3NVY B;  3TSJ A;  1W1S A;  5FXE A;  1E0Y A;  1W1R A;  1N61 C;  5D79 A;  1W1M A;  3AMZ A;  4PWB A;  3W8X A;  5HMR A;  1FFU C;  4ML8 A;  3TSH A;  5ADZ A;  2AXR A;  4PWC A;  5HQX A;  1WVE A;  2VFU A;  2Q85 A;  1T3Q C;  4MLA A;  1WYG A;  1N5X A;  2PLI A;  4BCA A;  3NRZ B;  3DQ0 A;  2VFS A;  2BVH A;  2P13 A;  2QKN A;  4PVE A;  3D2J A;  2MBR A;  2W3S A;  2P4P A;  2R2Z A;  2Y3R A;  5G5H B;  1AHZ A;  3D2D A;  1AHU A;  3POP A;  1RM6 B;  2P3H A;  3DED A;  3LAE A;  3W8W A;  2Y3S A;  1W1J A;  1UXY A;  2VFR A;  1QLU A;  2EXR A;  3FWA A;  2O3G A;  2OAI A;  3RJ8 A;  4PVJ A;  3AN1 A;  5FXF A;  4JB1 A;  3D2H A;  1E8H A;  2GQT A;  5FXP A;  3EUB 3;  2VFT A;  1FO4 A;  2BVF A;  2YVS A;  3SR6 B;  3S1F A;  3B9J B;  4PVH A;  1FFV C;  5AE3 A;  4BBY A;  1W1L A;  2Y08 A;  2IPI A;  4DNS A;  1DZN A;  1WVF A;  3ETR B;  5AE1 A;  3JS8 A;  5L6F A;  2NQW A;  1E8G A;  2PLS A;  4OAL A;  2BVG A;  2W55 A;  1QLT A;  3HSU A;  1VAO A;  2Y4G A;  5L6G A;  1FIQ B;  2E3T A;  3C0P A;  3FW7 A;  1N62 C;  1N5W C;  2VFV A;  2VAO A;  5FXD A;  1JRP A;  4UD8 A;  3RJA A;  4PZF A;  5I1W A;  2I0K A;  4PYT A;  1ZXI C;  1DIQ A;  3S1E A;  4XLO A;  2Q4W A;  2W54 A;  1E8F A;  3FW9 A;  3NVV B;  3NVW B;  5AE2 A;  3KJM A;  1AHV A;  3VTE A;  3S1C A;  5HHZ A;  2GQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...