2WDWA

The native crystal structure of the primary hexose oxidase (dbv29) in antibiotic a40926 biosynthesis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Interception of Teicoplanin Oxidation Intermediates Yields New Antimicrobial Scaffolds
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
molecule tags Oxidoreductase
molecule keywords PUTATIVE HEXOSE OXIDASE
total genus 139
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 1.1.3.13: Alcohol oxidase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2wdwA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2wdwA02
5AWVA 5K8EA 5L6GA 3D2DA 3W8ZA 2IPIA 3TSJA 3FW8A 3GSYA 4UD8A 3VTEA 2UUVA 5I1VA 2AXRA 4PZFA 4XLOA 3FW7A 3PQBA 3W8WA 4DNSA 3RJ8A 3W8XA 3POPA 4PVHA 2UUUA 3FWAA 4PWCA 3HSUA 2BVGA 2Y08A 2Y4GA 2Y3RA 3TSHA 3RJAA 2BVFA 4PVEA 3D2HA 5D79A 4PVKA 4EC3A 2Y3SA 2WDWA 2BVHA 4PWBA 1ZR6A 4PVJA 5L6FA 5I1WA 3D2JA 3FW9A
chains in the Genus database with same CATH superfamily
1HSKA 3PM9A 4JB1A 3C0PA 2QPMA 2VFVA 3TSJA 2QKNA 1AHVA 2O3GA 3VTEA 4ML8A 1UXYA 3RJ8A 3POPA 3EUB3 2UUUA 4PVHA 2GQTA 1QLUA 2PLIA 1T3QC 3FWAA 3NS1B 4PWCA 5ADZA 4JAYA 2VAOA 3TSHA 1E8FA 4HG0A 3NRZB 1VDVA 1W1KA 5D79A 2WDWA 3S1DA 2NQWA 3NVYB 5FXFA 1W1RA 1ZXIC 3S1CA 1JRPA 1V97A 1AHUA 1FFVC 1DIIA 5HHZA 1W1OA 2VFUA 2IPIA 2W3SA 3DEDA 3NVZB 2UUVA 3FW7A 3TX1A 3W8WA 4DNSA 3W8XA 2BVGA 2I0KA 3DQ0A 2P4PA 2VFRA 3AM9A 5AE3A 1N61C 2PLSA 1N5XA 5G5HB 3B9JB 1FIQB 2BVFA 5HMRA 5FXDA 4BBYA 2P13A 3D2HA 4PWBA 4MLAA 4PVJA 1QLTA 3AMZA 3S1EA 5I1WA 2W55A 5AWVA 5K8EA 1WYGA 3D2DA 3BW7A 3W8ZA 1W1QA 5HQXA 4BCAA 3NVWB 5FXPA 3GSYA 2GQUA 5G5GB 4XLOA 4PZFA 5FXEA 5I1VA 4BC7A 1E0YA 3LAEA 1WVEA 1E8HA 3LLBA 1W1MA 1FFUC 1AHZA 2Y4GA 1N62C 2Y3RA 2R8DA 1W1JA 3RJAA 1DIQA 5AE2A 2MBRA 2E3TA 1W1LA 2VFSA 1MBBA 3AN1A 2RK5A 2Y3SA 4EC3A 2BVHA 1ZR6A 2VFTA 1F0XA 2R2ZA 1VAOA 5L6FA 3D2JA 3FW9A 2W3RA 1JROA 1N63C 1RM6B 5L6GA 2P3HA 5AE1A 2YVSA 3FW8A 2Q4WA 3S1FA 1E8GA 4UD8A 3ETRB 1N60C 2AXRA 3PQBA 1WVFA 4ZOHB 3I99A 1I19A 1FO4A 1SB3B 3HSUA 2Q85A 2W54A 2Y08A 1W1SA 3NVVB 2OAIA 1N5WC 3JS8A 4PVEA 3KJMA 3HRDC 1DZNA 3SR6B 4PVKA 4BC9A 4O95A 1MBTA 4OALA 4PYTA 2EXRA
chains in the Genus database with same CATH topology
1HSKA 3PM9A 4JB1A 3C0PA 2QPMA 2VFVA 3TSJA 2QKNA 1AHVA 2O3GA 3VTEA 4ML8A 1UXYA 3RJ8A 3POPA 3EUB3 2UUUA 4PVHA 2GQTA 1QLUA 2PLIA 1T3QC 3FWAA 3NS1B 4PWCA 5ADZA 4JAYA 2VAOA 3TSHA 1E8FA 4HG0A 3NRZB 1VDVA 1W1KA 5D79A 2WDWA 3S1DA 2NQWA 3NVYB 5FXFA 1W1RA 1ZXIC 3S1CA 1JRPA 1V97A 1AHUA 1FFVC 1DIIA 5HHZA 1W1OA 2VFUA 2IPIA 2W3SA 3DEDA 3NVZB 2UUVA 3FW7A 3TX1A 3W8WA 4DNSA 3W8XA 2BVGA 2I0KA 3DQ0A 2P4PA 2VFRA 3AM9A 5AE3A 1N61C 2PLSA 1N5XA 5G5HB 3B9JB 1FIQB 2BVFA 5HMRA 5FXDA 4BBYA 2P13A 3D2HA 4PWBA 4MLAA 4PVJA 1QLTA 3AMZA 3S1EA 5I1WA 2W55A 5AWVA 5K8EA 1WYGA 3D2DA 3BW7A 3W8ZA 1W1QA 5HQXA 4BCAA 3NVWB 5FXPA 3GSYA 2GQUA 5G5GB 4XLOA 4PZFA 5FXEA 5I1VA 4BC7A 1E0YA 3LAEA 1WVEA 1E8HA 3LLBA 1W1MA 1FFUC 1AHZA 2Y4GA 1N62C 2Y3RA 2R8DA 1W1JA 3RJAA 1DIQA 5AE2A 2MBRA 2E3TA 1W1LA 2VFSA 1MBBA 3AN1A 2RK5A 2Y3SA 4EC3A 2BVHA 1ZR6A 2VFTA 1F0XA 2R2ZA 1VAOA 5L6FA 3D2JA 3FW9A 2W3RA 1JROA 1N63C 1RM6B 5L6GA 2P3HA 5AE1A 2YVSA 3FW8A 2Q4WA 3S1FA 1E8GA 4UD8A 3ETRB 1N60C 2AXRA 3PQBA 1WVFA 4ZOHB 3I99A 1I19A 1FO4A 1SB3B 3HSUA 2Q85A 2W54A 2Y08A 1W1SA 3NVVB 2OAIA 1N5WC 3JS8A 4PVEA 3KJMA 3HRDC 1DZNA 3SR6B 4PVKA 4BC9A 4O95A 1MBTA 4OALA 4PYTA 2EXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AWV A;  5K8E A;  5L6G A;  3D2D A;  3W8Z A;  2IPI A;  3TSJ A;  3FW8 A;  3GSY A;  4UD8 A;  3VTE A;  2UUV A;  5I1V A;  2AXR A;  4PZF A;  4XLO A;  3FW7 A;  3PQB A;  3W8W A;  4DNS A;  3RJ8 A;  3W8X A;  3POP A;  4PVH A;  2UUU A;  3FWA A;  4PWC A;  3HSU A;  2BVG A;  2Y08 A;  2Y4G A;  2Y3R A;  3TSH A;  3RJA A;  2BVF A;  4PVE A;  3D2H A;  5D79 A;  4PVK A;  4EC3 A;  2Y3S A;  2WDW A;  2BVH A;  4PWB A;  1ZR6 A;  4PVJ A;  5L6F A;  5I1W A;  3D2J A;  3FW9 A; 
#chains in the Genus database with same CATH topology
 1HSK A;  3PM9 A;  4JB1 A;  3C0P A;  2QPM A;  2VFV A;  3TSJ A;  2QKN A;  1AHV A;  2O3G A;  3VTE A;  4ML8 A;  1UXY A;  3RJ8 A;  3POP A;  3EUB 3;  2UUU A;  4PVH A;  2GQT A;  1QLU A;  2PLI A;  1T3Q C;  3FWA A;  3NS1 B;  4PWC A;  5ADZ A;  4JAY A;  2VAO A;  3TSH A;  1E8F A;  4HG0 A;  3NRZ B;  1VDV A;  1W1K A;  5D79 A;  2WDW A;  3S1D A;  2NQW A;  3NVY B;  5FXF A;  1W1R A;  1ZXI C;  3S1C A;  1JRP A;  1V97 A;  1AHU A;  1FFV C;  1DII A;  5HHZ A;  1W1O A;  2VFU A;  2IPI A;  2W3S A;  3DED A;  3NVZ B;  2UUV A;  3FW7 A;  3TX1 A;  3W8W A;  4DNS A;  3W8X A;  2BVG A;  2I0K A;  3DQ0 A;  2P4P A;  2VFR A;  3AM9 A;  5AE3 A;  1N61 C;  2PLS A;  1N5X A;  5G5H B;  3B9J B;  1FIQ B;  2BVF A;  5HMR A;  5FXD A;  4BBY A;  2P13 A;  3D2H A;  4PWB A;  4MLA A;  4PVJ A;  1QLT A;  3AMZ A;  3S1E A;  5I1W A;  2W55 A;  5AWV A;  5K8E A;  1WYG A;  3D2D A;  3BW7 A;  3W8Z A;  1W1Q A;  5HQX A;  4BCA A;  3NVW B;  5FXP A;  3GSY A;  2GQU A;  5G5G B;  4XLO A;  4PZF A;  5FXE A;  5I1V A;  4BC7 A;  1E0Y A;  3LAE A;  1WVE A;  1E8H A;  3LLB A;  1W1M A;  1FFU C;  1AHZ A;  2Y4G A;  1N62 C;  2Y3R A;  2R8D A;  1W1J A;  3RJA A;  1DIQ A;  5AE2 A;  2MBR A;  2E3T A;  1W1L A;  2VFS A;  1MBB A;  3AN1 A;  2RK5 A;  2Y3S A;  4EC3 A;  2BVH A;  1ZR6 A;  2VFT A;  1F0X A;  2R2Z A;  1VAO A;  5L6F A;  3D2J A;  3FW9 A;  2W3R A;  1JRO A;  1N63 C;  1RM6 B;  5L6G A;  2P3H A;  5AE1 A;  2YVS A;  3FW8 A;  2Q4W A;  3S1F A;  1E8G A;  4UD8 A;  3ETR B;  1N60 C;  2AXR A;  3PQB A;  1WVF A;  4ZOH B;  3I99 A;  1I19 A;  1FO4 A;  1SB3 B;  3HSU A;  2Q85 A;  2W54 A;  2Y08 A;  1W1S A;  3NVV B;  2OAI A;  1N5W C;  3JS8 A;  4PVE A;  3KJM A;  3HRD C;  1DZN A;  3SR6 B;  4PVK A;  4BC9 A;  4O95 A;  1MBT A;  4OAL A;  4PYT A;  2EXR A; 
#chains in the Genus database with same CATH homology
 1HSK A;  3PM9 A;  4JB1 A;  3C0P A;  2QPM A;  2VFV A;  3TSJ A;  2QKN A;  1AHV A;  2O3G A;  3VTE A;  4ML8 A;  1UXY A;  3RJ8 A;  3POP A;  3EUB 3;  2UUU A;  4PVH A;  2GQT A;  1QLU A;  2PLI A;  1T3Q C;  3FWA A;  3NS1 B;  4PWC A;  5ADZ A;  4JAY A;  2VAO A;  3TSH A;  1E8F A;  4HG0 A;  3NRZ B;  1VDV A;  1W1K A;  5D79 A;  2WDW A;  3S1D A;  2NQW A;  3NVY B;  5FXF A;  1W1R A;  1ZXI C;  3S1C A;  1JRP A;  1V97 A;  1AHU A;  1FFV C;  1DII A;  5HHZ A;  1W1O A;  2VFU A;  2IPI A;  2W3S A;  3DED A;  3NVZ B;  2UUV A;  3FW7 A;  3TX1 A;  3W8W A;  4DNS A;  3W8X A;  2BVG A;  2I0K A;  3DQ0 A;  2P4P A;  2VFR A;  3AM9 A;  5AE3 A;  1N61 C;  2PLS A;  1N5X A;  5G5H B;  3B9J B;  1FIQ B;  2BVF A;  5HMR A;  5FXD A;  4BBY A;  2P13 A;  3D2H A;  4PWB A;  4MLA A;  4PVJ A;  1QLT A;  3AMZ A;  3S1E A;  5I1W A;  2W55 A;  5AWV A;  5K8E A;  1WYG A;  3D2D A;  3BW7 A;  3W8Z A;  1W1Q A;  5HQX A;  4BCA A;  3NVW B;  5FXP A;  3GSY A;  2GQU A;  5G5G B;  4XLO A;  4PZF A;  5FXE A;  5I1V A;  4BC7 A;  1E0Y A;  3LAE A;  1WVE A;  1E8H A;  3LLB A;  1W1M A;  1FFU C;  1AHZ A;  2Y4G A;  1N62 C;  2Y3R A;  2R8D A;  1W1J A;  3RJA A;  1DIQ A;  5AE2 A;  2MBR A;  2E3T A;  1W1L A;  2VFS A;  1MBB A;  3AN1 A;  2RK5 A;  2Y3S A;  4EC3 A;  2BVH A;  1ZR6 A;  2VFT A;  1F0X A;  2R2Z A;  1VAO A;  5L6F A;  3D2J A;  3FW9 A;  2W3R A;  1JRO A;  1N63 C;  1RM6 B;  5L6G A;  2P3H A;  5AE1 A;  2YVS A;  3FW8 A;  2Q4W A;  3S1F A;  1E8G A;  4UD8 A;  3ETR B;  1N60 C;  2AXR A;  3PQB A;  1WVF A;  4ZOH B;  3I99 A;  1I19 A;  1FO4 A;  1SB3 B;  3HSU A;  2Q85 A;  2W54 A;  2Y08 A;  1W1S A;  3NVV B;  2OAI A;  1N5W C;  3JS8 A;  4PVE A;  3KJM A;  3HRD C;  1DZN A;  3SR6 B;  4PVK A;  4BC9 A;  4O95 A;  1MBT A;  4OAL A;  4PYT A;  2EXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...