2WDWA

The native crystal structure of the primary hexose oxidase (dbv29) in antibiotic a40926 biosynthesis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PUTATIVE HEXOSE OXIDASE
publication title Interception of Teicoplanin Oxidation Intermediates Yields New Antimicrobial Scaffolds
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
molecule tags Oxidoreductase
total genus 139
structure length 498
sequence length 498
chains with identical sequence B
ec nomenclature ec 1.1.3.13: Alcohol oxidase.
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2wdwA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 2wdwA02
2Y3SA 2UUVA 1ZR6A 3FW9A 3W8WA 3PQBA 5AWVA 2BVGA 3W8ZA 3D2JA 4DNSA 3FWAA 3VTEA 3FW7A 3RJ8A 4PWCA 4XLOA 2BVHA 5L6FA 5L6GA 2Y3RA 3RJAA 3TSHA 4PVJA 5I1WA 2UUUA 3D2HA 3D2DA 3FW8A 4PVKA 4PVEA 5I1VA 3GSYA 3TSJA 5D79A 2BVFA 2IPIA 4EC3A 2AXRA 4UD8A 2Y4GA 2WDWA 4PWBA 3POPA 4PVHA 3HSUA 4PZFA 2Y08A 5K8EA 3W8XA
chains in the Genus database with same CATH superfamily
3B9JB 4O95A 2UUVA 1ZR6A 1N5WC 3PQBA 3AMZA 2BVGA 2W3RA 1W1OA 3FWAA 4ML8A 3S1EA 4BCAA 1SB3B 2BVHA 3S1CA 2RK5A 5HQXA 5HMRA 4PVJA 2UUUA 3PM9A 5FXEA 2Q85A 2Q4WA 1AHZA 4PVEA 3LAEA 1N61C 2VFSA 3S1DA 5HHZA 2YVSA 2W3SA 4OALA 3AN1A 4UD8A 5AE3A 2GQUA 2VFTA 1E8HA 1WVEA 2VFUA 3POPA 5AE2A 2O3GA 2P3HA 3C0PA 3HSUA 3NVYB 3NVZB 5K8EA 1FO4A 1E8GA 5AE1A 1W1MA 1DZNA 3W8ZA 4DNSA 3VTEA 1N5XA 3RJ8A 4XLOA 1HSKA 3NS1B 2Y3RA 3DQ0A 1N62C 3D2DA 4HG0A 2W54A 3GSYA 1ZXIC 2BVFA 2IPIA 2PLIA 2QKNA 3LLBA 1QLUA 2GQTA 2R2ZA 3KJMA 4JAYA 4BBYA 1W1LA 3NVVB 2PLSA 2Y3SA 3BW7A 2E3TA 1W1QA 3W8WA 1WVFA 5FXDA 5AWVA 3S1FA 1W1RA 3D2JA 3AM9A 1QLTA 1AHUA 3FW7A 4PWCA 5G5HB 1W1JA 5L6FA 5L6GA 1V97A 3RJAA 4JB1A 4PYTA 3DEDA 3TSHA 1FIQB 3TX1A 5I1WA 1N63C 2I0KA 3FW8A 4BC9A 3HRDC 5G5GB 3TSJA 1WYGA 1FFVC 1N60C 5FXFA 3NVWB 1FFUC 2AXRA 1F0XA 2NQWA 2Y4GA 1W1KA 5FXPA 4PVHA 4PZFA 1T3QC 2P4PA 3W8XA 3ETRB 3FW9A 2MBRA 1JRPA 4ZOHB 4MLAA 1VDVA 1RM6B 2EXRA 1DIQA 1VAOA 3SR6B 4BC7A 3JS8A 2R8DA 5ADZA 2OAIA 3D2HA 3I99A 1MBTA 1E0YA 4PVKA 2W55A 3NRZB 5I1VA 1W1SA 1AHVA 5D79A 1I19A 1DIIA 2VFRA 4EC3A 2QPMA 1JROA 1MBBA 1UXYA 3EUB3 2WDWA 4PWBA 2VFVA 2Y08A 2P13A 2VAOA 1E8FA
chains in the Genus database with same CATH topology
3B9JB 4O95A 2UUVA 1ZR6A 1N5WC 3PQBA 3AMZA 2BVGA 2W3RA 1W1OA 3FWAA 4ML8A 3S1EA 4BCAA 1SB3B 2BVHA 3S1CA 2RK5A 5HQXA 5HMRA 4PVJA 2UUUA 3PM9A 5FXEA 2Q85A 2Q4WA 1AHZA 4PVEA 3LAEA 1N61C 2VFSA 3S1DA 5HHZA 2YVSA 2W3SA 4OALA 3AN1A 4UD8A 5AE3A 2GQUA 2VFTA 1E8HA 1WVEA 2VFUA 3POPA 5AE2A 2O3GA 2P3HA 3C0PA 3HSUA 3NVYB 3NVZB 5K8EA 1FO4A 1E8GA 5AE1A 1W1MA 1DZNA 3W8ZA 4DNSA 3VTEA 1N5XA 3RJ8A 4XLOA 1HSKA 3NS1B 2Y3RA 3DQ0A 1N62C 3D2DA 4HG0A 2W54A 3GSYA 1ZXIC 2BVFA 2IPIA 2PLIA 2QKNA 3LLBA 1QLUA 2GQTA 2R2ZA 3KJMA 4JAYA 4BBYA 1W1LA 3NVVB 2PLSA 2Y3SA 3BW7A 2E3TA 1W1QA 3W8WA 1WVFA 5FXDA 5AWVA 3S1FA 1W1RA 3D2JA 3AM9A 1QLTA 1AHUA 3FW7A 4PWCA 5G5HB 1W1JA 5L6FA 5L6GA 1V97A 3RJAA 4JB1A 4PYTA 3DEDA 3TSHA 1FIQB 3TX1A 5I1WA 1N63C 2I0KA 3FW8A 4BC9A 3HRDC 5G5GB 3TSJA 1WYGA 1FFVC 1N60C 5FXFA 3NVWB 1FFUC 2AXRA 1F0XA 2NQWA 2Y4GA 1W1KA 5FXPA 4PVHA 4PZFA 1T3QC 2P4PA 3W8XA 3ETRB 3FW9A 2MBRA 1JRPA 4ZOHB 4MLAA 1VDVA 1RM6B 2EXRA 1DIQA 1VAOA 3SR6B 4BC7A 3JS8A 2R8DA 5ADZA 2OAIA 3D2HA 3I99A 1MBTA 1E0YA 4PVKA 2W55A 3NRZB 5I1VA 1W1SA 1AHVA 5D79A 1I19A 1DIIA 2VFRA 4EC3A 2QPMA 1JROA 1MBBA 1UXYA 3EUB3 2WDWA 4PWBA 2VFVA 2Y08A 2P13A 2VAOA 1E8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y3S A;  2UUV A;  1ZR6 A;  3FW9 A;  3W8W A;  3PQB A;  5AWV A;  2BVG A;  3W8Z A;  3D2J A;  4DNS A;  3FWA A;  3VTE A;  3FW7 A;  3RJ8 A;  4PWC A;  4XLO A;  2BVH A;  5L6F A;  5L6G A;  2Y3R A;  3RJA A;  3TSH A;  4PVJ A;  5I1W A;  2UUU A;  3D2H A;  3D2D A;  3FW8 A;  4PVK A;  4PVE A;  5I1V A;  3GSY A;  3TSJ A;  5D79 A;  2BVF A;  2IPI A;  4EC3 A;  2AXR A;  4UD8 A;  2Y4G A;  2WDW A;  4PWB A;  3POP A;  4PVH A;  3HSU A;  4PZF A;  2Y08 A;  5K8E A;  3W8X A; 
#chains in the Genus database with same CATH topology
 3B9J B;  4O95 A;  2UUV A;  1ZR6 A;  1N5W C;  3PQB A;  3AMZ A;  2BVG A;  2W3R A;  1W1O A;  3FWA A;  4ML8 A;  3S1E A;  4BCA A;  1SB3 B;  2BVH A;  3S1C A;  2RK5 A;  5HQX A;  5HMR A;  4PVJ A;  2UUU A;  3PM9 A;  5FXE A;  2Q85 A;  2Q4W A;  1AHZ A;  4PVE A;  3LAE A;  1N61 C;  2VFS A;  3S1D A;  5HHZ A;  2YVS A;  2W3S A;  4OAL A;  3AN1 A;  4UD8 A;  5AE3 A;  2GQU A;  2VFT A;  1E8H A;  1WVE A;  2VFU A;  3POP A;  5AE2 A;  2O3G A;  2P3H A;  3C0P A;  3HSU A;  3NVY B;  3NVZ B;  5K8E A;  1FO4 A;  1E8G A;  5AE1 A;  1W1M A;  1DZN A;  3W8Z A;  4DNS A;  3VTE A;  1N5X A;  3RJ8 A;  4XLO A;  1HSK A;  3NS1 B;  2Y3R A;  3DQ0 A;  1N62 C;  3D2D A;  4HG0 A;  2W54 A;  3GSY A;  1ZXI C;  2BVF A;  2IPI A;  2PLI A;  2QKN A;  3LLB A;  1QLU A;  2GQT A;  2R2Z A;  3KJM A;  4JAY A;  4BBY A;  1W1L A;  3NVV B;  2PLS A;  2Y3S A;  3BW7 A;  2E3T A;  1W1Q A;  3W8W A;  1WVF A;  5FXD A;  5AWV A;  3S1F A;  1W1R A;  3D2J A;  3AM9 A;  1QLT A;  1AHU A;  3FW7 A;  4PWC A;  5G5H B;  1W1J A;  5L6F A;  5L6G A;  1V97 A;  3RJA A;  4JB1 A;  4PYT A;  3DED A;  3TSH A;  1FIQ B;  3TX1 A;  5I1W A;  1N63 C;  2I0K A;  3FW8 A;  4BC9 A;  3HRD C;  5G5G B;  3TSJ A;  1WYG A;  1FFV C;  1N60 C;  5FXF A;  3NVW B;  1FFU C;  2AXR A;  1F0X A;  2NQW A;  2Y4G A;  1W1K A;  5FXP A;  4PVH A;  4PZF A;  1T3Q C;  2P4P A;  3W8X A;  3ETR B;  3FW9 A;  2MBR A;  1JRP A;  4ZOH B;  4MLA A;  1VDV A;  1RM6 B;  2EXR A;  1DIQ A;  1VAO A;  3SR6 B;  4BC7 A;  3JS8 A;  2R8D A;  5ADZ A;  2OAI A;  3D2H A;  3I99 A;  1MBT A;  1E0Y A;  4PVK A;  2W55 A;  3NRZ B;  5I1V A;  1W1S A;  1AHV A;  5D79 A;  1I19 A;  1DII A;  2VFR A;  4EC3 A;  2QPM A;  1JRO A;  1MBB A;  1UXY A;  3EUB 3;  2WDW A;  4PWB A;  2VFV A;  2Y08 A;  2P13 A;  2VAO A;  1E8F A; 
#chains in the Genus database with same CATH homology
 3B9J B;  4O95 A;  2UUV A;  1ZR6 A;  1N5W C;  3PQB A;  3AMZ A;  2BVG A;  2W3R A;  1W1O A;  3FWA A;  4ML8 A;  3S1E A;  4BCA A;  1SB3 B;  2BVH A;  3S1C A;  2RK5 A;  5HQX A;  5HMR A;  4PVJ A;  2UUU A;  3PM9 A;  5FXE A;  2Q85 A;  2Q4W A;  1AHZ A;  4PVE A;  3LAE A;  1N61 C;  2VFS A;  3S1D A;  5HHZ A;  2YVS A;  2W3S A;  4OAL A;  3AN1 A;  4UD8 A;  5AE3 A;  2GQU A;  2VFT A;  1E8H A;  1WVE A;  2VFU A;  3POP A;  5AE2 A;  2O3G A;  2P3H A;  3C0P A;  3HSU A;  3NVY B;  3NVZ B;  5K8E A;  1FO4 A;  1E8G A;  5AE1 A;  1W1M A;  1DZN A;  3W8Z A;  4DNS A;  3VTE A;  1N5X A;  3RJ8 A;  4XLO A;  1HSK A;  3NS1 B;  2Y3R A;  3DQ0 A;  1N62 C;  3D2D A;  4HG0 A;  2W54 A;  3GSY A;  1ZXI C;  2BVF A;  2IPI A;  2PLI A;  2QKN A;  3LLB A;  1QLU A;  2GQT A;  2R2Z A;  3KJM A;  4JAY A;  4BBY A;  1W1L A;  3NVV B;  2PLS A;  2Y3S A;  3BW7 A;  2E3T A;  1W1Q A;  3W8W A;  1WVF A;  5FXD A;  5AWV A;  3S1F A;  1W1R A;  3D2J A;  3AM9 A;  1QLT A;  1AHU A;  3FW7 A;  4PWC A;  5G5H B;  1W1J A;  5L6F A;  5L6G A;  1V97 A;  3RJA A;  4JB1 A;  4PYT A;  3DED A;  3TSH A;  1FIQ B;  3TX1 A;  5I1W A;  1N63 C;  2I0K A;  3FW8 A;  4BC9 A;  3HRD C;  5G5G B;  3TSJ A;  1WYG A;  1FFV C;  1N60 C;  5FXF A;  3NVW B;  1FFU C;  2AXR A;  1F0X A;  2NQW A;  2Y4G A;  1W1K A;  5FXP A;  4PVH A;  4PZF A;  1T3Q C;  2P4P A;  3W8X A;  3ETR B;  3FW9 A;  2MBR A;  1JRP A;  4ZOH B;  4MLA A;  1VDV A;  1RM6 B;  2EXR A;  1DIQ A;  1VAO A;  3SR6 B;  4BC7 A;  3JS8 A;  2R8D A;  5ADZ A;  2OAI A;  3D2H A;  3I99 A;  1MBT A;  1E0Y A;  4PVK A;  2W55 A;  3NRZ B;  5I1V A;  1W1S A;  1AHV A;  5D79 A;  1I19 A;  1DII A;  2VFR A;  4EC3 A;  2QPM A;  1JRO A;  1MBB A;  1UXY A;  3EUB 3;  2WDW A;  4PWB A;  2VFV A;  2Y08 A;  2P13 A;  2VAO A;  1E8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...