2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
4C7YA 3AE2B 1NVID 2DWQA 3SR6B 3NVZB 2BS2B 2L83A 1W1QA 3A7UA 1QLBB 2O3GA 3B9JA 3AM9A 3W5VB 2VFVA 2Q5WD 3ZYYX 1ZP0B 4YSXB 4HG0A 2OAIA 2MBRA 1EWYC 4PVKA 1J7BA 1KRHA 2WDRB 1W1SA 1VJKA 1WVEA 2G1EA 5EE9A 4ITKA 2R2ZA 3AE8B 4YXDB 4IDIA 1VAOA 3ABVB 4JX1C 1N63A 2N0SB 1QOAA 2HTME 3AEEB 4YTMB 1FRRA 3FW9A 3DQ0A 3AB5A 1A70A 5H8YE 1X2GA 3KWLA 5ADZA 4ZHOA 3VRBB 1DIIA 3W9CB 1JQ4A 1OQRA 1N62C 1FFVA 3NVYB 5G5GB 2K9XA 3W5UB 2L52A 1N61A 4UD8A 3VRAB 1FFVC 3P4RB 3VR9B 2I0KA 4C7ZA 3NS1B 3B2FA 1DOXA 1GPXA 2QKNA 3JS8A 5AE1A 3LLBA 3VTEA 2GQUA 2K5PA 1W1LA 5EE1A 3WCQA 4PWBA 5HQXA 3B2GA 2WDQB 1N63C 2EKIA 2H89B 3AE1B 1JWAD 3S1DA 4JB1A 2NQWA 3NVWA 1PUTA 3TSHA 3AE7B 2P4PA 1E8FA 3I99A 4PVHA 5GXGB 2AX5A 1N5WA 1UXYA 4XLOA 1JALA 1N60A 1AHVA 1DOIA 1JRPA 1FXAA 4FXCA 2JQRB 5C2TB 1E9MA 3AMZA 3AEFB 3HUIA 3SFEB 2CJOA 3S1CA 5C3JB 2W55A 4OALA 2R8DA 4HRSA 1AHUA 4US9A 2WQYB 3TX1A 4N6EB 1N62A 2MH7A 1QOGA 3NS1A 1W1RA 1SB3C 3P4SB 1E8HA 2E5AA 3L4PA 1NI3A 1WWTA 2BS4B 1YJIA 1SB3B 3EUB3 4TVWA 1XLQA 3NVVA 1TYGB 2WDVB 3PM9A 4BCAA 1OQQA 3AEGB 2CU3A 1NYRA 1QLTA 1N5XA 4KX6B 1MBTA 2MJDA 1WXQA 2WU2B 1TKGA 1E6EB 2WLBA 3LXFA 4PVEA 2EXRA 1YJJA 1R7SA 2WS3B 1NEKB 5G5GA 3HVZA 3NVYA 2M56B 4BBYA 1KFYB 1FFUA 1VDVA 2VFUA 4PVJA 1JROA 1FMAD 2KMMA 1FO4A 1RYJA 4WWMA 1DZNA 4PYTA 1CJEA 1W1MA 1DGJA 4LTUA 1UWMA 2Q85A 1RM6B 3AEBB 4ZOHB 2MJ3A 1ZXIA 1PDXA 1FM0D 4YSZB 5FXDA 4MLAA 3CWIA 1OFFA 1PFDA 1AHZA 3ETRA 2BS3B 2Y5CA 4JWUC 2KAJA 3GSYA 3BIID 1N61C 4C80A 5G5HB 1E7PB 3SFDB 1XLPA 2JX5A 1SIJA 1NYQA 1GAQB 1X2HA 3FW7A 4USAA 3DWMA 1N5WC 2WU5B 1L6UA 4P6VF 1YQ3B 3NVZA 1VQZA 4ZOHC 2VAOA 3ETRB 4EC3A 2P13A 2ACZB 1CZPA 5MPOA 1QOFA 1JW9D 2P3HA 3AEDB 4JWSC 1FRDA 2VFRA 3CIRB 3AE9B 2GQTA 3P4QB 5FXEA 5FXPA 2PKOA 1TKEA 2BVHA 1XO3A 1QLUA 2AXRA 3NVVB 1L0VB 1IUEA 1MBBA 2BVFA 2BVGA 2W54A 2RK5A 1FXIA 4YTNB 3P63A 4JAYA 5HMRA 1XLNA 1E0YA 2DBYA 2PLSA 4PZFA 3D2JA 3AH7A 2QIEB 1JWBD 4BC7A 3W8ZA 1ZOYB 2QJLA 1V8CA 1TJEA 1AYFA 2BT6A 2PVGC 4N58A 3P4PB 1W1JA 2K22A 3P1MA 3AE5B 1J7AA 4HROA 1QF6A 1W1OA 5FXFA 2E3TA 3NRZA 2W3RA 3HRDC 2W3SA 4ML8A 4O95A 3LAEA 2YVSA 4WQMA 3BW7A 3B9JB 1ZUD2 3VR8B 2CJNA 1DIQA 2MJEA 3FAHA 5D79A 3SR6A 1T3QC 3D2HA 2PIAA 5H92C 4BC9A 1TKYA 2QPMA 2VFSA 3RPFC 3HRDD 3AV8A 4YTPB 2PLIA 3DEDA 5AE3A 1WRIA 1J7CA 2Q4WA 1HSKA 3R07C 1F0XA 1QOBA 2VFTA 1ZR6A 1F0ZA 2B76B 1WVFA 1N60C 3C0PA 1NENB 2M19A 4DNSA 5EE0A 1L6VA 3EUB2 3W8WA 4YSYB 3NRZB 1I19A 2H88B 2PVOD 3DWGC 1I7HA 1XLOA 3AE4B 1FFUC 1VLBA 5AE2A 1WGKA 3FW8A 3S1EA 4N59A 4TVYA 4PWCA 1E10A 3W8XA 1FIQB 3D2DA 1L5PA 1E8GA 1V97A 1ROEA 3AN1A 1FIQA 1WYGA 2LEKA 5EE3A 1T3QA 2OHFA 3AE6B 3FC4A 4US8A 5AUIA 1SF0A 3LB8C 3PO0A 4YT0B 1RWSA 3A7RA 1AWDA 3TSJA 3S1FA 1W1KA 5HHZA 2FBWB 2WP9B 5AUKA 3AEAB 1RFKA 3NVWB 1YQ4B 5G5HA 1KF6B 4ZHPA 3KJMA 3FWAA 4A9AA 1QT9A 1RM6C 1B9RA 3AE3B 1ZXIC 1E0ZA 1DOYA 3AECB 3A7AA
chains in the Genus database with same CATH superfamily
4O5KA 2QJJA 2FJ6A 2LVOA 4QZIA 2Q4TA 1GRFA 4BKTA 4F4RA 1XO1A 2YVFA 2PMVA 4E4FA 2XNAC 2OO6A 3TQ1A 1NVID 3H7PA 4UB8U 4II3B 4ACFA 1TE6A 4ZH4A 3UI3A 3MFIA 4DSIA 2L83A 4JV1A 2D3CA 1WWVA 1WJUA 1EU4A 1AN8A 1QTMA 2DNFA 4JV0A 4DQQA 2IY1B 4UASA 4AYBF 1QLBB 2MBQA 1L3SA 2XIDA 3RO6A 3H9DA 3ZYYX 3AUOA 2A1AA 4MFCA 4YSXB 2NVUI 1SL2A 1GC7A 1LV5A 1V2YA 3PREA 4W9JA 1EWYC 4NQKE 3ZVVA 2MAXA 1W6TA 3ZVHB 3ZLHA 3DGBA 2KWCA 4WJQA 2N9XA 2J42A 4OVVA 5J2GA 4TQ1A 1KRHA 2Z59B 1S8OA 1SKWA 1SGHA 1XD3B 4AUQC 2F5ZA 3IN5A 3V4BA 3M9MB 3SAFA 2LUEA 4IR9A 3T5JA 2XK5A 1FPYA 4NLKA 1GG3A 2ZXIA 1KFSA 1WXSA 1WXMA 3VH4B 5J2AA 4ITKA 3NGDA 1PK1A 2W8KA 2DENB 2Z0EB 3VTUA 5J8YA 2W9CA 3GIMA 1KH0A 3FYHA 3QEBZ 1WJ4A 2JWUA 3EC8A 3PHXB 3W1SC 1ECQA 4F5QA 4IDIA 3H7SA 1V80A 1SWVA 3QNMA 1L4DB 8ICSA 2N9LA 4HJKA 2ZTCA 5AK3A 1QOAA 5FJRA 3FW9A 2YMPA 1ECWA 3EAOA 3TCSA 3O13A 1FCLA 4K3BA 2A1JB 5IINA 9ICPA 5KFBA 1E7VA 1OW5A 2MRLA 3AB5A 4EE2A 4ECSA 3QU4A 2DAFA 1FD6A 2V9HA 1B1ZA 4AS1A 7ICSA 3D2NA 1E8ZA 4MELA 3DH9A 4CE6A 1T4GA 4KKJA 3ZDTA 2WF9A 3PX4A 4DQIA 2BQQA 2KFNA 1DIIA 2V4IB 4A8XC 2MRPA 4NM1A 3RNFC 1JEHA 2FPMA 2JH1A 5AI8A 5DGAA 1PDYA 3DFYA 4HJGE 3PMLA 5TR3A 4GOCA 2WXGA 2L32A 2YTUA 3H4DA 2JRIB 3GIIA 4UD8A 2AL6A 2KFZA 3VRAB 4MEYA 2HOFA 2FPLA 1MRAA 2IGGA 2WWZA 2KDMA 5KT5A 3Q8QB 2BZFA 2KC1A 3N4EA 3NS1B 2CR5A 3GB1A 2H5XA 3MR6A 1ZQSA 4QZ9A 1C20A 2KDFB 1NJZA 4W9HA 3UINB 5EDSA 1IV8A 4P1CC 3RBDA 1NK5A 1RDFA 4RT3A 4DQPA 3ZNGC 1JDFA 1L2NA 8ICFA 3VTEA 3TEYA 1GRTA 1S5LU 4A3PA 5HP4A 3I76A 5EE1A 4IWPA 3MGVA 4FULA 3GRSA 3ETLA 4B9UA 1VD2A 4FJZA 4PWBA 3FCPA 4QZ8A 5L1LA 2WXRA 2KXJA 1G6JA 2D5GA 1N63C 2EKIA 8ICAA 3PTFC 3T5KA 3AE1B 3JPNA 2ZIVB 2ZUDA 4O3OA 3KHHA 1JWAD 4IQWA 2PMQA 5D46A 2W7OA 5IA7A 4JB1A 2NQWA 3NVWA 2NBVB 2INDC 2IPKD 2K1FA 2K6DB 1IBXB 8ICYA 4K7WA 4IL0A 2NRXA 3STPA 3KZXA 4PVHA 5KFPA 1UCVA 1Y88A 3LYYA 2NVKX 2C9WB 1N5WA 4LNIA 1UXYA 4JWMA 1ESFA 5KG3A 2O2VB 1GEUA 3H8WA 1C79A 1ZE3D 5GMVA 1YT3A 1IBXA 1ZMDA 2NRZA 4EQRA 1R4MI 3P0WA 2FI1A 1IGDA 4PZNA 1U47A 4GISA 3V61A 5HI1A 2EZZA 4NJ7A 1ET9A 3AMZA 4RQMA 3AEFB 4W9GA 1YZ6A 1C4AA 5E6OA 1WIAA 1WM2A 1T0QC 3RCYA 4TSSA 5C3JB 4G9BA 3RRHA 3RN9C 5JRBA 4GU2A 4BKSA 2PTXA 3H6NA 3PWIA 4ZRIA 2R8DA 2KQ4X 4HRSA 2DGZA 5AKHA 2Y3RA 2W11A 2XCPA 2WQYB 4KZ0A 3BS7A 4YMOA 1TTNA 2IO3B 7ICFA 4RF0A 3GU3A 1XS9D 4XA5A 3BVMA 3NS1A 4L23A 4HYRA 3M1YA 8ICIA 2PPGA 1TKKA 4AP4C 3RH5A 1MA7A 3L5OA 5JHBA 2W43A 5KFWA 4HNLA 7ICTA 2E5AA 3L4PA 1TZ1A 3OLMD 1KSPA 1PGAA 3WAMA 4W9EA 2K0PA 2OH2A 2JK6A 4M0WA 1L7NA 3ZDCA 4JL9A 2BWFA 3I6EA 4MGYE 2LHTA 3WKDA 3JZUA 2IHNA 3N30A 3ZRCA 1ZETA 4AJYB 1SB3B 1SZPA 3N1ZC 5HR7A 4DS5A 1QQRA 2C5LC 1U48A 2JU6X 1D4BA 4H4PA 1SV4A 2LBOA 4K81A 2W9NA 5FS9A 4O5CA 5JCKA 4IP4A 3MGIA 1MJDA 1WX9A 1IYXA 2KVRA 4IT1A 4GB9A 1TYGB 3GZNB 1OQQA 5DBCA 2KZZA 3VA8A 3DJJA 5G55A 3RJHA 1VZ7A 3AEGB 5H2FU 2GI9A 2KHWB 2CU3A 5AM0A 1NI2A 2PMZC 1F44A 3KOOA 1WX7A 3KWVA 2W0HA 4JN8A 4RGNA 1C78A 1N5XA 4ECQA 9ICAA 2I1JA 1ZDLA 2LMCA 4KX6B 1GETA 1WCLA 2KACA 4HWIB 5D3IB 4NM2A 1CQVA 2MJDA 4A20A 2LYBA 1WXQA 3FV9A 4H4RA 4HCDA 3QYPA 2J6TA 1TKDA 4ED1A 2B21A 3CYMA 3WK9A 4C4VB 4GR1A 2Y9TA 2W9CB 2Y0SF 3JVAA 2NR2A 3A9JA 3LXFA 1HXYD 1UD7A 3ZI4A 2YB4A 4HCHA 7ENLA 1SJCA 5DPSA 2LMRA 2QC8A 2BB5A 2HHTA 2N7EA 1UH6A 4DQOC 2HHQA 3J81j 4M0AA 2MQJA 2WHIA 2PTYA 1E7UA 2M56B 3N3KB 4M0XA 2KHVA 3NZ3A 2PFPA 1FFUA 5ALZA 4FO6A 1P7EA 2VFUA 1Q1OA 4MGGA 5KG6A 1TYTA 4NXZA 4C4TA 1ZYQA 3HT3A 5EBKA 2MSNA 3V7LA 3GZFA 1LO5D 4RPYA 1TAMA 3PY8A 3ZIMA 5KFHA 1UWMA 3DBLI 2Q85A 5DBAA 4F72A 2IO2B 3ZTDA 5TISU 2PMZF 3CW2C 1MUCA 5DB6A 2OM6A 3UJ2A 1VZ6A 1ZXIA 2IY0B 2OCEA 4ECVA 2FCNA 4YSZB 4URKA 3T5LA 1D6EC 4EQXA 5J0SA 1X9SA 3PGEA 5DG9A 5EWEA 2KJRA 2ONEA 1PFDA 2N9PC 1GB1A 2MUCA 3CB3A 2PU0A 5AM2A 2Y5CA 2XCAA 1YX5B 4TURA 3OZMA 3A33B 4IR1A 1B22A 5AM4A 2JZ3B 4HKQA 4IUMB 1BZLA 3JYUA 1ZD5A 5IIMA 4F1SA 2AH5A 8ICXA 1UGMA 1N61C 2YVGA 2OZ8A 3KKAC 1WY8A 3GILA 4H2AA 3VQIA 5G5HB 3WK5A 3MR2A 3TOYA 4Y2QA 1YMHE 1E8YA 2MCNB 2AYOB 2IBKA 1NYQA 5JUMA 4EBEA 3VCNA 1GAQB 2EQ9A 4BJQA 2KX3A 1Z00B 3UXPA 2KK0A 1NZPA 1X2HA 1I4GA 4XWWA 4RQ2A 2PFOA 3TWAA 4KTQA 1TY2A 4A8EA 1S10A 3BSMA 1D5XC 3BK2A 2V3SA 3KUDB 2KVSA 4TUUA 4P6VF 2MA9B 3NVZA 2G09A 3QFAA 1ZQIA 1TGZB 2ZNVC 2VAOA 3QIJA 3O65B 2F1JA 3QEAZ 4RMAA 1VJ5A 5HFYA 2QKQA 2P13A 3JVZX 2C7HA 5KVIA 5G2NA 4DL3A 1QOFA 2NYVA 5L1MA 5BOFA 3DDHA 1I4HA 2BTEA 2AL2A 1JCTA 2LKYA 4NLCA 4DFDA 1XS2A 4DHZE 1JXEA 3EFCA 4K7SA 4FS2A 1KM7A 4Z6EA 3GRTA 3IP4B 4NLNA 5FXEA 1ZY8A 2KMCA 3H8HA 3EJEB 4H4VA 2W9MA 2BVHA 2LXCA 3NVVB 2DX5B 2KQ7A 3C5GA 1L0VB 1V49A 1V6EA 2WHEA 1O03A 1YIWA 2YEPB 4PL2A 2OG9A 1BGXT 4BGDA 3MC0B 4LJPB 2BVGA 4WAAA 3MZNA 2OOBB 3QU7A 1DTNA 5IIKA 4O3RA 5CHFA 3EANA 4ZRQA 1V85A 3RB3A 1C4CA 1T0RC 4ARCA 4FP1A 5KG1A 2W9BB 4DL6A 5CEHA 3RJKA 1V81A 1UHUA 5C23A 4DHJD 4PGYA 2Q0ZX 1PGBA 4MH8A 8ICWA 4KIKB 4H83A 3R25A 2ZTEA 2AHOB 2XEWA 2ZNVB 1GESA 1L5UA 2GR3A 1NHSA 2JXJA 2ZIXA 1HUOA 3UCDA 3R9KA 4NJ6A 3T9PA 2VKQA 4RQ8A 3C8YA 4EYIB 3KHRA 5KT3A 3WKCA 3NO1A 1JWMD 2WGSA 2UVUA 4X5VA 4FBUA 4DHZB 2FE8A 4PS3A 5FR6A 3RTVA 1IPGA 3O0HA 2K22A 3SBFA 3P1MA 2CS4A 1J7AA 2HJ1A 2PLPA 3NZSA 3IRUA 3EGRA 4FX9A 4JQWC 3HIZA 2KLCA 2BYEA 3IBEA 5HR6A 5T8IA 5FXFA 1JRUA 2PPHA 3HKZC 1C4PA 2NTTA 2W3RA 2WDTB 1GRHA 4MSQB 6ENLA 1M94A 4JGHB 2OQHA 4YWOA 3RNAC 3ZRFA 1U4BA 1ZQWA 2JPHA 1WCNA 4OVZA 4WWOA 3BZDB 4KITB 1DXLA 2OFJA 4I2HA 3LB8A 2CJNA 3KHGA 1TV9A 1DIQA 2BCPA 4ADWA 3PHWB 2HXUA 2MJEA 4XWTA 2LI5A 1SKRA 5KFTA 4BOSC 1EBDA 5J0QA 1LFDA 3FILB 5AICA 4F8RA 2J53A 4ZCWA 3H8SA 4GGQA 4ASWC 1L7OA 2NRTA 2MBOA 2KJ8A 3RR1A 4BFRA 4HPPA 3HRDD 1Z19A 3DBRI 1IIPA 2F8LA 4NLGA 4YTPB 2PLIA 1X40A 2LD9A 1J7CA 1A5RA 4BUGA 3OTQA 3GFKB 4Y2XA 2V3NA 1XDIA 4HAIA 5DBBA 4ZYSA 2EMSA 1QOBA 1KW4A 1PZNA 4II2B 1MG4A 1SE2A 3QA8A 2YX8A 7ICNA 1F0ZA 3URHA 4DSKA 4KWSA 5FS6A 3PFRA 3FYYA 2WXHA 1VCBA 4EKUA 3ISDA 4DEZA 1F2RI 2Y08A 2B76B 4EMJA 4KLLA 4GFJA 2R8HA 2FYMA 4I2AA 2IBIB 2MBEA 3SENA 5J2HA 2M19A 1YQZA 3S6JA 2DF4B 2INPE 1GREA 3ZDAA 4B9LA 3DGZA 4C8OA 4KLGA 2EQYA 2L00B 1KLGD 3ISCA 2D11A 2WPCA 1IM4A 4F4ZA 1DRGA 5LXIB 5ENLA 2BQ3A 4KLDA 1DGSA 5AE2A 1WGKA 3N32A 4CF5A 4YMMA 3ECIA 4PWCA 2MBBB 2LGIA 1ZQEA 4Z6FA 3GV7B 1L5PA 1E8GA 1GRGA 3VCCA 2BB6A 3PLUA 4UARA 4HCNB 2NO4A 5BPCA 3BQ1A 3QU2A 5D4BA 3I63C 4WAFA 1J19A 4IS7A 3UQ0A 4ED2A 7ICOA 1QLNA 3VCBA 2LFIA 4B9NA 3RJJA 3BJYA 4DXKA 4FA6A 1TAUA 2ZG6A 4GFIA 2FCMA 1BPXA 4IRCA 3QWZB 3AE6B 3VHTC 4WIPA 3FC4A 4US8A 3LVWA 4LZGA 4NAWB 1SF0A 1XANA 4H4UA 3LB8C 4Q45A 2LWPA 2R18A 4Y2SA 8ICLA 4AWJA 3DBLB 2UVRA 1AARA 3DBRB 4YXJA 1ZQPA 4EX7A 4GGBA 1EC9A 1BMLC 2WP9B 2KWVB 3CF6E 2RP5A 4RGTA 3MKCA 3AEAB 1PQSA 2RHFA 1KF6B 4O3QA 1KEJA 4NLZA 3OAWA 3U30A 3FWAA 1Z4OA 3EFUA 3RUIB 5AK6A 4ICUA 3UQAA 4KLMA 1ACCA 2A1JA 4EQSA 4Z6DA 2WDVB 3PM9A 2GR2A 2CHZA 3RT3B 4ECRA 3KLSX 1XSNA 4GRTA 2K8CA 1L0XB 3PZ8A 5AIAA 4CDGA 3ZNID 1X9XA 1FNWA 2DZIA 4I2GA 3SR6B 3LJ3A 3NVZB 2BS2B 1F3PA 4A35A 1W1QA 2BVCA 4RQ3A 4YCXA 1HJPA 1KFTA 2HHSA 3ZVIA 2G07A 4J3OD 2CDUA 4YP3A 5J2DA 2O3GA 4KLFA 4CRXA 5KFRA 1BPYA 3UJRA 1L7PA 2EQ7A 3VVWB 2UUUA 4FBJB 1AW7A 2OZ3A 4B9SA 3W5VB 2VFVA 5ALXA 1D9FA 1LB2B 1K1QA 4E8GA 1ZP0B 1F1HA 3DIPA 2MBRA 5IILA 3CSTA 3SJNA 2J4XA 4KDIC 2P0IA 1DXSA 4ANWA 1D8BA 1J7BA 3AL0B 2WDRB 3SEIA 1DYQA 3R66C 2QGYA 4FFDA 4F5RA 2UVWA 3HX0A 2RDJA 3PG6A 1FCCC 1H2IA 1KDHA 8ICKA 2G1EA 2KTRB 2DZMA 4IL6U 2ZJDA 3IAM1 4BKSD 3DDMA 2WOIA 2NRWA 1L4ZB 1SIFA 3V60A 2OEDA 3ONSA 3KHLA 1V1PA 3TIXA 3C29A 2XO7A 1NBFC 2G9HD 1ZQMA 4EWJA 5LLIA 5HKHA 2NRVA 3C19A 4KN7A 2MP2A 4WURA 2PA6A 4JX1C 4EZJA 5AWVA 2QJNA 2LPEA 4JMUA 1N63A 4YD1A 2UWQA 2KNJA 4YTMB 1FRRA 5AHXA 1R4MB 2K60A 2KTFA 3DQ0A 3DK4A 2IDYA 1HTOA 4NAMA 4CYEA 5J0YA 5HHDG 2WF5A 4LA1A 2DFLA 2GBRA 2KMDA 3QE9Y 2Y3SA 2RDIA 2XBBC 3KZIU 4UBBA 4K7ZA 4TUQA 2ZUCA 3M8SA 4B9VA 2HVHA 5IIOA 5BO4B 1UZXB 5ADZA 1EBHA 2JEGA 4ZHOA 7ICIA 4NPNA 1M4VA 4FLHA 2RDBC 3ZKJC 2YMLA 5KFMA 2QSDA 2DPIA 4EZ9A 3RJ8A 2OWOA 2BGWA 4BKGA 2KSOA 1UWXA 5AM5A 2ZVOA 1WZ0A 2BPSA 2L52A 2XH0A 1N61A 4XDDA 3APCA 1NHQA 4HVBA 2ZVNA 1J8CA 3HP6A 3RBEA 2NPTB 3WK4A 4I2JA 4DBGA 4P0QB 3BOXA 2WDWA 1BKHA 1ZQVA 2RQ5A 1OTRB 4EELA 4B6JA 4ECUA 3FKYA 1DOQA 3TEWA 3QUTA 1GPXA 2GH5A 5AE1A 4IC9A 1BPBA 3N1XC 4A3RA 2ZIWB 1XWLA 3Q8CA 1T7PA 3EJBB 1W1LA 5KFNA 4J03A 2JZBA 1PK1B 4TQ0A 3L13A 5KFXA 4UB2A 3CMMB 2M8SA 2KKPA 2WDQB 3VH3B 3PSPA 3N20C 1VR9A 4QNLA 2H89B 2E8MA 2PFQA 4Q44A 4C8NA 1BUIC 4IL2A 3ML8A 5EU9A 2N7JA 1PUTA 4PS7A 3KYCD 2SEBD 1Q5WB 3K75D 3EPGA 3IHQB 4EBCA 2WBAA 4M0WB 5J2JA 2HJ8A 4XLOA 1FHUA 3HPFA 1MQ3A 1NJWA 4KLHA 2GWSA 1TS5A 2IPIA 1ZQJA 1V1OA 1KLNA 2OYYA 1L3UA 2FCQA 4FXCA 4P1BC 3N6JA 5KTQA 3HM6X 4F4WA 2IOHA 3A4SC 5AI4A 1Q8KA 3ES7A 2R2OA 4HLEA 2CJOA 3U7DA 3S1CA 5FS8A 3DHHC 3NHEB 2M17A 4FJYA 3TFSA 2P6RA 2NCNA 2W55A 4I2BA 2WOWA 9ICUA 2N9EB 5ALKA 1UNSA 3H8MA 1BT0A 9ICBA 2X8CA 4WH4A 2YN4A 1LKYB 1L8LA 3SN4A 4MM3A 1ZD2P 2XN9C 4N6EB 3RFZB 1IYFA 2OX4A 2AKMA 2MH7A 4FHJA 4KIKA 4F93B 4F5PA 4J9MA 2JEJA 4LJXA 2PTWA 4GMVA 3DK8A 2QB0A 5DPTA 3UMCA 4ELVA 2BC1A 3BQ0A 1ZQTA 1XF5L 3APDA 1E8HA 4MJSB 1NI3A 1KFDA 2IA6A 1LPFA 4XE0A 3QLDA 2BS4B 3MFHA 3IJIA 3R11A 5ALEA 2J3NA 2AQ0A 2KJ5A 2JVCA 3EUB3 3OPSA 3MC9A 2Y1JA 1S0VA 2DW7A 3M63B 3GV5B 4Y2YA 1WX8A 2INCC 3M6ZA 3NZGA 5ER0A 1PK3A 2ZIVA 3NVVA 2O6VD 3TKAA 2DYOA 4DLGA 5CA7A 3AU6A 3UQBA 2ASLA 3ZW3A 3CGBA 3JPSA 3F2BA 2JXTA 1SL1A 1Q3UA 1NYRA 4Q8EA 2LRUA 3TANA 4J9QA 1UBIA 3OG5A 4TKNA 3CK5A 9ICNA 3Q8RB 1Z2MA 1CMXB 1WGDA 2WU2B 1TKGA 4W9LA 2MP2B 4KLSA 3FM9A 4KPLA 3Q8KA 2REXA 5CP2A 1E6EB 3PVLA 4E3CA 2WLBA 1E90A 1HZ6A 5JZEB 1ZQGA 4QJFB 2MUTA 4CF4A 4K1RB 1I42A 1TIFA 3WK6A 5HHHA 1URJA 4JLCA 3OPXA 1SL0A 5E79U 1R7SA 1F0MA 2BHNA 9ICXA 1D5ZC 1JMLA 3PSFA 1OQYA 3OGUA 3HVZA 3SHQA 3TCAA 3OSNA 3L10B 4IP5A 1WFYA 3UM9A 2C2RA 4RM9A 4EEYA 3TARA 2QB0B 4QAYA 5L6GA 4ARIA 4TMAB 3DBSA 1SJED 2V4LA 3NOBA 3PMNA 5J0OA 4WWMA 5TR5A 3SN1A 4DS4A 4PYTA 1LM8B 1F9JA 2JXXA 1W1MA 1X66A 9ICGA 4GDKA 1Z1VA 4E0DA 2AWTA 2KKCA 1KLUD 3Q14C 1RM6B 3AEBB 1SV0C 3ZXRA 4C00A 2I5QA 1QSSA 2HCFA 2L0FA 4RNNA 1X1MA 4RQNA 3RJGA 3ZUNA 4CQNA 3IT6B 3CWIA 2RD0A 3HILA 4HXDA 1WXVA 2BS3B 2KMAA 1F5SA 4PJ0U 2PI4A 3W1SA 4ZDVA 5C5JA 2JT4B 3AU4A 4GLSC 1YNTE 1EU3A 4P16A 4UB1A 8ICMA 1D8YA 2HW3A 4UAYA 1P0RA 3QX1A 3CXBA 4P4PA 1SEBD 2ESEA 2QCZA 2UYZB 2BC0A 3SQPA 1K52A 5AKXA 2ATLA 2UU7A 2VA3A 4LDTD 4PHAA 4NV0A 2FMQA 1E7PB 3OC4A 5DQHA 2AQ4A 3KVFB 1ZQYA 3PW7A 3A4RA 2HHWA 4JWNA 4BBNF 3RJEA 1S97A 4PGXA 3ZXVA 1ZQLA 5DPRA 1XT9B 2HQMA 5IDZA 5DB7A 4QW9A 2LYHA 1MHHE 3UF8A 3KKAA 2BQUA 1KKXA 4HPLB 2MNRA 3RFAA 5DGBA 3FW7A 2WYQA 4XGAB 2KANA 2ZW1A 2BGFA 4JV2A 1NDDA 4DF4A 2XY6A 5LNK1 1WRDB 8ICOA 2WAQF 3RR8A 2DL0A 4DL4A 4F7ZA 3DFHA 3H70A 3LVVA 4FS1A 5AKIA 3KH0A 4YWSA 2MHJA 2ZZCA 3QAQA 3QPEA 2N7DA 3ORYA 2KDBA 5GRTA 5ALHA 2VA8A 5KHQA 5MPOA 2FUHB 4P0PA 3DBHI 3ENEA 2QARA 4Y2PA 1MVKA 2IYDB 2M0AA 1YN5A 1FEAA 3PV1A 2ZCBA 3MY9A 3ZLFA 3P42A 1ED1A 5J8YC 2GGJA 3CIRB 2KOBA 4GLXA 4G3XB 3SN0A 4MFAA 1COKA 4DOCA 3P4QB 2DKZA 4DFJA 1UELA 2YAUA 4GC7A 1ZJMA 4G50A 5KT4A 4ECYA 3I28A 2PTLA 1QLUA 2AXRA 4KZCA 4W9CA 5KG2A 2P3ZA 4C56C 3TUOA 3OJSA 4K4IA 3C23A 5DCNA 1IUEA 5D94A 2GOLA 4F71A 1D3ZA 1SE3A 2I5HA 4FZMA 1SWWA 3D47A 2XI9A 4HDOA 2BVFA 1QILA 5KFCA 2M4NA 1JPMA 1NKBA 2RK5A 1VRAB 1FXIA 3QCAA 4YTNB 4R64A 2FE9A 5AKJA 1TFRA 1E0YA 3SQSA 5KG5A 2KICA 2ONQA 2ES6A 1WSPA 3A9KA 3NZUA 4DDGD 3MGHA 3SU8X 3ZJTA 2XH2A 2QARB 5JHAA 1TS2A 3UXOA 4DL5A 3SI8A 2QJLA 2BWES 2AGPA 1AYFA 3I5JC 3N1YC 2OKTA 2YEPF 2DZKA 3C0RB 1RXWA 4IQVA 1GO3F 2H3ZA 4DHJB 5ALYA 2KQSA 1K4QA 3NUHB 3TJPA 3P4PB 1WUEA 1CUKA 5ALMA 1W1JA 2JZZA 3DG6A 3UGBB 2D3BA 3QU9A 3AE5B 2R8KA 3IXSA 3B0YA 4HROA 4OJPA 4LZDA 1QF6A 3K9PB 1MOKA 4G8TA 2ZPNA 1V5OA 2JF5A 1W1OA 3C1YA 4UB4A 2E3TA 2HHXA 3NY5A 1TK8A 2OQYA 2WP6A 1B43A 4M9NA 3M7DA 1L7YA 1L7MA 3V6KA 1ZQDA 5ALDA 3LAEA 2X99A 2INNE 3BW7A 3ALRA 3B9JB 2LM1A 2VJ5A 2BR0A 1PYWD 5EWFA 2WXMA 2YMQA 4JPSA 3VR8B 1A76A 8ICVA 4KGSA 9ICEA 4DLEA 3Q4DA 2FIDA 4PYUA 4WWPA 3LWMA 1T3QC 3D2HA 2BYFA 3JPQA 3RAQA 3BS5A 4MM3B 5IO9A 2KIVA 2KN5A 3UPQA 1GXFA 4CF3A 2WAQC 2HHVA 3X23A 1QCKA 3DEEA 3B97A 1F2RC 1PVQA 3CAWA 3AV8A 2L3ZA 3NG0A 3WAOA 4K2SA 4EM3A 4YD2A 4YQWA 5AE3A 5AM1A 5FJUA 9ICJA 3DEDA 4KMOB 4LVSA 1MHXA 3DVNU 2KJ9A 4TQSA 3RH6A 1NELA 4ZYNA 3PW5A 2WXOA 5KFZA 1NK9A 3HWTA 1UF0A 4LDTB 3V72A 1JX4A 2CKHB 1X6IA 5CJ7A 4IWOA 1NK0A 4RFBA 3TL5A 3EHVA 3ZJVA 2B3AA 1OUQA 4GIBA 1U45A 2J0JA 4LCDE 1F52A 3PZDA 3C0PA 2PCEA 1T94A 3IJQA 2YB1A 3IDWA 3Q8SB 3PO5A 1NENB 2KZRA 3SDLC 4A3OA 4A6GA 2MU2A 2C7NB 3D2QA 1K53A 3B0XA 1D5MC 5JTIA 3IFWB 3SV4A 2OXOA 2DYBA 3EUB2 3PSTA 2AU0A 4W9DA 1CK1A 1GERA 1HUZA 3FVDA 4JK1A 3B0AA 2NQLA 5GTIU 5KFLA 2BKRB 2PVOD 2QVHA 4HPNA 1PDZA 1XLOA 3AE4B 2OLAA 2ZJ8A 3FJ4A 9ICMA 4JHMA 3SYZA 4JIOU 3Q3MC 2GRTA 3TW9A 2MWSB 1GUAB 1TK0A 3FW8A 3MUCA 2AQ1B 2J6UA 1QZEA 4ZA0A 1NOMA 3D2DA 3TAPA 3NTUA 1Q0WB 1LQBA 1V97A 4F4YA 4IQTA 4K4GA 4MEMA 3AN1A 1P9DU 2PI5A 3HK0A 2KYWA 5AIBA 2A3VA 4B0EA 1Z5SB 5ALUA 3BK1A 4ICAA 2WXNA 2OZTA 3IV6A 4P4MA 3BYYB 2LEKA 2V3PA 4ECZA 2DHZA 4G7FA 3VFKA 3R3MA 1TYPA 3R1ZA 2KVCA 3V7KA 3L5KA 3NRWA 3PV8A 4I29A 1VZ8A 4AOFA 3CT2A 3D46A 4R3DA 3POPA 2ZJAA 3T9LA 2WXPA 2WPFA 2K8HA 4H50A 3JW7A 5C1ZA 4GSWA 8ICCA 2LHDA 7ICQA 4ANVA 1BQGA 3VC8A 2W8LA 2K4PA 2I1KA 2LHEA 2OJRA 2Y5PA 3RMKC 2ISPA 4W9IA 5HHZA 4ZRKA 2ALZA 1HE8A 2GGIA 2HXTA 4OHJA 2PGEA 4KDLB 3H0RB 4HEA1 5AI9A 1NK4A 3RNGC 3PK7A 3NVWB 5ALLA 5ALFA 1YQ4B 2GB1A 3R0KA 4DWDA 3V5CA 2YQUA 4F4XA 4F91B 3TADC 5AKGA 4NEWA 4M8NA 4DOBA 1UA0A 4AP9A 2KTQA 3BJSA 3IK4A 4KVGB 4A90A 1ZXIC 5KL8B 1E0ZA 1DOYA 3AECB 5CB1A 4R65A 1Y56A 4PT5A 4A55A 3DESA 3CP8A 1C76A 4M2YA 3T3OA 4M9HA 3QUQA 2V3AA 4M52A 4UBCA 3NFUA 2KC2A 4IZGA 3L17A 4LIIA 7ICPA 3MR5A 4BAXA 2BW2A 4DFKA 3DG7A 3F2CA 4MFFA 2DWQA 1TK5A 4MMWA 3KYDD 2N9KA 3I6TA 4M02A 5U1OA 2KK8A 4RF1A 3JPTA 2KTRA 1K5OA 2FKPA 4DSJA 3A7UA 9ICLA 3PSIA 5D49A 3BZKA 2VIXA 2WX0A 4ZRPA 2Q5WD 1MDLA 1F8WA 4RQ7A 2G5IB 3MP9A 4FZNA 4L2YA 4GGHA 4BXOA 2HBJA 3OSPA 5DG8A 2X8XX 1AQ6A 2PEAA 4M01A 4J9NA 4GDLB 3EYZA 4Z1YA 3GP7A 2FDRA 3KBBA 2N1RA 1GOZA 5FK9C 3N28A 2W9AA 2D6FC 2AXTU 2HBLA 1W1SA 1P48A 2YY6A 1Z3EB 3KUMA 3N6HA 1VJKA 3SEBA 4ECTA 5J18A 2KDEB 2FLPA 2NTSA 1ZRNA 3E9SA 2R2ZA 5AZHA 3A9JB 2F44A 3RRAA 1N2XA 2HSZA 5BMGA 5J29A 4M6WB 3RJFA 1YN3A 4EFOA 1RLFA 2CHWA 1XU4A 4KT2A 2ZIWA 3LWLA 4Q8FA 3C1ZA 5HMLA 3ZNZB 3L08A 4UAUA 1MSWD 2LVPA 1H38A 5ALSA 4P0PB 2ODGA 2EDUA 3H1UA 4UAVA 5B5EU 2ZIUA 2XICA 2XC9A 4ED6A 1P3QU 2HTME 1QQ6A 1ONFA 2GQWA 4QWBA 2CFYA 4R8UA 3IT4B 4U6PA 9ICTA 3ZLZA 1ZQNA 1E5WA 5DQGA 1RYUA 5L9XA 2BPFA 3AEVA 1A70A 2XH4A 2HOQA 1ZGUB 5H8YE 1X2GA 3N4FA 3UJFA 2E8PA 4RGOS 4E74A 3HHMA 2HE7A 2GGGA 4NJCA 2BBCA 4P7IA 3W9CB 3PT2B 4G11A 2KHQA 3BQTA 2AGOA 1RQNA 2N4FA 5BOMA 4MKSA 3JPOA 3GIKA 5ALJA 3TSSA 1FFVA 3WKBA 1N62C 5CHGA 5G5GB 3GQCA 1BXTA 1ZQXA 3W5UB 3VDGA 4K3CA 1SJBA 1BPEA 3UCCA 1NKEA 3KUZA 3RULA 1WR1A 3BINA 5LXHA 3WK8A 4DOAA 3VR9B 5FJOA 2I0KA 1COOA 1TZZA 1MC8A 2GBKA 2H3VA 2WB1F 1OEYJ 3CGDA 4LNFA 4PGQA 3RJAA 2C60A 3B2FA 1DOXA 2NPXA 2WX1A 4KN4A 3RGTA 1NK6A 1GRBA 2BPGA 2I1QA 3JS8A 3LLBA 3N4MB 1ZQCA 3GDXA 3PLVA 4HNCA 2W03A 5F3XB 3C5FA 1P7FA 1ZQHA 5J0RA 2JY6A 2BQRA 2K5PA 2JRHA 2KLGA 2VZKB 4DL7A 3WCQA 1GSNA 1SJAA 3CXOA 1BWCA 3TWBA 2RRDA 3I4KA 1MPEA 1DK3A 1J0GA 1WJ6A 1LVHA 4UAZA 4CO7A 3H7VA 2A8XA 4DXFA 3M62B 4NL9A 4Y2JA 1GNUA 1EF1A 3S1DA 3DEQA 4J9PA 5HG2A 5AI5A 2X50A 5DLGA 3C2MA 3U26A 3KTQA 2P35A 3KW5B 4X57B 2YQEA 5GXGB 3A1QB 2O6KA 3S5SA 3UXLA 3GE3C 5C0YA 2QHOA 1TZOA 4RNMA 1AHVA 2BF8B 8ICNA 1JRPA 1FXAA 4H4QA 4YL8A 2UUVA 3LK9A 2K8BA 4OO1J 3Q8AA 5C2TB 1E9MA 3CNHA 3WKEA 2EQ8A 3MC1A 5K8EA 2Y1IA 3P93A 4ZRJA 5KFFA 3TEXA 5JXVA 1ZQ1C 4OJ5A 3OTRA 7ICLA 4GYPC 2AEHA 3RRGA 4TUSA 1T8EA 3VTVA 2ZZ0A 1C3TA 4BWMA 2Y5BB 4OALA 1L8OA 7ICMA 1IG6A 5AM3A 2FIFA 3UMGA 2PODA 4IWQA 2IGDA 3M6KA 1N62A 5KFDA 4KSKC 3T3NA 3P3BA 1EO6A 3B1LX 1SB3C 3Q45A 4FBTA 2MW5A 1S0NA 4J9SA 4RQ0A 3UIPB 3QN3A 2ON8A 4KLJA 4FDCB 3U8ZA 1WZ3A 3IG5A 4FADA 2D2QA 4GXKA 4M9JA 3U2SC 2XSXA 4KLTA 1I35A 2PGWA 4QZDA 4XRHA 5DDMA 2FMPA 4M04A 4I6PA 4E71A 1ZW7A 5FKAC 1IXRA 4H4WA 4TVWA 2JWZA 1T6BX 2N1WA 1KBUA 5JCMA 4MHVA 3JSVA 1XPYA 1WUFA 3D9XA 3PR4A 2BDPA 5CR0A 3ZGZA 1UGJA 3V7JA 4BCAA 1GC6A 4RPZA 2CHRA 2KN7A 2L1AA 1KN0A 4J1OA 4R8UB 2SAKA 3VFCA 1JWSD 1O08A 4KLQA 1LXDA 2WXIA 4J56A 4U7CA 3EA6A 1QLTA 4DCCA 3SMVA 1K51A 2ZIUB 4EEKA 1MBTA 4UB6U 3EW9A 1X9WA 7ICRA 5BMHA 2F1IA 2NS5A 2ZIXB 1RG6A 2QMTA 3DPDA 3V3WA 4NWIA 2HDOA 3SV3A 2A5UA 2EAPA 4IRDA 1D9DA 4ED3A 3EJDB 4Y2RA 2EQ6A 4FI4A 5JCIA 4H4ZA 1ZPSA 1UPHA 1BPDA 2TSSA 4QWAA 5BYRA 3ES8A 1EM7A 3G6XA 5FS7A 3T3FA 4ED7A 4FZLA 2WS3B 2JGAA 3JPRA 2LVQA 4F5OA 5BOLA 3PZ7A 4PK1A 2K4EA 4YVZA 3NVYA 3SD7A 2YVCA 4BBYA 1T3NA 2Y0SC 5ALQA 2C3DA 1VDVA 1FNVA 2E8OA 4PVJA 1JROA 1FMAD 2OVLA 2QB1A 4J9RA 3T4WA 1HEKA 1FO4A 1YN4A 3TBLD 3Q8BA 4EZLA 1DZNA 3V62A 1CJEA 2K89A 1DGJA 1X9MA 5AKEA 5ALRA 5J2IA 4LTUA 5IN7A 1JWUD 4QIWC 2KNBA 2BCQA 4IM2A 4XC2A 3Q8EA 3II4A 1PDXA 3U52E 4EZ6A 4I2CA 1YJ1A 1BPZA 4MLAA 4DO9A 1AOGA 1OFFA 4RGMA 3VDZA 2E1FA 1TAQA 1WGYA 1I4XA 3ETRA 4MGZE 5ALWA 1QSYA 3HW8A 3QTPA 2KX0A 3Q8LA 4P0QA 4JWUC 2A19A 8ICTA 2NPTA 2PU1A 4OVUA 3HSUA 4DHGA 2KAJA 3GSYA 2JMGA 4MH0E 1PGXA 3IHPC 4GDKB 2F2AB 2HBKA 4AYBC 2QILA 1JCKB 3G6YA 3GZNI 1YEYA 3R8BA 5AEKB 1RFAA 2O56A 3SFDB 2KV2A 1XLPA 2NV3A 2JX5A 2LGYA 1SIJA 3D2SA 2PW9A 1ENFA 4PH5A 4RM8A 3PVXA 3V6CB 2LJ5A 1AROP 8ICBA 4IC7B 3GC2A 2ZPYA 5AK5A 2PKEA 2XGPA 3UGVA 4DSFA 2V3BA 2LI6A 1N5WC 5AKYA 3UQ2A 1SBBB 1ONEA 3QKEA 1L6UA 4DSLA 2L0TA 4H4TA 2W04A 1YQ3B 5J2FA 1JIHA 1WGGA 1PUZA 5J0PA 2MLBA 4QZAA 2VH1A 1I4PA 3EWAA 1B4FA 3PNCA 2C2DA 3DQVA 2ACZB 3ETRB 1CZPA 4Z17A 3RCZA 2A4ZA 1JW9D 3IG3A 2G06A 2GLEA 2HOIA 4P2HA 4M8MA 3X0WA 3DVGY 3Q3JA 2Z0DB 4GIRA 3Q6JA 4EMWA 3ZDDA 4YG2A 4PS8A 4L1BA 1SV0A 3T5HA 5U25A 4OJOA 1D7YA 3AE9B 1SXEA 1MQ2A 1GV4A 5FXPA 2PKOA 5CHVC 2XGZA 1XSLA 1TKEA 3VUYA 4PL1A 1XO3A 3MJ5A 1C1YB 2BYVE 5DKWA 1QQ7A 2QEJC 4PPXA 1GB4A 3L0WB 9ICWA 2K39A 2HVIA 1MFWA 3PR5B 1MBBA 3GD3A 3V6HA 2G5HB 3MJWA 4WJNA 2NBUA 3RF9A 4B0MA 3HPOA 1IP9A 3R0UA 1OJTA 1LGRA 1WMHB 2D3AA 3U7ZA 5KFGA 3GD6A 3EKGA 5KFVA 3P63A 4JAYA 2ZTDA 1XLNA 2DBYA 4UB5A 2PLSA 1K50A 1EUVB 2LUMA 2NBWB 3RD2A 2M9NA 3APFA 1MI0A 4PZFA 3D2JA 2F8KA 5FMHA 7ICHA 3IAS1 4TV3A 3VAWA 3AH7A 7ICKA 1P1AA 2J0KA 1GJZA 1JWBD 1GRAA 1ET6A 4BC7A 4O5EA 2GGHA 4QIWF 3Q3NC 2K8CB 3WK7A 3RB4A 3LADA 1V8CA 5EOZA 4RQ5A 4OJLA 4C4RA 4O3SA 4QZFA 1ZQBA 4N58A 1STEA 2L7RA 4ED0A 2WXKA 2POZA 2VANA 2YVJA 4K1WA 2XK5B 1RVKA 3Q8MA 3C21A 3AU5A 4YWGG 1Z00A 3THVA 3WIMA 2ZZBA 5CRXA 2VRRB 1Q10A 4LLGM 1WGRA 4WJ3B 4YR3A 1SE9A 2J7QB 2FCSA 2KT7A 2W3SA 4ML8A 1C7YA 3HRDC 4O3NA 5I1VA 3HKZF 4QZGA 2IGHA 2J52A 3DBHB 3CYJA 3DERA 1NPXA 2YVSA 4WQMA 1WWUA 1KD0A 4KLUA 1P43A 2E1EA 4OZAA 1E8WA 3RAXA 3DHGC 2FNJB 3MQTA 1D8LA 2Y4GA 3FAHA 4DF8A 2R61A 5B66U 1P98A 4G3IA 4Z6CA 1UUPA 1V59A 1F77A 4YR0A 2RSUA 4BWJA 3ML9A 1EC8A 4M00A 4RQ6A 5H92C 1TKYA 3ZTCA 4AJWA 3V6JA 2LGDA 4ANXA 4EX6A 2QPMA 3H7IA 2VFSA 2VA2A 4HPMB 5BYQA 3RPFC 4E4UA 1OGWA 3I3TB 5DB8A 5D6JB 1WRIA 3RZFA 1HSKA 1YOVB 4APNA 1V9PA 3R07C 1F0XA 3PWGA 4HCPB 3VXWA 5KFOA 1PVPA 4M9GA 5KL1B 2VFTA 2FPKA 4R63A 2D07B 3N7SC 4I27A 3SAGA 4IHCA 4LNOA 2KZ3A 4KLIA 2YLMA 1J97A 1WVFA 9ICHA 1N60C 2Y3AA 4Y2VA 3RB0A 4YXMA 4G0NB 4EUTA 2DUYA 2O2VA 4FHKA 5IIIA 4F2RA 5J0UA 1KLVA 3L54A 1ZQQA 4BVUC 3GD4A 4JUZA 3TADA 1T0YA 4H2HA 4PHEA 1L6VA 3PW2A 2P8CA 4KMUA 4MJSA 3W8WA 1MN8A 3R2TA 2KG5A 2CPRA 5AI6A 2KOXA 4O0IA 4EYHB 1I19A 3R7RA 1I7HA 5ALNA 5D3DA 5AI0A 1R4NB 1NJXA 3NS8A 3FDSA 3A0HU 2BCSA 1FFUC 5I1WA 4RZRA 4UW9A 4EBDA 4K4HA 3Q8FA 3GIJA 4NNJB 5KAIU 3U9IA 4KV2A 3S1EA 5KFSA 3QARA 1YQBA 5BMIA 2AQ3B 2GLSA 3OWEB 1KCZA 2MX2A 3W8XA 9ICRA 2WF8A 4I6LB 2BCUA 7ICVA 1BNPA 1ZDVA 4QZHA 2WXLA 1FIQB 4BX9C 1ZOLA 3W1YA 2MA1A 4WWNA 3QK0A 3ONNA 4DFPA 4CGZA 9ICVA 3EECA 3JPPA 5DPWA 3DV9A 2ZXHA 3WKAA 3BWUD 1JI7A 4B9TA 1WH3A 3FILA 3MC8A 1EC7A 2D10A 2ZADA 1SXTA 1OXJA 3EPIA 2KVZA 1F9CA 1V38A 3TACB 1V1PB 3Q3OC 2OHFA 4IM0A 3MSYA 1NK8A 5HHIA 5TZVA 2IO0B 2KE7A 4RUAA 4ICVA 1Q3VA 2H3IA 3H4KA 5AUIA 3IC9A 2R9ZA 1FECA 3RITA 2LYAA 3QX7A 4YT0B 5IKCM 5K4LA 2LZ6A 3QJZA 4QWCA 3AXCA 4LJOB 3A7RA 1AWDA 1XHCA 4S0RA 5FJTA 3TSJA 4KGRA 2I2YA 3S1FA 4MDKE 2FLNA 1L3VA 2LASA 4J9OA 4F2SA 2QDFA 5E6JA 3PSEB 5KG4A 8ICZA 4IQUA 3RH4A 3V05A 3UXKA 4A6QA 2KDIA 2GBMA 5T14A 2JYTA 2QDDA 4ZHPA 2P6UA 3KJMA 1RYRA 3RJIA 2ZEQA 4A9AA 5KFEA 3TTEA 1XC9A 3DCGA 1B9RA 1Q46A 3M95A 3C28A 2DAJA 2VJ4A 3AE3B 3A7AA 4BV6A 3VUWA 9ICQA 1FHVA 2XH7A 4KLOA 2RR9A 4S17A 3D32A 8ICGA 2AJQA 1ZQRA 4C7YA 3RR7A 3AE2B 3AQFA 2H3FA 3OJ4B 4CHKA 5J17A 1X42A 4QWEA 1KTQA 2W9BA 4CNQA 1KQQA 1ZKHA 1EBGA 4DFMA 3CRXA 3C2KA 8ICPA 2OJWA 5CTRC 2BDUA 3B9JA 1STZA 1S7MA 3K1ZA 3AM9A 2KSOB 1ZXHA 2KZMA 4MACA 3T8MA 1WXAA 4HG0A 4J9KA 2OAIA 1SXDA 4DXGA 3B08A 1UBQA 3LXDA 3E58A 5ALPA 4DQRA 2QLTA 2QDEA 1UT8A 1WJNA 4PVKA 2WFAA 3BY4B 3V3XA 3GS2A 2I38A 3L16A 2EH9A 1Q1WA 2Y9UA 1WVEA 5AK4A 4ECWA 5AKZA 3I57A 5HMMA 2JH7A 5EE9A 4REZA 3I9V1 4ECXA 2IOFK 4QW8A 3GOEA 3RZWC 3AE8B 1XO0A 2LGSA 2KJ6A 4H4XA 3E56A 2PP1A 2DQNB 1WE6A 4YXDB 4ED8A 4YR2A 3MDCA 2AL2B 4IW0A 4DL2A 1VAOA 3RYTA 3U4EG 4NL9C 3ABVB 2K4IA 2DKXA 4DYEA 2IZVB 2JYEA 4IOIE 5JCNA 2N0SB 3AEEB 1SJDA 1P7DA 4E6MA 3M9NB 1TS3A 3IVFA 3RNEC 3UMBA 3WAPA 1SZHA 2RGFA 4J6IA 1X2IA 2QQ6A 4BDPA 2GBJA 4I2DA 2B6GA 3CSFA 4QZCA 2E8NA 4C0ZA 4X2PA 3UXNA 3PW0A 3KWLA 2GR1A 2ZZPB 3VRBB 1HQRD 2OPJA 4HK2A 2BPCA 3QC8B 2XY5A 2V0GA 3TI0A 3UJEA 5FJPA 2JUOA 3Q8PB 1JQ4A 4MF2A 4J57A 1ZQZA 2JHDA 5KG7A 1OQRA 2LGXA 2W82A 3NVYB 2C3CA 3MR3A 4JE3B 3F5EA 4BZAA 1RQLA 2K9XA 3F2DA 2KFKA 3K1GA 5KG0A 1TS4A 4RQ1A 2K4HA 3UJSA 5AZGA 1TY0A 4TQRA 3QQ8B 1RPLA 5KAFU 2XY7A 1FFVC 3P4RB 3J9CA 4C7ZA 2LXAA 5AZFA 1ZQFA 5F9NA 3DOWA 3RB6A 2WXQA 3PZPA 5J0XA 5GTHU 1RRBA 2KN4A 4UDUC 3R10A 3RI7C 1CEZA 3EEZA 2LRWA 2QKNA 2J6SA 3SSZA 2ASJA 2M0NA 4ENLA 2GQUA 2L8JA 3VC6A 4DXAB 1WF9A 3DHIC 2GH1A 2V4QA 5CX3A 4M6WA 2PTZA 4LNNA 2ASDA 5L1IA 3GE8C 5HQXA 1Z4NA 2O6VB 3B2GA 1KL9A 3DG3A 1J2MA 3ZDBA 1L8PA 3PO4A 5KVHA 2EZYA 5JRTA 2RDGA 5L1KA 3TJ4A 3BQ2A 1KTKA 1H8CA 1A0PA 4I2IA 2VZKD 3TSHA 3AE7B 3T79A 2EAMA 1XSPA 2P4PA 2HBMA 1E8FA 3I99A 4E5TA 1U4AA 3K9OB 1J2NA 1ZDXA 2AX5A 3N7PD 3GY1A 2E6XA 4PZOA 2E5SA 2K6QA 8ICJA 1JALA 2C28A 1N60A 1IGCA 3VC5A 4IM3A 2WPEA 1C9FA 4DN1A 2F1HA 2DPJA 1DOIA 3VTWA 4BOZB 8ICEA 2G45B 4NAWA 1ZK7A 2L5YA 3ZQ4A 1DNCA 3D6JA 4YN4A 4PHPA 1XCTL 9ICFA 2JQRB 3BVGA 3H7PB 1ZX9A 1SE4A 5I4DA 2KWUB 4HYKA 4I6NB 2H3QA 1X6JA 1HIWA 2KD1A 3HUIA 3CGEA 3ED5A 3A0BU 4LNKA 2O6VA 1C77A 3SFEB 3QZ8A 1S77D 1K1SA 1H6VA 2WB1C 1EWCA 3PS6A 4DDID 5IP4D 1FEZA 5L83A 3I1YA 1V86A 2C22A 2ICIA 4GYPA 5J04A 3NJTA 1ZD3A 3L3FX 2YMMA 4US9A 4ELTA 4EZKA 1AHUA 1V9JA 3OP2A 2QAEA 3HM3A 3TX1A 2TPRA 2HNEA 5J2EA 4RH6A 2GBNA 2JEIA 4RNOA 1QOGA 2P88A 2PS2A 2CXYA 4NLBA 1W1RA 3ZD8A 4RU9A 1WUDA 3NXLA 2RPQA 3DGHA 1L6NA 3P4SB 2BCVA 3ZO5B 2C2EA 1SSNA 3PQBA 4MGIE 1WWTA 8ICRA 1NNLA 2BKFA 1YJIA 4NEVA 1ZQOA 4B95A 4KGTA 5ALOA 5E6NA 3M9OB 4YMNA 4EQWA 4F4KA 1FEBA 2GR0A 2Z7JA 1JPDX 1ZKQA 3H0LB 5HNKA 2MUTB 2FAZA 2WP5A 2IMWP 4O9MA 1S76D 3W2DA 1XLQA 3RNBC 5KFKA 2GL5A 2GO7A 1V5TA 5J2CA 1ZQAA 4O3PA 1WGHA 3MBYA 3PRPB 2V6OA 4EOYA 2NO5A 9ICCA 2GOWA 3IM1A 4WQOB 4DWFA 2WNMA 3ENLA 2PFNA 3DJGX 4H1ZA 2WTFA 8ICUA 3Q69A 5KHOA 2OEHA 2PP0A 2ISOA 1E8XA 2KFJA 1S0MA 2KO3A 4EEWA 2PSNA 5L95C 4KSLC 1UA1A 2XGQA 3KQ4A 5IAAC 3ZD9A 3V6EB 2EELA 1MNSA 3H8AA 3JW0X 4Q43A 3C2LA 2F3NA 2GDQA 2K8BB 1NKCA 3DVGX 2CRXA 4XQ8A 3OHBA 2EMTA 4C4SA 5J2RA 2UVVA 4GC6A 7ICGA 2ZC8A 3H40A 2AQ2B 2EXRA 1YJJA 4PVEA 5FR3A 3PPAA 3L8KA 1NEKB 4OJ6A 4O3MA 1S9FA 4OZBA 4D2KA 1WE7A 3MWCA 3THUA 5G5GA 7ICEA 3KD3A 2HHUA 3SQIA 3H0MB 3WA0A 2AGQA 1JXLA 4F3OA 1KFYB 1TT5B 3TEZA 4OCZA 3NUQA 5KFJA 1UQVA 3AI5A 3M3JA 2HTHA 1NJYA 2HD5B 1SKSA 5ALTA 1NHRA 3H4BA 2KD0A 2KMMA 4UAWA 1L3TA 1RYJA 2GGEA 3BDPA 3KLJA 1TBEA 5D2MB 5JU5A 3OJ3A 1KKOA 4K8GA 1HEZE 4ACOA 7ICUA 2G4DB 3T6CA 5L6FA 3QU5A 5KFIA 4ZOHB 2W7PA 1JN3A 1YD8U 2MJ3A 8ICQA 3HVDA 4N9F4 4GXBA 4F92B 1ELSA 4W9FA 4JN7A 1FM0D 2GSHA 9ICKA 1S1QB 1CI4A 2ZCCA 5FXDA 4DWIA 2JSVX 2X8GA 4GIVA 4JB3A 2JV3A 1TE2A 1AHZA 3H8JA 1ZD4A 3IG8A 4RT2A 3PW4A 4IRKA 3M8RA 4RNAA 3MABA 2KKVA 3F53A 4B9MA 9ICOA 4ROPA 4MEXA 4OW0A 3N9YC 3FXGA 3ZJUA 3MDAA 2WXJA 2F77X 1YZ7A 4OD0A 1FNUA 4NY0A 4MF8A 3BIID 2LM4A 3EF6A 4C80A 4XDCA 2JRZA 4KX5A 2PXIA 5KT2A 4GDLA 1ZMCA 3OZYA 3RNMA 3BZCA 4C8LA 5J2BA 2RPVA 2QJMA 3ZLGA 4IG7B 3CGCA 3P2BA 2WOVA 4LK0M 1ZQUA 2DLBA 1Q1RA 2CHXA 4XUSA 4C8KA 4K8DA 4USAA 1KJTA 3DWMA 4BURA 2D3GA 4FN2A 4HCLA 3HJEA 4ELUA 7ICJA 2PJHA 2WU5B 4KKIA 2K8AA 4Y2UA 2JZBB 2EKEC 1VQZA 4ZOHC 5DDYA 1ISNA 1XEEA 2V1YA 2ZW0A 4PYZA 2IO1B 3Q2AC 1TVAA 3BQ7A 3MHSD 3SAHA 4EC3A 1NHPA 1E9IA 1NK7A 4MT5A 4M6UA 2PP3A 2WF6A 1JUDA 2FMSA 5JCLA 1R0MA 2D8CA 3QXGA 1K8RB 2DYMA 3ZDEA 4K7UA 4UATA 4RCOA 2P3HA 3A9KB 3AEDB 5IIJA 4I2EA 1MO9A 4JWSC 3RNCC 1FRDA 3Q6BA 2VFRA 1SJHD 2GQTA 3OJUA 3EZ5A 2C7MB 4J9LA 1MG8A 2CU1A 2KFKB 1N48A 2R8JA 3ALBA 2HZGA 4PHDA 2FUG1 4JDRA 1FXTB 1B0XA 2MBHA 1A77A 2HI0A 5KFYA 1RYSA 3BYTB 3N97B 1WR6E 3URYA 5JH5C 4KEMA 1U9LA 1BVSA 2W54A 2V4RA 2R8GA 1LVLA 1XQQA 3AULA 3ZNHB 5AKLA 5HMRA 3O0FA 3TQPA 1WYWB 4J3ZA 1N6ZA 2KEYA 2G4SA 2JR5A 3QFBA 3NASA 2WF7A 4EMIA 1QH9A 2QIEB 3S2AA 3DDCB 4ANUA 4DK5A 2WXFA 2BCRA 2GMIC 3W8ZA 4I2FA 1ZOYB 1TJEA 3QUBA 4B6WA 5KFAA 2BT6A 1QQ5A 3K1RB 4UB3A 4TUPA 4B9KA 2PVGC 5CHWA 1R4NI 2D3DA 5ALVA 4WJOA 4GMEA 1OEPA 2R8IA 5ALIA 3Q3FA 4QZEA 3PRZA 2LJIA 4Q2JA 4F8CB 3GV8B 1WG8A 5KNIA 2PE6B 4F50A 1NDAA 4JQ9A 3FG2P 4QWDA 2MSED 2EZXA 3NRZA 3N7RC 3MFGA 4HN8A 1KN5A 5ALGA 1SGGA 2AL1A 2NMQA 2ZUBA 4RUCA 4O95A 4XX5A 4UQGA 4DSEA 2IJ0A 3A1QA 5A0LA 5BOEA 2KP7A 5CWRA 3AU2A 1ZUD2 3MHZA 5L1JA 4DNAA 1QSLA 2V9WA 1HTQA 2KIWA 2VH2A 3ICXA 4CCHA 1RXVA 1S3SG 5BYSA 4YFKA 1JOAA 3V5FA 4P4OA 3E2EA 2K3UA 3VUXA 1R6WA 1RAXA 4HKZE 4WJPA 3WU2U 4QZBA 3SR6A 1N56A 5D79A 4KPRA 4C4VA 4I28A 2PIAA 3U4FA 4BC9A 1LKYA 3QUCA 4NJ8A 2N1VA 3G6VA 3LDAA 4HDQA 3E0FA 5DQIA 2DW6A 2G3QB 3QHTA 3DK9A 2PE9A 3DVNV 2Q4WA 1JMSA 2RDXA 3OW1A 1S0OA 4W9KA 2G0AA 1BNOA 4NQLB 4XYCA 2XVTA 4GXIA 1U49A 1ZQKA 1Y8RC 1NU5A 2P66A 1ZRMA 4NY8A 5TSSA 3S47A 3TJIA 3PX6A 1ZR6A 4BBNC 3OHAA 3IJLA 1KKRA 1H4RA 2M1MA 3K4GA 1OEYA 3JSVB 3TAQA 5IOIA 4FE3A 4F5NA 2JEFA 4RQ4A 1UT5A 3SZ2A 4M9LA 5DB9A 3R7QA 2BYTA 1T5XD 1XNSA 1WMHA 4KLEA 4Y2TA 3T8QA 2B0CA 2CN1A 3LYSA 4DNSA 4O1NA 5EE0A 4RPXA 9ICIA 2ASQA 3WANA 1XXGA 2GRIA 4YSYB 4NZLB 2F76X 2DZJA 3NRZB 2K25A 2H88B 3DWGC 3WALA 2RMMA 1L0YB 1VLBA 3QZ7A 1KOTA 5J2KA 3ZDMC 1EXNA 1PVRA 4GN1A 2I9GA 4N59A 2L76A 4TVYA 3GO2A 1A6SA 1E10A 5J0TA 5J0WA 2G08A 3KUCB 2X38A 1ROEA 5KT6A 3LDZE 4OZCA 4EENA 2IHMA 1NZBA 1DK2A 1FIQA 5E6PA 1HA5A 2M0XA 1CRXA 4AQ7A 2AAQA 1XCQL 2JZPA 1WYGA 4EM4A 2EANA 3BS5B 3SD5A 4R66A 5EE3A 5KFUA 1T3QA 1QKZA 4H4YA 5FP0A 1M6IA 2KWDA 4GXJA 1EF5A 1T0SC 4MSMB 3TMPB 5DLFA 3AQEA 2Z8LA 3R2IA 2P8BA 2BKEA 5EWGA 2RABA 1HZ5A 3HW2A 5F9LA 3PO0A 3H12A 4DX3A 1RWSA 1FEHA 2L05A 4FJVB 4H4SA 5DG7A 1RZTA 2KJHB 3PX0A 3TFRA 1M6YA 9ICSA 2AL3A 3BVZA 3MTNB 4M47A 2FBWB 1W1KA 2ZJ5A 3ZVHA 1YX6B 2R2QA 4BXOB 4MGKE 5AKKA 1Z1BA 5AUKA 2I6XA 1WI0A 3F5AA 1RFKA 2MEKA 3UIOB 1MDRA 4DQSA 2AKZA 4H19A 5G5HA 2X8HA 2IOFA 4IKGA 2FLLA 5KT7A 1I4QA 2J0MA 2RLTA 3PRMB 4KX3A 1KRPA 4XZ4A 2HDEA 4C8MA 1RM6C 3KFUF 1QT9A 1ZJNA 3ISBA 2EAOA 2RDHA 8ICHA 2HMXA 1WM3A 5D7GA 5KFQA 1I4RA
chains in the Genus database with same CATH topology
1Y56A 3KLSX 4PT5A 4A55A 1C76A 3T3OA 1L0XB 3PZ8A 2BW2A 2PMVA 4C7YA 3AE2B 2XNAC 1FNWA 1NVID 2DWQA 3SR6B 3NVZB 2BS2B 2N9KA 3UI3A 2L83A 4RF1A 1W1QA 1EU4A 1AN8A 4J3OD 3A7UA 1QLBB 2O3GA 3B9JA 1DOYA 2UUUA 3AM9A 1AW7A 4ZRPA 3W5VB 2VFVA 1ZXHA 2Q5WD 4MACA 3ZYYX 1ZP0B 3MP9A 4YSXB 4L2YA 2OAIA 4HG0A 2MBRA 1EWYC 4DXGA 2J4XA 4GDLB 4PVKA 4TQ1A 2J42A 3GP7A 1J7BA 3V3XA 1KRHA 1GOZA 2WDRB 3GS2A 5FK9C 2I38A 1W1SA 1DYQA 1FCCC 1VJKA 1WVEA 3SEBA 2G1EA 3I57A 2NTSA 4REZA 5EE9A 3I9V1 3E9SA 3IAM1 4ITKA 2R2ZA 1L4ZB 3AE8B 2OEDA 1V1PA 5BMGA 1KH0A 1YN3A 2JWUA 3E56A 2G9HD 4YXDB 4IDIA 1VAOA 4WURA 3U4EG 3ABVB 4JX1C 5AWVA 2JYEA 1L4DB 2N9LA 4IOIE 1N63A 2N0SB 1QOAA 2HTME 3AEEB 4YTMB 1FRRA 3FW9A 3DQ0A 3IT4B 1TS3A 2IDYA 3O13A 4NAMA 1FCLA 5HHDG 4EE2A 3AB5A 2Y3SA 1FD6A 1A70A 4AS1A 1B1ZA 5H8YE 1X2GA 4RGOS 3KWLA 4KKJA 5ADZA 4ZHOA 3VRBB 4NJCA 1M4VA 2BBCA 1HQRD 1DIIA 2V4IB 3W9CB 4A8XC 2V0GA 1JQ4A 3TSSA 2QSDA 1OQRA 2W82A 1FFVA 1N62C 3RJ8A 3NVYB 5G5GB 4JE3B 1BXTA 1UWXA 2K9XA 4HJGE 3W5UB 2L52A 2WXGA 1TS4A 1N61A 2L32A 4XDDA 4UD8A 1TY0A 3VRAB 1FFVC 3P4RB 3J9CA 3VR9B 2IGGA 2I0KA 4C7ZA 2KDMA 2WDWA 2WXQA 3NS1B 3GB1A 3RJAA 4UDUC 3B2FA 2KN4A 1DOXA 3TEWA 1GPXA 2QKNA 3JS8A 5AE1A 3LLBA 3VTEA 3TEYA 2GQUA 3Q8CA 2K5PA 1P7FA 2VZKB 1W1LA 5EE1A 3WCQA 4PWBA 5HQXA 4TQ0A 3B2GA 1MPEA 2WXRA 2WDQB 2D5GA 1N63C 2EKIA 1VR9A 2H89B 3AE1B 4DXFA 1JWAD 2RDGA 3S1DA 1KTKA 1BUIC 5HG2A 4JB1A 2NQWA 3NVWA 2N7JA 2IPKD 1PUTA 2VZKD 2SEBD 1IBXB 3AE7B 3TSHA 2P4PA 1E8FA 3I99A 4PVHA 3LYYA 1ZDXA 5GXGB 2AX5A 1N5WA 2E6XA 1UXYA 1ESFA 4XLOA 1JALA 1C79A 1ZE3D 1TZOA 1N60A 1IGCA 1TS5A 1C9FA 1IBXA 1AHVA 1DOIA 2IPIA 1V1OA 1JRPA 3ZQ4A 1FXAA 1IGDA 2UUVA 1XCTL 4FXCA 2JQRB 3BVGA 3Q8AA 5C2TB 1E9MA 1SE4A 5HI1A 5K8EA 5I4DA 1ET9A 3AMZA 3AEFB 5JXVA 3TEXA 3HUIA 1C4AA 1C77A 3SFEB 2CJOA 3S1CA 4TSSA 5C3JB 2W55A 4OALA 1EWCA 1UNSA 2ICIA 4WH4A 2R8DA 2KQ4X 4HRSA 1AHUA 4US9A 2Y3RA 2WQYB 2IGDA 3TX1A 2XN9C 4N6EB 3RFZB 4RF0A 1N62A 2MH7A 4RH6A 1QOGA 3NS1A 3BVMA 4L23A 3T3NA 1W1RA 1SB3C 2ON8A 3P4SB 1XF5L 1E8HA 3U2SC 1SSNA 3PQBA 2E5AA 3L4PA 1NI3A 1WWTA 1PGAA 4XE0A 2K0PA 2BS4B 1YJIA 4M0WA 4KGTA 5FKAC 1SB3B 3EUB3 1QQRA 4TVWA 1D4BA 2JU6X 1T6BX 3W2DA 1XLQA 3NVVA 3ZGZA 2DYOA 1UGJA 1TYGB 3PM9A 4BCAA 1OQQA 1VZ7A 3AEGB 2GI9A 2JXTA 2L1AA 2CU3A 1NYRA 2SAKA 1JWSD 2WNMA 2WXIA 3KWVA 3EA6A 4RGNA 1C78A 1N5XA 1QLTA 1K51A 2LMCA 4KX6B 3Q69A 1MBTA 2KACA 5BMHA 5D3IB 2MJDA 1CQVA 2QMTA 1WXQA 2WU2B 1TKGA 3KQ4A 2EELA 1E6EB 2WLBA 3LXFA 1HXYD 1HZ6A 1ZPSA 2TSSA 5BYRA 1EM7A 2BB5A 2AQ2B 4PVEA 2EXRA 1YJJA 1R7SA 2WS3B 3PZ7A 1NEKB 4OZBA 4D2KA 4DQOC 1JMLA 5FR3A 1D5ZC 5G5GA 3HVZA 3NVYA 2M56B 4BBYA 3NZ3A 1KFYB 1FFUA 3TEZA 1VDVA 1FNVA 1P7EA 2VFUA 4PVJA 1JROA 1FMAD 5L6GA 4ARIA 2KMMA 4TMAB 1YN4A 1FO4A 1SJED 1RYJA 4WWMA 1LO5D 3Q8BA 1DZNA 4PYTA 1CJEA 1W1MA 1DGJA 4LTUA 1UWMA 2Q85A 1HEZE 1JWUD 1KLUD 1RM6B 5L6FA 3AEBB 4ZOHB 2MJ3A 1VZ6A 1ZXIA 3HVDA 3Q8EA 1PDXA 3U52E 1FM0D 4YSZB 1D6EC 4CQNA 5FXDA 3IT6B 4MLAA 2JSVX 3CWIA 1OFFA 4RGMA 1PFDA 1GB1A 1AHZA 1I4XA 3ETRA 2BS3B 2Y5CA 3W1SA 4RNAA 4GLSC 1YNTE 1EU3A 4P16A 4OW0A 4JWUC 3N9YC 4HKQA 3ZJUA 1SEBD 3HSUA 2WXJA 2KAJA 1FNUA 3GSYA 1K52A 1PGXA 4GDKB 2QILA 3BIID 1N61C 1JCKB 4C80A 4H2AA 4XDCA 3VQIA 5G5HB 3R8BA 1E7PB 3SFDB 1XLPA 2JX5A 1YMHE 1SIJA 2RPVA 1NYQA 2PW9A 1ENFA 1MHHE 4LK0M 1GAQB 2DLBA 1X2HA 1I4GA 3FW7A 4USAA 2ZW1A 4XWWA 3DWMA 5LNK1 1N5WC 1TY2A 1SBBB 1D5XC 2WU5B 1L6UA 3BK2A 4KKIA 4P6VF 1YQ3B 3NVZA 1VQZA 4ZOHC 1XEEA 2ZW0A 2VAOA 5HFYA 1I4PA 3ETRB 4EC3A 2P13A 2ACZB 1CZPA 4MT5A 5MPOA 1QOFA 1JW9D 2DYMA 1MVKA 2M0AA 1I4HA 4RCOA 1YN5A 2BTEA 2P3HA 3AEDB 3P42A 4JWSC 4L1BA 1FRDA 2VFRA 3CIRB 3AE9B 1SJHD 2GQTA 3P4QB 5FXEA 5FXPA 2PKOA 3H8HA 1TKEA 2BVHA 1XO3A 2PTLA 3MJ5A 1QLUA 2AXRA 3NVVB 2QEJC 4C56C 3TUOA 1GB4A 1L0VB 2FUG1 1IUEA 1MBBA 2YEPB 1SE3A 3BYTB 3URYA 4B0MA 2BVFA 1QILA 2BVGA 3MC0B 2W54A 3U7ZA 2RK5A 1VRAB 1FXIA 4YTNB 3P63A 4JAYA 5HMRA 4ZRQA 1C4CA 1XLNA 4ARCA 1E0YA 2DBYA 2PLSA 1K50A 2LUMA 2ONQA 1MI0A 4PZFA 3D2JA 1PGBA 4MH8A 1WSPA 3IAS1 3AH7A 3ZJTA 2QIEB 1JWBD 2WXFA 1ET6A 4BC7A 1TS2A 3W8ZA 1ZOYB 2QJLA 3C8YA 1V8CA 1TJEA 1AYFA 2BT6A 1JWMD 2YEPF 2PVGC 4N58A 3NUHB 1STEA 3P4PB 2WXKA 2FE8A 1W1JA 2LJIA 4Q2JA 2K22A 3P1MA 3AE5B 1J7AA 3IXSA 4HROA 2PLPA 4YWGG 3EGRA 1QF6A 1W1OA 5FXFA 5T8IA 1Q10A 2E3TA 2NTTA 3NRZA 1C4PA 2W3RA 4LLGM 3MFGA 3HRDC 2W3SA 4ML8A 5I1VA 2IGHA 2J52A 2NMQA 4O95A 3LAEA 2YVSA 2IJ0A 4WQMA 2INNE 3BW7A 4OVZA 3B9JB 1ZUD2 3BZDB 3MHZA 1PYWD 2WXMA 4JPSA 5BYSA 3VR8B 2CJNA 4KGSA 1DIQA 4OZAA 2MJEA 2K3UA 4XWTA 4HKZE 2Y4GA 3FAHA 2R61A 3SR6A 5D79A 1UUPA 1T3QC 3D2HA 1F77A 2PIAA 3FILB 4MM3B 2J53A 5H92C 4BC9A 1TKYA 2QPMA 2VFSA 5BYQA 1F2RC 3RPFC 3HRDD 3AV8A 4YTPB 2PLIA 3DEDA 5AE3A 1WRIA 1J7CA 2Q4WA 1MHXA 1HSKA 2V3NA 4ZYSA 1F0XA 3R07C 1QOBA 2WXOA 5TSSA 1SE2A 2VFTA 1ZR6A 4RFBA 1F0ZA 3ZJVA 2WXHA 1F2RI 2Y08A 2B76B 1WVFA 1N60C 3C0PA 2Y3AA 1NENB 2BYTA 1T5XD 2M19A 4DNSA 1K53A 2INPE 1L6VA 4O1NA 5D7GA 1D5MC 5EE0A 3EUB2 1XXGA 2GRIA 4YSYB 1CK1A 3W8WA 4NZLB 3R2TA 3NRZB 1KLGD 1I19A 2H88B 2PVOD 3DWGC 1I7HA 2RMMA 5D3DA 1XLOA 3AE4B 1L0YB 5I1WA 1FFUC 1VLBA 5AE2A 3Q8FA 1WGKA 3FW8A 3S1EA 2AQ1B 4N59A 4TVYA 4PWCA 5BMIA 2AQ3B 2LGIA 3OWEB 1E10A 3W8XA 1FIQB 2WXLA 3D2DA 1ZDVA 1L5PA 2X38A 1E8GA 1V97A 1ROEA 4OZCA 2BB6A 3AN1A 1FIQA 1HA5A 4WAFA 4B0EA 4AQ7A 3BK1A 1XCQL 2JZPA 1WYGA 3BWUD 2WXNA 2LFIA 3FILA 1SXTA 3BYYB 1QKZA 2LEKA 2V3PA 1T3QA 5EE3A 1V1PB 2KWDA 2OHFA 3AE6B 4WIPA 1VZ8A 3FC4A 4US8A 2Z8LA 3R2IA 4NAWB 4R3DA 1SF0A 5AUIA 3LB8C 1HZ5A 3POPA 2WXPA 3PO0A 4YT0B 1RWSA 1FEHA 3A7RA 1AWDA 2LHDA 3TSJA 4KGRA 2Y5PA 2LHEA 3BVZA 2I2YA 1W1KA 3S1FA 2FBWB 5HHZA 5E6JA 1BMLC 2WP9B 4OHJA 5AUKA 4HEA1 4RGTA 3AEAB 2MEKA 1RFKA 3NVWB 3V05A 2GB1A 1YQ4B 5G5HA 1KF6B 4A6QA 4IKGA 1I4QA 2JYTA 4ZHPA 3KJMA 3FWAA 2HDEA 4A9AA 1QT9A 1RM6C 1ACCA 1B9RA 2RDHA 3AE3B 4A90A 1E0ZA 1ZXIC 2WDVB 3AECB 3A7AA 1I4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7Y A;  3AE2 B;  1NVI D;  2DWQ A;  3SR6 B;  3NVZ B;  2BS2 B;  2L83 A;  1W1Q A;  3A7U A;  1QLB B;  2O3G A;  3B9J A;  3AM9 A;  3W5V B;  2VFV A;  2Q5W D;  3ZYY X;  1ZP0 B;  4YSX B;  4HG0 A;  2OAI A;  2MBR A;  1EWY C;  4PVK A;  1J7B A;  1KRH A;  2WDR B;  1W1S A;  1VJK A;  1WVE A;  2G1E A;  5EE9 A;  4ITK A;  2R2Z A;  3AE8 B;  4YXD B;  4IDI A;  1VAO A;  3ABV B;  4JX1 C;  1N63 A;  2N0S B;  1QOA A;  2HTM E;  3AEE B;  4YTM B;  1FRR A;  3FW9 A;  3DQ0 A;  3AB5 A;  1A70 A;  5H8Y E;  1X2G A;  3KWL A;  5ADZ A;  4ZHO A;  3VRB B;  1DII A;  3W9C B;  1JQ4 A;  1OQR A;  1N62 C;  1FFV A;  3NVY B;  5G5G B;  2K9X A;  3W5U B;  2L52 A;  1N61 A;  4UD8 A;  3VRA B;  1FFV C;  3P4R B;  3VR9 B;  2I0K A;  4C7Z A;  3NS1 B;  3B2F A;  1DOX A;  1GPX A;  2QKN A;  3JS8 A;  5AE1 A;  3LLB A;  3VTE A;  2GQU A;  2K5P A;  1W1L A;  5EE1 A;  3WCQ A;  4PWB A;  5HQX A;  3B2G A;  2WDQ B;  1N63 C;  2EKI A;  2H89 B;  3AE1 B;  1JWA D;  3S1D A;  4JB1 A;  2NQW A;  3NVW A;  1PUT A;  3TSH A;  3AE7 B;  2P4P A;  1E8F A;  3I99 A;  4PVH A;  5GXG B;  2AX5 A;  1N5W A;  1UXY A;  4XLO A;  1JAL A;  1N60 A;  1AHV A;  1DOI A;  1JRP A;  1FXA A;  4FXC A;  2JQR B;  5C2T B;  1E9M A;  3AMZ A;  3AEF B;  3HUI A;  3SFE B;  2CJO A;  3S1C A;  5C3J B;  2W55 A;  4OAL A;  2R8D A;  4HRS A;  1AHU A;  4US9 A;  2WQY B;  3TX1 A;  4N6E B;  1N62 A;  2MH7 A;  1QOG A;  3NS1 A;  1W1R A;  1SB3 C;  3P4S B;  1E8H A;  2E5A A;  3L4P A;  1NI3 A;  1WWT A;  2BS4 B;  1YJI A;  1SB3 B;  3EUB 3;  4TVW A;  1XLQ A;  3NVV A;  1TYG B;  2WDV B;  3PM9 A;  4BCA A;  1OQQ A;  3AEG B;  2CU3 A;  1NYR A;  1QLT A;  1N5X A;  4KX6 B;  1MBT A;  2MJD A;  1WXQ A;  2WU2 B;  1TKG A;  1E6E B;  2WLB A;  3LXF A;  4PVE A;  2EXR A;  1YJJ A;  1R7S A;  2WS3 B;  1NEK B;  5G5G A;  3HVZ A;  3NVY A;  2M56 B;  4BBY A;  1KFY B;  1FFU A;  1VDV A;  2VFU A;  4PVJ A;  1JRO A;  1FMA D;  2KMM A;  1FO4 A;  1RYJ A;  4WWM A;  1DZN A;  4PYT A;  1CJE A;  1W1M A;  1DGJ A;  4LTU A;  1UWM A;  2Q85 A;  1RM6 B;  3AEB B;  4ZOH B;  2MJ3 A;  1ZXI A;  1PDX A;  1FM0 D;  4YSZ B;  5FXD A;  4MLA A;  3CWI A;  1OFF A;  1PFD A;  1AHZ A;  3ETR A;  2BS3 B;  2Y5C A;  4JWU C;  2KAJ A;  3GSY A;  3BII D;  1N61 C;  4C80 A;  5G5H B;  1E7P B;  3SFD B;  1XLP A;  2JX5 A;  1SIJ A;  1NYQ A;  1GAQ B;  1X2H A;  3FW7 A;  4USA A;  3DWM A;  1N5W C;  2WU5 B;  1L6U A;  4P6V F;  1YQ3 B;  3NVZ A;  1VQZ A;  4ZOH C;  2VAO A;  3ETR B;  4EC3 A;  2P13 A;  2ACZ B;  1CZP A;  5MPO A;  1QOF A;  1JW9 D;  2P3H A;  3AED B;  4JWS C;  1FRD A;  2VFR A;  3CIR B;  3AE9 B;  2GQT A;  3P4Q B;  5FXE A;  5FXP A;  2PKO A;  1TKE A;  2BVH A;  1XO3 A;  1QLU A;  2AXR A;  3NVV B;  1L0V B;  1IUE A;  1MBB A;  2BVF A;  2BVG A;  2W54 A;  2RK5 A;  1FXI A;  4YTN B;  3P63 A;  4JAY A;  5HMR A;  1XLN A;  1E0Y A;  2DBY A;  2PLS A;  4PZF A;  3D2J A;  3AH7 A;  2QIE B;  1JWB D;  4BC7 A;  3W8Z A;  1ZOY B;  2QJL A;  1V8C A;  1TJE A;  1AYF A;  2BT6 A;  2PVG C;  4N58 A;  3P4P B;  1W1J A;  2K22 A;  3P1M A;  3AE5 B;  1J7A A;  4HRO A;  1QF6 A;  1W1O A;  5FXF A;  2E3T A;  3NRZ A;  2W3R A;  3HRD C;  2W3S A;  4ML8 A;  4O95 A;  3LAE A;  2YVS A;  4WQM A;  3BW7 A;  3B9J B;  1ZUD 2;  3VR8 B;  2CJN A;  1DIQ A;  2MJE A;  3FAH A;  5D79 A;  3SR6 A;  1T3Q C;  3D2H A;  2PIA A;  5H92 C;  4BC9 A;  1TKY A;  2QPM A;  2VFS A;  3RPF C;  3HRD D;  3AV8 A;  4YTP B;  2PLI A;  3DED A;  5AE3 A;  1WRI A;  1J7C A;  2Q4W A;  1HSK A;  3R07 C;  1F0X A;  1QOB A;  2VFT A;  1ZR6 A;  1F0Z A;  2B76 B;  1WVF A;  1N60 C;  3C0P A;  1NEN B;  2M19 A;  4DNS A;  5EE0 A;  1L6V A;  3EUB 2;  3W8W A;  4YSY B;  3NRZ B;  1I19 A;  2H88 B;  2PVO D;  3DWG C;  1I7H A;  1XLO A;  3AE4 B;  1FFU C;  1VLB A;  5AE2 A;  1WGK A;  3FW8 A;  3S1E A;  4N59 A;  4TVY A;  4PWC A;  1E10 A;  3W8X A;  1FIQ B;  3D2D A;  1L5P A;  1E8G A;  1V97 A;  1ROE A;  3AN1 A;  1FIQ A;  1WYG A;  2LEK A;  5EE3 A;  1T3Q A;  2OHF A;  3AE6 B;  3FC4 A;  4US8 A;  5AUI A;  1SF0 A;  3LB8 C;  3PO0 A;  4YT0 B;  1RWS A;  3A7R A;  1AWD A;  3TSJ A;  3S1F A;  1W1K A;  5HHZ A;  2FBW B;  2WP9 B;  5AUK A;  3AEA B;  1RFK A;  3NVW B;  1YQ4 B;  5G5H A;  1KF6 B;  4ZHP A;  3KJM A;  3FWA A;  4A9A A;  1QT9 A;  1RM6 C;  1B9R A;  3AE3 B;  1ZXI C;  1E0Z A;  1DOY A;  3AEC B;  3A7A A; 
#chains in the Genus database with same CATH topology
 4O5K A;  2QJJ A;  2FJ6 A;  2LVO A;  4QZI A;  2Q4T A;  1GRF A;  4BKT A;  4F4R A;  1XO1 A;  2YVF A;  2PMV A;  4E4F A;  2XNA C;  2OO6 A;  3TQ1 A;  1NVI D;  3H7P A;  4UB8 U;  4II3 B;  4ACF A;  1TE6 A;  4ZH4 A;  3UI3 A;  3MFI A;  4DSI A;  2L83 A;  4JV1 A;  2D3C A;  1WWV A;  1WJU A;  1EU4 A;  1AN8 A;  1QTM A;  2DNF A;  4JV0 A;  4DQQ A;  2IY1 B;  4UAS A;  4AYB F;  1QLB B;  2MBQ A;  1L3S A;  2XID A;  3RO6 A;  3H9D A;  3ZYY X;  3AUO A;  2A1A A;  4MFC A;  4YSX B;  2NVU I;  1SL2 A;  1GC7 A;  1LV5 A;  1V2Y A;  3PRE A;  4W9J A;  1EWY C;  4NQK E;  3ZVV A;  2MAX A;  1W6T A;  3ZVH B;  3ZLH A;  3DGB A;  2KWC A;  4WJQ A;  2N9X A;  2J42 A;  4OVV A;  5J2G A;  4TQ1 A;  1KRH A;  2Z59 B;  1S8O A;  1SKW A;  1SGH A;  1XD3 B;  4AUQ C;  2F5Z A;  3IN5 A;  3V4B A;  3M9M B;  3SAF A;  2LUE A;  4IR9 A;  3T5J A;  2XK5 A;  1FPY A;  4NLK A;  1GG3 A;  2ZXI A;  1KFS A;  1WXS A;  1WXM A;  3VH4 B;  5J2A A;  4ITK A;  3NGD A;  1PK1 A;  2W8K A;  2DEN B;  2Z0E B;  3VTU A;  5J8Y A;  2W9C A;  3GIM A;  1KH0 A;  3FYH A;  3QEB Z;  1WJ4 A;  2JWU A;  3EC8 A;  3PHX B;  3W1S C;  1ECQ A;  4F5Q A;  4IDI A;  3H7S A;  1V80 A;  1SWV A;  3QNM A;  1L4D B;  8ICS A;  2N9L A;  4HJK A;  2ZTC A;  5AK3 A;  1QOA A;  5FJR A;  3FW9 A;  2YMP A;  1ECW A;  3EAO A;  3TCS A;  3O13 A;  1FCL A;  4K3B A;  2A1J B;  5IIN A;  9ICP A;  5KFB A;  1E7V A;  1OW5 A;  2MRL A;  3AB5 A;  4EE2 A;  4ECS A;  3QU4 A;  2DAF A;  1FD6 A;  2V9H A;  1B1Z A;  4AS1 A;  7ICS A;  3D2N A;  1E8Z A;  4MEL A;  3DH9 A;  4CE6 A;  1T4G A;  4KKJ A;  3ZDT A;  2WF9 A;  3PX4 A;  4DQI A;  2BQQ A;  2KFN A;  1DII A;  2V4I B;  4A8X C;  2MRP A;  4NM1 A;  3RNF C;  1JEH A;  2FPM A;  2JH1 A;  5AI8 A;  5DGA A;  1PDY A;  3DFY A;  4HJG E;  3PML A;  5TR3 A;  4GOC A;  2WXG A;  2L32 A;  2YTU A;  3H4D A;  2JRI B;  3GII A;  4UD8 A;  2AL6 A;  2KFZ A;  3VRA B;  4MEY A;  2HOF A;  2FPL A;  1MRA A;  2IGG A;  2WWZ A;  2KDM A;  5KT5 A;  3Q8Q B;  2BZF A;  2KC1 A;  3N4E A;  3NS1 B;  2CR5 A;  3GB1 A;  2H5X A;  3MR6 A;  1ZQS A;  4QZ9 A;  1C20 A;  2KDF B;  1NJZ A;  4W9H A;  3UIN B;  5EDS A;  1IV8 A;  4P1C C;  3RBD A;  1NK5 A;  1RDF A;  4RT3 A;  4DQP A;  3ZNG C;  1JDF A;  1L2N A;  8ICF A;  3VTE A;  3TEY A;  1GRT A;  1S5L U;  4A3P A;  5HP4 A;  3I76 A;  5EE1 A;  4IWP A;  3MGV A;  4FUL A;  3GRS A;  3ETL A;  4B9U A;  1VD2 A;  4FJZ A;  4PWB A;  3FCP A;  4QZ8 A;  5L1L A;  2WXR A;  2KXJ A;  1G6J A;  2D5G A;  1N63 C;  2EKI A;  8ICA A;  3PTF C;  3T5K A;  3AE1 B;  3JPN A;  2ZIV B;  2ZUD A;  4O3O A;  3KHH A;  1JWA D;  4IQW A;  2PMQ A;  5D46 A;  2W7O A;  5IA7 A;  4JB1 A;  2NQW A;  3NVW A;  2NBV B;  2IND C;  2IPK D;  2K1F A;  2K6D B;  1IBX B;  8ICY A;  4K7W A;  4IL0 A;  2NRX A;  3STP A;  3KZX A;  4PVH A;  5KFP A;  1UCV A;  1Y88 A;  3LYY A;  2NVK X;  2C9W B;  1N5W A;  4LNI A;  1UXY A;  4JWM A;  1ESF A;  5KG3 A;  2O2V B;  1GEU A;  3H8W A;  1C79 A;  1ZE3 D;  5GMV A;  1YT3 A;  1IBX A;  1ZMD A;  2NRZ A;  4EQR A;  1R4M I;  3P0W A;  2FI1 A;  1IGD A;  4PZN A;  1U47 A;  4GIS A;  3V61 A;  5HI1 A;  2EZZ A;  4NJ7 A;  1ET9 A;  3AMZ A;  4RQM A;  3AEF B;  4W9G A;  1YZ6 A;  1C4A A;  5E6O A;  1WIA A;  1WM2 A;  1T0Q C;  3RCY A;  4TSS A;  5C3J B;  4G9B A;  3RRH A;  3RN9 C;  5JRB A;  4GU2 A;  4BKS A;  2PTX A;  3H6N A;  3PWI A;  4ZRI A;  2R8D A;  2KQ4 X;  4HRS A;  2DGZ A;  5AKH A;  2Y3R A;  2W11 A;  2XCP A;  2WQY B;  4KZ0 A;  3BS7 A;  4YMO A;  1TTN A;  2IO3 B;  7ICF A;  4RF0 A;  3GU3 A;  1XS9 D;  4XA5 A;  3BVM A;  3NS1 A;  4L23 A;  4HYR A;  3M1Y A;  8ICI A;  2PPG A;  1TKK A;  4AP4 C;  3RH5 A;  1MA7 A;  3L5O A;  5JHB A;  2W43 A;  5KFW A;  4HNL A;  7ICT A;  2E5A A;  3L4P A;  1TZ1 A;  3OLM D;  1KSP A;  1PGA A;  3WAM A;  4W9E A;  2K0P A;  2OH2 A;  2JK6 A;  4M0W A;  1L7N A;  3ZDC A;  4JL9 A;  2BWF A;  3I6E A;  4MGY E;  2LHT A;  3WKD A;  3JZU A;  2IHN A;  3N30 A;  3ZRC A;  1ZET A;  4AJY B;  1SB3 B;  1SZP A;  3N1Z C;  5HR7 A;  4DS5 A;  1QQR A;  2C5L C;  1U48 A;  2JU6 X;  1D4B A;  4H4P A;  1SV4 A;  2LBO A;  4K81 A;  2W9N A;  5FS9 A;  4O5C A;  5JCK A;  4IP4 A;  3MGI A;  1MJD A;  1WX9 A;  1IYX A;  2KVR A;  4IT1 A;  4GB9 A;  1TYG B;  3GZN B;  1OQQ A;  5DBC A;  2KZZ A;  3VA8 A;  3DJJ A;  5G55 A;  3RJH A;  1VZ7 A;  3AEG B;  5H2F U;  2GI9 A;  2KHW B;  2CU3 A;  5AM0 A;  1NI2 A;  2PMZ C;  1F44 A;  3KOO A;  1WX7 A;  3KWV A;  2W0H A;  4JN8 A;  4RGN A;  1C78 A;  1N5X A;  4ECQ A;  9ICA A;  2I1J A;  1ZDL A;  2LMC A;  4KX6 B;  1GET A;  1WCL A;  2KAC A;  4HWI B;  5D3I B;  4NM2 A;  1CQV A;  2MJD A;  4A20 A;  2LYB A;  1WXQ A;  3FV9 A;  4H4R A;  4HCD A;  3QYP A;  2J6T A;  1TKD A;  4ED1 A;  2B21 A;  3CYM A;  3WK9 A;  4C4V B;  4GR1 A;  2Y9T A;  2W9C B;  2Y0S F;  3JVA A;  2NR2 A;  3A9J A;  3LXF A;  1HXY D;  1UD7 A;  3ZI4 A;  2YB4 A;  4HCH A;  7ENL A;  1SJC A;  5DPS A;  2LMR A;  2QC8 A;  2BB5 A;  2HHT A;  2N7E A;  1UH6 A;  4DQO C;  2HHQ A;  3J81 j;  4M0A A;  2MQJ A;  2WHI A;  2PTY A;  1E7U A;  2M56 B;  3N3K B;  4M0X A;  2KHV A;  3NZ3 A;  2PFP A;  1FFU A;  5ALZ A;  4FO6 A;  1P7E A;  2VFU A;  1Q1O A;  4MGG A;  5KG6 A;  1TYT A;  4NXZ A;  4C4T A;  1ZYQ A;  3HT3 A;  5EBK A;  2MSN A;  3V7L A;  3GZF A;  1LO5 D;  4RPY A;  1TAM A;  3PY8 A;  3ZIM A;  5KFH A;  1UWM A;  3DBL I;  2Q85 A;  5DBA A;  4F72 A;  2IO2 B;  3ZTD A;  5TIS U;  2PMZ F;  3CW2 C;  1MUC A;  5DB6 A;  2OM6 A;  3UJ2 A;  1VZ6 A;  1ZXI A;  2IY0 B;  2OCE A;  4ECV A;  2FCN A;  4YSZ B;  4URK A;  3T5L A;  1D6E C;  4EQX A;  5J0S A;  1X9S A;  3PGE A;  5DG9 A;  5EWE A;  2KJR A;  2ONE A;  1PFD A;  2N9P C;  1GB1 A;  2MUC A;  3CB3 A;  2PU0 A;  5AM2 A;  2Y5C A;  2XCA A;  1YX5 B;  4TUR A;  3OZM A;  3A33 B;  4IR1 A;  1B22 A;  5AM4 A;  2JZ3 B;  4HKQ A;  4IUM B;  1BZL A;  3JYU A;  1ZD5 A;  5IIM A;  4F1S A;  2AH5 A;  8ICX A;  1UGM A;  1N61 C;  2YVG A;  2OZ8 A;  3KKA C;  1WY8 A;  3GIL A;  4H2A A;  3VQI A;  5G5H B;  3WK5 A;  3MR2 A;  3TOY A;  4Y2Q A;  1YMH E;  1E8Y A;  2MCN B;  2AYO B;  2IBK A;  1NYQ A;  5JUM A;  4EBE A;  3VCN A;  1GAQ B;  2EQ9 A;  4BJQ A;  2KX3 A;  1Z00 B;  3UXP A;  2KK0 A;  1NZP A;  1X2H A;  1I4G A;  4XWW A;  4RQ2 A;  2PFO A;  3TWA A;  4KTQ A;  1TY2 A;  4A8E A;  1S10 A;  3BSM A;  1D5X C;  3BK2 A;  2V3S A;  3KUD B;  2KVS A;  4TUU A;  4P6V F;  2MA9 B;  3NVZ A;  2G09 A;  3QFA A;  1ZQI A;  1TGZ B;  2ZNV C;  2VAO A;  3QIJ A;  3O65 B;  2F1J A;  3QEA Z;  4RMA A;  1VJ5 A;  5HFY A;  2QKQ A;  2P13 A;  3JVZ X;  2C7H A;  5KVI A;  5G2N A;  4DL3 A;  1QOF A;  2NYV A;  5L1M A;  5BOF A;  3DDH A;  1I4H A;  2BTE A;  2AL2 A;  1JCT A;  2LKY A;  4NLC A;  4DFD A;  1XS2 A;  4DHZ E;  1JXE A;  3EFC A;  4K7S A;  4FS2 A;  1KM7 A;  4Z6E A;  3GRT A;  3IP4 B;  4NLN A;  5FXE A;  1ZY8 A;  2KMC A;  3H8H A;  3EJE B;  4H4V A;  2W9M A;  2BVH A;  2LXC A;  3NVV B;  2DX5 B;  2KQ7 A;  3C5G A;  1L0V B;  1V49 A;  1V6E A;  2WHE A;  1O03 A;  1YIW A;  2YEP B;  4PL2 A;  2OG9 A;  1BGX T;  4BGD A;  3MC0 B;  4LJP B;  2BVG A;  4WAA A;  3MZN A;  2OOB B;  3QU7 A;  1DTN A;  5IIK A;  4O3R A;  5CHF A;  3EAN A;  4ZRQ A;  1V85 A;  3RB3 A;  1C4C A;  1T0R C;  4ARC A;  4FP1 A;  5KG1 A;  2W9B B;  4DL6 A;  5CEH A;  3RJK A;  1V81 A;  1UHU A;  5C23 A;  4DHJ D;  4PGY A;  2Q0Z X;  1PGB A;  4MH8 A;  8ICW A;  4KIK B;  4H83 A;  3R25 A;  2ZTE A;  2AHO B;  2XEW A;  2ZNV B;  1GES A;  1L5U A;  2GR3 A;  1NHS A;  2JXJ A;  2ZIX A;  1HUO A;  3UCD A;  3R9K A;  4NJ6 A;  3T9P A;  2VKQ A;  4RQ8 A;  3C8Y A;  4EYI B;  3KHR A;  5KT3 A;  3WKC A;  3NO1 A;  1JWM D;  2WGS A;  2UVU A;  4X5V A;  4FBU A;  4DHZ B;  2FE8 A;  4PS3 A;  5FR6 A;  3RTV A;  1IPG A;  3O0H A;  2K22 A;  3SBF A;  3P1M A;  2CS4 A;  1J7A A;  2HJ1 A;  2PLP A;  3NZS A;  3IRU A;  3EGR A;  4FX9 A;  4JQW C;  3HIZ A;  2KLC A;  2BYE A;  3IBE A;  5HR6 A;  5T8I A;  5FXF A;  1JRU A;  2PPH A;  3HKZ C;  1C4P A;  2NTT A;  2W3R A;  2WDT B;  1GRH A;  4MSQ B;  6ENL A;  1M94 A;  4JGH B;  2OQH A;  4YWO A;  3RNA C;  3ZRF A;  1U4B A;  1ZQW A;  2JPH A;  1WCN A;  4OVZ A;  4WWO A;  3BZD B;  4KIT B;  1DXL A;  2OFJ A;  4I2H A;  3LB8 A;  2CJN A;  3KHG A;  1TV9 A;  1DIQ A;  2BCP A;  4ADW A;  3PHW B;  2HXU A;  2MJE A;  4XWT A;  2LI5 A;  1SKR A;  5KFT A;  4BOS C;  1EBD A;  5J0Q A;  1LFD A;  3FIL B;  5AIC A;  4F8R A;  2J53 A;  4ZCW A;  3H8S A;  4GGQ A;  4ASW C;  1L7O A;  2NRT A;  2MBO A;  2KJ8 A;  3RR1 A;  4BFR A;  4HPP A;  3HRD D;  1Z19 A;  3DBR I;  1IIP A;  2F8L A;  4NLG A;  4YTP B;  2PLI A;  1X40 A;  2LD9 A;  1J7C A;  1A5R A;  4BUG A;  3OTQ A;  3GFK B;  4Y2X A;  2V3N A;  1XDI A;  4HAI A;  5DBB A;  4ZYS A;  2EMS A;  1QOB A;  1KW4 A;  1PZN A;  4II2 B;  1MG4 A;  1SE2 A;  3QA8 A;  2YX8 A;  7ICN A;  1F0Z A;  3URH A;  4DSK A;  4KWS A;  5FS6 A;  3PFR A;  3FYY A;  2WXH A;  1VCB A;  4EKU A;  3ISD A;  4DEZ A;  1F2R I;  2Y08 A;  2B76 B;  4EMJ A;  4KLL A;  4GFJ A;  2R8H A;  2FYM A;  4I2A A;  2IBI B;  2MBE A;  3SEN A;  5J2H A;  2M19 A;  1YQZ A;  3S6J A;  2DF4 B;  2INP E;  1GRE A;  3ZDA A;  4B9L A;  3DGZ A;  4C8O A;  4KLG A;  2EQY A;  2L00 B;  1KLG D;  3ISC A;  2D11 A;  2WPC A;  1IM4 A;  4F4Z A;  1DRG A;  5LXI B;  5ENL A;  2BQ3 A;  4KLD A;  1DGS A;  5AE2 A;  1WGK A;  3N32 A;  4CF5 A;  4YMM A;  3ECI A;  4PWC A;  2MBB B;  2LGI A;  1ZQE A;  4Z6F A;  3GV7 B;  1L5P A;  1E8G A;  1GRG A;  3VCC A;  2BB6 A;  3PLU A;  4UAR A;  4HCN B;  2NO4 A;  5BPC A;  3BQ1 A;  3QU2 A;  5D4B A;  3I63 C;  4WAF A;  1J19 A;  4IS7 A;  3UQ0 A;  4ED2 A;  7ICO A;  1QLN A;  3VCB A;  2LFI A;  4B9N A;  3RJJ A;  3BJY A;  4DXK A;  4FA6 A;  1TAU A;  2ZG6 A;  4GFI A;  2FCM A;  1BPX A;  4IRC A;  3QWZ B;  3AE6 B;  3VHT C;  4WIP A;  3FC4 A;  4US8 A;  3LVW A;  4LZG A;  4NAW B;  1SF0 A;  1XAN A;  4H4U A;  3LB8 C;  4Q45 A;  2LWP A;  2R18 A;  4Y2S A;  8ICL A;  4AWJ A;  3DBL B;  2UVR A;  1AAR A;  3DBR B;  4YXJ A;  1ZQP A;  4EX7 A;  4GGB A;  1EC9 A;  1BML C;  2WP9 B;  2KWV B;  3CF6 E;  2RP5 A;  4RGT A;  3MKC A;  3AEA B;  1PQS A;  2RHF A;  1KF6 B;  4O3Q A;  1KEJ A;  4NLZ A;  3OAW A;  3U30 A;  3FWA A;  1Z4O A;  3EFU A;  3RUI B;  5AK6 A;  4ICU A;  3UQA A;  4KLM A;  1ACC A;  2A1J A;  4EQS A;  4Z6D A;  2WDV B;  3PM9 A;  2GR2 A;  2CHZ A;  3RT3 B;  4ECR A;  3KLS X;  1XSN A;  4GRT A;  2K8C A;  1L0X B;  3PZ8 A;  5AIA A;  4CDG A;  3ZNI D;  1X9X A;  1FNW A;  2DZI A;  4I2G A;  3SR6 B;  3LJ3 A;  3NVZ B;  2BS2 B;  1F3P A;  4A35 A;  1W1Q A;  2BVC A;  4RQ3 A;  4YCX A;  1HJP A;  1KFT A;  2HHS A;  3ZVI A;  2G07 A;  4J3O D;  2CDU A;  4YP3 A;  5J2D A;  2O3G A;  4KLF A;  4CRX A;  5KFR A;  1BPY A;  3UJR A;  1L7P A;  2EQ7 A;  3VVW B;  2UUU A;  4FBJ B;  1AW7 A;  2OZ3 A;  4B9S A;  3W5V B;  2VFV A;  5ALX A;  1D9F A;  1LB2 B;  1K1Q A;  4E8G A;  1ZP0 B;  1F1H A;  3DIP A;  2MBR A;  5IIL A;  3CST A;  3SJN A;  2J4X A;  4KDI C;  2P0I A;  1DXS A;  4ANW A;  1D8B A;  1J7B A;  3AL0 B;  2WDR B;  3SEI A;  1DYQ A;  3R66 C;  2QGY A;  4FFD A;  4F5R A;  2UVW A;  3HX0 A;  2RDJ A;  3PG6 A;  1FCC C;  1H2I A;  1KDH A;  8ICK A;  2G1E A;  2KTR B;  2DZM A;  4IL6 U;  2ZJD A;  3IAM 1;  4BKS D;  3DDM A;  2WOI A;  2NRW A;  1L4Z B;  1SIF A;  3V60 A;  2OED A;  3ONS A;  3KHL A;  1V1P A;  3TIX A;  3C29 A;  2XO7 A;  1NBF C;  2G9H D;  1ZQM A;  4EWJ A;  5LLI A;  5HKH A;  2NRV A;  3C19 A;  4KN7 A;  2MP2 A;  4WUR A;  2PA6 A;  4JX1 C;  4EZJ A;  5AWV A;  2QJN A;  2LPE A;  4JMU A;  1N63 A;  4YD1 A;  2UWQ A;  2KNJ A;  4YTM B;  1FRR A;  5AHX A;  1R4M B;  2K60 A;  2KTF A;  3DQ0 A;  3DK4 A;  2IDY A;  1HTO A;  4NAM A;  4CYE A;  5J0Y A;  5HHD G;  2WF5 A;  4LA1 A;  2DFL A;  2GBR A;  2KMD A;  3QE9 Y;  2Y3S A;  2RDI A;  2XBB C;  3KZI U;  4UBB A;  4K7Z A;  4TUQ A;  2ZUC A;  3M8S A;  4B9V A;  2HVH A;  5IIO A;  5BO4 B;  1UZX B;  5ADZ A;  1EBH A;  2JEG A;  4ZHO A;  7ICI A;  4NPN A;  1M4V A;  4FLH A;  2RDB C;  3ZKJ C;  2YML A;  5KFM A;  2QSD A;  2DPI A;  4EZ9 A;  3RJ8 A;  2OWO A;  2BGW A;  4BKG A;  2KSO A;  1UWX A;  5AM5 A;  2ZVO A;  1WZ0 A;  2BPS A;  2L52 A;  2XH0 A;  1N61 A;  4XDD A;  3APC A;  1NHQ A;  4HVB A;  2ZVN A;  1J8C A;  3HP6 A;  3RBE A;  2NPT B;  3WK4 A;  4I2J A;  4DBG A;  4P0Q B;  3BOX A;  2WDW A;  1BKH A;  1ZQV A;  2RQ5 A;  1OTR B;  4EEL A;  4B6J A;  4ECU A;  3FKY A;  1DOQ A;  3TEW A;  3QUT A;  1GPX A;  2GH5 A;  5AE1 A;  4IC9 A;  1BPB A;  3N1X C;  4A3R A;  2ZIW B;  1XWL A;  3Q8C A;  1T7P A;  3EJB B;  1W1L A;  5KFN A;  4J03 A;  2JZB A;  1PK1 B;  4TQ0 A;  3L13 A;  5KFX A;  4UB2 A;  3CMM B;  2M8S A;  2KKP A;  2WDQ B;  3VH3 B;  3PSP A;  3N20 C;  1VR9 A;  4QNL A;  2H89 B;  2E8M A;  2PFQ A;  4Q44 A;  4C8N A;  1BUI C;  4IL2 A;  3ML8 A;  5EU9 A;  2N7J A;  1PUT A;  4PS7 A;  3KYC D;  2SEB D;  1Q5W B;  3K75 D;  3EPG A;  3IHQ B;  4EBC A;  2WBA A;  4M0W B;  5J2J A;  2HJ8 A;  4XLO A;  1FHU A;  3HPF A;  1MQ3 A;  1NJW A;  4KLH A;  2GWS A;  1TS5 A;  2IPI A;  1ZQJ A;  1V1O A;  1KLN A;  2OYY A;  1L3U A;  2FCQ A;  4FXC A;  4P1B C;  3N6J A;  5KTQ A;  3HM6 X;  4F4W A;  2IOH A;  3A4S C;  5AI4 A;  1Q8K A;  3ES7 A;  2R2O A;  4HLE A;  2CJO A;  3U7D A;  3S1C A;  5FS8 A;  3DHH C;  3NHE B;  2M17 A;  4FJY A;  3TFS A;  2P6R A;  2NCN A;  2W55 A;  4I2B A;  2WOW A;  9ICU A;  2N9E B;  5ALK A;  1UNS A;  3H8M A;  1BT0 A;  9ICB A;  2X8C A;  4WH4 A;  2YN4 A;  1LKY B;  1L8L A;  3SN4 A;  4MM3 A;  1ZD2 P;  2XN9 C;  4N6E B;  3RFZ B;  1IYF A;  2OX4 A;  2AKM A;  2MH7 A;  4FHJ A;  4KIK A;  4F93 B;  4F5P A;  4J9M A;  2JEJ A;  4LJX A;  2PTW A;  4GMV A;  3DK8 A;  2QB0 A;  5DPT A;  3UMC A;  4ELV A;  2BC1 A;  3BQ0 A;  1ZQT A;  1XF5 L;  3APD A;  1E8H A;  4MJS B;  1NI3 A;  1KFD A;  2IA6 A;  1LPF A;  4XE0 A;  3QLD A;  2BS4 B;  3MFH A;  3IJI A;  3R11 A;  5ALE A;  2J3N A;  2AQ0 A;  2KJ5 A;  2JVC A;  3EUB 3;  3OPS A;  3MC9 A;  2Y1J A;  1S0V A;  2DW7 A;  3M63 B;  3GV5 B;  4Y2Y A;  1WX8 A;  2INC C;  3M6Z A;  3NZG A;  5ER0 A;  1PK3 A;  2ZIV A;  3NVV A;  2O6V D;  3TKA A;  2DYO A;  4DLG A;  5CA7 A;  3AU6 A;  3UQB A;  2ASL A;  3ZW3 A;  3CGB A;  3JPS A;  3F2B A;  2JXT A;  1SL1 A;  1Q3U A;  1NYR A;  4Q8E A;  2LRU A;  3TAN A;  4J9Q A;  1UBI A;  3OG5 A;  4TKN A;  3CK5 A;  9ICN A;  3Q8R B;  1Z2M A;  1CMX B;  1WGD A;  2WU2 B;  1TKG A;  4W9L A;  2MP2 B;  4KLS A;  3FM9 A;  4KPL A;  3Q8K A;  2REX A;  5CP2 A;  1E6E B;  3PVL A;  4E3C A;  2WLB A;  1E90 A;  1HZ6 A;  5JZE B;  1ZQG A;  4QJF B;  2MUT A;  4CF4 A;  4K1R B;  1I42 A;  1TIF A;  3WK6 A;  5HHH A;  1URJ A;  4JLC A;  3OPX A;  1SL0 A;  5E79 U;  1R7S A;  1F0M A;  2BHN A;  9ICX A;  1D5Z C;  1JML A;  3PSF A;  1OQY A;  3OGU A;  3HVZ A;  3SHQ A;  3TCA A;  3OSN A;  3L10 B;  4IP5 A;  1WFY A;  3UM9 A;  2C2R A;  4RM9 A;  4EEY A;  3TAR A;  2QB0 B;  4QAY A;  5L6G A;  4ARI A;  4TMA B;  3DBS A;  1SJE D;  2V4L A;  3NOB A;  3PMN A;  5J0O A;  4WWM A;  5TR5 A;  3SN1 A;  4DS4 A;  4PYT A;  1LM8 B;  1F9J A;  2JXX A;  1W1M A;  1X66 A;  9ICG A;  4GDK A;  1Z1V A;  4E0D A;  2AWT A;  2KKC A;  1KLU D;  3Q14 C;  1RM6 B;  3AEB B;  1SV0 C;  3ZXR A;  4C00 A;  2I5Q A;  1QSS A;  2HCF A;  2L0F A;  4RNN A;  1X1M A;  4RQN A;  3RJG A;  3ZUN A;  4CQN A;  3IT6 B;  3CWI A;  2RD0 A;  3HIL A;  4HXD A;  1WXV A;  2BS3 B;  2KMA A;  1F5S A;  4PJ0 U;  2PI4 A;  3W1S A;  4ZDV A;  5C5J A;  2JT4 B;  3AU4 A;  4GLS C;  1YNT E;  1EU3 A;  4P16 A;  4UB1 A;  8ICM A;  1D8Y A;  2HW3 A;  4UAY A;  1P0R A;  3QX1 A;  3CXB A;  4P4P A;  1SEB D;  2ESE A;  2QCZ A;  2UYZ B;  2BC0 A;  3SQP A;  1K52 A;  5AKX A;  2ATL A;  2UU7 A;  2VA3 A;  4LDT D;  4PHA A;  4NV0 A;  2FMQ A;  1E7P B;  3OC4 A;  5DQH A;  2AQ4 A;  3KVF B;  1ZQY A;  3PW7 A;  3A4R A;  2HHW A;  4JWN A;  4BBN F;  3RJE A;  1S97 A;  4PGX A;  3ZXV A;  1ZQL A;  5DPR A;  1XT9 B;  2HQM A;  5IDZ A;  5DB7 A;  4QW9 A;  2LYH A;  1MHH E;  3UF8 A;  3KKA A;  2BQU A;  1KKX A;  4HPL B;  2MNR A;  3RFA A;  5DGB A;  3FW7 A;  2WYQ A;  4XGA B;  2KAN A;  2ZW1 A;  2BGF A;  4JV2 A;  1NDD A;  4DF4 A;  2XY6 A;  5LNK 1;  1WRD B;  8ICO A;  2WAQ F;  3RR8 A;  2DL0 A;  4DL4 A;  4F7Z A;  3DFH A;  3H70 A;  3LVV A;  4FS1 A;  5AKI A;  3KH0 A;  4YWS A;  2MHJ A;  2ZZC A;  3QAQ A;  3QPE A;  2N7D A;  3ORY A;  2KDB A;  5GRT A;  5ALH A;  2VA8 A;  5KHQ A;  5MPO A;  2FUH B;  4P0P A;  3DBH I;  3ENE A;  2QAR A;  4Y2P A;  1MVK A;  2IYD B;  2M0A A;  1YN5 A;  1FEA A;  3PV1 A;  2ZCB A;  3MY9 A;  3ZLF A;  3P42 A;  1ED1 A;  5J8Y C;  2GGJ A;  3CIR B;  2KOB A;  4GLX A;  4G3X B;  3SN0 A;  4MFA A;  1COK A;  4DOC A;  3P4Q B;  2DKZ A;  4DFJ A;  1UEL A;  2YAU A;  4GC7 A;  1ZJM A;  4G50 A;  5KT4 A;  4ECY A;  3I28 A;  2PTL A;  1QLU A;  2AXR A;  4KZC A;  4W9C A;  5KG2 A;  2P3Z A;  4C56 C;  3TUO A;  3OJS A;  4K4I A;  3C23 A;  5DCN A;  1IUE A;  5D94 A;  2GOL A;  4F71 A;  1D3Z A;  1SE3 A;  2I5H A;  4FZM A;  1SWW A;  3D47 A;  2XI9 A;  4HDO A;  2BVF A;  1QIL A;  5KFC A;  2M4N A;  1JPM A;  1NKB A;  2RK5 A;  1VRA B;  1FXI A;  3QCA A;  4YTN B;  4R64 A;  2FE9 A;  5AKJ A;  1TFR A;  1E0Y A;  3SQS A;  5KG5 A;  2KIC A;  2ONQ A;  2ES6 A;  1WSP A;  3A9K A;  3NZU A;  4DDG D;  3MGH A;  3SU8 X;  3ZJT A;  2XH2 A;  2QAR B;  5JHA A;  1TS2 A;  3UXO A;  4DL5 A;  3SI8 A;  2QJL A;  2BWE S;  2AGP A;  1AYF A;  3I5J C;  3N1Y C;  2OKT A;  2YEP F;  2DZK A;  3C0R B;  1RXW A;  4IQV A;  1GO3 F;  2H3Z A;  4DHJ B;  5ALY A;  2KQS A;  1K4Q A;  3NUH B;  3TJP A;  3P4P B;  1WUE A;  1CUK A;  5ALM A;  1W1J A;  2JZZ A;  3DG6 A;  3UGB B;  2D3B A;  3QU9 A;  3AE5 B;  2R8K A;  3IXS A;  3B0Y A;  4HRO A;  4OJP A;  4LZD A;  1QF6 A;  3K9P B;  1MOK A;  4G8T A;  2ZPN A;  1V5O A;  2JF5 A;  1W1O A;  3C1Y A;  4UB4 A;  2E3T A;  2HHX A;  3NY5 A;  1TK8 A;  2OQY A;  2WP6 A;  1B43 A;  4M9N A;  3M7D A;  1L7Y A;  1L7M A;  3V6K A;  1ZQD A;  5ALD A;  3LAE A;  2X99 A;  2INN E;  3BW7 A;  3ALR A;  3B9J B;  2LM1 A;  2VJ5 A;  2BR0 A;  1PYW D;  5EWF A;  2WXM A;  2YMQ A;  4JPS A;  3VR8 B;  1A76 A;  8ICV A;  4KGS A;  9ICE A;  4DLE A;  3Q4D A;  2FID A;  4PYU A;  4WWP A;  3LWM A;  1T3Q C;  3D2H A;  2BYF A;  3JPQ A;  3RAQ A;  3BS5 A;  4MM3 B;  5IO9 A;  2KIV A;  2KN5 A;  3UPQ A;  1GXF A;  4CF3 A;  2WAQ C;  2HHV A;  3X23 A;  1QCK A;  3DEE A;  3B97 A;  1F2R C;  1PVQ A;  3CAW A;  3AV8 A;  2L3Z A;  3NG0 A;  3WAO A;  4K2S A;  4EM3 A;  4YD2 A;  4YQW A;  5AE3 A;  5AM1 A;  5FJU A;  9ICJ A;  3DED A;  4KMO B;  4LVS A;  1MHX A;  3DVN U;  2KJ9 A;  4TQS A;  3RH6 A;  1NEL A;  4ZYN A;  3PW5 A;  2WXO A;  5KFZ A;  1NK9 A;  3HWT A;  1UF0 A;  4LDT B;  3V72 A;  1JX4 A;  2CKH B;  1X6I A;  5CJ7 A;  4IWO A;  1NK0 A;  4RFB A;  3TL5 A;  3EHV A;  3ZJV A;  2B3A A;  1OUQ A;  4GIB A;  1U45 A;  2J0J A;  4LCD E;  1F52 A;  3PZD A;  3C0P A;  2PCE A;  1T94 A;  3IJQ A;  2YB1 A;  3IDW A;  3Q8S B;  3PO5 A;  1NEN B;  2KZR A;  3SDL C;  4A3O A;  4A6G A;  2MU2 A;  2C7N B;  3D2Q A;  1K53 A;  3B0X A;  1D5M C;  5JTI A;  3IFW B;  3SV4 A;  2OXO A;  2DYB A;  3EUB 2;  3PST A;  2AU0 A;  4W9D A;  1CK1 A;  1GER A;  1HUZ A;  3FVD A;  4JK1 A;  3B0A A;  2NQL A;  5GTI U;  5KFL A;  2BKR B;  2PVO D;  2QVH A;  4HPN A;  1PDZ A;  1XLO A;  3AE4 B;  2OLA A;  2ZJ8 A;  3FJ4 A;  9ICM A;  4JHM A;  3SYZ A;  4JIO U;  3Q3M C;  2GRT A;  3TW9 A;  2MWS B;  1GUA B;  1TK0 A;  3FW8 A;  3MUC A;  2AQ1 B;  2J6U A;  1QZE A;  4ZA0 A;  1NOM A;  3D2D A;  3TAP A;  3NTU A;  1Q0W B;  1LQB A;  1V97 A;  4F4Y A;  4IQT A;  4K4G A;  4MEM A;  3AN1 A;  1P9D U;  2PI5 A;  3HK0 A;  2KYW A;  5AIB A;  2A3V A;  4B0E A;  1Z5S B;  5ALU A;  3BK1 A;  4ICA A;  2WXN A;  2OZT A;  3IV6 A;  4P4M A;  3BYY B;  2LEK A;  2V3P A;  4ECZ A;  2DHZ A;  4G7F A;  3VFK A;  3R3M A;  1TYP A;  3R1Z A;  2KVC A;  3V7K A;  3L5K A;  3NRW A;  3PV8 A;  4I29 A;  1VZ8 A;  4AOF A;  3CT2 A;  3D46 A;  4R3D A;  3POP A;  2ZJA A;  3T9L A;  2WXP A;  2WPF A;  2K8H A;  4H50 A;  3JW7 A;  5C1Z A;  4GSW A;  8ICC A;  2LHD A;  7ICQ A;  4ANV A;  1BQG A;  3VC8 A;  2W8L A;  2K4P A;  2I1K A;  2LHE A;  2OJR A;  2Y5P A;  3RMK C;  2ISP A;  4W9I A;  5HHZ A;  4ZRK A;  2ALZ A;  1HE8 A;  2GGI A;  2HXT A;  4OHJ A;  2PGE A;  4KDL B;  3H0R B;  4HEA 1;  5AI9 A;  1NK4 A;  3RNG C;  3PK7 A;  3NVW B;  5ALL A;  5ALF A;  1YQ4 B;  2GB1 A;  3R0K A;  4DWD A;  3V5C A;  2YQU A;  4F4X A;  4F91 B;  3TAD C;  5AKG A;  4NEW A;  4M8N A;  4DOB A;  1UA0 A;  4AP9 A;  2KTQ A;  3BJS A;  3IK4 A;  4KVG B;  4A90 A;  1ZXI C;  5KL8 B;  1E0Z A;  1DOY A;  3AEC B;  5CB1 A;  4R65 A;  1Y56 A;  4PT5 A;  4A55 A;  3DES A;  3CP8 A;  1C76 A;  4M2Y A;  3T3O A;  4M9H A;  3QUQ A;  2V3A A;  4M52 A;  4UBC A;  3NFU A;  2KC2 A;  4IZG A;  3L17 A;  4LII A;  7ICP A;  3MR5 A;  4BAX A;  2BW2 A;  4DFK A;  3DG7 A;  3F2C A;  4MFF A;  2DWQ A;  1TK5 A;  4MMW A;  3KYD D;  2N9K A;  3I6T A;  4M02 A;  5U1O A;  2KK8 A;  4RF1 A;  3JPT A;  2KTR A;  1K5O A;  2FKP A;  4DSJ A;  3A7U A;  9ICL A;  3PSI A;  5D49 A;  3BZK A;  2VIX A;  2WX0 A;  4ZRP A;  2Q5W D;  1MDL A;  1F8W A;  4RQ7 A;  2G5I B;  3MP9 A;  4FZN A;  4L2Y A;  4GGH A;  4BXO A;  2HBJ A;  3OSP A;  5DG8 A;  2X8X X;  1AQ6 A;  2PEA A;  4M01 A;  4J9N A;  4GDL B;  3EYZ A;  4Z1Y A;  3GP7 A;  2FDR A;  3KBB A;  2N1R A;  1GOZ A;  5FK9 C;  3N28 A;  2W9A A;  2D6F C;  2AXT U;  2HBL A;  1W1S A;  1P48 A;  2YY6 A;  1Z3E B;  3KUM A;  3N6H A;  1VJK A;  3SEB A;  4ECT A;  5J18 A;  2KDE B;  2FLP A;  2NTS A;  1ZRN A;  3E9S A;  2R2Z A;  5AZH A;  3A9J B;  2F44 A;  3RRA A;  1N2X A;  2HSZ A;  5BMG A;  5J29 A;  4M6W B;  3RJF A;  1YN3 A;  4EFO A;  1RLF A;  2CHW A;  1XU4 A;  4KT2 A;  2ZIW A;  3LWL A;  4Q8F A;  3C1Z A;  5HML A;  3ZNZ B;  3L08 A;  4UAU A;  1MSW D;  2LVP A;  1H38 A;  5ALS A;  4P0P B;  2ODG A;  2EDU A;  3H1U A;  4UAV A;  5B5E U;  2ZIU A;  2XIC A;  2XC9 A;  4ED6 A;  1P3Q U;  2HTM E;  1QQ6 A;  1ONF A;  2GQW A;  4QWB A;  2CFY A;  4R8U A;  3IT4 B;  4U6P A;  9ICT A;  3ZLZ A;  1ZQN A;  1E5W A;  5DQG A;  1RYU A;  5L9X A;  2BPF A;  3AEV A;  1A70 A;  2XH4 A;  2HOQ A;  1ZGU B;  5H8Y E;  1X2G A;  3N4F A;  3UJF A;  2E8P A;  4RGO S;  4E74 A;  3HHM A;  2HE7 A;  2GGG A;  4NJC A;  2BBC A;  4P7I A;  3W9C B;  3PT2 B;  4G11 A;  2KHQ A;  3BQT A;  2AGO A;  1RQN A;  2N4F A;  5BOM A;  4MKS A;  3JPO A;  3GIK A;  5ALJ A;  3TSS A;  1FFV A;  3WKB A;  1N62 C;  5CHG A;  5G5G B;  3GQC A;  1BXT A;  1ZQX A;  3W5U B;  3VDG A;  4K3C A;  1SJB A;  1BPE A;  3UCC A;  1NKE A;  3KUZ A;  3RUL A;  1WR1 A;  3BIN A;  5LXH A;  3WK8 A;  4DOA A;  3VR9 B;  5FJO A;  2I0K A;  1COO A;  1TZZ A;  1MC8 A;  2GBK A;  2H3V A;  2WB1 F;  1OEY J;  3CGD A;  4LNF A;  4PGQ A;  3RJA A;  2C60 A;  3B2F A;  1DOX A;  2NPX A;  2WX1 A;  4KN4 A;  3RGT A;  1NK6 A;  1GRB A;  2BPG A;  2I1Q A;  3JS8 A;  3LLB A;  3N4M B;  1ZQC A;  3GDX A;  3PLV A;  4HNC A;  2W03 A;  5F3X B;  3C5F A;  1P7F A;  1ZQH A;  5J0R A;  2JY6 A;  2BQR A;  2K5P A;  2JRH A;  2KLG A;  2VZK B;  4DL7 A;  3WCQ A;  1GSN A;  1SJA A;  3CXO A;  1BWC A;  3TWB A;  2RRD A;  3I4K A;  1MPE A;  1DK3 A;  1J0G A;  1WJ6 A;  1LVH A;  4UAZ A;  4CO7 A;  3H7V A;  2A8X A;  4DXF A;  3M62 B;  4NL9 A;  4Y2J A;  1GNU A;  1EF1 A;  3S1D A;  3DEQ A;  4J9P A;  5HG2 A;  5AI5 A;  2X50 A;  5DLG A;  3C2M A;  3U26 A;  3KTQ A;  2P35 A;  3KW5 B;  4X57 B;  2YQE A;  5GXG B;  3A1Q B;  2O6K A;  3S5S A;  3UXL A;  3GE3 C;  5C0Y A;  2QHO A;  1TZO A;  4RNM A;  1AHV A;  2BF8 B;  8ICN A;  1JRP A;  1FXA A;  4H4Q A;  4YL8 A;  2UUV A;  3LK9 A;  2K8B A;  4OO1 J;  3Q8A A;  5C2T B;  1E9M A;  3CNH A;  3WKE A;  2EQ8 A;  3MC1 A;  5K8E A;  2Y1I A;  3P93 A;  4ZRJ A;  5KFF A;  3TEX A;  5JXV A;  1ZQ1 C;  4OJ5 A;  3OTR A;  7ICL A;  4GYP C;  2AEH A;  3RRG A;  4TUS A;  1T8E A;  3VTV A;  2ZZ0 A;  1C3T A;  4BWM A;  2Y5B B;  4OAL A;  1L8O A;  7ICM A;  1IG6 A;  5AM3 A;  2FIF A;  3UMG A;  2POD A;  4IWQ A;  2IGD A;  3M6K A;  1N62 A;  5KFD A;  4KSK C;  3T3N A;  3P3B A;  1EO6 A;  3B1L X;  1SB3 C;  3Q45 A;  4FBT A;  2MW5 A;  1S0N A;  4J9S A;  4RQ0 A;  3UIP B;  3QN3 A;  2ON8 A;  4KLJ A;  4FDC B;  3U8Z A;  1WZ3 A;  3IG5 A;  4FAD A;  2D2Q A;  4GXK A;  4M9J A;  3U2S C;  2XSX A;  4KLT A;  1I35 A;  2PGW A;  4QZD A;  4XRH A;  5DDM A;  2FMP A;  4M04 A;  4I6P A;  4E71 A;  1ZW7 A;  5FKA C;  1IXR A;  4H4W A;  4TVW A;  2JWZ A;  1T6B X;  2N1W A;  1KBU A;  5JCM A;  4MHV A;  3JSV A;  1XPY A;  1WUF A;  3D9X A;  3PR4 A;  2BDP A;  5CR0 A;  3ZGZ A;  1UGJ A;  3V7J A;  4BCA A;  1GC6 A;  4RPZ A;  2CHR A;  2KN7 A;  2L1A A;  1KN0 A;  4J1O A;  4R8U B;  2SAK A;  3VFC A;  1JWS D;  1O08 A;  4KLQ A;  1LXD A;  2WXI A;  4J56 A;  4U7C A;  3EA6 A;  1QLT A;  4DCC A;  3SMV A;  1K51 A;  2ZIU B;  4EEK A;  1MBT A;  4UB6 U;  3EW9 A;  1X9W A;  7ICR A;  5BMH A;  2F1I A;  2NS5 A;  2ZIX B;  1RG6 A;  2QMT A;  3DPD A;  3V3W A;  4NWI A;  2HDO A;  3SV3 A;  2A5U A;  2EAP A;  4IRD A;  1D9D A;  4ED3 A;  3EJD B;  4Y2R A;  2EQ6 A;  4FI4 A;  5JCI A;  4H4Z A;  1ZPS A;  1UPH A;  1BPD A;  2TSS A;  4QWA A;  5BYR A;  3ES8 A;  1EM7 A;  3G6X A;  5FS7 A;  3T3F A;  4ED7 A;  4FZL A;  2WS3 B;  2JGA A;  3JPR A;  2LVQ A;  4F5O A;  5BOL A;  3PZ7 A;  4PK1 A;  2K4E A;  4YVZ A;  3NVY A;  3SD7 A;  2YVC A;  4BBY A;  1T3N A;  2Y0S C;  5ALQ A;  2C3D A;  1VDV A;  1FNV A;  2E8O A;  4PVJ A;  1JRO A;  1FMA D;  2OVL A;  2QB1 A;  4J9R A;  3T4W A;  1HEK A;  1FO4 A;  1YN4 A;  3TBL D;  3Q8B A;  4EZL A;  1DZN A;  3V62 A;  1CJE A;  2K89 A;  1DGJ A;  1X9M A;  5AKE A;  5ALR A;  5J2I A;  4LTU A;  5IN7 A;  1JWU D;  4QIW C;  2KNB A;  2BCQ A;  4IM2 A;  4XC2 A;  3Q8E A;  3II4 A;  1PDX A;  3U52 E;  4EZ6 A;  4I2C A;  1YJ1 A;  1BPZ A;  4MLA A;  4DO9 A;  1AOG A;  1OFF A;  4RGM A;  3VDZ A;  2E1F A;  1TAQ A;  1WGY A;  1I4X A;  3ETR A;  4MGZ E;  5ALW A;  1QSY A;  3HW8 A;  3QTP A;  2KX0 A;  3Q8L A;  4P0Q A;  4JWU C;  2A19 A;  8ICT A;  2NPT A;  2PU1 A;  4OVU A;  3HSU A;  4DHG A;  2KAJ A;  3GSY A;  2JMG A;  4MH0 E;  1PGX A;  3IHP C;  4GDK B;  2F2A B;  2HBK A;  4AYB C;  2QIL A;  1JCK B;  3G6Y A;  3GZN I;  1YEY A;  3R8B A;  5AEK B;  1RFA A;  2O56 A;  3SFD B;  2KV2 A;  1XLP A;  2NV3 A;  2JX5 A;  2LGY A;  1SIJ A;  3D2S A;  2PW9 A;  1ENF A;  4PH5 A;  4RM8 A;  3PVX A;  3V6C B;  2LJ5 A;  1ARO P;  8ICB A;  4IC7 B;  3GC2 A;  2ZPY A;  5AK5 A;  2PKE A;  2XGP A;  3UGV A;  4DSF A;  2V3B A;  2LI6 A;  1N5W C;  5AKY A;  3UQ2 A;  1SBB B;  1ONE A;  3QKE A;  1L6U A;  4DSL A;  2L0T A;  4H4T A;  2W04 A;  1YQ3 B;  5J2F A;  1JIH A;  1WGG A;  1PUZ A;  5J0P A;  2MLB A;  4QZA A;  2VH1 A;  1I4P A;  3EWA A;  1B4F A;  3PNC A;  2C2D A;  3DQV A;  2ACZ B;  3ETR B;  1CZP A;  4Z17 A;  3RCZ A;  2A4Z A;  1JW9 D;  3IG3 A;  2G06 A;  2GLE A;  2HOI A;  4P2H A;  4M8M A;  3X0W A;  3DVG Y;  3Q3J A;  2Z0D B;  4GIR A;  3Q6J A;  4EMW A;  3ZDD A;  4YG2 A;  4PS8 A;  4L1B A;  1SV0 A;  3T5H A;  5U25 A;  4OJO A;  1D7Y A;  3AE9 B;  1SXE A;  1MQ2 A;  1GV4 A;  5FXP A;  2PKO A;  5CHV C;  2XGZ A;  1XSL A;  1TKE A;  3VUY A;  4PL1 A;  1XO3 A;  3MJ5 A;  1C1Y B;  2BYV E;  5DKW A;  1QQ7 A;  2QEJ C;  4PPX A;  1GB4 A;  3L0W B;  9ICW A;  2K39 A;  2HVI A;  1MFW A;  3PR5 B;  1MBB A;  3GD3 A;  3V6H A;  2G5H B;  3MJW A;  4WJN A;  2NBU A;  3RF9 A;  4B0M A;  3HPO A;  1IP9 A;  3R0U A;  1OJT A;  1LGR A;  1WMH B;  2D3A A;  3U7Z A;  5KFG A;  3GD6 A;  3EKG A;  5KFV A;  3P63 A;  4JAY A;  2ZTD A;  1XLN A;  2DBY A;  4UB5 A;  2PLS A;  1K50 A;  1EUV B;  2LUM A;  2NBW B;  3RD2 A;  2M9N A;  3APF A;  1MI0 A;  4PZF A;  3D2J A;  2F8K A;  5FMH A;  7ICH A;  3IAS 1;  4TV3 A;  3VAW A;  3AH7 A;  7ICK A;  1P1A A;  2J0K A;  1GJZ A;  1JWB D;  1GRA A;  1ET6 A;  4BC7 A;  4O5E A;  2GGH A;  4QIW F;  3Q3N C;  2K8C B;  3WK7 A;  3RB4 A;  3LAD A;  1V8C A;  5EOZ A;  4RQ5 A;  4OJL A;  4C4R A;  4O3S A;  4QZF A;  1ZQB A;  4N58 A;  1STE A;  2L7R A;  4ED0 A;  2WXK A;  2POZ A;  2VAN A;  2YVJ A;  4K1W A;  2XK5 B;  1RVK A;  3Q8M A;  3C21 A;  3AU5 A;  4YWG G;  1Z00 A;  3THV A;  3WIM A;  2ZZB A;  5CRX A;  2VRR B;  1Q10 A;  4LLG M;  1WGR A;  4WJ3 B;  4YR3 A;  1SE9 A;  2J7Q B;  2FCS A;  2KT7 A;  2W3S A;  4ML8 A;  1C7Y A;  3HRD C;  4O3N A;  5I1V A;  3HKZ F;  4QZG A;  2IGH A;  2J52 A;  3DBH B;  3CYJ A;  3DER A;  1NPX A;  2YVS A;  4WQM A;  1WWU A;  1KD0 A;  4KLU A;  1P43 A;  2E1E A;  4OZA A;  1E8W A;  3RAX A;  3DHG C;  2FNJ B;  3MQT A;  1D8L A;  2Y4G A;  3FAH A;  4DF8 A;  2R61 A;  5B66 U;  1P98 A;  4G3I A;  4Z6C A;  1UUP A;  1V59 A;  1F77 A;  4YR0 A;  2RSU A;  4BWJ A;  3ML9 A;  1EC8 A;  4M00 A;  4RQ6 A;  5H92 C;  1TKY A;  3ZTC A;  4AJW A;  3V6J A;  2LGD A;  4ANX A;  4EX6 A;  2QPM A;  3H7I A;  2VFS A;  2VA2 A;  4HPM B;  5BYQ A;  3RPF C;  4E4U A;  1OGW A;  3I3T B;  5DB8 A;  5D6J B;  1WRI A;  3RZF A;  1HSK A;  1YOV B;  4APN A;  1V9P A;  3R07 C;  1F0X A;  3PWG A;  4HCP B;  3VXW A;  5KFO A;  1PVP A;  4M9G A;  5KL1 B;  2VFT A;  2FPK A;  4R63 A;  2D07 B;  3N7S C;  4I27 A;  3SAG A;  4IHC A;  4LNO A;  2KZ3 A;  4KLI A;  2YLM A;  1J97 A;  1WVF A;  9ICH A;  1N60 C;  2Y3A A;  4Y2V A;  3RB0 A;  4YXM A;  4G0N B;  4EUT A;  2DUY A;  2O2V A;  4FHK A;  5III A;  4F2R A;  5J0U A;  1KLV A;  3L54 A;  1ZQQ A;  4BVU C;  3GD4 A;  4JUZ A;  3TAD A;  1T0Y A;  4H2H A;  4PHE A;  1L6V A;  3PW2 A;  2P8C A;  4KMU A;  4MJS A;  3W8W A;  1MN8 A;  3R2T A;  2KG5 A;  2CPR A;  5AI6 A;  2KOX A;  4O0I A;  4EYH B;  1I19 A;  3R7R A;  1I7H A;  5ALN A;  5D3D A;  5AI0 A;  1R4N B;  1NJX A;  3NS8 A;  3FDS A;  3A0H U;  2BCS A;  1FFU C;  5I1W A;  4RZR A;  4UW9 A;  4EBD A;  4K4H A;  3Q8F A;  3GIJ A;  4NNJ B;  5KAI U;  3U9I A;  4KV2 A;  3S1E A;  5KFS A;  3QAR A;  1YQB A;  5BMI A;  2AQ3 B;  2GLS A;  3OWE B;  1KCZ A;  2MX2 A;  3W8X A;  9ICR A;  2WF8 A;  4I6L B;  2BCU A;  7ICV A;  1BNP A;  1ZDV A;  4QZH A;  2WXL A;  1FIQ B;  4BX9 C;  1ZOL A;  3W1Y A;  2MA1 A;  4WWN A;  3QK0 A;  3ONN A;  4DFP A;  4CGZ A;  9ICV A;  3EEC A;  3JPP A;  5DPW A;  3DV9 A;  2ZXH A;  3WKA A;  3BWU D;  1JI7 A;  4B9T A;  1WH3 A;  3FIL A;  3MC8 A;  1EC7 A;  2D10 A;  2ZAD A;  1SXT A;  1OXJ A;  3EPI A;  2KVZ A;  1F9C A;  1V38 A;  3TAC B;  1V1P B;  3Q3O C;  2OHF A;  4IM0 A;  3MSY A;  1NK8 A;  5HHI A;  5TZV A;  2IO0 B;  2KE7 A;  4RUA A;  4ICV A;  1Q3V A;  2H3I A;  3H4K A;  5AUI A;  3IC9 A;  2R9Z A;  1FEC A;  3RIT A;  2LYA A;  3QX7 A;  4YT0 B;  5IKC M;  5K4L A;  2LZ6 A;  3QJZ A;  4QWC A;  3AXC A;  4LJO B;  3A7R A;  1AWD A;  1XHC A;  4S0R A;  5FJT A;  3TSJ A;  4KGR A;  2I2Y A;  3S1F A;  4MDK E;  2FLN A;  1L3V A;  2LAS A;  4J9O A;  4F2S A;  2QDF A;  5E6J A;  3PSE B;  5KG4 A;  8ICZ A;  4IQU A;  3RH4 A;  3V05 A;  3UXK A;  4A6Q A;  2KDI A;  2GBM A;  5T14 A;  2JYT A;  2QDD A;  4ZHP A;  2P6U A;  3KJM A;  1RYR A;  3RJI A;  2ZEQ A;  4A9A A;  5KFE A;  3TTE A;  1XC9 A;  3DCG A;  1B9R A;  1Q46 A;  3M95 A;  3C28 A;  2DAJ A;  2VJ4 A;  3AE3 B;  3A7A A;  4BV6 A;  3VUW A;  9ICQ A;  1FHV A;  2XH7 A;  4KLO A;  2RR9 A;  4S17 A;  3D32 A;  8ICG A;  2AJQ A;  1ZQR A;  4C7Y A;  3RR7 A;  3AE2 B;  3AQF A;  2H3F A;  3OJ4 B;  4CHK A;  5J17 A;  1X42 A;  4QWE A;  1KTQ A;  2W9B A;  4CNQ A;  1KQQ A;  1ZKH A;  1EBG A;  4DFM A;  3CRX A;  3C2K A;  8ICP A;  2OJW A;  5CTR C;  2BDU A;  3B9J A;  1STZ A;  1S7M A;  3K1Z A;  3AM9 A;  2KSO B;  1ZXH A;  2KZM A;  4MAC A;  3T8M A;  1WXA A;  4HG0 A;  4J9K A;  2OAI A;  1SXD A;  4DXG A;  3B08 A;  1UBQ A;  3LXD A;  3E58 A;  5ALP A;  4DQR A;  2QLT A;  2QDE A;  1UT8 A;  1WJN A;  4PVK A;  2WFA A;  3BY4 B;  3V3X A;  3GS2 A;  2I38 A;  3L16 A;  2EH9 A;  1Q1W A;  2Y9U A;  1WVE A;  5AK4 A;  4ECW A;  5AKZ A;  3I57 A;  5HMM A;  2JH7 A;  5EE9 A;  4REZ A;  3I9V 1;  4ECX A;  2IOF K;  4QW8 A;  3GOE A;  3RZW C;  3AE8 B;  1XO0 A;  2LGS A;  2KJ6 A;  4H4X A;  3E56 A;  2PP1 A;  2DQN B;  1WE6 A;  4YXD B;  4ED8 A;  4YR2 A;  3MDC A;  2AL2 B;  4IW0 A;  4DL2 A;  1VAO A;  3RYT A;  3U4E G;  4NL9 C;  3ABV B;  2K4I A;  2DKX A;  4DYE A;  2IZV B;  2JYE A;  4IOI E;  5JCN A;  2N0S B;  3AEE B;  1SJD A;  1P7D A;  4E6M A;  3M9N B;  1TS3 A;  3IVF A;  3RNE C;  3UMB A;  3WAP A;  1SZH A;  2RGF A;  4J6I A;  1X2I A;  2QQ6 A;  4BDP A;  2GBJ A;  4I2D A;  2B6G A;  3CSF A;  4QZC A;  2E8N A;  4C0Z A;  4X2P A;  3UXN A;  3PW0 A;  3KWL A;  2GR1 A;  2ZZP B;  3VRB B;  1HQR D;  2OPJ A;  4HK2 A;  2BPC A;  3QC8 B;  2XY5 A;  2V0G A;  3TI0 A;  3UJE A;  5FJP A;  2JUO A;  3Q8P B;  1JQ4 A;  4MF2 A;  4J57 A;  1ZQZ A;  2JHD A;  5KG7 A;  1OQR A;  2LGX A;  2W82 A;  3NVY B;  2C3C A;  3MR3 A;  4JE3 B;  3F5E A;  4BZA A;  1RQL A;  2K9X A;  3F2D A;  2KFK A;  3K1G A;  5KG0 A;  1TS4 A;  4RQ1 A;  2K4H A;  3UJS A;  5AZG A;  1TY0 A;  4TQR A;  3QQ8 B;  1RPL A;  5KAF U;  2XY7 A;  1FFV C;  3P4R B;  3J9C A;  4C7Z A;  2LXA A;  5AZF A;  1ZQF A;  5F9N A;  3DOW A;  3RB6 A;  2WXQ A;  3PZP A;  5J0X A;  5GTH U;  1RRB A;  2KN4 A;  4UDU C;  3R10 A;  3RI7 C;  1CEZ A;  3EEZ A;  2LRW A;  2QKN A;  2J6S A;  3SSZ A;  2ASJ A;  2M0N A;  4ENL A;  2GQU A;  2L8J A;  3VC6 A;  4DXA B;  1WF9 A;  3DHI C;  2GH1 A;  2V4Q A;  5CX3 A;  4M6W A;  2PTZ A;  4LNN A;  2ASD A;  5L1I A;  3GE8 C;  5HQX A;  1Z4N A;  2O6V B;  3B2G A;  1KL9 A;  3DG3 A;  1J2M A;  3ZDB A;  1L8P A;  3PO4 A;  5KVH A;  2EZY A;  5JRT A;  2RDG A;  5L1K A;  3TJ4 A;  3BQ2 A;  1KTK A;  1H8C A;  1A0P A;  4I2I A;  2VZK D;  3TSH A;  3AE7 B;  3T79 A;  2EAM A;  1XSP A;  2P4P A;  2HBM A;  1E8F A;  3I99 A;  4E5T A;  1U4A A;  3K9O B;  1J2N A;  1ZDX A;  2AX5 A;  3N7P D;  3GY1 A;  2E6X A;  4PZO A;  2E5S A;  2K6Q A;  8ICJ A;  1JAL A;  2C28 A;  1N60 A;  1IGC A;  3VC5 A;  4IM3 A;  2WPE A;  1C9F A;  4DN1 A;  2F1H A;  2DPJ A;  1DOI A;  3VTW A;  4BOZ B;  8ICE A;  2G45 B;  4NAW A;  1ZK7 A;  2L5Y A;  3ZQ4 A;  1DNC A;  3D6J A;  4YN4 A;  4PHP A;  1XCT L;  9ICF A;  2JQR B;  3BVG A;  3H7P B;  1ZX9 A;  1SE4 A;  5I4D A;  2KWU B;  4HYK A;  4I6N B;  2H3Q A;  1X6J A;  1HIW A;  2KD1 A;  3HUI A;  3CGE A;  3ED5 A;  3A0B U;  4LNK A;  2O6V A;  1C77 A;  3SFE B;  3QZ8 A;  1S77 D;  1K1S A;  1H6V A;  2WB1 C;  1EWC A;  3PS6 A;  4DDI D;  5IP4 D;  1FEZ A;  5L83 A;  3I1Y A;  1V86 A;  2C22 A;  2ICI A;  4GYP A;  5J04 A;  3NJT A;  1ZD3 A;  3L3F X;  2YMM A;  4US9 A;  4ELT A;  4EZK A;  1AHU A;  1V9J A;  3OP2 A;  2QAE A;  3HM3 A;  3TX1 A;  2TPR A;  2HNE A;  5J2E A;  4RH6 A;  2GBN A;  2JEI A;  4RNO A;  1QOG A;  2P88 A;  2PS2 A;  2CXY A;  4NLB A;  1W1R A;  3ZD8 A;  4RU9 A;  1WUD A;  3NXL A;  2RPQ A;  3DGH A;  1L6N A;  3P4S B;  2BCV A;  3ZO5 B;  2C2E A;  1SSN A;  3PQB A;  4MGI E;  1WWT A;  8ICR A;  1NNL A;  2BKF A;  1YJI A;  4NEV A;  1ZQO A;  4B95 A;  4KGT A;  5ALO A;  5E6N A;  3M9O B;  4YMN A;  4EQW A;  4F4K A;  1FEB A;  2GR0 A;  2Z7J A;  1JPD X;  1ZKQ A;  3H0L B;  5HNK A;  2MUT B;  2FAZ A;  2WP5 A;  2IMW P;  4O9M A;  1S76 D;  3W2D A;  1XLQ A;  3RNB C;  5KFK A;  2GL5 A;  2GO7 A;  1V5T A;  5J2C A;  1ZQA A;  4O3P A;  1WGH A;  3MBY A;  3PRP B;  2V6O A;  4EOY A;  2NO5 A;  9ICC A;  2GOW A;  3IM1 A;  4WQO B;  4DWF A;  2WNM A;  3ENL A;  2PFN A;  3DJG X;  4H1Z A;  2WTF A;  8ICU A;  3Q69 A;  5KHO A;  2OEH A;  2PP0 A;  2ISO A;  1E8X A;  2KFJ A;  1S0M A;  2KO3 A;  4EEW A;  2PSN A;  5L95 C;  4KSL C;  1UA1 A;  2XGQ A;  3KQ4 A;  5IAA C;  3ZD9 A;  3V6E B;  2EEL A;  1MNS A;  3H8A A;  3JW0 X;  4Q43 A;  3C2L A;  2F3N A;  2GDQ A;  2K8B B;  1NKC A;  3DVG X;  2CRX A;  4XQ8 A;  3OHB A;  2EMT A;  4C4S A;  5J2R A;  2UVV A;  4GC6 A;  7ICG A;  2ZC8 A;  3H40 A;  2AQ2 B;  2EXR A;  1YJJ A;  4PVE A;  5FR3 A;  3PPA A;  3L8K A;  1NEK B;  4OJ6 A;  4O3M A;  1S9F A;  4OZB A;  4D2K A;  1WE7 A;  3MWC A;  3THU A;  5G5G A;  7ICE A;  3KD3 A;  2HHU A;  3SQI A;  3H0M B;  3WA0 A;  2AGQ A;  1JXL A;  4F3O A;  1KFY B;  1TT5 B;  3TEZ A;  4OCZ A;  3NUQ A;  5KFJ A;  1UQV A;  3AI5 A;  3M3J A;  2HTH A;  1NJY A;  2HD5 B;  1SKS A;  5ALT A;  1NHR A;  3H4B A;  2KD0 A;  2KMM A;  4UAW A;  1L3T A;  1RYJ A;  2GGE A;  3BDP A;  3KLJ A;  1TBE A;  5D2M B;  5JU5 A;  3OJ3 A;  1KKO A;  4K8G A;  1HEZ E;  4ACO A;  7ICU A;  2G4D B;  3T6C A;  5L6F A;  3QU5 A;  5KFI A;  4ZOH B;  2W7P A;  1JN3 A;  1YD8 U;  2MJ3 A;  8ICQ A;  3HVD A;  4N9F 4;  4GXB A;  4F92 B;  1ELS A;  4W9F A;  4JN7 A;  1FM0 D;  2GSH A;  9ICK A;  1S1Q B;  1CI4 A;  2ZCC A;  5FXD A;  4DWI A;  2JSV X;  2X8G A;  4GIV A;  4JB3 A;  2JV3 A;  1TE2 A;  1AHZ A;  3H8J A;  1ZD4 A;  3IG8 A;  4RT2 A;  3PW4 A;  4IRK A;  3M8R A;  4RNA A;  3MAB A;  2KKV A;  3F53 A;  4B9M A;  9ICO A;  4ROP A;  4MEX A;  4OW0 A;  3N9Y C;  3FXG A;  3ZJU A;  3MDA A;  2WXJ A;  2F77 X;  1YZ7 A;  4OD0 A;  1FNU A;  4NY0 A;  4MF8 A;  3BII D;  2LM4 A;  3EF6 A;  4C80 A;  4XDC A;  2JRZ A;  4KX5 A;  2PXI A;  5KT2 A;  4GDL A;  1ZMC A;  3OZY A;  3RNM A;  3BZC A;  4C8L A;  5J2B A;  2RPV A;  2QJM A;  3ZLG A;  4IG7 B;  3CGC A;  3P2B A;  2WOV A;  4LK0 M;  1ZQU A;  2DLB A;  1Q1R A;  2CHX A;  4XUS A;  4C8K A;  4K8D A;  4USA A;  1KJT A;  3DWM A;  4BUR A;  2D3G A;  4FN2 A;  4HCL A;  3HJE A;  4ELU A;  7ICJ A;  2PJH A;  2WU5 B;  4KKI A;  2K8A A;  4Y2U A;  2JZB B;  2EKE C;  1VQZ A;  4ZOH C;  5DDY A;  1ISN A;  1XEE A;  2V1Y A;  2ZW0 A;  4PYZ A;  2IO1 B;  3Q2A C;  1TVA A;  3BQ7 A;  3MHS D;  3SAH A;  4EC3 A;  1NHP A;  1E9I A;  1NK7 A;  4MT5 A;  4M6U A;  2PP3 A;  2WF6 A;  1JUD A;  2FMS A;  5JCL A;  1R0M A;  2D8C A;  3QXG A;  1K8R B;  2DYM A;  3ZDE A;  4K7U A;  4UAT A;  4RCO A;  2P3H A;  3A9K B;  3AED B;  5IIJ A;  4I2E A;  1MO9 A;  4JWS C;  3RNC C;  1FRD A;  3Q6B A;  2VFR A;  1SJH D;  2GQT A;  3OJU A;  3EZ5 A;  2C7M B;  4J9L A;  1MG8 A;  2CU1 A;  2KFK B;  1N48 A;  2R8J A;  3ALB A;  2HZG A;  4PHD A;  2FUG 1;  4JDR A;  1FXT B;  1B0X A;  2MBH A;  1A77 A;  2HI0 A;  5KFY A;  1RYS A;  3BYT B;  3N97 B;  1WR6 E;  3URY A;  5JH5 C;  4KEM A;  1U9L A;  1BVS A;  2W54 A;  2V4R A;  2R8G A;  1LVL A;  1XQQ A;  3AUL A;  3ZNH B;  5AKL A;  5HMR A;  3O0F A;  3TQP A;  1WYW B;  4J3Z A;  1N6Z A;  2KEY A;  2G4S A;  2JR5 A;  3QFB A;  3NAS A;  2WF7 A;  4EMI A;  1QH9 A;  2QIE B;  3S2A A;  3DDC B;  4ANU A;  4DK5 A;  2WXF A;  2BCR A;  2GMI C;  3W8Z A;  4I2F A;  1ZOY B;  1TJE A;  3QUB A;  4B6W A;  5KFA A;  2BT6 A;  1QQ5 A;  3K1R B;  4UB3 A;  4TUP A;  4B9K A;  2PVG C;  5CHW A;  1R4N I;  2D3D A;  5ALV A;  4WJO A;  4GME A;  1OEP A;  2R8I A;  5ALI A;  3Q3F A;  4QZE A;  3PRZ A;  2LJI A;  4Q2J A;  4F8C B;  3GV8 B;  1WG8 A;  5KNI A;  2PE6 B;  4F50 A;  1NDA A;  4JQ9 A;  3FG2 P;  4QWD A;  2MSE D;  2EZX A;  3NRZ A;  3N7R C;  3MFG A;  4HN8 A;  1KN5 A;  5ALG A;  1SGG A;  2AL1 A;  2NMQ A;  2ZUB A;  4RUC A;  4O95 A;  4XX5 A;  4UQG A;  4DSE A;  2IJ0 A;  3A1Q A;  5A0L A;  5BOE A;  2KP7 A;  5CWR A;  3AU2 A;  1ZUD 2;  3MHZ A;  5L1J A;  4DNA A;  1QSL A;  2V9W A;  1HTQ A;  2KIW A;  2VH2 A;  3ICX A;  4CCH A;  1RXV A;  1S3S G;  5BYS A;  4YFK A;  1JOA A;  3V5F A;  4P4O A;  3E2E A;  2K3U A;  3VUX A;  1R6W A;  1RAX A;  4HKZ E;  4WJP A;  3WU2 U;  4QZB A;  3SR6 A;  1N56 A;  5D79 A;  4KPR A;  4C4V A;  4I28 A;  2PIA A;  3U4F A;  4BC9 A;  1LKY A;  3QUC A;  4NJ8 A;  2N1V A;  3G6V A;  3LDA A;  4HDQ A;  3E0F A;  5DQI A;  2DW6 A;  2G3Q B;  3QHT A;  3DK9 A;  2PE9 A;  3DVN V;  2Q4W A;  1JMS A;  2RDX A;  3OW1 A;  1S0O A;  4W9K A;  2G0A A;  1BNO A;  4NQL B;  4XYC A;  2XVT A;  4GXI A;  1U49 A;  1ZQK A;  1Y8R C;  1NU5 A;  2P66 A;  1ZRM A;  4NY8 A;  5TSS A;  3S47 A;  3TJI A;  3PX6 A;  1ZR6 A;  4BBN C;  3OHA A;  3IJL A;  1KKR A;  1H4R A;  2M1M A;  3K4G A;  1OEY A;  3JSV B;  3TAQ A;  5IOI A;  4FE3 A;  4F5N A;  2JEF A;  4RQ4 A;  1UT5 A;  3SZ2 A;  4M9L A;  5DB9 A;  3R7Q A;  2BYT A;  1T5X D;  1XNS A;  1WMH A;  4KLE A;  4Y2T A;  3T8Q A;  2B0C A;  2CN1 A;  3LYS A;  4DNS A;  4O1N A;  5EE0 A;  4RPX A;  9ICI A;  2ASQ A;  3WAN A;  1XXG A;  2GRI A;  4YSY B;  4NZL B;  2F76 X;  2DZJ A;  3NRZ B;  2K25 A;  2H88 B;  3DWG C;  3WAL A;  2RMM A;  1L0Y B;  1VLB A;  3QZ7 A;  1KOT A;  5J2K A;  3ZDM C;  1EXN A;  1PVR A;  4GN1 A;  2I9G A;  4N59 A;  2L76 A;  4TVY A;  3GO2 A;  1A6S A;  1E10 A;  5J0T A;  5J0W A;  2G08 A;  3KUC B;  2X38 A;  1ROE A;  5KT6 A;  3LDZ E;  4OZC A;  4EEN A;  2IHM A;  1NZB A;  1DK2 A;  1FIQ A;  5E6P A;  1HA5 A;  2M0X A;  1CRX A;  4AQ7 A;  2AAQ A;  1XCQ L;  2JZP A;  1WYG A;  4EM4 A;  2EAN A;  3BS5 B;  3SD5 A;  4R66 A;  5EE3 A;  5KFU A;  1T3Q A;  1QKZ A;  4H4Y A;  5FP0 A;  1M6I A;  2KWD A;  4GXJ A;  1EF5 A;  1T0S C;  4MSM B;  3TMP B;  5DLF A;  3AQE A;  2Z8L A;  3R2I A;  2P8B A;  2BKE A;  5EWG A;  2RAB A;  1HZ5 A;  3HW2 A;  5F9L A;  3PO0 A;  3H12 A;  4DX3 A;  1RWS A;  1FEH A;  2L05 A;  4FJV B;  4H4S A;  5DG7 A;  1RZT A;  2KJH B;  3PX0 A;  3TFR A;  1M6Y A;  9ICS A;  2AL3 A;  3BVZ A;  3MTN B;  4M47 A;  2FBW B;  1W1K A;  2ZJ5 A;  3ZVH A;  1YX6 B;  2R2Q A;  4BXO B;  4MGK E;  5AKK A;  1Z1B A;  5AUK A;  2I6X A;  1WI0 A;  3F5A A;  1RFK A;  2MEK A;  3UIO B;  1MDR A;  4DQS A;  2AKZ A;  4H19 A;  5G5H A;  2X8H A;  2IOF A;  4IKG A;  2FLL A;  5KT7 A;  1I4Q A;  2J0M A;  2RLT A;  3PRM B;  4KX3 A;  1KRP A;  4XZ4 A;  2HDE A;  4C8M A;  1RM6 C;  3KFU F;  1QT9 A;  1ZJN A;  3ISB A;  2EAO A;  2RDH A;  8ICH A;  2HMX A;  1WM3 A;  5D7G A;  5KFQ A;  1I4R A; 
#chains in the Genus database with same CATH homology
 1Y56 A;  3KLS X;  4PT5 A;  4A55 A;  1C76 A;  3T3O A;  1L0X B;  3PZ8 A;  2BW2 A;  2PMV A;  4C7Y A;  3AE2 B;  2XNA C;  1FNW A;  1NVI D;  2DWQ A;  3SR6 B;  3NVZ B;  2BS2 B;  2N9K A;  3UI3 A;  2L83 A;  4RF1 A;  1W1Q A;  1EU4 A;  1AN8 A;  4J3O D;  3A7U A;  1QLB B;  2O3G A;  3B9J A;  1DOY A;  2UUU A;  3AM9 A;  1AW7 A;  4ZRP A;  3W5V B;  2VFV A;  1ZXH A;  2Q5W D;  4MAC A;  3ZYY X;  1ZP0 B;  3MP9 A;  4YSX B;  4L2Y A;  2OAI A;  4HG0 A;  2MBR A;  1EWY C;  4DXG A;  2J4X A;  4GDL B;  4PVK A;  4TQ1 A;  2J42 A;  3GP7 A;  1J7B A;  3V3X A;  1KRH A;  1GOZ A;  2WDR B;  3GS2 A;  5FK9 C;  2I38 A;  1W1S A;  1DYQ A;  1FCC C;  1VJK A;  1WVE A;  3SEB A;  2G1E A;  3I57 A;  2NTS A;  4REZ A;  5EE9 A;  3I9V 1;  3E9S A;  3IAM 1;  4ITK A;  2R2Z A;  1L4Z B;  3AE8 B;  2OED A;  1V1P A;  5BMG A;  1KH0 A;  1YN3 A;  2JWU A;  3E56 A;  2G9H D;  4YXD B;  4IDI A;  1VAO A;  4WUR A;  3U4E G;  3ABV B;  4JX1 C;  5AWV A;  2JYE A;  1L4D B;  2N9L A;  4IOI E;  1N63 A;  2N0S B;  1QOA A;  2HTM E;  3AEE B;  4YTM B;  1FRR A;  3FW9 A;  3DQ0 A;  3IT4 B;  1TS3 A;  2IDY A;  3O13 A;  4NAM A;  1FCL A;  5HHD G;  4EE2 A;  3AB5 A;  2Y3S A;  1FD6 A;  1A70 A;  4AS1 A;  1B1Z A;  5H8Y E;  1X2G A;  4RGO S;  3KWL A;  4KKJ A;  5ADZ A;  4ZHO A;  3VRB B;  4NJC A;  1M4V A;  2BBC A;  1HQR D;  1DII A;  2V4I B;  3W9C B;  4A8X C;  2V0G A;  1JQ4 A;  3TSS A;  2QSD A;  1OQR A;  2W82 A;  1FFV A;  1N62 C;  3RJ8 A;  3NVY B;  5G5G B;  4JE3 B;  1BXT A;  1UWX A;  2K9X A;  4HJG E;  3W5U B;  2L52 A;  2WXG A;  1TS4 A;  1N61 A;  2L32 A;  4XDD A;  4UD8 A;  1TY0 A;  3VRA B;  1FFV C;  3P4R B;  3J9C A;  3VR9 B;  2IGG A;  2I0K A;  4C7Z A;  2KDM A;  2WDW A;  2WXQ A;  3NS1 B;  3GB1 A;  3RJA A;  4UDU C;  3B2F A;  2KN4 A;  1DOX A;  3TEW A;  1GPX A;  2QKN A;  3JS8 A;  5AE1 A;  3LLB A;  3VTE A;  3TEY A;  2GQU A;  3Q8C A;  2K5P A;  1P7F A;  2VZK B;  1W1L A;  5EE1 A;  3WCQ A;  4PWB A;  5HQX A;  4TQ0 A;  3B2G A;  1MPE A;  2WXR A;  2WDQ B;  2D5G A;  1N63 C;  2EKI A;  1VR9 A;  2H89 B;  3AE1 B;  4DXF A;  1JWA D;  2RDG A;  3S1D A;  1KTK A;  1BUI C;  5HG2 A;  4JB1 A;  2NQW A;  3NVW A;  2N7J A;  2IPK D;  1PUT A;  2VZK D;  2SEB D;  1IBX B;  3AE7 B;  3TSH A;  2P4P A;  1E8F A;  3I99 A;  4PVH A;  3LYY A;  1ZDX A;  5GXG B;  2AX5 A;  1N5W A;  2E6X A;  1UXY A;  1ESF A;  4XLO A;  1JAL A;  1C79 A;  1ZE3 D;  1TZO A;  1N60 A;  1IGC A;  1TS5 A;  1C9F A;  1IBX A;  1AHV A;  1DOI A;  2IPI A;  1V1O A;  1JRP A;  3ZQ4 A;  1FXA A;  1IGD A;  2UUV A;  1XCT L;  4FXC A;  2JQR B;  3BVG A;  3Q8A A;  5C2T B;  1E9M A;  1SE4 A;  5HI1 A;  5K8E A;  5I4D A;  1ET9 A;  3AMZ A;  3AEF B;  5JXV A;  3TEX A;  3HUI A;  1C4A A;  1C77 A;  3SFE B;  2CJO A;  3S1C A;  4TSS A;  5C3J B;  2W55 A;  4OAL A;  1EWC A;  1UNS A;  2ICI A;  4WH4 A;  2R8D A;  2KQ4 X;  4HRS A;  1AHU A;  4US9 A;  2Y3R A;  2WQY B;  2IGD A;  3TX1 A;  2XN9 C;  4N6E B;  3RFZ B;  4RF0 A;  1N62 A;  2MH7 A;  4RH6 A;  1QOG A;  3NS1 A;  3BVM A;  4L23 A;  3T3N A;  1W1R A;  1SB3 C;  2ON8 A;  3P4S B;  1XF5 L;  1E8H A;  3U2S C;  1SSN A;  3PQB A;  2E5A A;  3L4P A;  1NI3 A;  1WWT A;  1PGA A;  4XE0 A;  2K0P A;  2BS4 B;  1YJI A;  4M0W A;  4KGT A;  5FKA C;  1SB3 B;  3EUB 3;  1QQR A;  4TVW A;  1D4B A;  2JU6 X;  1T6B X;  3W2D A;  1XLQ A;  3NVV A;  3ZGZ A;  2DYO A;  1UGJ A;  1TYG B;  3PM9 A;  4BCA A;  1OQQ A;  1VZ7 A;  3AEG B;  2GI9 A;  2JXT A;  2L1A A;  2CU3 A;  1NYR A;  2SAK A;  1JWS D;  2WNM A;  2WXI A;  3KWV A;  3EA6 A;  4RGN A;  1C78 A;  1N5X A;  1QLT A;  1K51 A;  2LMC A;  4KX6 B;  3Q69 A;  1MBT A;  2KAC A;  5BMH A;  5D3I B;  2MJD A;  1CQV A;  2QMT A;  1WXQ A;  2WU2 B;  1TKG A;  3KQ4 A;  2EEL A;  1E6E B;  2WLB A;  3LXF A;  1HXY D;  1HZ6 A;  1ZPS A;  2TSS A;  5BYR A;  1EM7 A;  2BB5 A;  2AQ2 B;  4PVE A;  2EXR A;  1YJJ A;  1R7S A;  2WS3 B;  3PZ7 A;  1NEK B;  4OZB A;  4D2K A;  4DQO C;  1JML A;  5FR3 A;  1D5Z C;  5G5G A;  3HVZ A;  3NVY A;  2M56 B;  4BBY A;  3NZ3 A;  1KFY B;  1FFU A;  3TEZ A;  1VDV A;  1FNV A;  1P7E A;  2VFU A;  4PVJ A;  1JRO A;  1FMA D;  5L6G A;  4ARI A;  2KMM A;  4TMA B;  1YN4 A;  1FO4 A;  1SJE D;  1RYJ A;  4WWM A;  1LO5 D;  3Q8B A;  1DZN A;  4PYT A;  1CJE A;  1W1M A;  1DGJ A;  4LTU A;  1UWM A;  2Q85 A;  1HEZ E;  1JWU D;  1KLU D;  1RM6 B;  5L6F A;  3AEB B;  4ZOH B;  2MJ3 A;  1VZ6 A;  1ZXI A;  3HVD A;  3Q8E A;  1PDX A;  3U52 E;  1FM0 D;  4YSZ B;  1D6E C;  4CQN A;  5FXD A;  3IT6 B;  4MLA A;  2JSV X;  3CWI A;  1OFF A;  4RGM A;  1PFD A;  1GB1 A;  1AHZ A;  1I4X A;  3ETR A;  2BS3 B;  2Y5C A;  3W1S A;  4RNA A;  4GLS C;  1YNT E;  1EU3 A;  4P16 A;  4OW0 A;  4JWU C;  3N9Y C;  4HKQ A;  3ZJU A;  1SEB D;  3HSU A;  2WXJ A;  2KAJ A;  1FNU A;  3GSY A;  1K52 A;  1PGX A;  4GDK B;  2QIL A;  3BII D;  1N61 C;  1JCK B;  4C80 A;  4H2A A;  4XDC A;  3VQI A;  5G5H B;  3R8B A;  1E7P B;  3SFD B;  1XLP A;  2JX5 A;  1YMH E;  1SIJ A;  2RPV A;  1NYQ A;  2PW9 A;  1ENF A;  1MHH E;  4LK0 M;  1GAQ B;  2DLB A;  1X2H A;  1I4G A;  3FW7 A;  4USA A;  2ZW1 A;  4XWW A;  3DWM A;  5LNK 1;  1N5W C;  1TY2 A;  1SBB B;  1D5X C;  2WU5 B;  1L6U A;  3BK2 A;  4KKI A;  4P6V F;  1YQ3 B;  3NVZ A;  1VQZ A;  4ZOH C;  1XEE A;  2ZW0 A;  2VAO A;  5HFY A;  1I4P A;  3ETR B;  4EC3 A;  2P13 A;  2ACZ B;  1CZP A;  4MT5 A;  5MPO A;  1QOF A;  1JW9 D;  2DYM A;  1MVK A;  2M0A A;  1I4H A;  4RCO A;  1YN5 A;  2BTE A;  2P3H A;  3AED B;  3P42 A;  4JWS C;  4L1B A;  1FRD A;  2VFR A;  3CIR B;  3AE9 B;  1SJH D;  2GQT A;  3P4Q B;  5FXE A;  5FXP A;  2PKO A;  3H8H A;  1TKE A;  2BVH A;  1XO3 A;  2PTL A;  3MJ5 A;  1QLU A;  2AXR A;  3NVV B;  2QEJ C;  4C56 C;  3TUO A;  1GB4 A;  1L0V B;  2FUG 1;  1IUE A;  1MBB A;  2YEP B;  1SE3 A;  3BYT B;  3URY A;  4B0M A;  2BVF A;  1QIL A;  2BVG A;  3MC0 B;  2W54 A;  3U7Z A;  2RK5 A;  1VRA B;  1FXI A;  4YTN B;  3P63 A;  4JAY A;  5HMR A;  4ZRQ A;  1C4C A;  1XLN A;  4ARC A;  1E0Y A;  2DBY A;  2PLS A;  1K50 A;  2LUM A;  2ONQ A;  1MI0 A;  4PZF A;  3D2J A;  1PGB A;  4MH8 A;  1WSP A;  3IAS 1;  3AH7 A;  3ZJT A;  2QIE B;  1JWB D;  2WXF A;  1ET6 A;  4BC7 A;  1TS2 A;  3W8Z A;  1ZOY B;  2QJL A;  3C8Y A;  1V8C A;  1TJE A;  1AYF A;  2BT6 A;  1JWM D;  2YEP F;  2PVG C;  4N58 A;  3NUH B;  1STE A;  3P4P B;  2WXK A;  2FE8 A;  1W1J A;  2LJI A;  4Q2J A;  2K22 A;  3P1M A;  3AE5 B;  1J7A A;  3IXS A;  4HRO A;  2PLP A;  4YWG G;  3EGR A;  1QF6 A;  1W1O A;  5FXF A;  5T8I A;  1Q10 A;  2E3T A;  2NTT A;  3NRZ A;  1C4P A;  2W3R A;  4LLG M;  3MFG A;  3HRD C;  2W3S A;  4ML8 A;  5I1V A;  2IGH A;  2J52 A;  2NMQ A;  4O95 A;  3LAE A;  2YVS A;  2IJ0 A;  4WQM A;  2INN E;  3BW7 A;  4OVZ A;  3B9J B;  1ZUD 2;  3BZD B;  3MHZ A;  1PYW D;  2WXM A;  4JPS A;  5BYS A;  3VR8 B;  2CJN A;  4KGS A;  1DIQ A;  4OZA A;  2MJE A;  2K3U A;  4XWT A;  4HKZ E;  2Y4G A;  3FAH A;  2R61 A;  3SR6 A;  5D79 A;  1UUP A;  1T3Q C;  3D2H A;  1F77 A;  2PIA A;  3FIL B;  4MM3 B;  2J53 A;  5H92 C;  4BC9 A;  1TKY A;  2QPM A;  2VFS A;  5BYQ A;  1F2R C;  3RPF C;  3HRD D;  3AV8 A;  4YTP B;  2PLI A;  3DED A;  5AE3 A;  1WRI A;  1J7C A;  2Q4W A;  1MHX A;  1HSK A;  2V3N A;  4ZYS A;  1F0X A;  3R07 C;  1QOB A;  2WXO A;  5TSS A;  1SE2 A;  2VFT A;  1ZR6 A;  4RFB A;  1F0Z A;  3ZJV A;  2WXH A;  1F2R I;  2Y08 A;  2B76 B;  1WVF A;  1N60 C;  3C0P A;  2Y3A A;  1NEN B;  2BYT A;  1T5X D;  2M19 A;  4DNS A;  1K53 A;  2INP E;  1L6V A;  4O1N A;  5D7G A;  1D5M C;  5EE0 A;  3EUB 2;  1XXG A;  2GRI A;  4YSY B;  1CK1 A;  3W8W A;  4NZL B;  3R2T A;  3NRZ B;  1KLG D;  1I19 A;  2H88 B;  2PVO D;  3DWG C;  1I7H A;  2RMM A;  5D3D A;  1XLO A;  3AE4 B;  1L0Y B;  5I1W A;  1FFU C;  1VLB A;  5AE2 A;  3Q8F A;  1WGK A;  3FW8 A;  3S1E A;  2AQ1 B;  4N59 A;  4TVY A;  4PWC A;  5BMI A;  2AQ3 B;  2LGI A;  3OWE B;  1E10 A;  3W8X A;  1FIQ B;  2WXL A;  3D2D A;  1ZDV A;  1L5P A;  2X38 A;  1E8G A;  1V97 A;  1ROE A;  4OZC A;  2BB6 A;  3AN1 A;  1FIQ A;  1HA5 A;  4WAF A;  4B0E A;  4AQ7 A;  3BK1 A;  1XCQ L;  2JZP A;  1WYG A;  3BWU D;  2WXN A;  2LFI A;  3FIL A;  1SXT A;  3BYY B;  1QKZ A;  2LEK A;  2V3P A;  1T3Q A;  5EE3 A;  1V1P B;  2KWD A;  2OHF A;  3AE6 B;  4WIP A;  1VZ8 A;  3FC4 A;  4US8 A;  2Z8L A;  3R2I A;  4NAW B;  4R3D A;  1SF0 A;  5AUI A;  3LB8 C;  1HZ5 A;  3POP A;  2WXP A;  3PO0 A;  4YT0 B;  1RWS A;  1FEH A;  3A7R A;  1AWD A;  2LHD A;  3TSJ A;  4KGR A;  2Y5P A;  2LHE A;  3BVZ A;  2I2Y A;  1W1K A;  3S1F A;  2FBW B;  5HHZ A;  5E6J A;  1BML C;  2WP9 B;  4OHJ A;  5AUK A;  4HEA 1;  4RGT A;  3AEA B;  2MEK A;  1RFK A;  3NVW B;  3V05 A;  2GB1 A;  1YQ4 B;  5G5H A;  1KF6 B;  4A6Q A;  4IKG A;  1I4Q A;  2JYT A;  4ZHP A;  3KJM A;  3FWA A;  2HDE A;  4A9A A;  1QT9 A;  1RM6 C;  1ACC A;  1B9R A;  2RDH A;  3AE3 B;  4A90 A;  1E0Z A;  1ZXI C;  2WDV B;  3AEC B;  3A7A A;  1I4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...