2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
1UWMA 1FFUC 1FIQA 3S1CA 1DOIA 4A9AA 1DIIA 2PKOA 5FXPA 4N58A 3LLBA 1KF6B 1J7CA 4PVJA 1RYJA 2Y5CA 1SB3B 2WDQB 3NVZA 3HRDD 1QT9A 1XLNA 3D2HA 1V8CA 1IUEA 1JROA 3NRZA 1E7PB 1QOBA 1B9RA 1W1KA 1FMAD 3AE3B 2VFUA 4HRSA 1FM0D 2PLSA 5MPOA 3VRAB 3FW8A 1N61A 2W3SA 3AEAB 2WQYB 1WVEA 2OAIA 3LAEA 1WGKA 5C2TB 2FBWB 1N63A 1ZR6A 1FRDA 2BVGA 1N60A 2DBYA 1FXAA 2W55A 2KMMA 5H8YE 3W5UB 1E10A 1RM6C 3DWGC 4JWSC 3LB8C 3DQ0A 4TVWA 3FC4A 4ZOHC 2WP9B 2DWQA 2EKIA 1WRIA 4YXDB 1ZP0B 2LEKA 1QF6A 1L6UA 5G5GB 1E6EB 5AUIA 1W1SA 1PDXA 1VJKA 1AHZA 1JRPA 5HMRA 3AE4B 1YQ4B 3FW7A 5C3JB 5G5HA 1FXIA 5AE2A 4C80A 5ADZA 2RK5A 4MLAA 4ZHPA 3AE9B 5AE3A 2I0KA 4BBYA 5FXEA 3SR6A 2WU5B 2BS3B 2W54A 1I19A 3HVZA 3NVVA 3AMZA 5GXGB 3FW9A 4BC7A 1W1RA 2BVFA 4OALA 2CJOA 2EXRA 2KAJA 3NVYA 1VAOA 2MJ3A 4PWBA 1L0VB 2K9XA 1PFDA 3BW7A 4HROA 3AECB 4PZFA 2AXRA 1HSKA 2WLBA 1ZUD2 1AWDA 2PVOD 4YSYB 3NVWB 2VFVA 2MJEA 1DOXA 4BCAA 1KRHA 1TKYA 3B9JB 3DWMA 2M19A 2QIEB 4WQMA 1RWSA 5EE1A 1JWAD 1QLTA 3KWLA 1NVID 1JWBD 1E8HA 4N6EB 4C7ZA 4KX6B 1DIQA 4JX1C 1N61C 1W1LA 4FXCA 4O95A 1W1MA 1N63C 1CZPA 1W1JA 1DOYA 1PUTA 3P4PB 3S1DA 1N60C 3ETRA 3TSHA 3PM9A 2WDVB 3VRBB 1QLBB 3AEGB 3LXFA 4PVKA 2R8DA 3W9CB 1FRRA 2Q5WD 3AEEB 1E9MA 1VDVA 2R2ZA 3W8WA 3B2FA 3AEBB 1N62C 3CIRB 3NS1B 4EC3A 3CWIA 2CU3A 2OHFA 3P1MA 4DNSA 2PLIA 2WS3B 3AE5B 2Q85A 1E0YA 5FXFA 3HRDC 2K22A 1JQ4A 2MJDA 1GAQB 2H88B 3GSYA 4YTMB 2PVGC 4BC9A 3W8ZA 1N62A 1J7BA 3P4RB 2VFRA 1JW9D 1I7HA 4N59A 2JQRB 4IDIA 3P4QB 1RM6B 4ZOHB 3DEDA 4HG0A 1R7SA 3AH7A 1NYRA 1SIJA 2JX5A 4ML8A 1WWTA 3ZYYX 1QLUA 1YJJA 1GPXA 1TYGB 3D2JA 3AV8A 1NENB 5HHZA 2GQTA 4YTPB 5G5GA 1X2GA 5HQXA 2QPMA 3I99A 1F0ZA 1AHVA 3VR8B 3A7RA 4JAYA 1DGJA 3FAHA 1KFYB 2GQUA 1VQZA 3P63A 2O3GA 1N5WC 3S1EA 3EUB3 1FO4A 3R07C 4USAA 1YJIA 1AHUA 4WWMA 2VFTA 1ZXIC 1FIQB 1A70A 4YT0B 1JALA 3VR9B 1N5WA 1V97A 5EE9A 3NVZB 1QOGA 2HTME 1TJEA 4UD8A 2MH7A 2Q4WA 3KJMA 3NRZB 1WVFA 3ETRB 1SB3C 3AE8B 1W1QA 3A7UA 1ZXIA 2BT6A 1MBBA 3EUB2 1UXYA 3B9JA 2MBRA 1EWYC 4JB1A 1XLQA 1NEKB 3AN1A 4LTUA 1OQQA 3PO0A 4PVHA 2P4PA 1WYGA 3AE6B 1FFVA 4JWUC 3W5VB 4PWCA 1W1OA 2WDRB 2H89B 3S1FA 3B2GA 2BS2B 2QKNA 1X2HA 2WU2B 2N0SB 2ACZB 3AE1B 1FFUA 3HUIA 1F0XA 5AE1A 1WXQA 1VLBA 3VTEA 2QJLA 3AM9A 1L6VA 2VAOA 2L52A 3L4PA 3SFDB 4ITKA 2BS4B 1NI3A 3SFEB 2YVSA 1L5PA 3NS1A 3W8XA 1XLOA 2BVHA 3AE2B 5D79A 4YSZB 1T3QC 5G5HB 3P4SB 2AX5A 3TSJA 4ZHOA 1E8FA 4PYTA 3SR6B 4XLOA 3D2DA 3NVVB 3JS8A 4US9A 1J7AA 2B76B 2M56B 2G1EA 2CJNA 3NVYB 5EE0A 1E0ZA 4YSXB 2NQWA 1T3QA 3AB5A 3BIID 3RPFC 2W3RA 1TKGA 1E8GA 3AE7B 1QOFA 1RFKA 1ROEA 1QOAA 1MBTA 1SF0A 4PVEA 5H92C 2K5PA 4P6VF 1OQRA 1N5XA 2P3HA 1XO3A 4US8A 2L83A 1XLPA 1ZOYB 1DZNA 2E3TA 3AEDB 1YQ3B 2VFSA 2PIAA 1NYQA 2E5AA 3C0PA 1CJEA 4TVYA 5EE3A 1AYFA 5AUKA 3FWAA 4YTNB 1FFVC 3TX1A 3WCQA 3ABVB 3AEFB 5FXDA 3NVWA 3A7AA 1TKEA 4C7YA 1OFFA 2P13A
chains in the Genus database with same CATH superfamily
1SV0C 1CRXA 4KSKC 1ZGUB 4X57B 4KLSA 4IQVA 4ZCWA 3S1CA 3CGCA 3MR3A 3SDLC 2R9ZA 4JQ9A 3QIJA 2QMTA 3URHA 4HPMB 3RB0A 2XH0A 3CSTA 2WFAA 3BYTB 3K9OB 4MGZE 1J7CA 4ZYNA 1UQVA 3MTNB 3QU4A 3EJEB 4H4QA 1MDLA 1VZ8A 3QTPA 3SAHA 3PHWB 1MI0A 4IL6U 1XSNA 3ZTCA 4KLLA 3TUOA 3QZ8A 5DPRA 4ZDVA 3D2SA 3BVGA 1UNSA 4EUTA 4KX5A 3IVFA 5KFRA 2LGIA 4DDGD 1UD7A 5KTQA 5KFQA 4EE2A 1IUEA 1SV0A 2DKXA 2HVIA 2WXJA 3IXSA 1WUEA 1ZY8A 1L8OA 2PFOA 3IT4B 2GGIA 1FMAD 2J0KA 4C8OA 2FCNA 3N32A 4RZRA 4HRSA 2PLSA 5BPCA 2GMIC 1ESFA 2QARB 2KG5A 3C5GA 4C56C 2P66A 4KMOB 2PA6A 3PX6A 2TPRA 4BOSC 2BYTA 4JMUA 2R2QA 1R0MA 1N61A 5KAIU 5AIBA 2WQYB 3CSFA 9ICPA 1NPXA 2OAIA 1MQ2A 1WGKA 2GL5A 4ZRIA 4M47A 3TJIA 1N63A 4DFDA 2GQWA 4AQ7A 4YXJA 4DQQA 3MP9A 3PZPA 3CXBA 3IC9A 3V6KA 4RH6A 3BK1A 2LFIA 3A4RA 4LNIA 3RT3B 2JY6A 2RPQA 1N60A 3QCAA 2F8KA 1E10A 2KMMA 5H8YE 2JVCA 9ICHA 2CU1A 2INDC 1MG4A 2AHOB 5ALPA 2UU7A 3DWGC 1OEYJ 3D9XA 3DGBA 4P1CC 4TVWA 4LNFA 5JU5A 4ZOHC 4FULA 4O0IA 2E8OA 2HW3A 2DWQA 4LK0M 2HCFA 3ZNZB 2EKIA 4MT5A 4WJQA 2GGHA 3TOYA 3LK9A 1VCBA 4IM2A 3KVFB 4TVYA 3C21A 1QQRA 5EWEA 4FS2A 3K1ZA 1YZ7A 4PHAA 1L6UA 4HJGE 3V6JA 4K7WA 2NVUI 3V7KA 4HCPB 3GD3A 1S5LU 1M6YA 8ICKA 3ZRFA 3NO1A 4FADA 4O3PA 3GO2A 2WXOA 1KLVA 3CF6E 1PDXA 4H2HA 1PVRA 4F4ZA 2KE7A 2WF5A 1QSLA 3ZUNA 4LIIA 5J0WA 3CYJA 3TWBA 1AQ6A 2WPEA 4JUZA 2W7OA 1FXIA 5J0XA 2HOFA 3U4EG 8ICUA 3AXCA 3FYHA 4FJZA 3DFHA 3AE9B 4RF1A 2RP5A 1BKHA 4A35A 1K52A 4BBYA 2G9HD 2EAMA 3RI7C 1IP9A 5FXEA 9ICAA 2ZIXB 2WU5B 5L1KA 1WR6E 3R25A 2FPKA 3AMZA 4P4MA 1J19A 2PMZC 1NBFC 3V3XA 1IBXB 3BOXA 9ICSA 1W1RA 2BVFA 4OCZA 2CJOA 3RB4A 3GZNB 4LA1A 2JXXA 4LNNA 3I6EA 3RTVA 4BKTA 3TEXA 4MGYE 4NLNA 4NAWB 4BZAA 4PWBA 4E0DA 3N7RC 3E58A 3QEAZ 5T8IA 1Q1OA 4M6UA 1SV4A 3K9PB 2H3FA 2K9XA 2OH2A 2DYMA 2ZZBA 3PV1A 2ODGA 2KQ7A 3BW7A 4YR0A 4HROA 2C5LC 1EU4A 4PZNA 4K81A 4CHKA 1WFYA 1ZUD2 2M9NA 1UHUA 2WLBA 4YSYB 2YVGA 3HIZA 3V4BA 3TQ1A 3A9JB 4ICAA 5ALZA 4UB4A 1Q0WB 2WX0A 2VFVA 5FJTA 4UASA 2X38A 5KFZA 1SEBD 1NZBA 4GLSC 1TKDA 3MJ5A 4P0PA 1KRHA 4I2DA 4GOCA 2PPHA 2N9XA 4KN4A 3SI8A 2W0HA 3QPEA 4C4VA 3Q14C 4OO1J 3BJYA 1RWSA 1YJ1A 3UJ2A 5J0PA 3UINB 3N4FA 1COOA 3OG5A 1L7MA 2IBIB 2AKMA 3KWLA 1K50A 3T4WA 2QGYA 3BYYB 2KXJA 4N6EB 3CGEA 1S8OA 1A0PA 4CF4A 5KFEA 4F72A 2AWTA 1ZQRA 2RDXA 3EAOA 3RBEA 5BYQA 4RPYA 1S77D 1C3TA 5AM1A 1BVSA 1KLGD 2PSNA 3T6CA 3KUCB 3GIJA 1W1LA 5J2CA 4YR3A 2ZUBA 5IIJA 3KHHA 1WY8A 2CPRA 2QHOA 3GOEA 2KIVA 4RU9A 2Z59B 5D49A 1JWMD 1EC7A 1ZD2P 1NKBA 4I2IA 3RH5A 2BC1A 4G8TA 2O56A 4F92B 1DOYA 1TBEA 2I5HA 3MSYA 2L0FA 1Z4NA 4GMVA 3R11A 2PMQA 3WK4A 4GISA 4B9VA 2WDVB 2KFKA 4F93B 2WXIA 2KWVB 3IG8A 3RNAC 4C4RA 9ICBA 1ZQEA 3PX0A 4FFDA 4W9GA 5J0QA 2WXFA 2ASDA 4K8DA 4RQ6A 2OZ3A 1D4BA 4RQMA 1LFDA 3PNCA 2IOFA 1KFTA 2MBBB 2KVZA 2O2VB 5HHIA 2Q5WD 2F1IA 3HHMA 4TV3A 5C1ZA 2BW2A 1JPMA 4JHMA 1LVLA 1BPXA 4KLHA 3B2FA 3AEBB 2N1RA 7ICNA 1V80A 3PRZA 1NK5A 8ICPA 4WAAA 4AOFA 5EBKA 5J2AA 3UJSA 4GIVA 2N1WA 2KHVA 2PXIA 2REXA 2W82A 3CWIA 4MH8A 1S9FA 3P1MA 2K4IA 5KFIA 2NBVB 3OSPA 3AE5B 1S0VA 2UVRA 1N56A 5J2HA 3ALBA 2DZIA 3HM3A 4PS7A 3PZDA 2MA9B 4IQWA 4HK2A 4TQ1A 4NV0A 3RZFA 2C3DA 2H3ZA 3EJDB 2XY6A 2L32A 4YTMB 1OTRB 3PSIA 1ZQIA 1DXSA 2QARA 4BC9A 4LCDE 3W8ZA 1Y88A 3AI5A 4QZAA 5B5EU 1A77A 3QK0A 3ED5A 1DNCA 5BMGA 4EQRA 4ZH4A 1TS2A 4FA6A 1JW9D 2VFRA 1I4QA 5ALOA 3PGEA 4FE3A 1K1QA 1FHVA 4I29A 1RXVA 5KFXA 2ASQA 3ZVHB 2KFNA 4KDIC 4P1BC 3NXLA 3DEDA 3HKZC 3SD5A 3IJLA 2IBKA 1PYWD 2DAFA 1MRAA 2IGDA 5L1LA 4UARA 1URJA 1S7MA 3KTQA 2UUVA 2Y3SA 5KT7A 4UDUC 1NYRA 4XX5A 2DX5B 3B08A 1F2RC 2JX5A 1TTNA 1ZMCA 3OC4A 5JRBA 1DXLA 4NEVA 4JQWC 3ZYYX 4C8NA 4J9KA 1U47A 3TBLD 3OTQA 2RR9A 3D2JA 4FN2A 8ICWA 1NENB 7ICGA 5HHZA 3DH9A 2MWSB 1BWCA 3QFAA 5J2KA 2KOXA 3QWZB 1X2GA 4TUQA 2PKEA 5FR3A 4F5OA 2ZEQA 3JVAA 3I99A 4DSIA 3LYSA 2R8JA 1R6WA 4OHJA 1AHVA 3TTEA 4H2AA 1PGAA 1KFYB 3WU2U 4QZDA 1SXDA 4XZ4A 2WTFA 1Y56A 5AKYA 2G3QB 1ZQXA 3P63A 5ALHA 3BS5B 4E6MA 3N7PD 1JIHA 4TSSA 2DQNB 2PP3A 2KWDA 1XS9D 4DXAB 2GGJA 4ADWA 5F9LA 1ZDLA 4UAWA 1V38A 3B97A 3IJIA 5JTIA 2ZIXA 4MHVA 4YG2A 4NJ8A 4NXZA 1IBXA 1X40A 5FJOA 2WB1C 3V05A 2YY6A 2AL2B 4KEMA 4WWMA 2VFTA 7ICQA 1WXVA 2PE9A 4GXBA 2R18A 3MQTA 2FYMA 5JCLA 1PK3A 4BBNC 4DF8A 1A70A 4KLGA 3OJUA 5HP4A 2MQJA 4NAWA 2QEJC 4YT0B 4B6WA 2BTEA 1FECA 2JT4B 2ZJ8A 3N1ZC 3G6VA 3PW4A 2EMSA 4KLIA 2LJ5A 2Z0EB 4I6LB 2ZC8A 1JX4A 3MFGA 2O6KA 2AKZA 1JUDA 4JV0A 1WCNA 4BKSA 4K2SA 3P3BA 5CP2A 1P7FA 5L9XA 9ICUA 2EQ6A 1IYXA 3A9JA 3H8MA 4DCCA 1GB4A 4UD8A 2PGWA 2DFLA 3TAQA 1MPEA 3JW0X 3NRZB 3UJFA 3A7UA 4DL6A 4RQ8A 2W9AA 1KH0A 2PLPA 3RMKC 2BDPA 4M9HA 3H1UA 1HJPA 4AJYB 3ES7A 2TSSA 1MN8A 1NEKB 1XLQA 2AQ1B 5CX3A 5LXIB 2BHNA 2QB1A 3AN1A 3A0BU 1KM7A 3TL5A 2HI0A 1OQQA 3L0WB 5EU9A 1AARA 2AL1A 1WYGA 3M8SA 2V0GA 3KLJA 1TS4A 3RJKA 4I2BA 4B9KA 2VZKB 1B1ZA 1Q10A 3PZ7A 3ZLFA 2EANA 3W5VB 4DXFA 1W1OA 4GRTA 3BZKA 1C4CA 3MKCA 1V9JA 1YMHE 4KKJA 1E8WA 3PQBA 3RO6A 4KZCA 1X2HA 4WWOA 1IGCA 5CWRA 5DLFA 3KW5B 5TSSA 2MUTB 3EKGA 5C23A 1WMHB 4BFRA 1GRBA 4K8GA 2RDGA 2BB6A 5KAFU 2N7DA 1L4DB 1YX6B 3QUTA 2FCMA 1ZQBA 3ISBA 2DENB 2JRZA 3SEIA 3T5KA 2GOLA 3B0AA 5ALNA 3RNEC 2PU1A 4EQWA 3GIIA 5FS9A 3VTEA 4EQSA 4IQTA 1XEEA 4H50A 4M0WB 3KD3A 4DFPA 3KZIU 3H8WA 3JPOA 1E90A 4MGIE 4W9JA 4WJOA 2G09A 1QQ5A 4HWIB 4B9TA 2VAOA 3PMLA 4H4VA 4TQSA 2OPJA 3L4PA 2O2VA 3SFDB 3DK9A 3SFEB 1ZQKA 2JZZA 4JDRA 3N6HA 4O3QA 5J2EA 3M9NB 2F3NA 3NJTA 4NJ7A 5KFSA 2J0JA 2QAEA 3QJZA 3AE2B 5D79A 3RJ8A 1K1SA 3EWAA 1T3QC 3UXLA 1ONEA 5G5HB 3ZLHA 4H1ZA 4X5VA 1FCCC 4NLKA 3P4SB 1HZ6A 4A55A 2K1FA 4DHZB 5AKZA 4CGZA 2EDUA 3OLMD 4BX9C 3PTFC 3R0KA 4MF8A 4XLOA 4HDQA 3OHAA 1DYQA 3JS8A 2BDUA 4YD2A 3H0LB 1P7EA 1O03A 3AU6A 4EZ9A 4OVZA 1ZD3A 1RFAA 4GYPA 4CDGA 2G1EA 1FEBA 1V86A 1SGGA 5J2IA 4DSEA 1WXMA 3OJ4B 2GBNA 5DPTA 1GREA 3MUCA 1MG8A 2KN4A 3FYYA 3UXPA 4I2AA 3NTUA 1GO3F 1T3QA 3ZVHA 3UQ2A 2CRXA 1TK0A 3AB5A 3KUDB 5E6NA 4ELTA 1S0MA 1W6TA 8ICTA 3ZXVA 4YMOA 4E8GA 2W3RA 4ECTA 4RGOS 3VHTC 4F2RA 4EM3A 1NK9A 4EYHB 1H8CA 4P0QB 4KZ0A 5AWVA 7ICUA 2ZTDA 1NNLA 5KT3A 1FEZA 1AW7A 4NJCA 8ICNA 4Q2JA 2K5PA 1BQGA 1N5XA 2W11A 2C2DA 4R66A 3M1YA 3KUZA 1N2XA 4QZGA 3IDWA 2WF7A 4REZA 2I1QA 3DVNU 3AEVA 3PZ8A 3PW0A 1VR9A 1H4RA 2FCQA 1Q8KA 1WJUA 5FJRA 2KANA 1QQ6A 2E3TA 3MBYA 4RPZA 3WAMA 3SAGA 3WK7A 3ES8A 3AU5A 1X66A 2XH7A 4DHZE 4FZNA 1Q3UA 2J0MA 2KKVA 1EBDA 3URYA 1WGYA 2NR2A 1ZKQA 3T3NA 3GRSA 5KFVA 3C28A 3KLSX 3BS5A 3TEWA 5GTHU 2Y5PA 3D2QA 4HCDA 9ICJA 3UQBA 4KKIA 2OZTA 3TX1A 2FI1A 1Y8RC 3ABVB 1XO1A 3DHGC 1E5WA 4WH4A 3AEFB 5FXDA 3NVWA 2F76X 1S3SG 1WGGA 2AXTU 3PW5A 3TAPA 2YB4A 3Q8MA 2I38A 1T0SC 4F8CB 5J2DA 1VJ5A 5EWFA 3VDZA 3W1SA 2PCEA 2KVRA 5J0YA 4XYCA 2AL2A 2A4ZA 4ECRA 3D46A 3FJ4A 5AIAA 4Q8FA 4MM3B 2CFYA 1FFUC 2OEHA 4BURA 2ZCBA 5I1WA 4TQRA 2WXQA 3ENEA 4TURA 9ICKA 4RQ4A 5HNKA 2B3AA 4A9AA 1GERA 5FXPA 4KIKB 3C2MA 5TR3A 4Q44A 1JMLA 3MFIA 1EXNA 2Y5CA 4F2SA 1SZHA 4C0ZA 2ZZCA 4KN7A 4Y2YA 4A8XC 1MC8A 4LZGA 3TANA 1JDFA 1QT9A 1PDYA 2JXTA 4B9LA 3P42A 4E71A 1KW4A 1V8CA 4O3NA 2YVFA 5KG7A 3NRZA 2ZNVB 4ECXA 1V5TA 2WOVA 5BOEA 2PW9A 1QOBA 1I4GA 1Z4OA 5DQIA 2N7EA 1A5RA 3D6JA 2NPTB 4GFIA 4BGDA 3A1QB 2GLEA 2IHMA 4J9SA 3AE3B 1SWVA 2VFUA 3SJNA 3RJIA 3T5HA 3VRAB 4XRHA 4OVUA 3RR1A 1SL0A 1D8BA 3UQ0A 3TQPA 5L1JA 2MBHA 4U6PA 3RH6A 4ELVA 2FBWB 3LVVA 4DWDA 5DCNA 3H8JA 3BVMA 2GGEA 1NK7A 2OX4A 2BKEA 3U7DA 3PO5A 2XY7A 2ZW1A 4R8UB 1WXSA 3GV7B 3SHQA 2DKZA 1AN8A 2PODA 3OTRA 2LASA 1HQRD 3BZCA 2MUTA 1RM6C 2KTFA 1WMHA 4FP1A 4JWSC 3RAQA 1V81A 1WF9A 3FC4A 3ZI4A 1T0RC 2KX3A 1EBHA 2D3CA 2LYBA 5JZEB 4K4HA 4KGSA 3RH4A 3H4DA 4I2GA 4KDLB 4OJ6A 7ICFA 1P1AA 4M0WA 3TMPB 2WX1A 2A3VA 4QIWF 1ZP0B 2LEKA 9ICTA 1VZ6A 9ICXA 2NCNA 3MZNA 4IW0A 4AP4C 2DF4B 2INCC 2D07B 1ONFA 2HBKA 4QWCA 2W7PA 3QQ8B 3UF8A 5EDSA 3M9MB 1KEJA 2KJRA 2KJHB 4ARIA 3IV6A 3CXOA 4DL5A 3FILB 2FMQA 4IC7B 1ZQOA 1AHZA 2MBOA 8ICIA 3AE4B 3N9YC 2MUCA 5KFHA 2PJHA 2RK5A 5G5HA 2F44A 1P7DA 1SKWA 3QX1A 4MLAA 4I2CA 1B43A 4Y2RA 3ML9A 3PR4A 2BYFA 4ZHPA 4JV2A 2OYYA 2LWPA 5CR0A 2JWZA 5ENLA 3WA0A 5D3IB 1TKKA 1Q46A 2M17A 4B9SA 3O0HA 1MSWD 4I27A 3A33B 1ET9A 3FW9A 4F3OA 4OALA 1NJYA 5AK3A 2ZCCA 1KKRA 5AK5A 2DHZA 1SZPA 1ZQYA 4QWDA 8ICFA 4DWFA 1VAOA 4JN7A 3PO4A 3ZVIA 1WUFA 3QC8B 4F71A 2MCNB 4EEKA 4Z6CA 3B0XA 2MRPA 4Q8EA 1JEHA 2ESEA 4J03A 4KLOA 4C8LA 3BSMA 4HXDA 3S2AA 5ALXA 3U30A 2JH7A 4I28A 2PTWA 3RNBC 1AROP 4JWMA 4GGQA 3PY8A 2GBRA 3ZDMC 4DYEA 4P0QA 2L0TA 2IA6A 2MJEA 2Z0DB 3KHRA 5FK9C 3PWGA 3P2BA 1DOXA 1D5MC 4BCAA 1TKYA 2WGSA 2GRTA 2A1JA 2ISPA 1YQZA 2R61A 1GV4A 3V6CB 1ZQWA 2EZYA 4DHJD 1G6JA 1P98A 1EM7A 1JWAD 2GWSA 2GH1A 3EYZA 1L0YB 4Y2PA 5ALSA 4CE6A 4PGQA 1EU3A 4QWAA 2FCSA 5G55A 3C2LA 1E8HA 3PSEB 4C7ZA 4KX6B 3UIPB 3MC1A 1FEHA 2NTTA 1CMXB 4BKGA 1GEUA 4IL2A 9ICMA 1N61C 4HCLA 4XUSA 5CB1A 2K4HA 2KNJA 2PGEA 4H19A 1ZQGA 1J0GA 1KSPA 2LGDA 3LLBA 2Q0ZX 1N63C 4MJSB 2W9CB 5IIIA 3RRHA 2QDEA 3UXKA 3HVDA 3GB1A 1HZ5A 1I4XA 1N60C 3CAWA 3BVZA 1YT3A 3ETRA 1UGMA 3TSHA 4DHJB 3ZIMA 3R3MA 1U45A 5ALQA 2FIDA 3MJWA 3LXFA 1L8LA 4MFAA 2AQ2B 4MM3A 5AZFA 3SU8X 3DK8A 1LB2B 3PSFA 1BPBA 3K4GA 2PTXA 2IOHA 4M9LA 4ZRKA 4FJYA 1WG8A 1FRRA 4KIKA 1FEAA 3AEEB 2FLPA 4DQRA 1QILA 1PK1A 4NWIA 2YMMA 5ALEA 5KFOA 1ZQQA 2KT7A 4Y2TA 1T94A 3N97B 3CIRB 3I6TA 2OXOA 4CRXA 3ONSA 3VVWB 3NS1B 1HTOA 4ACFA 3TKAA 1OEYA 4ZA0A 3IHQB 1BGXT 2BYVE 5AZHA 4QZEA 2KDIA 2WXKA 2PLIA 4G11A 7ICEA 1NDDA 2Q85A 4MGKE 5KFGA 3SAFA 3GV8B 2EKEC 3WAPA 1RYUA 2WF8A 5KVHA 3TIXA 2ZTCA 3UGBB 1JQ4A 1ISNA 4HLEA 3GE8C 5ALIA 4DFMA 1T3NA 2NPTA 3GSYA 1RQLA 3A1QA 2V4LA 1SJCA 7ICLA 3FM9A 1LM8B 8ICAA 3ALRA 4PZOA 2JWUA 4XDCA 1D8LA 5CEHA 2QB0B 4U7CA 1MHHE 4NM2A 2XCPA 2RMMA 2GBMA 4LDTB 5GRTA 1V1OA 3TARA 1QCKA 4MF2A 4BXOA 4C8KA 1S76D 3KYDD 4QW8A 5ALUA 3N1YC 4IDIA 3T5JA 4UB6U 2BZFA 7ICSA 4RUCA 3A9KB 7ENLA 4R8UA 1SBBB 3VA8A 4H4ZA 4HG0A 1NKCA 2DPIA 2AL6A 4URKA 4E74A 4M04A 2ON8A 3SQSA 3HSUA 3N28A 3PHXB 3OJSA 2WF9A 5IINA 3QE9Y 3GP7A 4B6JA 5AI9A 2IGHA 2QSDA 3LVWA 2V4IB 2KP7A 2HOIA 3NZ3A 1N48A 3VTUA 4DSKA 2GH5A 3MR2A 2C2EA 1V5OA 4BKSD 2G08A 3Q8QB 2JEGA 2ZXIA 1E8XA 2EQ7A 5KG4A 5AM3A 2HBJA 2AJQA 1JCKB 1K51A 1YJJA 3ZJVA 9ICVA 4NY8A 4RQ0A 2N9KA 5KL8B 4I2EA 2K39A 1CQVA 2QILA 5C0YA 1KCZA 4UAYA 2UUUA 1WM3A 1F3PA 1SJDA 4PK1A 4H83A 2L05A 3SD7A 1KD0A 3QN3A 2XI9A 3ZDBA 3Q3FA 5J0SA 5DQGA 1XNSA 2LD9A 2ZIUB 2V4QA 4EBEA 2PS2A 2KTRA 4H4RA 4APNA 3JPQA 2OVLA 2KK0A 3EW9A 3SZ2A 2JYEA 2K0PA 4F5NA 3VR8B 4JAYA 1DGJA 3FAHA 1XO0A 7ICJA 4G9BA 4GIRA 4TUPA 2WXLA 5HKHA 1VQZA 2I1JA 3F5EA 1WZ0A 3WK8A 2BC0A 4E4FA 4UAVA 1TZ1A 1JWSD 3BK2A 1ZMDA 2Y08A 3NS8A 5J2RA 4ECVA 1JMSA 4R3DA 3GC2A 1F9CA 2J7QB 3DHIC 1KTQA 2ZW0A 3CB3A 1U9LA 4NLCA 1E7UA 2P0IA 4MDKE 3FKYA 2WXGA 4I2FA 3ECIA 4USAA 5KG2A 2XEWA 2LXAA 1TK8A 1AHUA 4DXKA 4W9LA 3KWVA 1GUAB 3ML8A 4RFBA 1JWUD 2ZTEA 4NQKE 4GB9A 1QKZA 3E2EA 4B9NA 4WIPA 2HJ8A 3F2CA 3R7QA 3JZUA 5DPWA 1J97A 3BQTA 2YTUA 1ZDVA 2FJ6A 1PGXA 3ZW3A 4BAXA 4H4PA 3TJ4A 3NGDA 2F2AB 5J0RA 4ECSA 2PFNA 4L2YA 1F77A 4IC9A 1T7PA 2NBUA 3N6JA 3NZUA 4LNOA 2FNJB 4P4OA 2CDUA 3AUOA 4KLUA 4Z6DA 1HTQA 3ZJUA 1V59A 2JK6A 4BWJA 3EFCA 1S0OA 1TJEA 2MH7A 2Q4WA 2KMDA 4O1NA 4NL9A 3AE8B 1W1QA 1JI7A 2NRXA 1NK0A 3RRGA 4PPXA 1ZQTA 3LJ3A 1MBBA 3RJAA 2MBRA 1HE8A 1ZE3D 3GU3A 4H4SA 4RNAA 3V3WA 1KRPA 3EJBB 5F3XB 3PW7A 3Q8AA 3TJPA 3IM1A 4IL0A 4QWEA 4IQUA 3N20C 4A20A 2QQ6A 2LPEA 2R8GA 2MBQA 4K7UA 1XS2A 3SEBA 1S10A 3KQ4A 1FFVA 1TS3A 3PVLA 5KT2A 1LQBA 3GY1A 4J9MA 1ZJMA 1ZD5A 2Y5BB 4PWCA 7ICHA 2PE6B 1NKEA 1F0MA 2Y0SF 3RB6A 1T5XD 2H89B 2WDRB 3N3KB 4XC2A 4CQNA 2LM1A 1WE7A 2QKNA 3DG6A 3DGZA 2J42A 4HN8A 4EMJA 4M02A 3ZDTA 1STZA 4JB3A 1KLNA 1GB1A 1TY2A 4MJSA 4M9NA 3ISDA 2LZ6A 4M8NA 3PK7A 2ONQA 2B6GA 2OJWA 3HUIA 2P8CA 3GV5B 5AKHA 4YXMA 1YN3A 4JL9A 5DDYA 3ETLA 1YX5B 1WXQA 3K75D 1ZRNA 3NZSA 2YLMA 4F4YA 3DDHA 5ALYA 2ZPNA 2KK8A 2R8HA 3UPQA 3I9V1 2BPFA 4I6PA 3Q3OC 2XBBC 4IR9A 5DPSA 4NLGA 3EZ5A 4IG7B 2VKQA 3MGHA 3P93A 5ALRA 4A3OA 4I2HA 2YMPA 2LRWA 1MDRA 2RQ5A 3NS1A 2JEJA 4DQIA 5L6FA 4GDKB 2JZBB 4K3BA 3ZNHB 3HP6A 2M4NA 2EQYA 1L3UA 2LVOA 4YSZB 3NUQA 3M3JA 1ZQZA 2N9EB 4YD1A 2MW5A 1ZKHA 1M4VA 4C4TA 1XD3B 4ANUA 4MKSA 2CN1A 1RPLA 2LGYA 5KFTA 4AWJA 1L7YA 1L3TA 3H7PB 1C78A 4ZHOA 2BCUA 4A6QA 5H2FU 2XGPA 1ZQCA 1SE3A 3RFAA 5ALDA 4ACOA 3BQ1A 5BYRA 3RNCC 3SR6B 5JCMA 3ZQ4A 3D2DA 3NVVB 4YWSA 1J7AA 2J53A 1ZOLA 3QU2A 2W9BB 2QB0A 2B76B 1UCVA 2VRRB 3NASA 4F4KA 1SXTA 2M56B 2XIDA 2G45B 2CJNA 1GJZA 4F4RA 2F1HA 3NVYB 3MC8A 1TZOA 2NV3A 3OWEB 4IT1A 3T9PA 2K25A 5J2GA 8ICQA 3B1LX 1IYFA 1SJAA 3A9KA 3UMCA 1U48A 1FXTB 2Y4GA 1X9XA 1YD8U 3UJRA 1OGWA 1OXJA 3ZRCA 3BIID 1HUOA 4K4IA 2G07A 2FAZA 2GRIA 4I2JA 1ZQAA 3VUXA 4K1RB 4P7IA 1TKGA 2Y1JA 4KPLA 5JH5C 1ROEA 2GOWA 1MBTA 3RCZA 1FD6A 4PVEA 3PWIA 5IDZA 4B9MA 5G2NA 3JPTA 8ICCA 3PV8A 4KV2A 2LVPA 4RQ3A 2UYZB 2I5QA 1Z00B 1XWLA 1XLPA 3A0HU 1Z19A 2FMSA 5DQHA 2SEBD 4IRKA 1NHPA 1ECWA 2H3VA 1TK5A 4EBCA 3V6EB 2ZZ0A 3WK5A 1SSNA 1DZNA 5ALTA 2VANA 9ICOA 3AEDB 4LLGM 4O5EA 1D7YA 2ZIUA 3RJHA 2KEYA 2L00B 3WALA 2X8CA 1PVQA 4ZRJA 2VFSA 5L1IA 2N9PC 3JW7A 4GC7A 4KLFA 2E8NA 1A6SA 2A5UA 1KFSA 2LM4A 4TQ0A 2BCRA 1L7NA 3VTVA 2E5AA 2HJ1A 2KMAA 4UB3A 1I4PA 3GQCA 2EQ8A 1WIAA 2VZKD 3SQIA 1AYFA 4WJNA 4YTNB 5AUKA 3QFBA 3J81j 2K89A 4GU2A 2SAKA 3WCQA 3APDA 3HW8A 1GC6A 4DBGA 2PP0A 1TAQA 2MNRA 4IS7A 1NJWA 2BCSA 2L76A 5HHDG 4C7YA 2E6XA 1ZQPA 3D47A 3T5LA 1NK6A 4H4YA 5FR6A 4LVSA 1MFWA 1OFFA 2P13A 5HR7A 4DX3A 5L6GA 2WAQF 2C2RA 2BPSA 4Y2SA 2Y9TA 2YMQA 1KN5A 2HE7A 1PZNA 4KGRA 4K7SA 4XWWA 1KF6B 3OHBA 4KVGB 3Q8KA 2FE9A 4PVJA 4NY0A 4IP5A 1RYJA 1TFRA 3WANA 4B9UA 1SB3B 3UIOB 4MEXA 1WYWB 5C5JA 5IIMA 2DZKA 1GRAA 1WX7A 2WDQB 3PSPA 2HHQA 1XLNA 2GBKA 2FPLA 4HAIA 5AI6A 1WGHA 4FS1A 1ET6A 4E5TA 4N9F4 3HJEA 5J0OA 3H4KA 4MSMB 2KTQA 1X9WA 1OQYA 1TV9A 1E7PB 2LXCA 1ZXHA 2C3CA 2QVHA 2OQHA 1B9RA 4UB1A 1WE6A 2K4PA 5D4BA 3M8RA 2DZMA 2AQ4A 1W1KA 3WKAA 1COKA 3RULA 1NDAA 9ICIA 3PPAA 2YQUA 2QLTA 8ICHA 3IP4B 3W1YA 3OZMA 4E4UA 1SL2A 1ZDXA 2VA8A 2K8CB 5D94A 3SENA 3AEAB 2IY1B 2W43A 1WVEA 2X50A 2DYBA 3VXWA 2YX8A 2ZJ5A 2LHTA 2WXPA 5C2TB 1J2NA 2FKPA 4P2HA 3I5JC 4XE0A 4EZLA 1ZR6A 1FRDA 1ECQA 4OVVA 3PRMB 1WWUA 4HKZE 1F2RI 2KZZA 4DQPA 5ALKA 2EH9A 2DBYA 4QW9A 3ORYA 1I42A 4GYPC 4CF5A 8ICVA 1EF1A 2HVHA 1DK2A 3W5UB 3IT6B 2K8BB 5AI5A 4OZBA 2OJRA 4ZYSA 2YQEA 1PGBA 4Y2XA 2F5ZA 2NS5A 3STPA 5CA7A 2UWQA 3LB8C 3MR6A 3CMMB 3DQ0A 5L1MA 2CHRA 5BYSA 2JEIA 1TAMA 2K6DB 2WP9B 2AEHA 4D2KA 3DERA 3KYCD 5FJUA 5CHFA 3ENLA 1KFDA 2K60A 2NRTA 1ZETA 3M6KA 4DOCA 4BJQA 1Q5WB 3KHGA 5G5GB 2E8MA 5KL1B 1E6EB 3ZO5B 1ZQHA 5B66U 3R2IA 5FS7A 3IG3A 3DHHC 4PH5A 4MGGA 4Q45A 5BOFA 3Q8PB 2RSUA 5TR5A 1W1SA 3AQEA 4KLJA 1ZYQA 4GDKA 2K8AA 2JZBA 5AM2A 1JRPA 1VJKA 2IJ0A 3LB8A 3ZNID 1YQ4B 2KWCA 2PI4A 2ZIVB 5KFLA 4ENLA 5TZVA 4EKUA 1WUDA 1P3QU 1RVKA 4IM3A 3C2KA 2MSED 4DLGA 2HZGA 3APCA 3B0YA 4F7ZA 3H7PA 5AM0A 2KFZA 1C77A 4GXKA 3T8MA 1MQ3A 3MHZA 3SR6A 3GIMA 1UELA 4RM9A 2GO7A 2W54A 3BQ2A 3MR5A 3NVVA 4DSFA 1U4AA 2BS3B 2CS4A 4LZDA 1I19A 4A6GA 2O6VB 4FZLA 5KG5A 3ZJTA 2W9BA 2PU0A 1WCLA 3QZ7A 4J3OD 3NZGA 3G6YA 3SYZA 1T8EA 2E8PA 3QYPA 4S17A 2EXRA 2KAJA 3NVYA 1TYTA 3VCNA 2MP2B 2MJ3A 4J9OA 5AKEA 4PHEA 2N1VA 2N9LA 2YVCA 3W1SC 4CO7A 1L0VB 2HDEA 1O08A 4Z6FA 3U9IA 5DDMA 4HDOA 4ED3A 2Y1IA 4AS1A 4DFKA 2OO6A 4FLHA 1SIFA 4PZFA 3GDXA 4FO6A 4M6WB 1AWDA 2ASLA 2PVOD 1TS5A 4J1OA 5IIKA 3GZFA 2KD0A 3UMBA 1RRBA 3TSSA 4WURA 4HJKA 5BOMA 3Q3MC 4DL7A 4CYEA 2G5IB 3D2NA 2KV2A 1Z00A 3VH3B 2VJ4A 3B9JB 2KDFB 1L6NA 4ECUA 1LKYB 4C00A 2G0AA 2LMRA 4F5PA 4RM8A 3SV3A 2BR0A 5I4DA 1K4QA 4UAUA 4IM0A 3FG2P 3IK4A 3DOWA 3QHTA 4RQ2A 4WWNA 7ICPA 4Y2VA 1QLTA 2H3QA 3SQPA 1QSYA 1T0QC 2JF5A 2Y3AA 1WGDA 1RQNA 1NVID 4W9FA 1X6IA 5ALWA 3GD4A 8ICGA 3IN5A 3E56A 3QARA 1HXYD 2HQMA 2DLBA 3DK4A 1DIQA 3KHLA 4JX1C 5KNIA 4ASWC 2BF8B 5DLGA 4HVBA 3M7DA 2NO5A 2MX2A 2E1EA 3Q8EA 1GRFA 4FXCA 1H6VA 2F77X 4DNAA 2JRIB 5DBAA 1TGZB 2OWOA 3QAQA 1CZPA 1SJED 1JN3A 2L5YA 1BNPA 1W1JA 3HPFA 4JK1A 4FHJA 4RF0A 2MHJA 3S1DA 3SV4A 1XSLA 4AUQC 2BGWA 4QWBA 4RT2A 1QLBB 3AEGB 2XNAC 2HHTA 2MLBA 4M9JA 2ZUDA 5DG8A 1NJXA 3VQIA 4Z6EA 3A4SC 3U4FA 4RQ1A 4PVKA 3ZDEA 1FHUA 1B4FA 3W9CB 1Z1BA 2W03A 4EMWA 5KG0A 3T3FA 3Q3JA 2VA2A 1SE2A 1ZQUA 1WJ6A 4W9EA 1VDVA 4CCHA 1FCLA 2R2ZA 4NLBA 3W8WA 3I4KA 2KX0A 3RRAA 5AHXA 3EC8A 2HXTA 2BPCA 5AEKB 2IOFK 2AGQA 4EC3A 1MA7A 1MO9A 1D9DA 2OEDA 4EOYA 4O3MA 1QH9A 4JPSA 2X8HA 2CKHB 2V1YA 1HUZA 2J6SA 4DNSA 2W8KA 2MBEA 3VFCA 1E0YA 2WF6A 1UT5A 3Q45A 2BQ3A 3PRPB 1TE6A 4PHDA 1CK1A 2JXJA 2MJDA 5KG6A 3OPSA 3MDAA 1NHRA 4FDCB 2WNMA 5KFWA 4C4SA 2X99A 5KG1A 2PVGC 4IWQA 3QKEA 2IPKD 4DSJA 5CTRC 2OZ8A 2D3BA 2KC1A 3DG3A 1J7BA 3PFRA 2GGGA 9ICFA 4N59A 2FE8A 5ALMA 2BPGA 2ZIWB 3P4QB 1OW5A 4ED7A 2QC8A 5AKXA 3C29A 1GESA 1ED1A 3NY5A 3C23A 5FKAC 5DB7A 2BKFA 2POZA 4ZOHB 3JPSA 4RNOA 2KJ6A 5JUMA 3OSNA 3L13A 2AQ3B 3EHVA 3OZYA 1LVHA 1R7SA 1F8WA 1A76A 2ES6A 4PJ0U 3OJ3A 2NO4A 2A19A 3AH7A 2K8BA 4LJOB 4B0EA 1RDFA 3Q8CA 1NZPA 3HKZF 4ML8A 2XGQA 4QAYA 4M9GA 5KFJA 1SE9A 2GR2A 1R4MI 3ZKJC 1ZQ1C 1QLUA 8ICMA 3TADA 5AI8A 1GPXA 4G0NB 4ED1A 2M8SA 3PREA 5IA7A 3DCGA 2D3GA 3MHSD 3AULA 3AV8A 4GDLB 3RJGA 3UXOA 1QTMA 2GQTA 5J0TA 7ICMA 5G5GA 4YTPB 4F4WA 2BCVA 5HQXA 5KHOA 2QPMA 3P0WA 2LYAA 4QZHA 3V72A 4PGXA 5CHVC 3GRTA 2LHDA 5JCKA 1L7PA 4GXJA 4EQXA 3VUYA 3Q6BA 2KICA 4RUAA 4RNNA 2QDFA 2GQUA 2WDWA 2P6UA 2HHWA 1QZEA 3OP2A 2O3GA 4KLMA 3HW2A 2KQSA 3L08A 2ZIVA 2J4XA 2GR0A 2WHEA 2YB1A 4ANWA 1N5WC 2BCPA 4JIOU 2WPFA 2WWZA 5AKKA 2PP1A 2INNE 3EUB3 4H4XA 1FO4A 9ICRA 5GTIU 4YP3A 3HPOA 4J9QA 1UBIA 2D10A 1MNSA 2PPGA 1NU5A 3RCYA 3KZXA 3EA6A 1YJIA 3DVGX 8ICYA 1GRGA 4ECWA 4OD0A 1DOQA 4MELA 3EANA 2E5SA 2UVUA 2WXMA 1BNOA 3DBHI 5ALVA 1GOZA 4YWGG 1FIQB 3V5FA 2BWES 2Y3RA 4MEMA 3ICXA 3KKAA 2IMWP 2MP2A 4ELUA 1BMLC 2C7HA 5EOZA 3VH4B 2AGPA 2KVSA 2J6UA 7ICKA 3MC0B 3VR9B 1PVPA 1N5WA 5KT5A 1V97A 4AJWA 1P0RA 2AH5A 1ZD4A 3Q8BA 4MFCA 2V9HA 4WQOB 4F1SA 1V49A 3H7SA 4BBNF 3GIKA 3NFUA 3N4MB 7ICRA 2KYWA 3JSVB 2ZZPB 3VFKA 1ZX9A 4M6WA 5EE9A 3GS2A 3NVZB 5FJPA 4YL8A 1QOGA 2HTME 2KO3A 4J9LA 2RD0A 3M63B 3F53A 1ZQMA 4EELA 2LRUA 3L17A 3THUA 3ZGZA 2VIXA 4PHPA 2BT6A 3PLUA 2HNEA 3VTWA 5ALJA 2L3ZA 2DPJA 1PDZA 2HXUA 3B9JA 4QJFB 1EWYC 4JB1A 3KOOA 3GILA 2NBWB 4ZRQA 2WPCA 1FPYA 3MDCA 1LKYA 1T0YA 1X9SA 2N4FA 5GMVA 1ELSA 3I3TB 2ZNVC 2KDBA 3DDCB 1UT8A 4PVHA 1UA1A 4RQ5A 3AE6B 3TEYA 4JWUC 1RYSA 1KTKA 4NNJB 4W9HA 3T9LA 4LDTD 3R9KA 1GRTA 2MRLA 2IO3B 5AK6A 2WOWA 4QZIA 3U52E 5KFDA 1Z3EB 3S1FA 1U4BA 3B2GA 4NPNA 4EEWA 2NYVA 1DGSA 4KPRA 4HNLA 4YWOA 4OJLA 3U8ZA 5L83A 2QJNA 3WKDA 1MVKA 1SWWA 2W9NA 3UI3A 4GGBA 3WK9A 3E0FA 4J3ZA 2KNBA 2YVJA 1NHSA 1XPYA 4RQ7A 1C1YB 4HCHA 1F0XA 5AE1A 3IAS1 2XICA 1MJDA 2AQ0A 2I9GA 1UBQA 2M0NA 1N6ZA 2D2QA 2HD5B 2KOBA 5AKGA 3PR5B 2KN5A 2QJLA 2CHZA 5D6JB 3C0RB 2BGFA 8ICZA 4PYUA 4YFKA 1IXRA 1ACCA 1L6VA 4IOIE 1D8YA 1SGHA 4Y2UA 2ZJDA 3KBBA 3M6ZA 1BT0A 3UMGA 1LPFA 2M0XA 2IPIA 2R8IA 4DL4A 4JE3B 1LV5A 1OEPA 5J2FA 4DS4A 3RITA 4CNQA 2DYOA 4DOAA 2FUHB 4EEYA 1MHXA 3T8QA 3W8XA 1WX9A 4HPLB 1F9JA 3WKCA 4DQOC 2BVHA 2Z8LA 3SN4A 1ZRMA 5FP0A 3EPGA 1EUVB 4RMAA 2EMTA 2P6RA 2KLGA 5KFPA 5KFUA 4HPPA 3LDZE 2OQYA 2K4EA 2AX5A 3TSJA 1J8CA 1GXFA 1SKSA 1L3SA 2ALZA 3LDAA 5L95C 1E8FA 4KGTA 4GLXA 1B22A 2NMQA 4J6IA 4BOZB 3RFZB 1EC9A 4US9A 3FCPA 4KLDA 2ISOA 1L8PA 1Z2MA 3EFUA 3VCBA 4NAMA 3PG6A 2ZG6A 1KL9A 2I2YA 3CGBA 1BUIC 3MY9A 2YN4A 2D3AA 3ZXRA 4L1BA 3G6XA 1ZQFA 5EE0A 3I1YA 1FNWA 1E0ZA 3GE3C 2RRDA 3MABA 2ZIWA 3IG5A 1RZTA 1YZ6A 2OM6A 3M62B 4P16A 2V3BA 2NQWA 5AI4A 1Q3VA 2RLTA 4O3SA 4A3PA 3H12A 4NJ6A 3RZWC 4JN8A 3FILA 2Z7JA 4G3IA 3L8KA 4IRDA 2GR3A 1E8GA 2KKPA 2LKYA 1KLUD 2BCQA 3AE7B 3HILA 1QOAA 2INPE 3BJSA 2IDYA 5AICA 2WHIA 1WGRA 2C28A 3Q8FA 2LYHA 3I63C 1WJ4A 2CHWA 2LVQA 4P6VF 5H92C 1OQRA 1F5SA 3N1XC 2BQRA 2MAXA 3O0FA 5HMMA 2LI5A 3IHPC 3VDGA 3JPRA 2L83A 8ICJA 2G4DB 2RDIA 2KZ3A 4YN4A 4KSLC 4ANVA 4DLEA 5ALGA 4GDLA 2NRVA 3V6HA 1ZOYB 3DBRI 1ZQVA 4UBCA 3PLVA 4GIBA 4XQ8A 4W9DA 3Q8SB 1STEA 5KG3A 4NL9C 1C4PA 5AKLA 3M95A 4KMUA 2KSOB 3RR8A 2HHUA 7ICIA 7ICOA 2D5GA 2PTZA 3SN0A 4YR2A 1IM4A 3UQAA 1F52A 3BS7A 3I76A 4Q43A 1BPZA 2JH1A 4ED8A 3TFRA 1DRGA 3L54A 4IWOA 4EZJA 2PTYA 3V60A 1HA5A 2XVTA 1Q1WA 1X6JA 2FUG1 3CP8A 1ZQDA 2IO0B 3RBDA 2L8JA 1M6IA 3RNFC 3QU9A 3C1ZA 4UBBA 3JPPA 2BVCA 4KLEA 1FFVC 3KFUF 4E3CA 5KFYA 1P48A 4KWSA 2M1MA 2UVVA 5ALLA 4EZ6A 3JVZX 3VC6A 5KFAA 4W9CA 3DGHA 4NM1A 3RF9A 3L16A 2LUMA 3OGUA 4RQNA 3ZDAA 4DFJA 4DWIA 1S1QB 2YEPB 5J0UA 4OW0A 3H7VA 2KD1A 5FMHA 1NK4A 3SN1A 4FZMA 1LGRA 4UATA 1UWMA 1E9IA 3ONNA 1C79A 1UUPA 1XT9B 2GLSA 8ICRA 1MUCA 4GGHA 1FIQA 3PSTA 5J2JA 9ICWA 1M94A 1NI2A 1VZ7A 1DOIA 3L10B 4WJ3B 2V3NA 2EZZA 1DIIA 1XDIA 2PKOA 4F8RA 4N58A 3HWTA 3AQFA 2LJIA 5T14A 1RYRA 2R8KA 1LO5D 1UF0A 2LGSA 2XN9C 3DPDA 1YIWA 3VC5A 4O3OA 4RGTA 4O5CA 4K1WA 3VCCA 2HTHA 5DB8A 2JHDA 2X8GA 1WX8A 1IV8A 3JSVA 2GBJA 3QNMA 3POPA 5FS6A 3NVZA 3HRDD 4OZCA 3D2HA 3X23A 4UB8U 2MSNA 4ED6A 4DXGA 1JROA 9ICLA 2W9CA 4M52A 2P88A 3R66C 2CHXA 5CHWA 3TW9A 5D7GA 5E6OA 2KN7A 4MFFA 2GI9A 3CW2C 4DF4A 3QUCA 1TIFA 1FM0D 2N7JA 2V3SA 3QX7A 5MPOA 1VD2A 1NOMA 3QEBZ 2EELA 2ICIA 4EMIA 2RDBC 4DDID 3FW8A 2W3SA 1H38A 3H0MB 3ZD8A 3ZDCA 4HCNB 4WJPA 1ZQLA 3DQVA 4NEWA 3LAEA 3F2DA 3R7RA 1WSPA 3ZD9A 5J18A 2JEFA 8ICOA 2DZJA 1GETA 4FBJB 5J29A 1RAXA 2ATLA 2BVGA 5JCNA 1R4NI 2W55A 8ICSA 1FXAA 5BO4B 1WZ3A 5HMLA 3H4BA 1EF5A 2B21A 1SE4A 3CT2A 5IILA 1KKXA 3II4A 3QU7A 4OJOA 2A1AA 5KT6A 4QIWC 2X8XX 4A8EA 4R65A 3DBLI 1Q1RA 3RJEA 4TUUA 1UPHA 1TE2A 2HBLA 2ONEA 1WRIA 2Q4TA 4J57A 1D3ZA 4HPNA 4YXDB 3NG0A 2EQ9A 2HMXA 3AU2A 5J17A 1BZLA 2OG9A 1JOAA 5DG9A 3LXDA 2QCZA 2I1KA 3BY4B 2ZVOA 4W9IA 5U1OA 3LWLA 3RUIB 4NLZA 4F91B 3V62A 3VAWA 1QF6A 4IHCA 2JZ3B 3PT2B 2DW7A 3MC9A 4H4WA 3TEZA 1XHCA 2HOQA 4JV1A 2G4SA 5AUIA 2EZXA 4AYBF 4UW9A 2PFQA 2PMVA 1L7OA 4LJPB 1K5OA 4G3XB 1D5ZC 2XK5B 5HMRA 2IO1B 3VC8A 1C9FA 3I57A 3FW7A 1PQSA 5C3JB 2XH4A 3ZDDA 5AE2A 4C80A 8ICLA 9ICEA 4PYZA 3D32A 5ADZA 4DHGA 4M0XA 1QLNA 1K8RB 1YQBA 4BWMA 4EFOA 5U25A 3PS6A 3F5AA 2I0KA 3H0RB 5AE3A 2C60A 4HYRA 2BBCA 1U49A 2EAPA 1V2YA 2KC2A 3HX0A 3R8BA 1X9MA 4OZAA 4JWNA 3EGRA 3HVZA 4TMAB 3APFA 4XDDA 5GXGB 1AOGA 1T6BX 5DKWA 2CXYA 4I6NB 1QSSA 4ZRPA 4BC7A 1K53A 4XA5A 5AM4A 2JR5A 2JPHA 4IZGA 2I6XA 5KFFA 4RNMA 4RGMA 8ICEA 1ZQJA 4IWPA 4F5RA 5BMIA 1P43A 3IAM1 1CUKA 2DUYA 2JGAA 2PFPA 3IRUA 1I4HA 1IGDA 2LGXA 3ZVVA 2ASJA 9ICCA 4ROPA 4RCOA 5TISU 1KDHA 2K8HA 4IP4A 3TWAA 4EWJA 4KLQA 5HHHA 8ICBA 3DIPA 3PVXA 1GG3A 3IFWB 4RT3A 4YCXA 3TI0A 4L23A 2FPMA 4QZBA 1PFDA 4JLCA 3RD2A 1NHQA 3AECB 3IJQA 2IZVB 2AXRA 1HSKA 1L3VA 5I1VA 4B0MA 4QZFA 3NVWB 3V61A 4EYIB 4M0AA 2D6FC 4ECQA 1WI0A 1DTNA 5KHQA 3S47A 5J04A 1TVAA 1F44A 5AI0A 3N4EA 4W9KA 1R4MB 2IGGA 3QA8A 3TACB 3V7JA 2RABA 5D2MB 1JPDX 2E1FA 4YQWA 1DK3A 3RYTA 2C7NB 4NQLB 3U7ZA 1UA0A 2MU2A 3DWMA 1E7VA 2M19A 2QIEB 2WP6A 1GNUA 1IIPA 7ICVA 4WQMA 1BPDA 4DK5A 5EE1A 2NRZA 3H70A 1V9PA 2GSHA 2W9MA 3PMNA 3NHEB 4GN1A 2KSOA 4F5QA 1JCTA 4DO9A 2XY5A 1JWBD 3WKEA 1V85A 1YOVB 4GC6A 2JYTA 3CNHA 4IKGA 1WRDB 4PGYA 2H5XA 4DSLA 4FHKA 1BPEA 3NRWA 3DDMA 5DGBA 1IPGA 3SSZA 3ZTDA 1YEYA 1XCTL 4GMEA 4M2YA 2F1JA 2BKRB 2IO2B 2RDJA 1C20A 4O95A 1W1MA 2WBAA 3QLDA 5KFMA 4F50A 1L5UA 3EPIA 3E9SA 5HI1A 2W04A 2KIWA 4OJPA 1ZQSA 1PUTA 2FLLA 3P4PB 1V6EA 1ZW7A 1FNUA 3GFKB 2GR1A 3DBSA 4ANXA 3DJJA 3PM9A 2K3UA 3Q69A 5F9NA 3VRBB 2BQQA 1D9FA 2JV3A 2LHEA 3DBHB 4M00A 1CI4A 3KUMA 2KMCA 2VH2A 2DL0A 4Y2JA 2R8DA 4Z17A 3NUHB 4IUMB 4Z1YA 2KDMA 2JUOA 4DEZA 2WYQA 1SXEA 3ZLZA 2WDTB 3RNMA 1MOKA 1X1MA 1E9MA 4PS3A 1UGJA 3WK6A 1N62C 2QDDA 2GB1A 3ISCA 2XO7A 5J8YC 3UXNA 2XSXA 2AGOA 3LWMA 2P3ZA 4R64A 2OHFA 2CU3A 3OW1A 5IAAC 5JXVA 2WS3B 5FXFA 4BVUC 2UVWA 2L1AA 4NZLB 3HRDC 5DBBA 2K22A 3U2SC 3DEQA 2NRWA 1GAQB 2H88B 1TY0A 2KDEB 1V1PB 1NK8A 4FJVB 1TAUA 4DQSA 1XCQL 8ICXA 4YVZA 5EWGA 3O13A 1SKRA 3QUQA 3DVNV 3BZDB 1S97A 3QXGA 1N62A 3Q2AC 3P4RB 1RG6A 5DGAA 3CRXA 2OOBB 3GZNI 2O6VD 4PL2A 5J8YA 3WAOA 2YMLA 1I7HA 3UJEA 2WP5A 1WM2A 2QKQA 2JQRB 1RM6B 5E6JA 1X2IA 2OCEA 2HDOA 5AM5A 5DB9A 4RPXA 3H9DA 3O65B 3MWCA 3Q8LA 2Y9UA 4IRCA 2H3IA 4KTQA 1WH3A 5IIOA 2KFJA 3BWUD 4G50A 3W2DA 2DAJA 5CHGA 2BWFA 4ED2A 2HHVA 2ZXHA 5K4LA 3TFSA 3L5OA 2RGFA 5LLIA 1SIJA 1XU4A 1E8ZA 3BQ0A 4M8MA 2QJJA 2IHNA 3RGTA 4QZCA 3DV9A 5DBCA 1TT5B 4GXIA 2L7RA 2A8XA 4MEYA 2KHWB 5AZGA 1WWTA 2AL3A 4DOBA 4GFJA 5IN7A 1TYGB 2XC9A 1SL1A 3SMVA 2WXHA 2ZADA 2P8BA 1WWVA 3DVGY 2ZJAA 3T79A 5JRTA 1CEZA 3BDPA 4FBUA 5HFYA 4H4TA 3HT3A 3V5CA 1NJZA 1F0ZA 4WWPA 2PMZF 3A7RA 5CJ7A 1FNVA 1GRHA 2C7MB 2KKCA 2XK5A 3CGDA 2XGZA 3DFYA 3S6JA 3C1YA 3HK0A 3T3OA 4MACA 5A0LA 3ZNGC 2KLCA 1KOTA 3C8YA 1SJBA 1OUQA 3GD6A 4G7FA 1LXDA 2W8LA 5KFBA 3H8SA 3PW2A 3S1EA 4R63A 3K1GA 4TKNA 4MSQB 5KVIA 3R07C 1GSNA 4UB5A 3H8AA 4DL2A 2A1JB 4HKQA 4EX7A 3WIMA 5LXHA 3V7LA 1EC8A 2C9WB 2FDRA 4J9RA 2WXRA 4KT2A 4BV6A 3HM6X 3RAXA 2XCAA 3WKBA 1ZXIC 3R1ZA 2FMPA 1B0XA 4FX9A 4BDPA 3RJFA 4UB2A 3VUWA 1BXTA 1HEKA 2OFJA 1ZPSA 3AU4A 2MEKA 9ICNA 4X2PA 1JALA 1XQQA 2KQ4X 3ZLGA 2V3PA 2PI5A 7ICTA 4LNKA 1P9DU 1KN0A 3Q4DA 4HYKA 3J9CA 2G06A 3UGVA 1L0XB 1H2IA 1Z5SB 1UH6A 1KBUA 1C4AA 4GR1A 4TUSA 5LNK1 2KACA 1D6EC 2DW6A 4QZ9A 3MGIA 4JGHB 2V6OA 3KJMA 1I35A 1KQQA 2V9WA 1WVFA 1SB3C 5IKCM 3ETRB 1TZZA 1ZXIA 3EF6A 5KFNA 4H4UA 3EUB2 3QU5A 2R2OA 1UXYA 2JRHA 2FLNA 1GC7A 2FIFA 3TCAA 5K8EA 4HNCA 1F1HA 1XXGA 2P35A 3DBRB 1WJNA 3S5SA 4LTUA 4O5KA 3RB3A 3PO0A 4C8MA 1ENFA 4MMWA 2Y0SC 3AL0B 5BOLA 2K6QA 4II2B 2KZRA 1VRAB 2JZPA 2LMCA 1PK1B 2HHXA 2LUEA 4K7ZA 2P4PA 3Q8RB 3UM9A 2KWUB 4KITB 5IO9A 1HIWA 3OPXA 3FVDA 6ENLA 1BPYA 5D3DA 4B95A 2C22A 2BS2B 4CF3A 1SJHD 2BB5A 1UZXB 2WU2B 2D11A 2N0SB 2ACZB 5BMHA 1NELA 3AE1B 4HEA1 4YMMA 3MFHA 1FFUA 1I4RA 4S0RA 1QQ7A 1RXWA 2NVKX 2J52A 3RN9C 4DN1A 2HSZA 3RR7A 1VLBA 3Q3NC 3Q6JA 2KJ5A 1TYPA 3UCDA 4DS5A 1JXEA 4ARCA 2OLAA 5HG2A 4OJ5A 1KKOA 3DJGX 2NTSA 4XGAB 3AM9A 2KVCA 4II3B 3DEEA 4BXOB 2BYEA 2L52A 4FI4A 4UAZA 2KZMA 2J3NA 2K8CA 3U26A 2PTLA 3L3FX 2F8LA 3TADC 4J9NA 4ECYA 1NI3A 2BS4B 4ICVA 2WXNA 3K1RB 4ITKA 2YVSA 1KJTA 5IP4D 4Y2QA 1XSPA 1L5PA 4YMNA 5KFKA 1JRUA 9ICGA 2PEAA 3JYUA 1EBGA 1XLOA 5KFCA 2ZUCA 3KH0A 3JPNA 3DG7A 2VH1A 3OAWA 3F2BA 2V3AA 4WAFA 5IOIA 2LBOA 2LI6A 5CRXA 5JHAA 4K4GA 5FS8A 3BQ7A 2EAOA 3TCSA 1XANA 1RLFA 4IR1A 3H8HA 3MGVA 1ZJNA 5HR6A 1X42A 4PYTA 4KLTA 1V1PA 1JXLA 4EZKA 4P4PA 2ZPYA 4AYBC 2JMGA 1L4ZB 4ECZA 3EECA 3CYMA 2JSVX 3CK5A 4BUGA 3X0WA 2KTRB 3M9OB 1IG6A 4M01A 4A3RA 3FXGA 3N7SC 2RDHA 2RPVA 2YAUA 4YSXB 2NQLA 9ICQA 5AKIA 5DG7A 1D5XC 4ED0A 1L2NA 4ICUA 2NPXA 3H6NA 1YN5A 4PL1A 2JU6X 5AK4A 4DL3A 3THVA 4MH0E 3LYYA 4RGNA 3FV9A 3FDSA 2M0AA 3C19A 1E8YA 1Z1VA 4A90A 3RPFC 1R4NB 2RHFA 5JHBA 2G5HB 2BQUA 4UQGA 3KKAC 3I28A 4FBTA 3NOBA 2VA3A 1QOFA 1RFKA 2OKTA 2KJ9A 1SF0A 2QJMA 3RJJA 4EENA 2XH2A 2HBMA 2WOIA 4QZ8A 3R0UA 3DBLB 1J2MA 2DGZA 1YNTE 3EEZA 3DESA 2P3HA 4P0PB 1XO3A 4O9MA 5E79U 1XC9A 4US8A 1WR1A 1PUZA 2CR5A 3SBFA 3R10A 1EO6A 4XWTA 1ZK7A 4C4VB 3LADA 2IY0B 5ALFA 3PX4A 2AU0A 5AKJA 5J2BA 3C5FA 2O6VA 4EBDA 1EWCA 5JCIA 1YQ3B 1YN4A 2MA1A 2KHQA 5D46A 1ZQNA 2ZVNA 4J56A 3N30A 4AP9A 2B0CA 3IBEA 2KJ8A 3QUBA 2HHSA 1T4GA 2PIAA 1S0NA 5ER0A 2D8CA 2WB1F 4PS8A 4LJXA 2V4RA 1C76A 1NYQA 4J9PA 1HEZE 1WXAA 3H7IA 4F4XA 3C0PA 1CJEA 3RNGC 2AYOB 5EE3A 1UWXA 2AAQA 1XF5L 4QNLA 3FWAA 1OJTA 4EX6A 2GDQA 1C7YA 2IYDB 4KX3A 2YEPF 4GSWA 2DNFA 2D3DA 4PT5A 5E6PA 3A7AA 2WAQC 1TKEA 5DB6A 4K3CA 3L5KA 4O3RA 3UCCA 3BINA 5KT4A 4EM4A 2VJ5A 3H40A 2J6TA 2KFKB 3R2TA
chains in the Genus database with same CATH topology
5L6GA 1UWMA 1C79A 1UUPA 4MM3B 1FFUC 5I1WA 1FIQA 3S1CA 1VZ7A 2WXQA 1DOIA 2V3NA 4A9AA 1DIIA 2PKOA 4KGRA 2QMTA 5FXPA 4N58A 3LLBA 2LJIA 4XWWA 3BYTB 1LO5D 1KF6B 1J7CA 3W1SA 1JMLA 2XN9C 4PVJA 4RGTA 1RYJA 2Y5CA 1VZ8A 1SB3B 1MI0A 4A8XC 3TUOA 3POPA 2WDQB 3NVZA 3HRDD 1QT9A 1UNSA 1XLNA 3BVGA 4OZCA 2JXTA 1ET6A 3D2HA 2LGIA 3P42A 4DXGA 1V8CA 4EE2A 1IUEA 1JROA 3NRZA 1E7PB 2WXJA 1ZXHA 2PW9A 3IXSA 1QOBA 1B9RA 1I4GA 3IT4B 5D7GA 2GI9A 1W1KA 1FMAD 3AE3B 2VFUA 4HRSA 1FM0D 2N7JA 5MPOA 2PLSA 1ESFA 3VRAB 4C56C 2EELA 2ICIA 1ZDXA 2BYTA 3FW8A 1N61A 2W3SA 3AEAB 2WQYB 1WVEA 2OAIA 2WXPA 1WGKA 3LAEA 5C2TB 2FBWB 1N63A 1WSPA 3BVMA 4XE0A 1ZR6A 1FRDA 4AQ7A 3MP9A 4HKZE 4RH6A 2ZW1A 1F2RI 3BK1A 2LFIA 2BVGA 1N60A 1AN8A 2DBYA 2W55A 1FXAA 2KMMA 5H8YE 3W5UB 1E10A 1HQRD 3IT6B 1RM6C 1SE4A 3DWGC 4OZBA 4ZYSA 1PGBA 4JWSC 3LB8C 3DQ0A 4TVWA 3FC4A 5BYSA 4ZOHC 2WP9B 2DWQA 4LK0M 4KGSA 2EKIA 4MT5A 4D2KA 1WRIA 4M0WA 4YXDB 1ZP0B 4TVYA 2LEKA 1QQRA 1VZ6A 1QF6A 1L6UA 4HJGE 5G5GB 1E6EB 3R2IA 3TEZA 4ARIA 5AUIA 2PMVA 2WXOA 1W1SA 1PDXA 3FILB 1D5ZC 1VJKA 2IJ0A 1AHZA 1JRPA 5HMRA 3AE4B 1C9FA 3I57A 1YQ4B 3FW7A 3N9YC 5C3JB 5G5HA 1FXIA 5AE2A 4C80A 3U4EG 5ADZA 2RK5A 4MLAA 4ZHPA 3AE9B 4RF1A 5AE3A 1C77A 2I0KA 1K52A 4BBYA 2G9HD 2BBCA 5D3IB 3MHZA 3R8BA 5FXEA 3SR6A 2WU5B 4OZAA 4DQOC 2BS3B 2W54A 3EGRA 3HVZA 3NVVA 3AMZA 4TMAB 4XDDA 5GXGB 3V3XA 1IBXB 1T6BX 1ET9A 4ZRPA 3FW9A 4BC7A 3ZJTA 1K53A 1W1RA 2BVFA 4OALA 2CJOA 4RGMA 4J3OD 5BMIA 3IAM1 1I4HA 2EXRA 1IGDA 3NVYA 2KAJA 1VAOA 2MJ3A 3TEXA 4PWBA 4NAWB 4RCOA 2N9LA 5T8IA 1L0VB 2HDEA 2K9XA 2DYMA 4L23A 1PFDA 3BW7A 4AS1A 4HROA 3AECB 4PZFA 1EU4A 2AXRA 1HSKA 2WLBA 1ZUD2 1AWDA 2PVOD 4YSYB 4B0MA 1TS5A 3NVWB 2VFVA 2X38A 2MJEA 3TSSA 1SEBD 5FK9C 4GLSC 4WURA 1DOXA 1D5MC 2IGGA 3MJ5A 4BCAA 1KRHA 1TKYA 3B9JB 2R61A 3U7ZA 3DWMA 2M19A 2QIEB 4WQMA 5I4DA 1RWSA 5EE1A 1EM7A 1JWAD 1QLTA 2Y3AA 1L0YB 3KWLA 1EU3A 1K50A 1NVID 1JWBD 1E8HA 3BYYB 4N6EB 2JYTA 3E56A 4IKGA 4C7ZA 4KX6B 1HXYD 2DLBA 5BYQA 1FEHA 1DIQA 4JX1C 2NTTA 1KLGD 1XCTL 1N61C 3Q8EA 1W1LA 4FXCA 4O95A 1W1MA 1JWMD 1N63C 3E9SA 1CZPA 1SJED 5HI1A 1W1JA 1DOYA 1PUTA 3P4PB 3HVDA 4RF0A 3GB1A 3S1DA 1HZ5A 1FNUA 1I4XA 1N60C 3BVZA 3ETRA 3TSHA 3PM9A 2WDVB 2K3UA 3Q69A 2WXIA 3VRBB 1QLBB 3AEGB 2XNAC 2LHEA 3LXFA 2AQ2B 3VQIA 2WXFA 4PVKA 2R8DA 3NUHB 3W9CB 1D4BA 2KDMA 1FRRA 2Q5WD 3AEEB 1SE2A 1E9MA 1QILA 2BW2A 1VDVA 1FCLA 2R2ZA 1UGJA 3W8WA 3B2FA 3AEBB 1N62C 3CIRB 2GB1A 3NS1B 4EC3A 2OEDA 4JPSA 2W82A 3CWIA 4MH8A 2CU3A 2OHFA 2WXKA 3P1MA 4DNSA 2PLIA 5JXVA 2WS3B 3AE5B 2Q85A 1E0YA 4TQ1A 5FXFA 2L1AA 4NZLB 3HRDC 2K22A 3U2SC 1CK1A 1JQ4A 2MJDA 1I19A 1GAQB 2H88B 1TY0A 3GSYA 2L32A 2WNMA 4YTMB 1V1PB 1XCQL 3O13A 2JWUA 2PVGC 4XDCA 4BC9A 2IPKD 3BZDB 1MHHE 3W8ZA 1N62A 2RMMA 1J7BA 3P4RB 1V1OA 5BMGA 1TS2A 2VFRA 1JW9D 1I4QA 1I7HA 2FE8A 4N59A 2JQRB 4IDIA 3P4QB 1RM6B 5E6JA 1SBBB 5FKAC 4ZOHB 3DEDA 4HG0A 2AQ3B 3BWUD 1R7SA 1PYWD 2ON8A 3W2DA 2IGDA 3HSUA 3AH7A 2UUVA 2Y3SA 3GP7A 4UDUC 2QSDA 1NYRA 2IGHA 2V4IB 1SIJA 3NZ3A 1F2RC 2JX5A 4B0EA 3Q8CA 4ML8A 1K51A 1WWTA 1JCKB 3ZYYX 1YJJA 3ZJVA 1QLUA 2N9KA 2QILA 1GPXA 1CQVA 2UUUA 1TYGB 3D2JA 3AV8A 1NENB 4GDLB 2WXHA 5HHZA 2GQTA 4YTPB 5G5GA 1X2GA 5HFYA 5HQXA 5FR3A 2QPMA 3I99A 1F0ZA 4OHJA 1AHVA 2JYEA 2K0PA 2LHDA 4H2AA 3VR8B 1PGAA 1FNVA 1DGJA 3FAHA 1KFYB 4JAYA 3A7RA 2GQUA 2WXLA 1Y56A 2WDWA 1VQZA 3T3OA 3P63A 4MACA 2O3GA 1JWSD 3C8YA 3BK2A 4TSSA 2J4XA 4R3DA 1N5WC 3S1EA 2KWDA 2INNE 2ZW0A 3EUB3 1FO4A 3R07C 4HKQA 2WXGA 4USAA 3EA6A 1YJIA 1IBXA 1AHUA 2WXRA 3V05A 3KWVA 4RFBA 1JWUD 2WXMA 4WWMA 2VFTA 1GOZA 1ZXIC 4YWGG 1FIQB 1QKZA 2Y3RA 4WIPA 1A70A 1BXTA 1BMLC 1ZPSA 2QEJC 4YT0B 3MC0B 2MEKA 2BTEA 1JALA 1PGXA 1ZDVA 2KQ4X 2V3PA 3VR9B 1N5WA 1V97A 3MFGA 4L2YA 1F77A 3Q8BA 3J9CA 1L0XB 1C4AA 5EE9A 5LNK1 3GS2A 2KACA 1P7FA 3ZJUA 1QOGA 3NVZB 1D6EC 2HTME 1TJEA 1GB4A 4UD8A 2MH7A 2Q4WA 3KJMA 1MPEA 3NRZB 4O1NA 3ZGZA 1WVFA 1SB3C 3AE8B 1W1QA 3ETRB 1ZXIA 3A7UA 2BT6A 1KH0A 3EUB2 2PLPA 1MBBA 1UXYA 3RJAA 3B9JA 2MBRA 1EWYC 1ZE3D 4JB1A 4ZRQA 5K8EA 4RNAA 2TSSA 1XLQA 1NEKB 1XXGA 2AQ1B 3Q8AA 3AN1A 4LTUA 1OQQA 3PO0A 1ENFA 4PVHA 5I1VA 2P4PA 1VRAB 2JZPA 1WYGA 2LMCA 3SEBA 2V0GA 1TS4A 3AE6B 3KQ4A 1FFVA 1TS3A 3TEYA 2VZKB 1B1ZA 1KTKA 1Q10A 3PZ7A 4JWUC 3W5VB 4PWCA 4DXFA 1T5XD 2WDRB 3U52E 1W1OA 2H89B 1C4CA 4CQNA 1YMHE 3S1FA 3B2GA 4KKJA 5D3DA 3PQBA 2BS2B 1SJHD 2BB5A 2J42A 2QKNA 1X2HA 2WU2B 1MVKA 5BMHA 2N0SB 1IGCA 2ACZB 5TSSA 3AE1B 1GB1A 1TY2A 3UI3A 4HEA1 1FFUA 2ONQA 3HUIA 2RDGA 1I4RA 2BB6A 1L4DB 1YN3A 1F0XA 2J52A 5AE1A 3IAS1 1WXQA 2Y08A 1VLBA 3VTEA 2QJLA 1XEEA 4ARCA 5HG2A 2NTSA 3AM9A 1ACCA 1L6VA 3I9V1 4IOIE 2VAOA 2L52A 3L4PA 3SFDB 2PTLA 2IPIA 4ITKA 2BS4B 1NI3A 4JE3B 3SFEB 2WXNA 2YVSA 2DYOA 1L5PA 1MHXA 3NS1A 3W8XA 1XLOA 5L6FA 4GDKB 2BVHA 2Z8LA 3AE2B 5D79A 3RJ8A 4YSZB 1T3QC 5G5HB 1M4VA 4WAFA 1FCCC 3P4SB 2AX5A 3TSJA 1HZ6A 4A55A 1C78A 4ZHOA 4A6QA 3H8HA 1E8FA 1SE3A 4KGTA 5BYRA 4PYTA 2NMQA 1V1PA 3SR6B 4XLOA 3ZQ4A 3D2DA 1DYQA 3RFZB 3NVVB 3JS8A 4US9A 1J7AA 1L4ZB 2J53A 1P7EA 4NAMA 2B76B 2JSVX 2I2YA 4OVZA 1BUIC 1SXTA 2M56B 2G1EA 4L1BA 2CJNA 2RDHA 3NVYB 1FNWA 5EE0A 1E0ZA 1TZOA 2RPVA 3OWEB 4YSXB 2KN4A 1D5XC 4P16A 2NQWA 1T3QA 1YN5A 2JU6X 2Y4GA 4RGNA 3LYYA 3AB5A 2M0AA 3BIID 2GRIA 4A90A 3RPFC 3FILA 2W3RA 4RGOS 1TKGA 1E8GA 1KLUD 1QOFA 3AE7B 1RFKA 1ROEA 1QOAA 1MBTA 1SF0A 2INPE 2IDYA 1FD6A 4PVEA 3Q8FA 5AWVA 1AW7A 4NJCA 4Q2JA 5H92C 2K5PA 4P6VF 1OQRA 1N5XA 1YNTE 2P3HA 1XO3A 4US8A 2L83A 4REZA 1XLPA 2SEBD 1VR9A 3PZ8A 4XWTA 1SSNA 1ZOYB 1DZNA 2E3TA 1EWCA 3AEDB 1STEA 4LLGM 1YQ3B 1C4PA 1YN4A 2D5GA 2VFSA 2PIAA 3URYA 4TQ0A 1C76A 1NYQA 2E5AA 1HEZE 1I4PA 3T3NA 3C0PA 2VZKD 1CJEA 1HA5A 3KLSX 5EE3A 2FUG1 1UWXA 2Y5PA 1AYFA 1XF5L 5AUKA 4YTNB 3TEWA 3FWAA 4KKIA 1FFVC 2YEPF 3TX1A 2SAKA 3ABVB 3WCQA 4WH4A 3AEFB 5FXDA 3NVWA 4PT5A 3A7AA 1TKEA 5HHDG 4C7YA 2E6XA 2I38A 2LUMA 4OW0A 2YEPB 1OFFA 3R2TA 2P13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWM A;  1FFU C;  1FIQ A;  3S1C A;  1DOI A;  4A9A A;  1DII A;  2PKO A;  5FXP A;  4N58 A;  3LLB A;  1KF6 B;  1J7C A;  4PVJ A;  1RYJ A;  2Y5C A;  1SB3 B;  2WDQ B;  3NVZ A;  3HRD D;  1QT9 A;  1XLN A;  3D2H A;  1V8C A;  1IUE A;  1JRO A;  3NRZ A;  1E7P B;  1QOB A;  1B9R A;  1W1K A;  1FMA D;  3AE3 B;  2VFU A;  4HRS A;  1FM0 D;  2PLS A;  5MPO A;  3VRA B;  3FW8 A;  1N61 A;  2W3S A;  3AEA B;  2WQY B;  1WVE A;  2OAI A;  3LAE A;  1WGK A;  5C2T B;  2FBW B;  1N63 A;  1ZR6 A;  1FRD A;  2BVG A;  1N60 A;  2DBY A;  1FXA A;  2W55 A;  2KMM A;  5H8Y E;  3W5U B;  1E10 A;  1RM6 C;  3DWG C;  4JWS C;  3LB8 C;  3DQ0 A;  4TVW A;  3FC4 A;  4ZOH C;  2WP9 B;  2DWQ A;  2EKI A;  1WRI A;  4YXD B;  1ZP0 B;  2LEK A;  1QF6 A;  1L6U A;  5G5G B;  1E6E B;  5AUI A;  1W1S A;  1PDX A;  1VJK A;  1AHZ A;  1JRP A;  5HMR A;  3AE4 B;  1YQ4 B;  3FW7 A;  5C3J B;  5G5H A;  1FXI A;  5AE2 A;  4C80 A;  5ADZ A;  2RK5 A;  4MLA A;  4ZHP A;  3AE9 B;  5AE3 A;  2I0K A;  4BBY A;  5FXE A;  3SR6 A;  2WU5 B;  2BS3 B;  2W54 A;  1I19 A;  3HVZ A;  3NVV A;  3AMZ A;  5GXG B;  3FW9 A;  4BC7 A;  1W1R A;  2BVF A;  4OAL A;  2CJO A;  2EXR A;  2KAJ A;  3NVY A;  1VAO A;  2MJ3 A;  4PWB A;  1L0V B;  2K9X A;  1PFD A;  3BW7 A;  4HRO A;  3AEC B;  4PZF A;  2AXR A;  1HSK A;  2WLB A;  1ZUD 2;  1AWD A;  2PVO D;  4YSY B;  3NVW B;  2VFV A;  2MJE A;  1DOX A;  4BCA A;  1KRH A;  1TKY A;  3B9J B;  3DWM A;  2M19 A;  2QIE B;  4WQM A;  1RWS A;  5EE1 A;  1JWA D;  1QLT A;  3KWL A;  1NVI D;  1JWB D;  1E8H A;  4N6E B;  4C7Z A;  4KX6 B;  1DIQ A;  4JX1 C;  1N61 C;  1W1L A;  4FXC A;  4O95 A;  1W1M A;  1N63 C;  1CZP A;  1W1J A;  1DOY A;  1PUT A;  3P4P B;  3S1D A;  1N60 C;  3ETR A;  3TSH A;  3PM9 A;  2WDV B;  3VRB B;  1QLB B;  3AEG B;  3LXF A;  4PVK A;  2R8D A;  3W9C B;  1FRR A;  2Q5W D;  3AEE B;  1E9M A;  1VDV A;  2R2Z A;  3W8W A;  3B2F A;  3AEB B;  1N62 C;  3CIR B;  3NS1 B;  4EC3 A;  3CWI A;  2CU3 A;  2OHF A;  3P1M A;  4DNS A;  2PLI A;  2WS3 B;  3AE5 B;  2Q85 A;  1E0Y A;  5FXF A;  3HRD C;  2K22 A;  1JQ4 A;  2MJD A;  1GAQ B;  2H88 B;  3GSY A;  4YTM B;  2PVG C;  4BC9 A;  3W8Z A;  1N62 A;  1J7B A;  3P4R B;  2VFR A;  1JW9 D;  1I7H A;  4N59 A;  2JQR B;  4IDI A;  3P4Q B;  1RM6 B;  4ZOH B;  3DED A;  4HG0 A;  1R7S A;  3AH7 A;  1NYR A;  1SIJ A;  2JX5 A;  4ML8 A;  1WWT A;  3ZYY X;  1QLU A;  1YJJ A;  1GPX A;  1TYG B;  3D2J A;  3AV8 A;  1NEN B;  5HHZ A;  2GQT A;  4YTP B;  5G5G A;  1X2G A;  5HQX A;  2QPM A;  3I99 A;  1F0Z A;  1AHV A;  3VR8 B;  3A7R A;  4JAY A;  1DGJ A;  3FAH A;  1KFY B;  2GQU A;  1VQZ A;  3P63 A;  2O3G A;  1N5W C;  3S1E A;  3EUB 3;  1FO4 A;  3R07 C;  4USA A;  1YJI A;  1AHU A;  4WWM A;  2VFT A;  1ZXI C;  1FIQ B;  1A70 A;  4YT0 B;  1JAL A;  3VR9 B;  1N5W A;  1V97 A;  5EE9 A;  3NVZ B;  1QOG A;  2HTM E;  1TJE A;  4UD8 A;  2MH7 A;  2Q4W A;  3KJM A;  3NRZ B;  1WVF A;  3ETR B;  1SB3 C;  3AE8 B;  1W1Q A;  3A7U A;  1ZXI A;  2BT6 A;  1MBB A;  3EUB 2;  1UXY A;  3B9J A;  2MBR A;  1EWY C;  4JB1 A;  1XLQ A;  1NEK B;  3AN1 A;  4LTU A;  1OQQ A;  3PO0 A;  4PVH A;  2P4P A;  1WYG A;  3AE6 B;  1FFV A;  4JWU C;  3W5V B;  4PWC A;  1W1O A;  2WDR B;  2H89 B;  3S1F A;  3B2G A;  2BS2 B;  2QKN A;  1X2H A;  2WU2 B;  2N0S B;  2ACZ B;  3AE1 B;  1FFU A;  3HUI A;  1F0X A;  5AE1 A;  1WXQ A;  1VLB A;  3VTE A;  2QJL A;  3AM9 A;  1L6V A;  2VAO A;  2L52 A;  3L4P A;  3SFD B;  4ITK A;  2BS4 B;  1NI3 A;  3SFE B;  2YVS A;  1L5P A;  3NS1 A;  3W8X A;  1XLO A;  2BVH A;  3AE2 B;  5D79 A;  4YSZ B;  1T3Q C;  5G5H B;  3P4S B;  2AX5 A;  3TSJ A;  4ZHO A;  1E8F A;  4PYT A;  3SR6 B;  4XLO A;  3D2D A;  3NVV B;  3JS8 A;  4US9 A;  1J7A A;  2B76 B;  2M56 B;  2G1E A;  2CJN A;  3NVY B;  5EE0 A;  1E0Z A;  4YSX B;  2NQW A;  1T3Q A;  3AB5 A;  3BII D;  3RPF C;  2W3R A;  1TKG A;  1E8G A;  3AE7 B;  1QOF A;  1RFK A;  1ROE A;  1QOA A;  1MBT A;  1SF0 A;  4PVE A;  5H92 C;  2K5P A;  4P6V F;  1OQR A;  1N5X A;  2P3H A;  1XO3 A;  4US8 A;  2L83 A;  1XLP A;  1ZOY B;  1DZN A;  2E3T A;  3AED B;  1YQ3 B;  2VFS A;  2PIA A;  1NYQ A;  2E5A A;  3C0P A;  1CJE A;  4TVY A;  5EE3 A;  1AYF A;  5AUK A;  3FWA A;  4YTN B;  1FFV C;  3TX1 A;  3WCQ A;  3ABV B;  3AEF B;  5FXD A;  3NVW A;  3A7A A;  1TKE A;  4C7Y A;  1OFF A;  2P13 A; 
#chains in the Genus database with same CATH topology
 1SV0 C;  1CRX A;  4KSK C;  1ZGU B;  4X57 B;  4KLS A;  4IQV A;  4ZCW A;  3S1C A;  3CGC A;  3MR3 A;  3SDL C;  2R9Z A;  4JQ9 A;  3QIJ A;  2QMT A;  3URH A;  4HPM B;  3RB0 A;  2XH0 A;  3CST A;  2WFA A;  3BYT B;  3K9O B;  4MGZ E;  1J7C A;  4ZYN A;  1UQV A;  3MTN B;  3QU4 A;  3EJE B;  4H4Q A;  1MDL A;  1VZ8 A;  3QTP A;  3SAH A;  3PHW B;  1MI0 A;  4IL6 U;  1XSN A;  3ZTC A;  4KLL A;  3TUO A;  3QZ8 A;  5DPR A;  4ZDV A;  3D2S A;  3BVG A;  1UNS A;  4EUT A;  4KX5 A;  3IVF A;  5KFR A;  2LGI A;  4DDG D;  1UD7 A;  5KTQ A;  5KFQ A;  4EE2 A;  1IUE A;  1SV0 A;  2DKX A;  2HVI A;  2WXJ A;  3IXS A;  1WUE A;  1ZY8 A;  1L8O A;  2PFO A;  3IT4 B;  2GGI A;  1FMA D;  2J0K A;  4C8O A;  2FCN A;  3N32 A;  4RZR A;  4HRS A;  2PLS A;  5BPC A;  2GMI C;  1ESF A;  2QAR B;  2KG5 A;  3C5G A;  4C56 C;  2P66 A;  4KMO B;  2PA6 A;  3PX6 A;  2TPR A;  4BOS C;  2BYT A;  4JMU A;  2R2Q A;  1R0M A;  1N61 A;  5KAI U;  5AIB A;  2WQY B;  3CSF A;  9ICP A;  1NPX A;  2OAI A;  1MQ2 A;  1WGK A;  2GL5 A;  4ZRI A;  4M47 A;  3TJI A;  1N63 A;  4DFD A;  2GQW A;  4AQ7 A;  4YXJ A;  4DQQ A;  3MP9 A;  3PZP A;  3CXB A;  3IC9 A;  3V6K A;  4RH6 A;  3BK1 A;  2LFI A;  3A4R A;  4LNI A;  3RT3 B;  2JY6 A;  2RPQ A;  1N60 A;  3QCA A;  2F8K A;  1E10 A;  2KMM A;  5H8Y E;  2JVC A;  9ICH A;  2CU1 A;  2IND C;  1MG4 A;  2AHO B;  5ALP A;  2UU7 A;  3DWG C;  1OEY J;  3D9X A;  3DGB A;  4P1C C;  4TVW A;  4LNF A;  5JU5 A;  4ZOH C;  4FUL A;  4O0I A;  2E8O A;  2HW3 A;  2DWQ A;  4LK0 M;  2HCF A;  3ZNZ B;  2EKI A;  4MT5 A;  4WJQ A;  2GGH A;  3TOY A;  3LK9 A;  1VCB A;  4IM2 A;  3KVF B;  4TVY A;  3C21 A;  1QQR A;  5EWE A;  4FS2 A;  3K1Z A;  1YZ7 A;  4PHA A;  1L6U A;  4HJG E;  3V6J A;  4K7W A;  2NVU I;  3V7K A;  4HCP B;  3GD3 A;  1S5L U;  1M6Y A;  8ICK A;  3ZRF A;  3NO1 A;  4FAD A;  4O3P A;  3GO2 A;  2WXO A;  1KLV A;  3CF6 E;  1PDX A;  4H2H A;  1PVR A;  4F4Z A;  2KE7 A;  2WF5 A;  1QSL A;  3ZUN A;  4LII A;  5J0W A;  3CYJ A;  3TWB A;  1AQ6 A;  2WPE A;  4JUZ A;  2W7O A;  1FXI A;  5J0X A;  2HOF A;  3U4E G;  8ICU A;  3AXC A;  3FYH A;  4FJZ A;  3DFH A;  3AE9 B;  4RF1 A;  2RP5 A;  1BKH A;  4A35 A;  1K52 A;  4BBY A;  2G9H D;  2EAM A;  3RI7 C;  1IP9 A;  5FXE A;  9ICA A;  2ZIX B;  2WU5 B;  5L1K A;  1WR6 E;  3R25 A;  2FPK A;  3AMZ A;  4P4M A;  1J19 A;  2PMZ C;  1NBF C;  3V3X A;  1IBX B;  3BOX A;  9ICS A;  1W1R A;  2BVF A;  4OCZ A;  2CJO A;  3RB4 A;  3GZN B;  4LA1 A;  2JXX A;  4LNN A;  3I6E A;  3RTV A;  4BKT A;  3TEX A;  4MGY E;  4NLN A;  4NAW B;  4BZA A;  4PWB A;  4E0D A;  3N7R C;  3E58 A;  3QEA Z;  5T8I A;  1Q1O A;  4M6U A;  1SV4 A;  3K9P B;  2H3F A;  2K9X A;  2OH2 A;  2DYM A;  2ZZB A;  3PV1 A;  2ODG A;  2KQ7 A;  3BW7 A;  4YR0 A;  4HRO A;  2C5L C;  1EU4 A;  4PZN A;  4K81 A;  4CHK A;  1WFY A;  1ZUD 2;  2M9N A;  1UHU A;  2WLB A;  4YSY B;  2YVG A;  3HIZ A;  3V4B A;  3TQ1 A;  3A9J B;  4ICA A;  5ALZ A;  4UB4 A;  1Q0W B;  2WX0 A;  2VFV A;  5FJT A;  4UAS A;  2X38 A;  5KFZ A;  1SEB D;  1NZB A;  4GLS C;  1TKD A;  3MJ5 A;  4P0P A;  1KRH A;  4I2D A;  4GOC A;  2PPH A;  2N9X A;  4KN4 A;  3SI8 A;  2W0H A;  3QPE A;  4C4V A;  3Q14 C;  4OO1 J;  3BJY A;  1RWS A;  1YJ1 A;  3UJ2 A;  5J0P A;  3UIN B;  3N4F A;  1COO A;  3OG5 A;  1L7M A;  2IBI B;  2AKM A;  3KWL A;  1K50 A;  3T4W A;  2QGY A;  3BYY B;  2KXJ A;  4N6E B;  3CGE A;  1S8O A;  1A0P A;  4CF4 A;  5KFE A;  4F72 A;  2AWT A;  1ZQR A;  2RDX A;  3EAO A;  3RBE A;  5BYQ A;  4RPY A;  1S77 D;  1C3T A;  5AM1 A;  1BVS A;  1KLG D;  2PSN A;  3T6C A;  3KUC B;  3GIJ A;  1W1L A;  5J2C A;  4YR3 A;  2ZUB A;  5IIJ A;  3KHH A;  1WY8 A;  2CPR A;  2QHO A;  3GOE A;  2KIV A;  4RU9 A;  2Z59 B;  5D49 A;  1JWM D;  1EC7 A;  1ZD2 P;  1NKB A;  4I2I A;  3RH5 A;  2BC1 A;  4G8T A;  2O56 A;  4F92 B;  1DOY A;  1TBE A;  2I5H A;  3MSY A;  2L0F A;  1Z4N A;  4GMV A;  3R11 A;  2PMQ A;  3WK4 A;  4GIS A;  4B9V A;  2WDV B;  2KFK A;  4F93 B;  2WXI A;  2KWV B;  3IG8 A;  3RNA C;  4C4R A;  9ICB A;  1ZQE A;  3PX0 A;  4FFD A;  4W9G A;  5J0Q A;  2WXF A;  2ASD A;  4K8D A;  4RQ6 A;  2OZ3 A;  1D4B A;  4RQM A;  1LFD A;  3PNC A;  2IOF A;  1KFT A;  2MBB B;  2KVZ A;  2O2V B;  5HHI A;  2Q5W D;  2F1I A;  3HHM A;  4TV3 A;  5C1Z A;  2BW2 A;  1JPM A;  4JHM A;  1LVL A;  1BPX A;  4KLH A;  3B2F A;  3AEB B;  2N1R A;  7ICN A;  1V80 A;  3PRZ A;  1NK5 A;  8ICP A;  4WAA A;  4AOF A;  5EBK A;  5J2A A;  3UJS A;  4GIV A;  2N1W A;  2KHV A;  2PXI A;  2REX A;  2W82 A;  3CWI A;  4MH8 A;  1S9F A;  3P1M A;  2K4I A;  5KFI A;  2NBV B;  3OSP A;  3AE5 B;  1S0V A;  2UVR A;  1N56 A;  5J2H A;  3ALB A;  2DZI A;  3HM3 A;  4PS7 A;  3PZD A;  2MA9 B;  4IQW A;  4HK2 A;  4TQ1 A;  4NV0 A;  3RZF A;  2C3D A;  2H3Z A;  3EJD B;  2XY6 A;  2L32 A;  4YTM B;  1OTR B;  3PSI A;  1ZQI A;  1DXS A;  2QAR A;  4BC9 A;  4LCD E;  3W8Z A;  1Y88 A;  3AI5 A;  4QZA A;  5B5E U;  1A77 A;  3QK0 A;  3ED5 A;  1DNC A;  5BMG A;  4EQR A;  4ZH4 A;  1TS2 A;  4FA6 A;  1JW9 D;  2VFR A;  1I4Q A;  5ALO A;  3PGE A;  4FE3 A;  1K1Q A;  1FHV A;  4I29 A;  1RXV A;  5KFX A;  2ASQ A;  3ZVH B;  2KFN A;  4KDI C;  4P1B C;  3NXL A;  3DED A;  3HKZ C;  3SD5 A;  3IJL A;  2IBK A;  1PYW D;  2DAF A;  1MRA A;  2IGD A;  5L1L A;  4UAR A;  1URJ A;  1S7M A;  3KTQ A;  2UUV A;  2Y3S A;  5KT7 A;  4UDU C;  1NYR A;  4XX5 A;  2DX5 B;  3B08 A;  1F2R C;  2JX5 A;  1TTN A;  1ZMC A;  3OC4 A;  5JRB A;  1DXL A;  4NEV A;  4JQW C;  3ZYY X;  4C8N A;  4J9K A;  1U47 A;  3TBL D;  3OTQ A;  2RR9 A;  3D2J A;  4FN2 A;  8ICW A;  1NEN B;  7ICG A;  5HHZ A;  3DH9 A;  2MWS B;  1BWC A;  3QFA A;  5J2K A;  2KOX A;  3QWZ B;  1X2G A;  4TUQ A;  2PKE A;  5FR3 A;  4F5O A;  2ZEQ A;  3JVA A;  3I99 A;  4DSI A;  3LYS A;  2R8J A;  1R6W A;  4OHJ A;  1AHV A;  3TTE A;  4H2A A;  1PGA A;  1KFY B;  3WU2 U;  4QZD A;  1SXD A;  4XZ4 A;  2WTF A;  1Y56 A;  5AKY A;  2G3Q B;  1ZQX A;  3P63 A;  5ALH A;  3BS5 B;  4E6M A;  3N7P D;  1JIH A;  4TSS A;  2DQN B;  2PP3 A;  2KWD A;  1XS9 D;  4DXA B;  2GGJ A;  4ADW A;  5F9L A;  1ZDL A;  4UAW A;  1V38 A;  3B97 A;  3IJI A;  5JTI A;  2ZIX A;  4MHV A;  4YG2 A;  4NJ8 A;  4NXZ A;  1IBX A;  1X40 A;  5FJO A;  2WB1 C;  3V05 A;  2YY6 A;  2AL2 B;  4KEM A;  4WWM A;  2VFT A;  7ICQ A;  1WXV A;  2PE9 A;  4GXB A;  2R18 A;  3MQT A;  2FYM A;  5JCL A;  1PK3 A;  4BBN C;  4DF8 A;  1A70 A;  4KLG A;  3OJU A;  5HP4 A;  2MQJ A;  4NAW A;  2QEJ C;  4YT0 B;  4B6W A;  2BTE A;  1FEC A;  2JT4 B;  2ZJ8 A;  3N1Z C;  3G6V A;  3PW4 A;  2EMS A;  4KLI A;  2LJ5 A;  2Z0E B;  4I6L B;  2ZC8 A;  1JX4 A;  3MFG A;  2O6K A;  2AKZ A;  1JUD A;  4JV0 A;  1WCN A;  4BKS A;  4K2S A;  3P3B A;  5CP2 A;  1P7F A;  5L9X A;  9ICU A;  2EQ6 A;  1IYX A;  3A9J A;  3H8M A;  4DCC A;  1GB4 A;  4UD8 A;  2PGW A;  2DFL A;  3TAQ A;  1MPE A;  3JW0 X;  3NRZ B;  3UJF A;  3A7U A;  4DL6 A;  4RQ8 A;  2W9A A;  1KH0 A;  2PLP A;  3RMK C;  2BDP A;  4M9H A;  3H1U A;  1HJP A;  4AJY B;  3ES7 A;  2TSS A;  1MN8 A;  1NEK B;  1XLQ A;  2AQ1 B;  5CX3 A;  5LXI B;  2BHN A;  2QB1 A;  3AN1 A;  3A0B U;  1KM7 A;  3TL5 A;  2HI0 A;  1OQQ A;  3L0W B;  5EU9 A;  1AAR A;  2AL1 A;  1WYG A;  3M8S A;  2V0G A;  3KLJ A;  1TS4 A;  3RJK A;  4I2B A;  4B9K A;  2VZK B;  1B1Z A;  1Q10 A;  3PZ7 A;  3ZLF A;  2EAN A;  3W5V B;  4DXF A;  1W1O A;  4GRT A;  3BZK A;  1C4C A;  3MKC A;  1V9J A;  1YMH E;  4KKJ A;  1E8W A;  3PQB A;  3RO6 A;  4KZC A;  1X2H A;  4WWO A;  1IGC A;  5CWR A;  5DLF A;  3KW5 B;  5TSS A;  2MUT B;  3EKG A;  5C23 A;  1WMH B;  4BFR A;  1GRB A;  4K8G A;  2RDG A;  2BB6 A;  5KAF U;  2N7D A;  1L4D B;  1YX6 B;  3QUT A;  2FCM A;  1ZQB A;  3ISB A;  2DEN B;  2JRZ A;  3SEI A;  3T5K A;  2GOL A;  3B0A A;  5ALN A;  3RNE C;  2PU1 A;  4EQW A;  3GII A;  5FS9 A;  3VTE A;  4EQS A;  4IQT A;  1XEE A;  4H50 A;  4M0W B;  3KD3 A;  4DFP A;  3KZI U;  3H8W A;  3JPO A;  1E90 A;  4MGI E;  4W9J A;  4WJO A;  2G09 A;  1QQ5 A;  4HWI B;  4B9T A;  2VAO A;  3PML A;  4H4V A;  4TQS A;  2OPJ A;  3L4P A;  2O2V A;  3SFD B;  3DK9 A;  3SFE B;  1ZQK A;  2JZZ A;  4JDR A;  3N6H A;  4O3Q A;  5J2E A;  3M9N B;  2F3N A;  3NJT A;  4NJ7 A;  5KFS A;  2J0J A;  2QAE A;  3QJZ A;  3AE2 B;  5D79 A;  3RJ8 A;  1K1S A;  3EWA A;  1T3Q C;  3UXL A;  1ONE A;  5G5H B;  3ZLH A;  4H1Z A;  4X5V A;  1FCC C;  4NLK A;  3P4S B;  1HZ6 A;  4A55 A;  2K1F A;  4DHZ B;  5AKZ A;  4CGZ A;  2EDU A;  3OLM D;  4BX9 C;  3PTF C;  3R0K A;  4MF8 A;  4XLO A;  4HDQ A;  3OHA A;  1DYQ A;  3JS8 A;  2BDU A;  4YD2 A;  3H0L B;  1P7E A;  1O03 A;  3AU6 A;  4EZ9 A;  4OVZ A;  1ZD3 A;  1RFA A;  4GYP A;  4CDG A;  2G1E A;  1FEB A;  1V86 A;  1SGG A;  5J2I A;  4DSE A;  1WXM A;  3OJ4 B;  2GBN A;  5DPT A;  1GRE A;  3MUC A;  1MG8 A;  2KN4 A;  3FYY A;  3UXP A;  4I2A A;  3NTU A;  1GO3 F;  1T3Q A;  3ZVH A;  3UQ2 A;  2CRX A;  1TK0 A;  3AB5 A;  3KUD B;  5E6N A;  4ELT A;  1S0M A;  1W6T A;  8ICT A;  3ZXV A;  4YMO A;  4E8G A;  2W3R A;  4ECT A;  4RGO S;  3VHT C;  4F2R A;  4EM3 A;  1NK9 A;  4EYH B;  1H8C A;  4P0Q B;  4KZ0 A;  5AWV A;  7ICU A;  2ZTD A;  1NNL A;  5KT3 A;  1FEZ A;  1AW7 A;  4NJC A;  8ICN A;  4Q2J A;  2K5P A;  1BQG A;  1N5X A;  2W11 A;  2C2D A;  4R66 A;  3M1Y A;  3KUZ A;  1N2X A;  4QZG A;  3IDW A;  2WF7 A;  4REZ A;  2I1Q A;  3DVN U;  3AEV A;  3PZ8 A;  3PW0 A;  1VR9 A;  1H4R A;  2FCQ A;  1Q8K A;  1WJU A;  5FJR A;  2KAN A;  1QQ6 A;  2E3T A;  3MBY A;  4RPZ A;  3WAM A;  3SAG A;  3WK7 A;  3ES8 A;  3AU5 A;  1X66 A;  2XH7 A;  4DHZ E;  4FZN A;  1Q3U A;  2J0M A;  2KKV A;  1EBD A;  3URY A;  1WGY A;  2NR2 A;  1ZKQ A;  3T3N A;  3GRS A;  5KFV A;  3C28 A;  3KLS X;  3BS5 A;  3TEW A;  5GTH U;  2Y5P A;  3D2Q A;  4HCD A;  9ICJ A;  3UQB A;  4KKI A;  2OZT A;  3TX1 A;  2FI1 A;  1Y8R C;  3ABV B;  1XO1 A;  3DHG C;  1E5W A;  4WH4 A;  3AEF B;  5FXD A;  3NVW A;  2F76 X;  1S3S G;  1WGG A;  2AXT U;  3PW5 A;  3TAP A;  2YB4 A;  3Q8M A;  2I38 A;  1T0S C;  4F8C B;  5J2D A;  1VJ5 A;  5EWF A;  3VDZ A;  3W1S A;  2PCE A;  2KVR A;  5J0Y A;  4XYC A;  2AL2 A;  2A4Z A;  4ECR A;  3D46 A;  3FJ4 A;  5AIA A;  4Q8F A;  4MM3 B;  2CFY A;  1FFU C;  2OEH A;  4BUR A;  2ZCB A;  5I1W A;  4TQR A;  2WXQ A;  3ENE A;  4TUR A;  9ICK A;  4RQ4 A;  5HNK A;  2B3A A;  4A9A A;  1GER A;  5FXP A;  4KIK B;  3C2M A;  5TR3 A;  4Q44 A;  1JML A;  3MFI A;  1EXN A;  2Y5C A;  4F2S A;  1SZH A;  4C0Z A;  2ZZC A;  4KN7 A;  4Y2Y A;  4A8X C;  1MC8 A;  4LZG A;  3TAN A;  1JDF A;  1QT9 A;  1PDY A;  2JXT A;  4B9L A;  3P42 A;  4E71 A;  1KW4 A;  1V8C A;  4O3N A;  2YVF A;  5KG7 A;  3NRZ A;  2ZNV B;  4ECX A;  1V5T A;  2WOV A;  5BOE A;  2PW9 A;  1QOB A;  1I4G A;  1Z4O A;  5DQI A;  2N7E A;  1A5R A;  3D6J A;  2NPT B;  4GFI A;  4BGD A;  3A1Q B;  2GLE A;  2IHM A;  4J9S A;  3AE3 B;  1SWV A;  2VFU A;  3SJN A;  3RJI A;  3T5H A;  3VRA B;  4XRH A;  4OVU A;  3RR1 A;  1SL0 A;  1D8B A;  3UQ0 A;  3TQP A;  5L1J A;  2MBH A;  4U6P A;  3RH6 A;  4ELV A;  2FBW B;  3LVV A;  4DWD A;  5DCN A;  3H8J A;  3BVM A;  2GGE A;  1NK7 A;  2OX4 A;  2BKE A;  3U7D A;  3PO5 A;  2XY7 A;  2ZW1 A;  4R8U B;  1WXS A;  3GV7 B;  3SHQ A;  2DKZ A;  1AN8 A;  2POD A;  3OTR A;  2LAS A;  1HQR D;  3BZC A;  2MUT A;  1RM6 C;  2KTF A;  1WMH A;  4FP1 A;  4JWS C;  3RAQ A;  1V81 A;  1WF9 A;  3FC4 A;  3ZI4 A;  1T0R C;  2KX3 A;  1EBH A;  2D3C A;  2LYB A;  5JZE B;  4K4H A;  4KGS A;  3RH4 A;  3H4D A;  4I2G A;  4KDL B;  4OJ6 A;  7ICF A;  1P1A A;  4M0W A;  3TMP B;  2WX1 A;  2A3V A;  4QIW F;  1ZP0 B;  2LEK A;  9ICT A;  1VZ6 A;  9ICX A;  2NCN A;  3MZN A;  4IW0 A;  4AP4 C;  2DF4 B;  2INC C;  2D07 B;  1ONF A;  2HBK A;  4QWC A;  2W7P A;  3QQ8 B;  3UF8 A;  5EDS A;  3M9M B;  1KEJ A;  2KJR A;  2KJH B;  4ARI A;  3IV6 A;  3CXO A;  4DL5 A;  3FIL B;  2FMQ A;  4IC7 B;  1ZQO A;  1AHZ A;  2MBO A;  8ICI A;  3AE4 B;  3N9Y C;  2MUC A;  5KFH A;  2PJH A;  2RK5 A;  5G5H A;  2F44 A;  1P7D A;  1SKW A;  3QX1 A;  4MLA A;  4I2C A;  1B43 A;  4Y2R A;  3ML9 A;  3PR4 A;  2BYF A;  4ZHP A;  4JV2 A;  2OYY A;  2LWP A;  5CR0 A;  2JWZ A;  5ENL A;  3WA0 A;  5D3I B;  1TKK A;  1Q46 A;  2M17 A;  4B9S A;  3O0H A;  1MSW D;  4I27 A;  3A33 B;  1ET9 A;  3FW9 A;  4F3O A;  4OAL A;  1NJY A;  5AK3 A;  2ZCC A;  1KKR A;  5AK5 A;  2DHZ A;  1SZP A;  1ZQY A;  4QWD A;  8ICF A;  4DWF A;  1VAO A;  4JN7 A;  3PO4 A;  3ZVI A;  1WUF A;  3QC8 B;  4F71 A;  2MCN B;  4EEK A;  4Z6C A;  3B0X A;  2MRP A;  4Q8E A;  1JEH A;  2ESE A;  4J03 A;  4KLO A;  4C8L A;  3BSM A;  4HXD A;  3S2A A;  5ALX A;  3U30 A;  2JH7 A;  4I28 A;  2PTW A;  3RNB C;  1ARO P;  4JWM A;  4GGQ A;  3PY8 A;  2GBR A;  3ZDM C;  4DYE A;  4P0Q A;  2L0T A;  2IA6 A;  2MJE A;  2Z0D B;  3KHR A;  5FK9 C;  3PWG A;  3P2B A;  1DOX A;  1D5M C;  4BCA A;  1TKY A;  2WGS A;  2GRT A;  2A1J A;  2ISP A;  1YQZ A;  2R61 A;  1GV4 A;  3V6C B;  1ZQW A;  2EZY A;  4DHJ D;  1G6J A;  1P98 A;  1EM7 A;  1JWA D;  2GWS A;  2GH1 A;  3EYZ A;  1L0Y B;  4Y2P A;  5ALS A;  4CE6 A;  4PGQ A;  1EU3 A;  4QWA A;  2FCS A;  5G55 A;  3C2L A;  1E8H A;  3PSE B;  4C7Z A;  4KX6 B;  3UIP B;  3MC1 A;  1FEH A;  2NTT A;  1CMX B;  4BKG A;  1GEU A;  4IL2 A;  9ICM A;  1N61 C;  4HCL A;  4XUS A;  5CB1 A;  2K4H A;  2KNJ A;  2PGE A;  4H19 A;  1ZQG A;  1J0G A;  1KSP A;  2LGD A;  3LLB A;  2Q0Z X;  1N63 C;  4MJS B;  2W9C B;  5III A;  3RRH A;  2QDE A;  3UXK A;  3HVD A;  3GB1 A;  1HZ5 A;  1I4X A;  1N60 C;  3CAW A;  3BVZ A;  1YT3 A;  3ETR A;  1UGM A;  3TSH A;  4DHJ B;  3ZIM A;  3R3M A;  1U45 A;  5ALQ A;  2FID A;  3MJW A;  3LXF A;  1L8L A;  4MFA A;  2AQ2 B;  4MM3 A;  5AZF A;  3SU8 X;  3DK8 A;  1LB2 B;  3PSF A;  1BPB A;  3K4G A;  2PTX A;  2IOH A;  4M9L A;  4ZRK A;  4FJY A;  1WG8 A;  1FRR A;  4KIK A;  1FEA A;  3AEE B;  2FLP A;  4DQR A;  1QIL A;  1PK1 A;  4NWI A;  2YMM A;  5ALE A;  5KFO A;  1ZQQ A;  2KT7 A;  4Y2T A;  1T94 A;  3N97 B;  3CIR B;  3I6T A;  2OXO A;  4CRX A;  3ONS A;  3VVW B;  3NS1 B;  1HTO A;  4ACF A;  3TKA A;  1OEY A;  4ZA0 A;  3IHQ B;  1BGX T;  2BYV E;  5AZH A;  4QZE A;  2KDI A;  2WXK A;  2PLI A;  4G11 A;  7ICE A;  1NDD A;  2Q85 A;  4MGK E;  5KFG A;  3SAF A;  3GV8 B;  2EKE C;  3WAP A;  1RYU A;  2WF8 A;  5KVH A;  3TIX A;  2ZTC A;  3UGB B;  1JQ4 A;  1ISN A;  4HLE A;  3GE8 C;  5ALI A;  4DFM A;  1T3N A;  2NPT A;  3GSY A;  1RQL A;  3A1Q A;  2V4L A;  1SJC A;  7ICL A;  3FM9 A;  1LM8 B;  8ICA A;  3ALR A;  4PZO A;  2JWU A;  4XDC A;  1D8L A;  5CEH A;  2QB0 B;  4U7C A;  1MHH E;  4NM2 A;  2XCP A;  2RMM A;  2GBM A;  4LDT B;  5GRT A;  1V1O A;  3TAR A;  1QCK A;  4MF2 A;  4BXO A;  4C8K A;  1S76 D;  3KYD D;  4QW8 A;  5ALU A;  3N1Y C;  4IDI A;  3T5J A;  4UB6 U;  2BZF A;  7ICS A;  4RUC A;  3A9K B;  7ENL A;  4R8U A;  1SBB B;  3VA8 A;  4H4Z A;  4HG0 A;  1NKC A;  2DPI A;  2AL6 A;  4URK A;  4E74 A;  4M04 A;  2ON8 A;  3SQS A;  3HSU A;  3N28 A;  3PHX B;  3OJS A;  2WF9 A;  5IIN A;  3QE9 Y;  3GP7 A;  4B6J A;  5AI9 A;  2IGH A;  2QSD A;  3LVW A;  2V4I B;  2KP7 A;  2HOI A;  3NZ3 A;  1N48 A;  3VTU A;  4DSK A;  2GH5 A;  3MR2 A;  2C2E A;  1V5O A;  4BKS D;  2G08 A;  3Q8Q B;  2JEG A;  2ZXI A;  1E8X A;  2EQ7 A;  5KG4 A;  5AM3 A;  2HBJ A;  2AJQ A;  1JCK B;  1K51 A;  1YJJ A;  3ZJV A;  9ICV A;  4NY8 A;  4RQ0 A;  2N9K A;  5KL8 B;  4I2E A;  2K39 A;  1CQV A;  2QIL A;  5C0Y A;  1KCZ A;  4UAY A;  2UUU A;  1WM3 A;  1F3P A;  1SJD A;  4PK1 A;  4H83 A;  2L05 A;  3SD7 A;  1KD0 A;  3QN3 A;  2XI9 A;  3ZDB A;  3Q3F A;  5J0S A;  5DQG A;  1XNS A;  2LD9 A;  2ZIU B;  2V4Q A;  4EBE A;  2PS2 A;  2KTR A;  4H4R A;  4APN A;  3JPQ A;  2OVL A;  2KK0 A;  3EW9 A;  3SZ2 A;  2JYE A;  2K0P A;  4F5N A;  3VR8 B;  4JAY A;  1DGJ A;  3FAH A;  1XO0 A;  7ICJ A;  4G9B A;  4GIR A;  4TUP A;  2WXL A;  5HKH A;  1VQZ A;  2I1J A;  3F5E A;  1WZ0 A;  3WK8 A;  2BC0 A;  4E4F A;  4UAV A;  1TZ1 A;  1JWS D;  3BK2 A;  1ZMD A;  2Y08 A;  3NS8 A;  5J2R A;  4ECV A;  1JMS A;  4R3D A;  3GC2 A;  1F9C A;  2J7Q B;  3DHI C;  1KTQ A;  2ZW0 A;  3CB3 A;  1U9L A;  4NLC A;  1E7U A;  2P0I A;  4MDK E;  3FKY A;  2WXG A;  4I2F A;  3ECI A;  4USA A;  5KG2 A;  2XEW A;  2LXA A;  1TK8 A;  1AHU A;  4DXK A;  4W9L A;  3KWV A;  1GUA B;  3ML8 A;  4RFB A;  1JWU D;  2ZTE A;  4NQK E;  4GB9 A;  1QKZ A;  3E2E A;  4B9N A;  4WIP A;  2HJ8 A;  3F2C A;  3R7Q A;  3JZU A;  5DPW A;  1J97 A;  3BQT A;  2YTU A;  1ZDV A;  2FJ6 A;  1PGX A;  3ZW3 A;  4BAX A;  4H4P A;  3TJ4 A;  3NGD A;  2F2A B;  5J0R A;  4ECS A;  2PFN A;  4L2Y A;  1F77 A;  4IC9 A;  1T7P A;  2NBU A;  3N6J A;  3NZU A;  4LNO A;  2FNJ B;  4P4O A;  2CDU A;  3AUO A;  4KLU A;  4Z6D A;  1HTQ A;  3ZJU A;  1V59 A;  2JK6 A;  4BWJ A;  3EFC A;  1S0O A;  1TJE A;  2MH7 A;  2Q4W A;  2KMD A;  4O1N A;  4NL9 A;  3AE8 B;  1W1Q A;  1JI7 A;  2NRX A;  1NK0 A;  3RRG A;  4PPX A;  1ZQT A;  3LJ3 A;  1MBB A;  3RJA A;  2MBR A;  1HE8 A;  1ZE3 D;  3GU3 A;  4H4S A;  4RNA A;  3V3W A;  1KRP A;  3EJB B;  5F3X B;  3PW7 A;  3Q8A A;  3TJP A;  3IM1 A;  4IL0 A;  4QWE A;  4IQU A;  3N20 C;  4A20 A;  2QQ6 A;  2LPE A;  2R8G A;  2MBQ A;  4K7U A;  1XS2 A;  3SEB A;  1S10 A;  3KQ4 A;  1FFV A;  1TS3 A;  3PVL A;  5KT2 A;  1LQB A;  3GY1 A;  4J9M A;  1ZJM A;  1ZD5 A;  2Y5B B;  4PWC A;  7ICH A;  2PE6 B;  1NKE A;  1F0M A;  2Y0S F;  3RB6 A;  1T5X D;  2H89 B;  2WDR B;  3N3K B;  4XC2 A;  4CQN A;  2LM1 A;  1WE7 A;  2QKN A;  3DG6 A;  3DGZ A;  2J42 A;  4HN8 A;  4EMJ A;  4M02 A;  3ZDT A;  1STZ A;  4JB3 A;  1KLN A;  1GB1 A;  1TY2 A;  4MJS A;  4M9N A;  3ISD A;  2LZ6 A;  4M8N A;  3PK7 A;  2ONQ A;  2B6G A;  2OJW A;  3HUI A;  2P8C A;  3GV5 B;  5AKH A;  4YXM A;  1YN3 A;  4JL9 A;  5DDY A;  3ETL A;  1YX5 B;  1WXQ A;  3K75 D;  1ZRN A;  3NZS A;  2YLM A;  4F4Y A;  3DDH A;  5ALY A;  2ZPN A;  2KK8 A;  2R8H A;  3UPQ A;  3I9V 1;  2BPF A;  4I6P A;  3Q3O C;  2XBB C;  4IR9 A;  5DPS A;  4NLG A;  3EZ5 A;  4IG7 B;  2VKQ A;  3MGH A;  3P93 A;  5ALR A;  4A3O A;  4I2H A;  2YMP A;  2LRW A;  1MDR A;  2RQ5 A;  3NS1 A;  2JEJ A;  4DQI A;  5L6F A;  4GDK B;  2JZB B;  4K3B A;  3ZNH B;  3HP6 A;  2M4N A;  2EQY A;  1L3U A;  2LVO A;  4YSZ B;  3NUQ A;  3M3J A;  1ZQZ A;  2N9E B;  4YD1 A;  2MW5 A;  1ZKH A;  1M4V A;  4C4T A;  1XD3 B;  4ANU A;  4MKS A;  2CN1 A;  1RPL A;  2LGY A;  5KFT A;  4AWJ A;  1L7Y A;  1L3T A;  3H7P B;  1C78 A;  4ZHO A;  2BCU A;  4A6Q A;  5H2F U;  2XGP A;  1ZQC A;  1SE3 A;  3RFA A;  5ALD A;  4ACO A;  3BQ1 A;  5BYR A;  3RNC C;  3SR6 B;  5JCM A;  3ZQ4 A;  3D2D A;  3NVV B;  4YWS A;  1J7A A;  2J53 A;  1ZOL A;  3QU2 A;  2W9B B;  2QB0 A;  2B76 B;  1UCV A;  2VRR B;  3NAS A;  4F4K A;  1SXT A;  2M56 B;  2XID A;  2G45 B;  2CJN A;  1GJZ A;  4F4R A;  2F1H A;  3NVY B;  3MC8 A;  1TZO A;  2NV3 A;  3OWE B;  4IT1 A;  3T9P A;  2K25 A;  5J2G A;  8ICQ A;  3B1L X;  1IYF A;  1SJA A;  3A9K A;  3UMC A;  1U48 A;  1FXT B;  2Y4G A;  1X9X A;  1YD8 U;  3UJR A;  1OGW A;  1OXJ A;  3ZRC A;  3BII D;  1HUO A;  4K4I A;  2G07 A;  2FAZ A;  2GRI A;  4I2J A;  1ZQA A;  3VUX A;  4K1R B;  4P7I A;  1TKG A;  2Y1J A;  4KPL A;  5JH5 C;  1ROE A;  2GOW A;  1MBT A;  3RCZ A;  1FD6 A;  4PVE A;  3PWI A;  5IDZ A;  4B9M A;  5G2N A;  3JPT A;  8ICC A;  3PV8 A;  4KV2 A;  2LVP A;  4RQ3 A;  2UYZ B;  2I5Q A;  1Z00 B;  1XWL A;  1XLP A;  3A0H U;  1Z19 A;  2FMS A;  5DQH A;  2SEB D;  4IRK A;  1NHP A;  1ECW A;  2H3V A;  1TK5 A;  4EBC A;  3V6E B;  2ZZ0 A;  3WK5 A;  1SSN A;  1DZN A;  5ALT A;  2VAN A;  9ICO A;  3AED B;  4LLG M;  4O5E A;  1D7Y A;  2ZIU A;  3RJH A;  2KEY A;  2L00 B;  3WAL A;  2X8C A;  1PVQ A;  4ZRJ A;  2VFS A;  5L1I A;  2N9P C;  3JW7 A;  4GC7 A;  4KLF A;  2E8N A;  1A6S A;  2A5U A;  1KFS A;  2LM4 A;  4TQ0 A;  2BCR A;  1L7N A;  3VTV A;  2E5A A;  2HJ1 A;  2KMA A;  4UB3 A;  1I4P A;  3GQC A;  2EQ8 A;  1WIA A;  2VZK D;  3SQI A;  1AYF A;  4WJN A;  4YTN B;  5AUK A;  3QFB A;  3J81 j;  2K89 A;  4GU2 A;  2SAK A;  3WCQ A;  3APD A;  3HW8 A;  1GC6 A;  4DBG A;  2PP0 A;  1TAQ A;  2MNR A;  4IS7 A;  1NJW A;  2BCS A;  2L76 A;  5HHD G;  4C7Y A;  2E6X A;  1ZQP A;  3D47 A;  3T5L A;  1NK6 A;  4H4Y A;  5FR6 A;  4LVS A;  1MFW A;  1OFF A;  2P13 A;  5HR7 A;  4DX3 A;  5L6G A;  2WAQ F;  2C2R A;  2BPS A;  4Y2S A;  2Y9T A;  2YMQ A;  1KN5 A;  2HE7 A;  1PZN A;  4KGR A;  4K7S A;  4XWW A;  1KF6 B;  3OHB A;  4KVG B;  3Q8K A;  2FE9 A;  4PVJ A;  4NY0 A;  4IP5 A;  1RYJ A;  1TFR A;  3WAN A;  4B9U A;  1SB3 B;  3UIO B;  4MEX A;  1WYW B;  5C5J A;  5IIM A;  2DZK A;  1GRA A;  1WX7 A;  2WDQ B;  3PSP A;  2HHQ A;  1XLN A;  2GBK A;  2FPL A;  4HAI A;  5AI6 A;  1WGH A;  4FS1 A;  1ET6 A;  4E5T A;  4N9F 4;  3HJE A;  5J0O A;  3H4K A;  4MSM B;  2KTQ A;  1X9W A;  1OQY A;  1TV9 A;  1E7P B;  2LXC A;  1ZXH A;  2C3C A;  2QVH A;  2OQH A;  1B9R A;  4UB1 A;  1WE6 A;  2K4P A;  5D4B A;  3M8R A;  2DZM A;  2AQ4 A;  1W1K A;  3WKA A;  1COK A;  3RUL A;  1NDA A;  9ICI A;  3PPA A;  2YQU A;  2QLT A;  8ICH A;  3IP4 B;  3W1Y A;  3OZM A;  4E4U A;  1SL2 A;  1ZDX A;  2VA8 A;  2K8C B;  5D94 A;  3SEN A;  3AEA B;  2IY1 B;  2W43 A;  1WVE A;  2X50 A;  2DYB A;  3VXW A;  2YX8 A;  2ZJ5 A;  2LHT A;  2WXP A;  5C2T B;  1J2N A;  2FKP A;  4P2H A;  3I5J C;  4XE0 A;  4EZL A;  1ZR6 A;  1FRD A;  1ECQ A;  4OVV A;  3PRM B;  1WWU A;  4HKZ E;  1F2R I;  2KZZ A;  4DQP A;  5ALK A;  2EH9 A;  2DBY A;  4QW9 A;  3ORY A;  1I42 A;  4GYP C;  4CF5 A;  8ICV A;  1EF1 A;  2HVH A;  1DK2 A;  3W5U B;  3IT6 B;  2K8B B;  5AI5 A;  4OZB A;  2OJR A;  4ZYS A;  2YQE A;  1PGB A;  4Y2X A;  2F5Z A;  2NS5 A;  3STP A;  5CA7 A;  2UWQ A;  3LB8 C;  3MR6 A;  3CMM B;  3DQ0 A;  5L1M A;  2CHR A;  5BYS A;  2JEI A;  1TAM A;  2K6D B;  2WP9 B;  2AEH A;  4D2K A;  3DER A;  3KYC D;  5FJU A;  5CHF A;  3ENL A;  1KFD A;  2K60 A;  2NRT A;  1ZET A;  3M6K A;  4DOC A;  4BJQ A;  1Q5W B;  3KHG A;  5G5G B;  2E8M A;  5KL1 B;  1E6E B;  3ZO5 B;  1ZQH A;  5B66 U;  3R2I A;  5FS7 A;  3IG3 A;  3DHH C;  4PH5 A;  4MGG A;  4Q45 A;  5BOF A;  3Q8P B;  2RSU A;  5TR5 A;  1W1S A;  3AQE A;  4KLJ A;  1ZYQ A;  4GDK A;  2K8A A;  2JZB A;  5AM2 A;  1JRP A;  1VJK A;  2IJ0 A;  3LB8 A;  3ZNI D;  1YQ4 B;  2KWC A;  2PI4 A;  2ZIV B;  5KFL A;  4ENL A;  5TZV A;  4EKU A;  1WUD A;  1P3Q U;  1RVK A;  4IM3 A;  3C2K A;  2MSE D;  4DLG A;  2HZG A;  3APC A;  3B0Y A;  4F7Z A;  3H7P A;  5AM0 A;  2KFZ A;  1C77 A;  4GXK A;  3T8M A;  1MQ3 A;  3MHZ A;  3SR6 A;  3GIM A;  1UEL A;  4RM9 A;  2GO7 A;  2W54 A;  3BQ2 A;  3MR5 A;  3NVV A;  4DSF A;  1U4A A;  2BS3 B;  2CS4 A;  4LZD A;  1I19 A;  4A6G A;  2O6V B;  4FZL A;  5KG5 A;  3ZJT A;  2W9B A;  2PU0 A;  1WCL A;  3QZ7 A;  4J3O D;  3NZG A;  3G6Y A;  3SYZ A;  1T8E A;  2E8P A;  3QYP A;  4S17 A;  2EXR A;  2KAJ A;  3NVY A;  1TYT A;  3VCN A;  2MP2 B;  2MJ3 A;  4J9O A;  5AKE A;  4PHE A;  2N1V A;  2N9L A;  2YVC A;  3W1S C;  4CO7 A;  1L0V B;  2HDE A;  1O08 A;  4Z6F A;  3U9I A;  5DDM A;  4HDO A;  4ED3 A;  2Y1I A;  4AS1 A;  4DFK A;  2OO6 A;  4FLH A;  1SIF A;  4PZF A;  3GDX A;  4FO6 A;  4M6W B;  1AWD A;  2ASL A;  2PVO D;  1TS5 A;  4J1O A;  5IIK A;  3GZF A;  2KD0 A;  3UMB A;  1RRB A;  3TSS A;  4WUR A;  4HJK A;  5BOM A;  3Q3M C;  4DL7 A;  4CYE A;  2G5I B;  3D2N A;  2KV2 A;  1Z00 A;  3VH3 B;  2VJ4 A;  3B9J B;  2KDF B;  1L6N A;  4ECU A;  1LKY B;  4C00 A;  2G0A A;  2LMR A;  4F5P A;  4RM8 A;  3SV3 A;  2BR0 A;  5I4D A;  1K4Q A;  4UAU A;  4IM0 A;  3FG2 P;  3IK4 A;  3DOW A;  3QHT A;  4RQ2 A;  4WWN A;  7ICP A;  4Y2V A;  1QLT A;  2H3Q A;  3SQP A;  1QSY A;  1T0Q C;  2JF5 A;  2Y3A A;  1WGD A;  1RQN A;  1NVI D;  4W9F A;  1X6I A;  5ALW A;  3GD4 A;  8ICG A;  3IN5 A;  3E56 A;  3QAR A;  1HXY D;  2HQM A;  2DLB A;  3DK4 A;  1DIQ A;  3KHL A;  4JX1 C;  5KNI A;  4ASW C;  2BF8 B;  5DLG A;  4HVB A;  3M7D A;  2NO5 A;  2MX2 A;  2E1E A;  3Q8E A;  1GRF A;  4FXC A;  1H6V A;  2F77 X;  4DNA A;  2JRI B;  5DBA A;  1TGZ B;  2OWO A;  3QAQ A;  1CZP A;  1SJE D;  1JN3 A;  2L5Y A;  1BNP A;  1W1J A;  3HPF A;  4JK1 A;  4FHJ A;  4RF0 A;  2MHJ A;  3S1D A;  3SV4 A;  1XSL A;  4AUQ C;  2BGW A;  4QWB A;  4RT2 A;  1QLB B;  3AEG B;  2XNA C;  2HHT A;  2MLB A;  4M9J A;  2ZUD A;  5DG8 A;  1NJX A;  3VQI A;  4Z6E A;  3A4S C;  3U4F A;  4RQ1 A;  4PVK A;  3ZDE A;  1FHU A;  1B4F A;  3W9C B;  1Z1B A;  2W03 A;  4EMW A;  5KG0 A;  3T3F A;  3Q3J A;  2VA2 A;  1SE2 A;  1ZQU A;  1WJ6 A;  4W9E A;  1VDV A;  4CCH A;  1FCL A;  2R2Z A;  4NLB A;  3W8W A;  3I4K A;  2KX0 A;  3RRA A;  5AHX A;  3EC8 A;  2HXT A;  2BPC A;  5AEK B;  2IOF K;  2AGQ A;  4EC3 A;  1MA7 A;  1MO9 A;  1D9D A;  2OED A;  4EOY A;  4O3M A;  1QH9 A;  4JPS A;  2X8H A;  2CKH B;  2V1Y A;  1HUZ A;  2J6S A;  4DNS A;  2W8K A;  2MBE A;  3VFC A;  1E0Y A;  2WF6 A;  1UT5 A;  3Q45 A;  2BQ3 A;  3PRP B;  1TE6 A;  4PHD A;  1CK1 A;  2JXJ A;  2MJD A;  5KG6 A;  3OPS A;  3MDA A;  1NHR A;  4FDC B;  2WNM A;  5KFW A;  4C4S A;  2X99 A;  5KG1 A;  2PVG C;  4IWQ A;  3QKE A;  2IPK D;  4DSJ A;  5CTR C;  2OZ8 A;  2D3B A;  2KC1 A;  3DG3 A;  1J7B A;  3PFR A;  2GGG A;  9ICF A;  4N59 A;  2FE8 A;  5ALM A;  2BPG A;  2ZIW B;  3P4Q B;  1OW5 A;  4ED7 A;  2QC8 A;  5AKX A;  3C29 A;  1GES A;  1ED1 A;  3NY5 A;  3C23 A;  5FKA C;  5DB7 A;  2BKF A;  2POZ A;  4ZOH B;  3JPS A;  4RNO A;  2KJ6 A;  5JUM A;  3OSN A;  3L13 A;  2AQ3 B;  3EHV A;  3OZY A;  1LVH A;  1R7S A;  1F8W A;  1A76 A;  2ES6 A;  4PJ0 U;  3OJ3 A;  2NO4 A;  2A19 A;  3AH7 A;  2K8B A;  4LJO B;  4B0E A;  1RDF A;  3Q8C A;  1NZP A;  3HKZ F;  4ML8 A;  2XGQ A;  4QAY A;  4M9G A;  5KFJ A;  1SE9 A;  2GR2 A;  1R4M I;  3ZKJ C;  1ZQ1 C;  1QLU A;  8ICM A;  3TAD A;  5AI8 A;  1GPX A;  4G0N B;  4ED1 A;  2M8S A;  3PRE A;  5IA7 A;  3DCG A;  2D3G A;  3MHS D;  3AUL A;  3AV8 A;  4GDL B;  3RJG A;  3UXO A;  1QTM A;  2GQT A;  5J0T A;  7ICM A;  5G5G A;  4YTP B;  4F4W A;  2BCV A;  5HQX A;  5KHO A;  2QPM A;  3P0W A;  2LYA A;  4QZH A;  3V72 A;  4PGX A;  5CHV C;  3GRT A;  2LHD A;  5JCK A;  1L7P A;  4GXJ A;  4EQX A;  3VUY A;  3Q6B A;  2KIC A;  4RUA A;  4RNN A;  2QDF A;  2GQU A;  2WDW A;  2P6U A;  2HHW A;  1QZE A;  3OP2 A;  2O3G A;  4KLM A;  3HW2 A;  2KQS A;  3L08 A;  2ZIV A;  2J4X A;  2GR0 A;  2WHE A;  2YB1 A;  4ANW A;  1N5W C;  2BCP A;  4JIO U;  2WPF A;  2WWZ A;  5AKK A;  2PP1 A;  2INN E;  3EUB 3;  4H4X A;  1FO4 A;  9ICR A;  5GTI U;  4YP3 A;  3HPO A;  4J9Q A;  1UBI A;  2D10 A;  1MNS A;  2PPG A;  1NU5 A;  3RCY A;  3KZX A;  3EA6 A;  1YJI A;  3DVG X;  8ICY A;  1GRG A;  4ECW A;  4OD0 A;  1DOQ A;  4MEL A;  3EAN A;  2E5S A;  2UVU A;  2WXM A;  1BNO A;  3DBH I;  5ALV A;  1GOZ A;  4YWG G;  1FIQ B;  3V5F A;  2BWE S;  2Y3R A;  4MEM A;  3ICX A;  3KKA A;  2IMW P;  2MP2 A;  4ELU A;  1BML C;  2C7H A;  5EOZ A;  3VH4 B;  2AGP A;  2KVS A;  2J6U A;  7ICK A;  3MC0 B;  3VR9 B;  1PVP A;  1N5W A;  5KT5 A;  1V97 A;  4AJW A;  1P0R A;  2AH5 A;  1ZD4 A;  3Q8B A;  4MFC A;  2V9H A;  4WQO B;  4F1S A;  1V49 A;  3H7S A;  4BBN F;  3GIK A;  3NFU A;  3N4M B;  7ICR A;  2KYW A;  3JSV B;  2ZZP B;  3VFK A;  1ZX9 A;  4M6W A;  5EE9 A;  3GS2 A;  3NVZ B;  5FJP A;  4YL8 A;  1QOG A;  2HTM E;  2KO3 A;  4J9L A;  2RD0 A;  3M63 B;  3F53 A;  1ZQM A;  4EEL A;  2LRU A;  3L17 A;  3THU A;  3ZGZ A;  2VIX A;  4PHP A;  2BT6 A;  3PLU A;  2HNE A;  3VTW A;  5ALJ A;  2L3Z A;  2DPJ A;  1PDZ A;  2HXU A;  3B9J A;  4QJF B;  1EWY C;  4JB1 A;  3KOO A;  3GIL A;  2NBW B;  4ZRQ A;  2WPC A;  1FPY A;  3MDC A;  1LKY A;  1T0Y A;  1X9S A;  2N4F A;  5GMV A;  1ELS A;  3I3T B;  2ZNV C;  2KDB A;  3DDC B;  1UT8 A;  4PVH A;  1UA1 A;  4RQ5 A;  3AE6 B;  3TEY A;  4JWU C;  1RYS A;  1KTK A;  4NNJ B;  4W9H A;  3T9L A;  4LDT D;  3R9K A;  1GRT A;  2MRL A;  2IO3 B;  5AK6 A;  2WOW A;  4QZI A;  3U52 E;  5KFD A;  1Z3E B;  3S1F A;  1U4B A;  3B2G A;  4NPN A;  4EEW A;  2NYV A;  1DGS A;  4KPR A;  4HNL A;  4YWO A;  4OJL A;  3U8Z A;  5L83 A;  2QJN A;  3WKD A;  1MVK A;  1SWW A;  2W9N A;  3UI3 A;  4GGB A;  3WK9 A;  3E0F A;  4J3Z A;  2KNB A;  2YVJ A;  1NHS A;  1XPY A;  4RQ7 A;  1C1Y B;  4HCH A;  1F0X A;  5AE1 A;  3IAS 1;  2XIC A;  1MJD A;  2AQ0 A;  2I9G A;  1UBQ A;  2M0N A;  1N6Z A;  2D2Q A;  2HD5 B;  2KOB A;  5AKG A;  3PR5 B;  2KN5 A;  2QJL A;  2CHZ A;  5D6J B;  3C0R B;  2BGF A;  8ICZ A;  4PYU A;  4YFK A;  1IXR A;  1ACC A;  1L6V A;  4IOI E;  1D8Y A;  1SGH A;  4Y2U A;  2ZJD A;  3KBB A;  3M6Z A;  1BT0 A;  3UMG A;  1LPF A;  2M0X A;  2IPI A;  2R8I A;  4DL4 A;  4JE3 B;  1LV5 A;  1OEP A;  5J2F A;  4DS4 A;  3RIT A;  4CNQ A;  2DYO A;  4DOA A;  2FUH B;  4EEY A;  1MHX A;  3T8Q A;  3W8X A;  1WX9 A;  4HPL B;  1F9J A;  3WKC A;  4DQO C;  2BVH A;  2Z8L A;  3SN4 A;  1ZRM A;  5FP0 A;  3EPG A;  1EUV B;  4RMA A;  2EMT A;  2P6R A;  2KLG A;  5KFP A;  5KFU A;  4HPP A;  3LDZ E;  2OQY A;  2K4E A;  2AX5 A;  3TSJ A;  1J8C A;  1GXF A;  1SKS A;  1L3S A;  2ALZ A;  3LDA A;  5L95 C;  1E8F A;  4KGT A;  4GLX A;  1B22 A;  2NMQ A;  4J6I A;  4BOZ B;  3RFZ B;  1EC9 A;  4US9 A;  3FCP A;  4KLD A;  2ISO A;  1L8P A;  1Z2M A;  3EFU A;  3VCB A;  4NAM A;  3PG6 A;  2ZG6 A;  1KL9 A;  2I2Y A;  3CGB A;  1BUI C;  3MY9 A;  2YN4 A;  2D3A A;  3ZXR A;  4L1B A;  3G6X A;  1ZQF A;  5EE0 A;  3I1Y A;  1FNW A;  1E0Z A;  3GE3 C;  2RRD A;  3MAB A;  2ZIW A;  3IG5 A;  1RZT A;  1YZ6 A;  2OM6 A;  3M62 B;  4P16 A;  2V3B A;  2NQW A;  5AI4 A;  1Q3V A;  2RLT A;  4O3S A;  4A3P A;  3H12 A;  4NJ6 A;  3RZW C;  4JN8 A;  3FIL A;  2Z7J A;  4G3I A;  3L8K A;  4IRD A;  2GR3 A;  1E8G A;  2KKP A;  2LKY A;  1KLU D;  2BCQ A;  3AE7 B;  3HIL A;  1QOA A;  2INP E;  3BJS A;  2IDY A;  5AIC A;  2WHI A;  1WGR A;  2C28 A;  3Q8F A;  2LYH A;  3I63 C;  1WJ4 A;  2CHW A;  2LVQ A;  4P6V F;  5H92 C;  1OQR A;  1F5S A;  3N1X C;  2BQR A;  2MAX A;  3O0F A;  5HMM A;  2LI5 A;  3IHP C;  3VDG A;  3JPR A;  2L83 A;  8ICJ A;  2G4D B;  2RDI A;  2KZ3 A;  4YN4 A;  4KSL C;  4ANV A;  4DLE A;  5ALG A;  4GDL A;  2NRV A;  3V6H A;  1ZOY B;  3DBR I;  1ZQV A;  4UBC A;  3PLV A;  4GIB A;  4XQ8 A;  4W9D A;  3Q8S B;  1STE A;  5KG3 A;  4NL9 C;  1C4P A;  5AKL A;  3M95 A;  4KMU A;  2KSO B;  3RR8 A;  2HHU A;  7ICI A;  7ICO A;  2D5G A;  2PTZ A;  3SN0 A;  4YR2 A;  1IM4 A;  3UQA A;  1F52 A;  3BS7 A;  3I76 A;  4Q43 A;  1BPZ A;  2JH1 A;  4ED8 A;  3TFR A;  1DRG A;  3L54 A;  4IWO A;  4EZJ A;  2PTY A;  3V60 A;  1HA5 A;  2XVT A;  1Q1W A;  1X6J A;  2FUG 1;  3CP8 A;  1ZQD A;  2IO0 B;  3RBD A;  2L8J A;  1M6I A;  3RNF C;  3QU9 A;  3C1Z A;  4UBB A;  3JPP A;  2BVC A;  4KLE A;  1FFV C;  3KFU F;  4E3C A;  5KFY A;  1P48 A;  4KWS A;  2M1M A;  2UVV A;  5ALL A;  4EZ6 A;  3JVZ X;  3VC6 A;  5KFA A;  4W9C A;  3DGH A;  4NM1 A;  3RF9 A;  3L16 A;  2LUM A;  3OGU A;  4RQN A;  3ZDA A;  4DFJ A;  4DWI A;  1S1Q B;  2YEP B;  5J0U A;  4OW0 A;  3H7V A;  2KD1 A;  5FMH A;  1NK4 A;  3SN1 A;  4FZM A;  1LGR A;  4UAT A;  1UWM A;  1E9I A;  3ONN A;  1C79 A;  1UUP A;  1XT9 B;  2GLS A;  8ICR A;  1MUC A;  4GGH A;  1FIQ A;  3PST A;  5J2J A;  9ICW A;  1M94 A;  1NI2 A;  1VZ7 A;  1DOI A;  3L10 B;  4WJ3 B;  2V3N A;  2EZZ A;  1DII A;  1XDI A;  2PKO A;  4F8R A;  4N58 A;  3HWT A;  3AQF A;  2LJI A;  5T14 A;  1RYR A;  2R8K A;  1LO5 D;  1UF0 A;  2LGS A;  2XN9 C;  3DPD A;  1YIW A;  3VC5 A;  4O3O A;  4RGT A;  4O5C A;  4K1W A;  3VCC A;  2HTH A;  5DB8 A;  2JHD A;  2X8G A;  1WX8 A;  1IV8 A;  3JSV A;  2GBJ A;  3QNM A;  3POP A;  5FS6 A;  3NVZ A;  3HRD D;  4OZC A;  3D2H A;  3X23 A;  4UB8 U;  2MSN A;  4ED6 A;  4DXG A;  1JRO A;  9ICL A;  2W9C A;  4M52 A;  2P88 A;  3R66 C;  2CHX A;  5CHW A;  3TW9 A;  5D7G A;  5E6O A;  2KN7 A;  4MFF A;  2GI9 A;  3CW2 C;  4DF4 A;  3QUC A;  1TIF A;  1FM0 D;  2N7J A;  2V3S A;  3QX7 A;  5MPO A;  1VD2 A;  1NOM A;  3QEB Z;  2EEL A;  2ICI A;  4EMI A;  2RDB C;  4DDI D;  3FW8 A;  2W3S A;  1H38 A;  3H0M B;  3ZD8 A;  3ZDC A;  4HCN B;  4WJP A;  1ZQL A;  3DQV A;  4NEW A;  3LAE A;  3F2D A;  3R7R A;  1WSP A;  3ZD9 A;  5J18 A;  2JEF A;  8ICO A;  2DZJ A;  1GET A;  4FBJ B;  5J29 A;  1RAX A;  2ATL A;  2BVG A;  5JCN A;  1R4N I;  2W55 A;  8ICS A;  1FXA A;  5BO4 B;  1WZ3 A;  5HML A;  3H4B A;  1EF5 A;  2B21 A;  1SE4 A;  3CT2 A;  5IIL A;  1KKX A;  3II4 A;  3QU7 A;  4OJO A;  2A1A A;  5KT6 A;  4QIW C;  2X8X X;  4A8E A;  4R65 A;  3DBL I;  1Q1R A;  3RJE A;  4TUU A;  1UPH A;  1TE2 A;  2HBL A;  2ONE A;  1WRI A;  2Q4T A;  4J57 A;  1D3Z A;  4HPN A;  4YXD B;  3NG0 A;  2EQ9 A;  2HMX A;  3AU2 A;  5J17 A;  1BZL A;  2OG9 A;  1JOA A;  5DG9 A;  3LXD A;  2QCZ A;  2I1K A;  3BY4 B;  2ZVO A;  4W9I A;  5U1O A;  3LWL A;  3RUI B;  4NLZ A;  4F91 B;  3V62 A;  3VAW A;  1QF6 A;  4IHC A;  2JZ3 B;  3PT2 B;  2DW7 A;  3MC9 A;  4H4W A;  3TEZ A;  1XHC A;  2HOQ A;  4JV1 A;  2G4S A;  5AUI A;  2EZX A;  4AYB F;  4UW9 A;  2PFQ A;  2PMV A;  1L7O A;  4LJP B;  1K5O A;  4G3X B;  1D5Z C;  2XK5 B;  5HMR A;  2IO1 B;  3VC8 A;  1C9F A;  3I57 A;  3FW7 A;  1PQS A;  5C3J B;  2XH4 A;  3ZDD A;  5AE2 A;  4C80 A;  8ICL A;  9ICE A;  4PYZ A;  3D32 A;  5ADZ A;  4DHG A;  4M0X A;  1QLN A;  1K8R B;  1YQB A;  4BWM A;  4EFO A;  5U25 A;  3PS6 A;  3F5A A;  2I0K A;  3H0R B;  5AE3 A;  2C60 A;  4HYR A;  2BBC A;  1U49 A;  2EAP A;  1V2Y A;  2KC2 A;  3HX0 A;  3R8B A;  1X9M A;  4OZA A;  4JWN A;  3EGR A;  3HVZ A;  4TMA B;  3APF A;  4XDD A;  5GXG B;  1AOG A;  1T6B X;  5DKW A;  2CXY A;  4I6N B;  1QSS A;  4ZRP A;  4BC7 A;  1K53 A;  4XA5 A;  5AM4 A;  2JR5 A;  2JPH A;  4IZG A;  2I6X A;  5KFF A;  4RNM A;  4RGM A;  8ICE A;  1ZQJ A;  4IWP A;  4F5R A;  5BMI A;  1P43 A;  3IAM 1;  1CUK A;  2DUY A;  2JGA A;  2PFP A;  3IRU A;  1I4H A;  1IGD A;  2LGX A;  3ZVV A;  2ASJ A;  9ICC A;  4ROP A;  4RCO A;  5TIS U;  1KDH A;  2K8H A;  4IP4 A;  3TWA A;  4EWJ A;  4KLQ A;  5HHH A;  8ICB A;  3DIP A;  3PVX A;  1GG3 A;  3IFW B;  4RT3 A;  4YCX A;  3TI0 A;  4L23 A;  2FPM A;  4QZB A;  1PFD A;  4JLC A;  3RD2 A;  1NHQ A;  3AEC B;  3IJQ A;  2IZV B;  2AXR A;  1HSK A;  1L3V A;  5I1V A;  4B0M A;  4QZF A;  3NVW B;  3V61 A;  4EYI B;  4M0A A;  2D6F C;  4ECQ A;  1WI0 A;  1DTN A;  5KHQ A;  3S47 A;  5J04 A;  1TVA A;  1F44 A;  5AI0 A;  3N4E A;  4W9K A;  1R4M B;  2IGG A;  3QA8 A;  3TAC B;  3V7J A;  2RAB A;  5D2M B;  1JPD X;  2E1F A;  4YQW A;  1DK3 A;  3RYT A;  2C7N B;  4NQL B;  3U7Z A;  1UA0 A;  2MU2 A;  3DWM A;  1E7V A;  2M19 A;  2QIE B;  2WP6 A;  1GNU A;  1IIP A;  7ICV A;  4WQM A;  1BPD A;  4DK5 A;  5EE1 A;  2NRZ A;  3H70 A;  1V9P A;  2GSH A;  2W9M A;  3PMN A;  3NHE B;  4GN1 A;  2KSO A;  4F5Q A;  1JCT A;  4DO9 A;  2XY5 A;  1JWB D;  3WKE A;  1V85 A;  1YOV B;  4GC6 A;  2JYT A;  3CNH A;  4IKG A;  1WRD B;  4PGY A;  2H5X A;  4DSL A;  4FHK A;  1BPE A;  3NRW A;  3DDM A;  5DGB A;  1IPG A;  3SSZ A;  3ZTD A;  1YEY A;  1XCT L;  4GME A;  4M2Y A;  2F1J A;  2BKR B;  2IO2 B;  2RDJ A;  1C20 A;  4O95 A;  1W1M A;  2WBA A;  3QLD A;  5KFM A;  4F50 A;  1L5U A;  3EPI A;  3E9S A;  5HI1 A;  2W04 A;  2KIW A;  4OJP A;  1ZQS A;  1PUT A;  2FLL A;  3P4P B;  1V6E A;  1ZW7 A;  1FNU A;  3GFK B;  2GR1 A;  3DBS A;  4ANX A;  3DJJ A;  3PM9 A;  2K3U A;  3Q69 A;  5F9N A;  3VRB B;  2BQQ A;  1D9F A;  2JV3 A;  2LHE A;  3DBH B;  4M00 A;  1CI4 A;  3KUM A;  2KMC A;  2VH2 A;  2DL0 A;  4Y2J A;  2R8D A;  4Z17 A;  3NUH B;  4IUM B;  4Z1Y A;  2KDM A;  2JUO A;  4DEZ A;  2WYQ A;  1SXE A;  3ZLZ A;  2WDT B;  3RNM A;  1MOK A;  1X1M A;  1E9M A;  4PS3 A;  1UGJ A;  3WK6 A;  1N62 C;  2QDD A;  2GB1 A;  3ISC A;  2XO7 A;  5J8Y C;  3UXN A;  2XSX A;  2AGO A;  3LWM A;  2P3Z A;  4R64 A;  2OHF A;  2CU3 A;  3OW1 A;  5IAA C;  5JXV A;  2WS3 B;  5FXF A;  4BVU C;  2UVW A;  2L1A A;  4NZL B;  3HRD C;  5DBB A;  2K22 A;  3U2S C;  3DEQ A;  2NRW A;  1GAQ B;  2H88 B;  1TY0 A;  2KDE B;  1V1P B;  1NK8 A;  4FJV B;  1TAU A;  4DQS A;  1XCQ L;  8ICX A;  4YVZ A;  5EWG A;  3O13 A;  1SKR A;  3QUQ A;  3DVN V;  3BZD B;  1S97 A;  3QXG A;  1N62 A;  3Q2A C;  3P4R B;  1RG6 A;  5DGA A;  3CRX A;  2OOB B;  3GZN I;  2O6V D;  4PL2 A;  5J8Y A;  3WAO A;  2YML A;  1I7H A;  3UJE A;  2WP5 A;  1WM2 A;  2QKQ A;  2JQR B;  1RM6 B;  5E6J A;  1X2I A;  2OCE A;  2HDO A;  5AM5 A;  5DB9 A;  4RPX A;  3H9D A;  3O65 B;  3MWC A;  3Q8L A;  2Y9U A;  4IRC A;  2H3I A;  4KTQ A;  1WH3 A;  5IIO A;  2KFJ A;  3BWU D;  4G50 A;  3W2D A;  2DAJ A;  5CHG A;  2BWF A;  4ED2 A;  2HHV A;  2ZXH A;  5K4L A;  3TFS A;  3L5O A;  2RGF A;  5LLI A;  1SIJ A;  1XU4 A;  1E8Z A;  3BQ0 A;  4M8M A;  2QJJ A;  2IHN A;  3RGT A;  4QZC A;  3DV9 A;  5DBC A;  1TT5 B;  4GXI A;  2L7R A;  2A8X A;  4MEY A;  2KHW B;  5AZG A;  1WWT A;  2AL3 A;  4DOB A;  4GFJ A;  5IN7 A;  1TYG B;  2XC9 A;  1SL1 A;  3SMV A;  2WXH A;  2ZAD A;  2P8B A;  1WWV A;  3DVG Y;  2ZJA A;  3T79 A;  5JRT A;  1CEZ A;  3BDP A;  4FBU A;  5HFY A;  4H4T A;  3HT3 A;  3V5C A;  1NJZ A;  1F0Z A;  4WWP A;  2PMZ F;  3A7R A;  5CJ7 A;  1FNV A;  1GRH A;  2C7M B;  2KKC A;  2XK5 A;  3CGD A;  2XGZ A;  3DFY A;  3S6J A;  3C1Y A;  3HK0 A;  3T3O A;  4MAC A;  5A0L A;  3ZNG C;  2KLC A;  1KOT A;  3C8Y A;  1SJB A;  1OUQ A;  3GD6 A;  4G7F A;  1LXD A;  2W8L A;  5KFB A;  3H8S A;  3PW2 A;  3S1E A;  4R63 A;  3K1G A;  4TKN A;  4MSQ B;  5KVI A;  3R07 C;  1GSN A;  4UB5 A;  3H8A A;  4DL2 A;  2A1J B;  4HKQ A;  4EX7 A;  3WIM A;  5LXH A;  3V7L A;  1EC8 A;  2C9W B;  2FDR A;  4J9R A;  2WXR A;  4KT2 A;  4BV6 A;  3HM6 X;  3RAX A;  2XCA A;  3WKB A;  1ZXI C;  3R1Z A;  2FMP A;  1B0X A;  4FX9 A;  4BDP A;  3RJF A;  4UB2 A;  3VUW A;  1BXT A;  1HEK A;  2OFJ A;  1ZPS A;  3AU4 A;  2MEK A;  9ICN A;  4X2P A;  1JAL A;  1XQQ A;  2KQ4 X;  3ZLG A;  2V3P A;  2PI5 A;  7ICT A;  4LNK A;  1P9D U;  1KN0 A;  3Q4D A;  4HYK A;  3J9C A;  2G06 A;  3UGV A;  1L0X B;  1H2I A;  1Z5S B;  1UH6 A;  1KBU A;  1C4A A;  4GR1 A;  4TUS A;  5LNK 1;  2KAC A;  1D6E C;  2DW6 A;  4QZ9 A;  3MGI A;  4JGH B;  2V6O A;  3KJM A;  1I35 A;  1KQQ A;  2V9W A;  1WVF A;  1SB3 C;  5IKC M;  3ETR B;  1TZZ A;  1ZXI A;  3EF6 A;  5KFN A;  4H4U A;  3EUB 2;  3QU5 A;  2R2O A;  1UXY A;  2JRH A;  2FLN A;  1GC7 A;  2FIF A;  3TCA A;  5K8E A;  4HNC A;  1F1H A;  1XXG A;  2P35 A;  3DBR B;  1WJN A;  3S5S A;  4LTU A;  4O5K A;  3RB3 A;  3PO0 A;  4C8M A;  1ENF A;  4MMW A;  2Y0S C;  3AL0 B;  5BOL A;  2K6Q A;  4II2 B;  2KZR A;  1VRA B;  2JZP A;  2LMC A;  1PK1 B;  2HHX A;  2LUE A;  4K7Z A;  2P4P A;  3Q8R B;  3UM9 A;  2KWU B;  4KIT B;  5IO9 A;  1HIW A;  3OPX A;  3FVD A;  6ENL A;  1BPY A;  5D3D A;  4B95 A;  2C22 A;  2BS2 B;  4CF3 A;  1SJH D;  2BB5 A;  1UZX B;  2WU2 B;  2D11 A;  2N0S B;  2ACZ B;  5BMH A;  1NEL A;  3AE1 B;  4HEA 1;  4YMM A;  3MFH A;  1FFU A;  1I4R A;  4S0R A;  1QQ7 A;  1RXW A;  2NVK X;  2J52 A;  3RN9 C;  4DN1 A;  2HSZ A;  3RR7 A;  1VLB A;  3Q3N C;  3Q6J A;  2KJ5 A;  1TYP A;  3UCD A;  4DS5 A;  1JXE A;  4ARC A;  2OLA A;  5HG2 A;  4OJ5 A;  1KKO A;  3DJG X;  2NTS A;  4XGA B;  3AM9 A;  2KVC A;  4II3 B;  3DEE A;  4BXO B;  2BYE A;  2L52 A;  4FI4 A;  4UAZ A;  2KZM A;  2J3N A;  2K8C A;  3U26 A;  2PTL A;  3L3F X;  2F8L A;  3TAD C;  4J9N A;  4ECY A;  1NI3 A;  2BS4 B;  4ICV A;  2WXN A;  3K1R B;  4ITK A;  2YVS A;  1KJT A;  5IP4 D;  4Y2Q A;  1XSP A;  1L5P A;  4YMN A;  5KFK A;  1JRU A;  9ICG A;  2PEA A;  3JYU A;  1EBG A;  1XLO A;  5KFC A;  2ZUC A;  3KH0 A;  3JPN A;  3DG7 A;  2VH1 A;  3OAW A;  3F2B A;  2V3A A;  4WAF A;  5IOI A;  2LBO A;  2LI6 A;  5CRX A;  5JHA A;  4K4G A;  5FS8 A;  3BQ7 A;  2EAO A;  3TCS A;  1XAN A;  1RLF A;  4IR1 A;  3H8H A;  3MGV A;  1ZJN A;  5HR6 A;  1X42 A;  4PYT A;  4KLT A;  1V1P A;  1JXL A;  4EZK A;  4P4P A;  2ZPY A;  4AYB C;  2JMG A;  1L4Z B;  4ECZ A;  3EEC A;  3CYM A;  2JSV X;  3CK5 A;  4BUG A;  3X0W A;  2KTR B;  3M9O B;  1IG6 A;  4M01 A;  4A3R A;  3FXG A;  3N7S C;  2RDH A;  2RPV A;  2YAU A;  4YSX B;  2NQL A;  9ICQ A;  5AKI A;  5DG7 A;  1D5X C;  4ED0 A;  1L2N A;  4ICU A;  2NPX A;  3H6N A;  1YN5 A;  4PL1 A;  2JU6 X;  5AK4 A;  4DL3 A;  3THV A;  4MH0 E;  3LYY A;  4RGN A;  3FV9 A;  3FDS A;  2M0A A;  3C19 A;  1E8Y A;  1Z1V A;  4A90 A;  3RPF C;  1R4N B;  2RHF A;  5JHB A;  2G5H B;  2BQU A;  4UQG A;  3KKA C;  3I28 A;  4FBT A;  3NOB A;  2VA3 A;  1QOF A;  1RFK A;  2OKT A;  2KJ9 A;  1SF0 A;  2QJM A;  3RJJ A;  4EEN A;  2XH2 A;  2HBM A;  2WOI A;  4QZ8 A;  3R0U A;  3DBL B;  1J2M A;  2DGZ A;  1YNT E;  3EEZ A;  3DES A;  2P3H A;  4P0P B;  1XO3 A;  4O9M A;  5E79 U;  1XC9 A;  4US8 A;  1WR1 A;  1PUZ A;  2CR5 A;  3SBF A;  3R10 A;  1EO6 A;  4XWT A;  1ZK7 A;  4C4V B;  3LAD A;  2IY0 B;  5ALF A;  3PX4 A;  2AU0 A;  5AKJ A;  5J2B A;  3C5F A;  2O6V A;  4EBD A;  1EWC A;  5JCI A;  1YQ3 B;  1YN4 A;  2MA1 A;  2KHQ A;  5D46 A;  1ZQN A;  2ZVN A;  4J56 A;  3N30 A;  4AP9 A;  2B0C A;  3IBE A;  2KJ8 A;  3QUB A;  2HHS A;  1T4G A;  2PIA A;  1S0N A;  5ER0 A;  2D8C A;  2WB1 F;  4PS8 A;  4LJX A;  2V4R A;  1C76 A;  1NYQ A;  4J9P A;  1HEZ E;  1WXA A;  3H7I A;  4F4X A;  3C0P A;  1CJE A;  3RNG C;  2AYO B;  5EE3 A;  1UWX A;  2AAQ A;  1XF5 L;  4QNL A;  3FWA A;  1OJT A;  4EX6 A;  2GDQ A;  1C7Y A;  2IYD B;  4KX3 A;  2YEP F;  4GSW A;  2DNF A;  2D3D A;  4PT5 A;  5E6P A;  3A7A A;  2WAQ C;  1TKE A;  5DB6 A;  4K3C A;  3L5K A;  4O3R A;  3UCC A;  3BIN A;  5KT4 A;  4EM4 A;  2VJ5 A;  3H40 A;  2J6T A;  2KFK B;  3R2T A; 
#chains in the Genus database with same CATH homology
 5L6G A;  1UWM A;  1C79 A;  1UUP A;  4MM3 B;  1FFU C;  5I1W A;  1FIQ A;  3S1C A;  1VZ7 A;  2WXQ A;  1DOI A;  2V3N A;  4A9A A;  1DII A;  2PKO A;  4KGR A;  2QMT A;  5FXP A;  4N58 A;  3LLB A;  2LJI A;  4XWW A;  3BYT B;  1LO5 D;  1KF6 B;  1J7C A;  3W1S A;  1JML A;  2XN9 C;  4PVJ A;  4RGT A;  1RYJ A;  2Y5C A;  1VZ8 A;  1SB3 B;  1MI0 A;  4A8X C;  3TUO A;  3POP A;  2WDQ B;  3NVZ A;  3HRD D;  1QT9 A;  1UNS A;  1XLN A;  3BVG A;  4OZC A;  2JXT A;  1ET6 A;  3D2H A;  2LGI A;  3P42 A;  4DXG A;  1V8C A;  4EE2 A;  1IUE A;  1JRO A;  3NRZ A;  1E7P B;  2WXJ A;  1ZXH A;  2PW9 A;  3IXS A;  1QOB A;  1B9R A;  1I4G A;  3IT4 B;  5D7G A;  2GI9 A;  1W1K A;  1FMA D;  3AE3 B;  2VFU A;  4HRS A;  1FM0 D;  2N7J A;  5MPO A;  2PLS A;  1ESF A;  3VRA B;  4C56 C;  2EEL A;  2ICI A;  1ZDX A;  2BYT A;  3FW8 A;  1N61 A;  2W3S A;  3AEA B;  2WQY B;  1WVE A;  2OAI A;  2WXP A;  1WGK A;  3LAE A;  5C2T B;  2FBW B;  1N63 A;  1WSP A;  3BVM A;  4XE0 A;  1ZR6 A;  1FRD A;  4AQ7 A;  3MP9 A;  4HKZ E;  4RH6 A;  2ZW1 A;  1F2R I;  3BK1 A;  2LFI A;  2BVG A;  1N60 A;  1AN8 A;  2DBY A;  2W55 A;  1FXA A;  2KMM A;  5H8Y E;  3W5U B;  1E10 A;  1HQR D;  3IT6 B;  1RM6 C;  1SE4 A;  3DWG C;  4OZB A;  4ZYS A;  1PGB A;  4JWS C;  3LB8 C;  3DQ0 A;  4TVW A;  3FC4 A;  5BYS A;  4ZOH C;  2WP9 B;  2DWQ A;  4LK0 M;  4KGS A;  2EKI A;  4MT5 A;  4D2K A;  1WRI A;  4M0W A;  4YXD B;  1ZP0 B;  4TVY A;  2LEK A;  1QQR A;  1VZ6 A;  1QF6 A;  1L6U A;  4HJG E;  5G5G B;  1E6E B;  3R2I A;  3TEZ A;  4ARI A;  5AUI A;  2PMV A;  2WXO A;  1W1S A;  1PDX A;  3FIL B;  1D5Z C;  1VJK A;  2IJ0 A;  1AHZ A;  1JRP A;  5HMR A;  3AE4 B;  1C9F A;  3I57 A;  1YQ4 B;  3FW7 A;  3N9Y C;  5C3J B;  5G5H A;  1FXI A;  5AE2 A;  4C80 A;  3U4E G;  5ADZ A;  2RK5 A;  4MLA A;  4ZHP A;  3AE9 B;  4RF1 A;  5AE3 A;  1C77 A;  2I0K A;  1K52 A;  4BBY A;  2G9H D;  2BBC A;  5D3I B;  3MHZ A;  3R8B A;  5FXE A;  3SR6 A;  2WU5 B;  4OZA A;  4DQO C;  2BS3 B;  2W54 A;  3EGR A;  3HVZ A;  3NVV A;  3AMZ A;  4TMA B;  4XDD A;  5GXG B;  3V3X A;  1IBX B;  1T6B X;  1ET9 A;  4ZRP A;  3FW9 A;  4BC7 A;  3ZJT A;  1K53 A;  1W1R A;  2BVF A;  4OAL A;  2CJO A;  4RGM A;  4J3O D;  5BMI A;  3IAM 1;  1I4H A;  2EXR A;  1IGD A;  3NVY A;  2KAJ A;  1VAO A;  2MJ3 A;  3TEX A;  4PWB A;  4NAW B;  4RCO A;  2N9L A;  5T8I A;  1L0V B;  2HDE A;  2K9X A;  2DYM A;  4L23 A;  1PFD A;  3BW7 A;  4AS1 A;  4HRO A;  3AEC B;  4PZF A;  1EU4 A;  2AXR A;  1HSK A;  2WLB A;  1ZUD 2;  1AWD A;  2PVO D;  4YSY B;  4B0M A;  1TS5 A;  3NVW B;  2VFV A;  2X38 A;  2MJE A;  3TSS A;  1SEB D;  5FK9 C;  4GLS C;  4WUR A;  1DOX A;  1D5M C;  2IGG A;  3MJ5 A;  4BCA A;  1KRH A;  1TKY A;  3B9J B;  2R61 A;  3U7Z A;  3DWM A;  2M19 A;  2QIE B;  4WQM A;  5I4D A;  1RWS A;  5EE1 A;  1EM7 A;  1JWA D;  1QLT A;  2Y3A A;  1L0Y B;  3KWL A;  1EU3 A;  1K50 A;  1NVI D;  1JWB D;  1E8H A;  3BYY B;  4N6E B;  2JYT A;  3E56 A;  4IKG A;  4C7Z A;  4KX6 B;  1HXY D;  2DLB A;  5BYQ A;  1FEH A;  1DIQ A;  4JX1 C;  2NTT A;  1KLG D;  1XCT L;  1N61 C;  3Q8E A;  1W1L A;  4FXC A;  4O95 A;  1W1M A;  1JWM D;  1N63 C;  3E9S A;  1CZP A;  1SJE D;  5HI1 A;  1W1J A;  1DOY A;  1PUT A;  3P4P B;  3HVD A;  4RF0 A;  3GB1 A;  3S1D A;  1HZ5 A;  1FNU A;  1I4X A;  1N60 C;  3BVZ A;  3ETR A;  3TSH A;  3PM9 A;  2WDV B;  2K3U A;  3Q69 A;  2WXI A;  3VRB B;  1QLB B;  3AEG B;  2XNA C;  2LHE A;  3LXF A;  2AQ2 B;  3VQI A;  2WXF A;  4PVK A;  2R8D A;  3NUH B;  3W9C B;  1D4B A;  2KDM A;  1FRR A;  2Q5W D;  3AEE B;  1SE2 A;  1E9M A;  1QIL A;  2BW2 A;  1VDV A;  1FCL A;  2R2Z A;  1UGJ A;  3W8W A;  3B2F A;  3AEB B;  1N62 C;  3CIR B;  2GB1 A;  3NS1 B;  4EC3 A;  2OED A;  4JPS A;  2W82 A;  3CWI A;  4MH8 A;  2CU3 A;  2OHF A;  2WXK A;  3P1M A;  4DNS A;  2PLI A;  5JXV A;  2WS3 B;  3AE5 B;  2Q85 A;  1E0Y A;  4TQ1 A;  5FXF A;  2L1A A;  4NZL B;  3HRD C;  2K22 A;  3U2S C;  1CK1 A;  1JQ4 A;  2MJD A;  1I19 A;  1GAQ B;  2H88 B;  1TY0 A;  3GSY A;  2L32 A;  2WNM A;  4YTM B;  1V1P B;  1XCQ L;  3O13 A;  2JWU A;  2PVG C;  4XDC A;  4BC9 A;  2IPK D;  3BZD B;  1MHH E;  3W8Z A;  1N62 A;  2RMM A;  1J7B A;  3P4R B;  1V1O A;  5BMG A;  1TS2 A;  2VFR A;  1JW9 D;  1I4Q A;  1I7H A;  2FE8 A;  4N59 A;  2JQR B;  4IDI A;  3P4Q B;  1RM6 B;  5E6J A;  1SBB B;  5FKA C;  4ZOH B;  3DED A;  4HG0 A;  2AQ3 B;  3BWU D;  1R7S A;  1PYW D;  2ON8 A;  3W2D A;  2IGD A;  3HSU A;  3AH7 A;  2UUV A;  2Y3S A;  3GP7 A;  4UDU C;  2QSD A;  1NYR A;  2IGH A;  2V4I B;  1SIJ A;  3NZ3 A;  1F2R C;  2JX5 A;  4B0E A;  3Q8C A;  4ML8 A;  1K51 A;  1WWT A;  1JCK B;  3ZYY X;  1YJJ A;  3ZJV A;  1QLU A;  2N9K A;  2QIL A;  1GPX A;  1CQV A;  2UUU A;  1TYG B;  3D2J A;  3AV8 A;  1NEN B;  4GDL B;  2WXH A;  5HHZ A;  2GQT A;  4YTP B;  5G5G A;  1X2G A;  5HFY A;  5HQX A;  5FR3 A;  2QPM A;  3I99 A;  1F0Z A;  4OHJ A;  1AHV A;  2JYE A;  2K0P A;  2LHD A;  4H2A A;  3VR8 B;  1PGA A;  1FNV A;  1DGJ A;  3FAH A;  1KFY B;  4JAY A;  3A7R A;  2GQU A;  2WXL A;  1Y56 A;  2WDW A;  1VQZ A;  3T3O A;  3P63 A;  4MAC A;  2O3G A;  1JWS D;  3C8Y A;  3BK2 A;  4TSS A;  2J4X A;  4R3D A;  1N5W C;  3S1E A;  2KWD A;  2INN E;  2ZW0 A;  3EUB 3;  1FO4 A;  3R07 C;  4HKQ A;  2WXG A;  4USA A;  3EA6 A;  1YJI A;  1IBX A;  1AHU A;  2WXR A;  3V05 A;  3KWV A;  4RFB A;  1JWU D;  2WXM A;  4WWM A;  2VFT A;  1GOZ A;  1ZXI C;  4YWG G;  1FIQ B;  1QKZ A;  2Y3R A;  4WIP A;  1A70 A;  1BXT A;  1BML C;  1ZPS A;  2QEJ C;  4YT0 B;  3MC0 B;  2MEK A;  2BTE A;  1JAL A;  1PGX A;  1ZDV A;  2KQ4 X;  2V3P A;  3VR9 B;  1N5W A;  1V97 A;  3MFG A;  4L2Y A;  1F77 A;  3Q8B A;  3J9C A;  1L0X B;  1C4A A;  5EE9 A;  5LNK 1;  3GS2 A;  2KAC A;  1P7F A;  3ZJU A;  1QOG A;  3NVZ B;  1D6E C;  2HTM E;  1TJE A;  1GB4 A;  4UD8 A;  2MH7 A;  2Q4W A;  3KJM A;  1MPE A;  3NRZ B;  4O1N A;  3ZGZ A;  1WVF A;  1SB3 C;  3AE8 B;  1W1Q A;  3ETR B;  1ZXI A;  3A7U A;  2BT6 A;  1KH0 A;  3EUB 2;  2PLP A;  1MBB A;  1UXY A;  3RJA A;  3B9J A;  2MBR A;  1EWY C;  1ZE3 D;  4JB1 A;  4ZRQ A;  5K8E A;  4RNA A;  2TSS A;  1XLQ A;  1NEK B;  1XXG A;  2AQ1 B;  3Q8A A;  3AN1 A;  4LTU A;  1OQQ A;  3PO0 A;  1ENF A;  4PVH A;  5I1V A;  2P4P A;  1VRA B;  2JZP A;  1WYG A;  2LMC A;  3SEB A;  2V0G A;  1TS4 A;  3AE6 B;  3KQ4 A;  1FFV A;  1TS3 A;  3TEY A;  2VZK B;  1B1Z A;  1KTK A;  1Q10 A;  3PZ7 A;  4JWU C;  3W5V B;  4PWC A;  4DXF A;  1T5X D;  2WDR B;  3U52 E;  1W1O A;  2H89 B;  1C4C A;  4CQN A;  1YMH E;  3S1F A;  3B2G A;  4KKJ A;  5D3D A;  3PQB A;  2BS2 B;  1SJH D;  2BB5 A;  2J42 A;  2QKN A;  1X2H A;  2WU2 B;  1MVK A;  5BMH A;  2N0S B;  1IGC A;  2ACZ B;  5TSS A;  3AE1 B;  1GB1 A;  1TY2 A;  3UI3 A;  4HEA 1;  1FFU A;  2ONQ A;  3HUI A;  2RDG A;  1I4R A;  2BB6 A;  1L4D B;  1YN3 A;  1F0X A;  2J52 A;  5AE1 A;  3IAS 1;  1WXQ A;  2Y08 A;  1VLB A;  3VTE A;  2QJL A;  1XEE A;  4ARC A;  5HG2 A;  2NTS A;  3AM9 A;  1ACC A;  1L6V A;  3I9V 1;  4IOI E;  2VAO A;  2L52 A;  3L4P A;  3SFD B;  2PTL A;  2IPI A;  4ITK A;  2BS4 B;  1NI3 A;  4JE3 B;  3SFE B;  2WXN A;  2YVS A;  2DYO A;  1L5P A;  1MHX A;  3NS1 A;  3W8X A;  1XLO A;  5L6F A;  4GDK B;  2BVH A;  2Z8L A;  3AE2 B;  5D79 A;  3RJ8 A;  4YSZ B;  1T3Q C;  5G5H B;  1M4V A;  4WAF A;  1FCC C;  3P4S B;  2AX5 A;  3TSJ A;  1HZ6 A;  4A55 A;  1C78 A;  4ZHO A;  4A6Q A;  3H8H A;  1E8F A;  1SE3 A;  4KGT A;  5BYR A;  4PYT A;  2NMQ A;  1V1P A;  3SR6 B;  4XLO A;  3ZQ4 A;  3D2D A;  1DYQ A;  3RFZ B;  3NVV B;  3JS8 A;  4US9 A;  1J7A A;  1L4Z B;  2J53 A;  1P7E A;  4NAM A;  2B76 B;  2JSV X;  2I2Y A;  4OVZ A;  1BUI C;  1SXT A;  2M56 B;  2G1E A;  4L1B A;  2CJN A;  2RDH A;  3NVY B;  1FNW A;  5EE0 A;  1E0Z A;  1TZO A;  2RPV A;  3OWE B;  4YSX B;  2KN4 A;  1D5X C;  4P16 A;  2NQW A;  1T3Q A;  1YN5 A;  2JU6 X;  2Y4G A;  4RGN A;  3LYY A;  3AB5 A;  2M0A A;  3BII D;  2GRI A;  4A90 A;  3RPF C;  3FIL A;  2W3R A;  4RGO S;  1TKG A;  1E8G A;  1KLU D;  1QOF A;  3AE7 B;  1RFK A;  1ROE A;  1QOA A;  1MBT A;  1SF0 A;  2INP E;  2IDY A;  1FD6 A;  4PVE A;  3Q8F A;  5AWV A;  1AW7 A;  4NJC A;  4Q2J A;  5H92 C;  2K5P A;  4P6V F;  1OQR A;  1N5X A;  1YNT E;  2P3H A;  1XO3 A;  4US8 A;  2L83 A;  4REZ A;  1XLP A;  2SEB D;  1VR9 A;  3PZ8 A;  4XWT A;  1SSN A;  1ZOY B;  1DZN A;  2E3T A;  1EWC A;  3AED B;  1STE A;  4LLG M;  1YQ3 B;  1C4P A;  1YN4 A;  2D5G A;  2VFS A;  2PIA A;  3URY A;  4TQ0 A;  1C76 A;  1NYQ A;  2E5A A;  1HEZ E;  1I4P A;  3T3N A;  3C0P A;  2VZK D;  1CJE A;  1HA5 A;  3KLS X;  5EE3 A;  2FUG 1;  1UWX A;  2Y5P A;  1AYF A;  1XF5 L;  5AUK A;  4YTN B;  3TEW A;  3FWA A;  4KKI A;  1FFV C;  2YEP F;  3TX1 A;  2SAK A;  3ABV B;  3WCQ A;  4WH4 A;  3AEF B;  5FXD A;  3NVW A;  4PT5 A;  3A7A A;  1TKE A;  5HHD G;  4C7Y A;  2E6X A;  2I38 A;  2LUM A;  4OW0 A;  2YEP B;  1OFF A;  3R2T A;  2P13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...