2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
3NRZB 4PYTA 2B76B 2BS2B 1OQRA 3HUIA 4A9AA 1WGKA 3S1DA 3KWLA 1NVID 1F0ZA 4C7ZA 4ML8A 1MBTA 1W1JA 4PZFA 2WDVB 1A70A 2WU5B 1FM0D 4US9A 3DEDA 1DGJA 1DZNA 3B2FA 1QF6A 2P13A 4DNSA 2MH7A 4YTNB 3W8ZA 1FFUC 3FW8A 1SIJA 4YSZB 4JWUC 2OAIA 3B2GA 1FIQB 4JAYA 3AE9B 3I99A 4MLAA 4YSYB 2H89B 3KJMA 4PWBA 5G5GA 3NVWB 2AXRA 2BVHA 3VR8B 1N62C 1JRPA 4BC7A 3L4PA 1GPXA 4BCAA 1AYFA 1YQ3B 4ZOHB 2LEKA 2VFSA 1W1SA 1ROEA 4YTMB 5EE0A 2W55A 4ZHOA 3S1FA 1AHZA 1FRRA 2WLBA 1JWBD 1SB3C 5C2TB 3WCQA 1XLNA 2WQYB 3NVZA 2Y5CA 1I19A 1W1KA 1PUTA 1J7CA 3TX1A 3NS1B 4JWSC 1WWTA 5AE2A 1W1LA 4KX6B 1NI3A 2DWQA 1ZUD2 4ZHPA 1E9MA 2P4PA 1N5WA 2Q4WA 4BC9A 2QJLA 1DOYA 3P4QB 1DOXA 5MPOA 3B9JA 1E7PB 4EC3A 1VAOA 4PVHA 1VJKA 3PO0A 4UD8A 3FW7A 2WDRB 4FXCA 1XLOA 2O3GA 3PM9A 5HQXA 3AEFB 3TSHA 1HSKA 3NVVB 5FXFA 1N60C 4C80A 5FXDA 4US8A 1E8GA 4OALA 3AMZA 2R2ZA 3CIRB 2ACZB 1JALA 4TVWA 1QOFA 2JQRB 1QT9A 3HRDC 3FW9A 1JWAD 1WXQA 2OHFA 2WP9B 4N59A 3NVYB 3VRAB 2QIEB 1V8CA 2JX5A 4LTUA 2PIAA 1UXYA 3S1CA 1WVEA 1QOGA 4XLOA 1NEKB 2VFRA 2W3RA 3S1EA 3AEGB 1FFUA 1CJEA 3AEBB 5G5HA 3P63A 1L6UA 1TKYA 5EE9A 2EKIA 1JW9D 3AE6B 3A7RA 3ABVB 1QLBB 1OFFA 1MBBA 3JS8A 3NRZA 1QOAA 2WU2B 3AB5A 3P1MA 1E0YA 2W3SA 1L5PA 1YQ4B 3BIID 4ITKA 2VAOA 3SR6B 2CU3A 2E5AA 3AEDB 1ZP0B 2PKOA 3P4PB 1SB3B 1E6EB 3VTEA 3AE4B 3D2JA 2L83A 3RPFC 3D2DA 2AX5A 3GSYA 1KRHA 4N6EB 1WYGA 2E3TA 3W5VB 3AE7B 1NYRA 1TKGA 1W1OA 3ETRB 4ZOHC 3FWAA 1F0XA 5FXPA 1QOBA 2W54A 4IDIA 5G5GB 3EUB2 4PVJA 2YVSA 3P4SB 2R8DA 2CJNA 4HG0A 2K9XA 1RM6C 3LB8C 1N5XA 1FFVA 5AUKA 3NVVA 2FBWB 3SFEB 3LAEA 3VRBB 1JQ4A 3SFDB 3AE2B 2MBRA 5C3JB 3NVWA 2BS4B 1V97A 1JROA 2M56B 2PLIA 3AM9A 4HRSA 1ZR6A 1AWDA 1FIQA 2I0KA 1XO3A 1ZXIA 1E8HA 1WVFA 5FXEA 2WDQB 1YJIA 2PLSA 3DQ0A 1UWMA 3SR6A 1J7AA 2GQTA 3TSJA 3LXFA 1ZOYB 4WQMA 4PVKA 2MJDA 4JX1C 1W1RA 1R7SA 1X2HA 3W9CB 5GXGB 5EE1A 5H8YE 2G1EA 1E0ZA 5HHZA 1PDXA 2DBYA 4O95A 1VLBA 1XLQA 5EE3A 5G5HB 1W1QA 1VQZA 3AN1A 1W1MA 1FMAD 3W8XA 5D79A 3FC4A 3B9JB 3P4RB 3ETRA 3DWMA 1B9RA 4YTPB 1E8FA 2Q85A 1VDVA 3NVZB 3D2HA 4USAA 1RYJA 3AE8B 1N63A 2L52A 2BVGA 2P3HA 3AE1B 2PVOD 3VR9B 1TJEA 2M19A 1DIQA 1N63C 2VFUA 2HTME 1QLUA 2MJ3A 3ZYYX 1OQQA 1TKEA 1FXIA 4HROA 3A7AA 3AV8A 4YSXB 2RK5A 3FAHA 1DOIA 2KAJA 2PVGC 2BVFA 2QPMA 3W5UB 5AE1A 2MJEA 2VFTA 2KMMA 1I7HA 1N61C 4BBYA 4N58A 1L6VA 5HMRA 1QLTA 3AH7A 3EUB3 4PVEA 4JB1A 4C7YA 2K5PA 3A7UA 3AEAB 1CZPA 1ZXIC 1NENB 1WRIA 1AHVA 4P6VF 3HRDD 3NVYA 4YT0B 3LLBA 2GQUA 2K22A 1RFKA 5H92C 1N62A 1GAQB 4TVYA 5AE3A 1RM6B 2N0SB 2VFVA 3AECB 1TYGB 1FXAA 2H88B 1T3QC 2EXRA 3W8WA 3AEEB 1J7BA 1N61A 5ADZA 1AHUA 3DWGC 3HVZA 1XLPA 2Q5WD 2NQWA 1SF0A 1X2GA 1KF6B 4YXDB 3AE5B 1N60A 1RWSA 3CWIA 2BT6A 2QKNA 3NS1A 2CJOA 1YJJA 2BS3B 4WWMA 3C0PA 1T3QA 1IUEA 1NYQA 2WS3B 3R07C 1E10A 3AE3B 3BW7A 1FRDA 1L0VB 1FFVC 1PFDA 1KFYB 4PWCA 1FO4A 1EWYC 5AUIA 1DIIA 1N5WC
chains in the Genus database with same CATH superfamily
3DVNV 1TS3A 1GOZA 3ZVHB 2KO3A 3IN5A 7ICEA 2OH2A 2OO6A 4B9MA 3CSTA 2RP5A 1OQRA 2OXOA 1ZQRA 4A9AA 5CHGA 3S1DA 4C56C 3VFCA 5KFNA 3PQBA 2NO4A 1KLUD 4DXFA 3GIKA 3EEZA 4ECQA 1FEBA 2CHRA 4YMNA 4K3CA 3PLUA 2QARA 5BOMA 1QTMA 4OZAA 1KN0A 4HXDA 4OVVA 3QU5A 1W1JA 1PVPA 1NKBA 3DBRB 1I4GA 4QZDA 4GR1A 4HPPA 3A0BU 2VH2A 1ZRMA 1EC9A 1A70A 2QJJA 1SWVA 2AU0A 4HJKA 2K60A 4RGTA 4DQSA 1DGJA 4QZIA 9ICIA 5ALYA 1QF6A 2P13A 2OM6A 4WJQA 4XWWA 3R1ZA 4Z6DA 1NK4A 2KJ8A 1K1QA 4G8TA 2JH7A 4UAWA 2ES6A 4P0PB 5J2RA 2AQ0A 2X8HA 1V81A 7ICFA 4BKSA 4YSZB 9ICXA 5FR6A 2OPJA 4R66A 1JOAA 1NPXA 2PE9A 1K52A 1ZD2P 4IR1A 3N97B 3B2GA 1YQBA 4H4UA 1PVQA 1L4ZB 3PO4A 5IAAC 4JQWC 1PVRA 3BZCA 1A0PA 1F52A 3NS8A 3A9KA 1VJ5A 7ICKA 2WF6A 4FBTA 4LK0M 7ICMA 1KKXA 2XY5A 4LDTB 2EZXA 1NELA 4NQLB 1WCNA 4O3MA 4FZNA 4CRXA 2RDXA 5AKXA 3FILB 3RZWC 4B9VA 2K6DB 5HG2A 2E1FA 4ED8A 2LUEA 4MEXA 4RF1A 3WAOA 1GERA 4BC7A 1GPXA 3W1SA 2X8CA 4UW9A 3HJEA 1AYFA 1AN8A 1TVAA 3MJWA 4C4VB 1MVKA 5DGBA 5HMMA 2LEKA 1UF0A 4K8DA 4PHPA 4FBJB 1W1SA 4PZNA 3RR8A 3TIXA 5EE0A 4GGBA 2GBRA 2DAFA 3UQ0A 4ZHOA 2IGGA 3GRSA 1MSWD 1WX9A 3S1FA 1AHZA 1NK0A 1WMHA 1S0MA 4GXBA 1UD7A 2RGFA 1Q1RA 3MC8A 3MZNA 2PMQA 5BYQA 4BZAA 1MC8A 4YVZA 2KICA 2IY1B 3UI3A 2GBMA 4K7UA 4ICAA 4GDLA 4TKNA 1IBXB 1KJTA 2KIWA 2WP6A 3JPNA 4LA1A 4ASWC 2I5QA 1FEZA 3LDZE 4JLCA 1PUTA 2G9HD 2PGEA 1J7CA 1T0SC 3VUWA 5AE2A 2QAEA 5J2FA 4HCPB 4KX6B 2OOBB 1RXVA 3M9OB 3ZQ4A 4A20A 3EKGA 1NI3A 2QCZA 2N1RA 2KJHB 2EMTA 4DDID 1MN8A 4HN8A 2C7HA 2CPRA 1NZBA 2FPKA 1ZUD2 4M01A 4EZJA 1E9MA 4XDDA 2DW6A 5AHXA 4J9LA 2HTHA 2N9EB 4I2BA 3C21A 2MBOA 2NVUI 5C1ZA 1STEA 1H38A 3UXNA 1WXSA 3P4QB 3HP6A 4M00A 1DOXA 1RRBA 1N6ZA 1IYFA 2H3VA 1XC9A 1SSNA 4C0ZA 3L3FX 3B9JA 2IMWP 1E7PB 3APDA 5AM5A 1PGAA 5IKCM 1NZPA 3T9PA 5HKHA 2KN7A 1IXRA 2PODA 2A4ZA 3ZJTA 2QILA 2EAPA 1GREA 4AYBC 1S97A 5C23A 4A3OA 4C00A 3VUXA 4UD8A 2PS2A 3Q8KA 4HKZE 1KLGD 2BPCA 4I6NB 4KEMA 5D94A 5DDYA 3UGBB 5KT2A 3L54A 1HSKA 2ZADA 3R8BA 3NVVB 1W6TA 3U9IA 5HR6A 5JCIA 4RUCA 4NM2A 5F3XB 3BQ2A 2IPKD 4NAMA 1JWSD 2JRIB 2HSZA 4K4HA 4GDKA 3AEVA 1U4AA 3BDPA 5ALLA 2W9BB 3AMZA 3JPPA 2BQRA 4EQSA 1ECWA 2L5YA 1T0YA 1ZXHA 3WALA 5EBKA 1L8LA 2LRWA 3HIZA 4O3OA 2ACZB 3JZUA 3OC4A 1JALA 4MEMA 4TVWA 1QOFA 2YLMA 4FADA 2WXPA 3N9YC 4QWBA 3U2SC 3GRTA 1VD2A 2LASA 4ARIA 3RRGA 1EO6A 1U47A 1JWAD 1LXDA 4M0WB 3WAMA 4BKGA 3Q6JA 3BS7A 1R4NB 4DXKA 1M4VA 4BVUC 4C8MA 3L16A 4KLUA 4O0IA 5GMVA 2PTZA 4H4XA 3T3FA 4QNLA 3H0RB 1JUDA 3TACB 3PG6A 2INNE 1ZQXA 4ECYA 3JSVA 3L5OA 3QKEA 2GB1A 1UT5A 3AL0B 5L1KA 5KFTA 2DZIA 3HM6X 2K8HA 2NBUA 1XPYA 1XNSA 2L0FA 1QOGA 2ISOA 4PK1A 2WOWA 4R64A 2BQQA 4URKA 2NPTA 1SBBB 4J56A 3ZLFA 1CJEA 4K4IA 2E5SA 2XCAA 5GTHU 5IINA 3AEBB 4OVUA 4HCNB 1NK7A 1LVLA 5EDSA 4EFOA 5DPSA 4KWSA 3BJSA 1KW4A 4PGXA 2PMZC 4DL5A 4ICUA 4LNOA 4F5QA 1JXLA 4W9FA 3RNBC 3AE6B 2DZKA 5J0SA 4EYIB 2RABA 2OJWA 3N1ZC 1BMLC 1JN3A 1MBBA 1E8XA 3ZVVA 4JL9A 5ALVA 4EZ9A 3ZVHA 1XCQL 4LNKA 3UF8A 4F7ZA 5KFOA 4QWAA 4F1SA 5BO4B 1DGSA 3ZW3A 3E58A 2NMQA 1YQ4B 4TURA 3MC9A 3BIID 4LDTD 3Q4DA 3GZNB 4M9NA 4F8CB 3SR6B 5KG1A 5JUMA 2JRZA 3MR2A 3C29A 2KHVA 2BCVA 2CU3A 5JHAA 2R9ZA 2L05A 4H50A 4MFAA 4WWPA 2EAOA 3PW4A 2Q0ZX 2KZ3A 2PKOA 1SB3B 3UCDA 3N7RC 4ED3A 1NNLA 3WKEA 4LJOB 5L9XA 1Q10A 4UASA 4P0QA 2FUG1 4MFCA 4BBNC 4NAWA 3OJSA 1SE3A 2HXUA 2EZZA 1K51A 3AE4B 4RGOS 3D2JA 1BPBA 2KZZA 1V5TA 1AW7A 2AL3A 2I38A 2N7EA 4ICVA 3GSYA 5ENLA 2NQLA 4JDRA 4Y2YA 3PREA 2VH1A 2XH4A 3JPTA 5C5JA 4O5KA 9ICTA 4QZCA 1FNUA 1RYRA 2E3TA 4M52A 3VDZA 3AE7B 1NYRA 2FNJB 3PVLA 3W5VB 4EELA 4JHMA 5FS7A 3VH3B 4GOCA 4B9KA 3BYYB 3H8JA 3QC8B 3QHTA 2LFIA 4B6JA 3QU2A 2FDRA 2R18A 8ICSA 2KOBA 1NKEA 4TQ1A 1Z2MA 2BB6A 2KDIA 2KVCA 3LADA 1P7FA 4FULA 3P4SB 5L6GA 1ISNA 5I1WA 2YAUA 4EQXA 3TCSA 5KG2A 4O5CA 2BWFA 2CRXA 3LB8C 1DOQA 2ZPNA 5D3DA 5IN7A 5CHWA 4OW0A 3E0FA 5HFYA 5LNK1 1XWLA 4O3NA 4RQ7A 4ELVA 2Z59B 1ZQCA 3BZDB 3MDAA 2D3CA 3UMGA 4TMAB 4EMIA 2BKEA 2KNJA 3HM3A 1V85A 3V6KA 4ANUA 4TQ0A 2JH1A 2LPEA 3N4EA 3ZNHB 3APCA 2RDBC 1UQVA 3SFDB 2UVVA 3E9SA 4G11A 2MBRA 2L00B 3SN1A 3WKBA 4KMUA 1VCBA 5C3JB 5KT4A 2UU7A 1BQGA 2OZ3A 4JK1A 3SBFA 2K8BB 2W9MA 4OZBA 2CHXA 5ALUA 2WXFA 3ZTCA 1N48A 4HCHA 1XO3A 1D8LA 4AS1A 5AI4A 3ZLZA 1Q0WB 5AZGA 1I4XA 3QQ8B 1E8HA 4GRTA 4QZ9A 1ZQJA 1V9PA 1NHRA 2G3QB 1YJIA 4UQGA 1MPEA 2SEBD 2FLLA 4IM0A 2ZUBA 2DAJA 1IIPA 3C0RB 1MHXA 3U30A 1L5UA 2UYZB 3D46A 1ZOYB 4IW0A 4PVKA 4ECWA 3RB6A 2UUUA 8ICXA 5KT5A 2HOFA 3OPXA 1FNVA 1F3PA 2BGFA 2HHWA 4JX1C 1J19A 8ICUA 3TWAA 2FCMA 3PZDA 1X2HA 3W9CB 3WK8A 4BX9C 5KL1B 8ICCA 5H8YE 3T9LA 8ICOA 2LZ6A 4O1NA 4G9BA 2UWQA 2X8XX 5KFIA 4DSEA 3V62A 4F5RA 4C4SA 2V3PA 2KG5A 2QGYA 3M95A 3I76A 3AN1A 1SXTA 5KFQA 1I42A 1VQZA 3SEIA 2C60A 3EF6A 3W8XA 2UVRA 3SMVA 1R0MA 4JV2A 3N7SC 4LNNA 3FC4A 4O3QA 1Y88A 3TSSA 1UCVA 4Q45A 4IQVA 3IHPC 5DB7A 1V2YA 2KE7A 1GEUA 2XH7A 2NRTA 2Y9TA 2GWSA 3DGZA 4A8EA 3ZKJC 2GGGA 3Q8LA 1GRAA 1B9RA 4ZRIA 1BGXT 4YTPB 1E8FA 4JMUA 4M9HA 2KQ4X 1MQ2A 3KHGA 3OJ4B 3QA8A 5CEHA 4Y2TA 1HUZA 1MFWA 1VRAB 3PSEB 4DSIA 3QX1A 5DG9A 2Q85A 4K7ZA 3SV4A 3H1UA 5KFRA 3ISCA 4KLSA 2XK5B 5LXIB 3PSPA 3GILA 4Z6CA 1FCCC 2HDOA 2ALZA 2HHSA 1IGCA 4MELA 1A76A 3NASA 1OW5A 4I2GA 1N63A 3OW1A 2L52A 2L3ZA 3O13A 5ALOA 1ZQSA 1CK1A 3HK0A 1CUKA 2ASLA 3H0MB 1EC8A 3SYZA 2N9LA 2KHWB 1ZQNA 4W9CA 1QLUA 3QWZB 1FXIA 3N6JA 2AQ3B 4WIPA 1EWCA 2KMDA 3QU9A 5I1VA 1KFDA 3A7AA 1D9FA 2FCNA 1XDIA 1GNUA 2QDFA 4YSXB 2KFKA 2M8SA 2RK5A 1PK1A 3F5EA 2QPMA 1RQNA 4YR2A 4GU2A 1ZJMA 3CXOA 3OHBA 1SKWA 5EU9A 3S47A 4KDIC 1GSNA 4NJCA 4GDKB 4PL2A 3PSTA 5AK5A 1YEYA 2QB0A 2I1QA 2KHQA 1TV9A 3N20C 3H7SA 1C79A 3W1YA 4DHZE 1I7HA 1N61C 1JPMA 1NHQA 5AI9A 2BDUA 2PXIA 3ZD8A 2ZVNA 2SAKA 4NLKA 5KFYA 4BBYA 2VA2A 4ELUA 3UQ2A 3VC5A 1L6VA 3TADA 1GRFA 2ZIUB 2FIDA 4AUQC 2XICA 1T0QC 1F2RC 3VDGA 3HW8A 4GC7A 2G06A 3NUQA 2EQYA 5HP4A 2BCSA 2IHNA 2GH1A 2ESEA 2EAMA 9ICAA 4DXAB 4TUUA 3EYZA 4F5PA 3V5CA 5A0LA 4G50A 1FPYA 1GB1A 1WGHA 1AOGA 1C4AA 4IQTA 4U6PA 2GLEA 4FJZA 2K8CB 4TQSA 3A9JB 3AU6A 1S5LU 1SJAA 3HPFA 4G7FA 1CZPA 4PS8A 5J18A 3KD3A 2BCQA 3GE8C 2O6KA 4ZRQA 3SSZA 4BAXA 1AHVA 2K8BA 2PKEA 5DBAA 2GQUA 2WXIA 5J0WA 4WQOB 1XCTL 3H8AA 1U4BA 2K4IA 1WH3A 3H7VA 2QQ6A 3GOEA 4KTQA 2J0KA 4EBCA 4DWDA 2VANA 5H92C 3MWCA 4DHJB 4QWEA 3I5JC 2HHUA 3H4KA 3ISBA 5CWRA 2KDEB 2N0SB 2WWZA 3R0KA 2HVHA 3AECB 1TYGB 2MX2A 3AI5A 3AU5A 4DFJA 2IA6A 1ZQMA 2GGHA 4FP1A 2YMLA 1X2IA 3L5KA 3PPAA 2ZIXA 2KDBA 5JCKA 4RT3A 9ICPA 4DDGD 2OZTA 4B9SA 1ZW7A 1TT5B 1L3VA 4B9UA 2KFZA 3RJIA 9ICOA 3HVZA 4GB9A 4CE6A 5HMLA 5HI1A 1D5XC 1NU5A 3TEWA 2KN4A 2V3AA 4MHVA 1KF6B 4YXDB 1ZQZA 1J2NA 5AIAA 2B0CA 2BT6A 2WXGA 2QKNA 4Q8FA 3Q3FA 1P3QU 1F5SA 3NS1A 5CR0A 3A4SC 2CJOA 3F53A 4W9GA 3R11A 3AQFA 3UPQA 3PY8A 4O3SA 4JIOU 1OEPA 2CN1A 2BS3B 4NEVA 1ZQOA 2EQ6A 1BXTA 2L8JA 2K4HA 3HSUA 3DVGX 3DHGC 1STZA 3DG3A 5KHOA 2OEHA 5AICA 4XX5A 3GO2A 3SU8X 4E4UA 4RH6A 5DG8A 3AE3B 4Y2RA 3RITA 4IL6U 3GC2A 1Z3EB 1NJWA 2KVRA 3RT3B 2MUCA 4J9MA 5KHQA 2MU2A 2WHEA 3C19A 3H12A 1FO4A 4PJ0U 1JWMD 2KMAA 4UB1A 4KIKB 3M8RA 3DHHC 3NRZB 4XUSA 2F76X 3KHLA 1IP9A 4PYTA 2V3NA 4UB4A 4P7IA 2NO5A 2B76B 2BS2B 3P42A 4J3ZA 4EMWA 1BNOA 3HKZC 5J8YC 2BDPA 3SAGA 3EW9A 2GMIC 2IJ0A 3RO6A 5F9NA 2MSNA 4FS1A 4W9IA 5EWGA 1P7DA 3A1QB 4ML8A 1QKZA 4OHJA 2HBMA 3M63B 1MBTA 2O56A 1ZKHA 3C2KA 3CYMA 2V0GA 4ED1A 1AARA 3EGRA 4MGYE 4PZFA 1VR9A 2WDVB 5DB6A 2JRHA 2LGYA 2LGSA 4H4SA 3M1YA 3UXLA 4B9LA 2K1FA 3T79A 1J97A 3KKAC 3DEDA 2EKEC 3IFWB 3HX0A 4EEKA 3IVFA 4I6LB 4J3OD 2YY6A 4UB8U 5ALHA 4O3RA 2Y5PA 1KSPA 2JXJA 4ROPA 4YTNB 4EZLA 4NL9A 4DSLA 3N1YC 3FW8A 3IXSA 2LXAA 4OZCA 4JWUC 1ZE3D 4F4KA 1EUVB 1YNTE 4HYRA 1KQQA 2Y0SF 3QTPA 1MNSA 3PWIA 2NTTA 1FIQB 3AE9B 7ICPA 3C23A 1ZQLA 4KN4A 4JAYA 3I99A 3PRPB 4IQWA 5J2EA 4MLAA 1S0OA 2C9WB 4HDQA 1NKCA 9ICWA 4YSYB 1MUCA 4FX9A 2WF5A 4TUPA 2H89B 4YP3A 7ICHA 4PWBA 5G5GA 5AKJA 3RUIB 1COKA 2L7RA 2FJ6A 4BOSC 1RVKA 4XE0A 4WJPA 3ORYA 5KAFU 3UQAA 2AXRA 4JQ9A 2GOLA 2AGOA 3Q3JA 4HKQA 2BVHA 4F5OA 4GIVA 3EANA 4K8GA 2XSXA 4Y2JA 2XEWA 3SQIA 2GH5A 4CF3A 9ICVA 1OQYA 1UUPA 2MUTA 2K4PA 3L4PA 2MBBB 4XYCA 2YMPA 4E4FA 5G55A 1GRTA 5JHBA 4TQRA 2XIDA 1PDYA 1E8YA 1SV4A 4J6IA 1UBIA 1WXVA 4QIWF 3SAFA 4KLEA 2VFSA 2Y0SC 3SQSA 3ZD9A 5AKEA 4FJYA 3N30A 4ECVA 1SE4A 3TANA 9ICGA 5FS8A 3L17A 4HPLB 8ICBA 4K7WA 2R8IA 3QX7A 1FRRA 1PQSA 2PI5A 4REZA 5LXHA 1HXYD 3OGUA 2FCQA 2WLBA 1JWBD 4MDKE 5C2TB 4XWTA 5AIBA 1ONEA 4IUMB 8ICLA 1I19A 4DYEA 3PX6A 4K81A 1Y56A 1JRUA 5GTIU 1S77D 1ZQQA 2Z8LA 2PSNA 2QDEA 3NS1B 2OKTA 1W1LA 2ZPYA 2KVSA 1WG8A 2D6FC 2LUMA 1NHSA 5KFVA 4GIBA 1UZXB 4YD1A 3TUOA 1NOMA 2WF7A 4RZRA 3TTEA 3VCBA 4ZHPA 4KZ0A 1E7VA 2NR2A 2WF9A 2LYAA 3GZFA 5KFKA 1Z5SB 3IJQA 4F93B 2Q4WA 5ALSA 2ZTEA 1KDHA 2NS5A 2KX0A 4RNAA 3OTQA 4UBCA 4JV0A 2O6VA 4ECTA 2RPQA 2JT4B 4ANXA 7ICQA 5IP4D 1DNCA 5MPOA 2JWZA 2C7NB 4EC3A 4QZGA 3TI0A 2RDJA 1X9SA 2KANA 2M1MA 3V61A 4JV1A 1WX8A 1M6IA 1IV8A 3AU2A 1QSSA 1RYUA 1BPDA 1TYTA 3PWGA 2XCPA 2MBQA 2P6RA 4KN7A 4BKTA 1XLOA 3MQTA 8ICRA 4YMMA 3PM9A 2PP1A 1TIFA 5HQXA 3IC9A 3QFAA 5AK6A 3M9NB 4Q8EA 2MW5A 3AEFB 1QH9A 3T4WA 3ZXVA 4FN2A 3FDSA 4Q43A 5FXFA 5DGAA 3P0WA 2JEJA 1E5WA 2QJMA 1N60C 2BF8B 4US8A 3NG0A 1D7YA 2YMMA 5ALQA 4ECXA 1I4RA 2J7QB 3JVZX 2ZTCA 3EWAA 1KBUA 1V1PA 5AKZA 1WUEA 1NDAA 3M9MB 2MBEA 3ML8A 2J52A 3CIRB 2VRRB 4ED7A 2R2ZA 3IDWA 1XXGA 3GB1A 5AKGA 4J9KA 4DFKA 3H8WA 4B0EA 3CT2A 2LKYA 3C28A 3HRDC 2KTRB 4JUZA 2ZW0A 5KG4A 3FW9A 1TAMA 2KLGA 4GMVA 4MGZE 1B0XA 2EDUA 2RDIA 3WKCA 1GESA 1F0MA 2WAQF 2BCUA 1ZDXA 4TSSA 4FE3A 1C9FA 4FI4A 4Z17A 1PK1B 4K4GA 3VFKA 2WXLA 2FMPA 2WXRA 2KJ9A 4QJFB 4P16A 4BURA 1V8CA 1SIFA 4LTUA 5KFLA 1MHHE 3RNEC 3JYUA 4CO7A 1ZYQA 1SKRA 4MF2A 2KN5A 4IT1A 3ZTDA 4HCLA 3UJ2A 2OYYA 4I2DA 1MI0A 3FVDA 5L83A 3PMNA 1YX5B 2HJ8A 4DLEA 1ZQDA 1ZQHA 3RJFA 4IRCA 1NEKB 1Z00A 4UATA 2IGDA 2VFRA 3PK7A 5H2FU 2ZXHA 2W3RA 3CAWA 1KTKA 3D9XA 1V38A 1X6JA 2IZVB 5KFAA 3AEGB 1L8PA 2Z0DB 1S0VA 3Q8EA 3CYJA 4HYKA 4MSMB 1K4QA 1JIHA 2G09A 2ZIWA 2PMVA 1L6UA 3U8ZA 1RLFA 4F2RA 5EE9A 2EKIA 3KYDD 1L3UA 1HTOA 4AOFA 3EJBB 2ZTDA 2CFYA 5L1MA 3WKDA 3I63C 3ABVB 2RDGA 4KLQA 2PLPA 1BPYA 4DL4A 1OFFA 3JS8A 3NRZA 4RQ8A 4RGNA 3DK8A 3ZJVA 4PZOA 1MDLA 3A4RA 3TEXA 1DXSA 1WGGA 8ICWA 3RCYA 2YVFA 4U7CA 5D6JB 5TSSA 4UB6U 4ITKA 4LCDE 2GDQA 8ICFA 4FFDA 1BVSA 2LGIA 2YQUA 4F4WA 2KTQA 3U4EG 4QWDA 1ZP0B 4PHDA 5KFBA 5C0YA 3P4PB 3SHQA 3RH4A 1Z1VA 3WK4A 1QQ6A 3F2CA 4ACOA 4P4OA 2ZNVC 3L13A 3VTEA 4H83A 4O5EA 2AQ1B 3DEEA 4CDGA 1XHCA 3M8SA 3V5FA 4HK2A 2ZJ8A 5ALFA 1NK8A 2WXKA 1WYWB 2XH0A 2RR9A 5CHFA 4Y2QA 1EXNA 2ZIXB 2V1YA 2C3DA 2KV2A 2KMCA 4E5TA 5L6FA 1PUZA 4RT2A 2TSSA 3U7DA 4RQ5A 5DLGA 2AX5A 2C5LC 2R2QA 2DLBA 2PTYA 4ECUA 3Q2AC 3EJEB 1KRHA 5GRTA 5ALJA 2J6SA 4DCCA 1FNWA 1YN3A 1L8OA 2KOXA 2ZCCA 4E8GA 1C76A 3RJKA 1BKHA 3G6VA 4W9HA 2O6VB 2JZBB 4J9PA 3DBRI 2M4NA 3NZSA 4OJ6A 2NBVB 1OEYA 3RNFC 4XDCA 2LYHA 4UDUC 2W11A 1F0XA 5FXPA 1QOBA 5G5GB 1QCKA 1SKSA 3V7LA 4MF8A 1V80A 2YVSA 2LM4A 3THVA 2VJ4A 4LJXA 1E7UA 5ALDA 5DQHA 3H0LB 4OJ5A 5DB8A 4OO1J 1RM6C 2Y3RA 1N5XA 3QEAZ 1KM7A 3GP7A 3NY5A 5J0YA 5BMIA 2QB1A 5AUKA 2HXTA 2F1IA 5IIIA 4CCHA 2BTEA 2FBWB 3PO5A 3KUDB 1WE6A 1QQ5A 3LWLA 3VRBB 3RRAA 3KH0A 3URHA 1KTQA 2W9AA 2ONQA 2K8CA 3I57A 3V3XA 4AWJA 3AE2B 2HNEA 4DSJA 2KD1A 4BWMA 2J42A 2YEPF 5HHDG 4WAAA 3NTUA 3P3BA 3NVWA 3F5AA 1WIAA 1ZY8A 1ZPSA 5L1LA 4IRKA 4CGZA 3DERA 2PLIA 1L2NA 1SWWA 4P4PA 4K1RB 1HE8A 2QARB 3DJJA 2LJ5A 4HRSA 1FIQA 3A0HU 2RHFA 2OCEA 5KFCA 1WX7A 4DL6A 4EKUA 1WVFA 4ARCA 5FXEA 4NY8A 2WDQB 1Q3UA 4XRHA 1XEEA 3HKZF 2CKHB 1LGRA 2IO0B 3OPSA 3BQ0A 4DWIA 3UJRA 2C22A 5ALGA 1UWMA 3SR6A 2BGWA 4H2AA 2GQTA 3DQ0A 5TISU 4Y2PA 1ONFA 4YWOA 5T14A 4C4VA 1GXFA 2AH5A 2V6OA 2JZZA 4ENLA 2K6QA 2MSED 3PLVA 2AL2B 2UUVA 1LM8B 3PRZA 2F8LA 1LV5A 8ICGA 2G1EA 4GLSC 1E0ZA 4GISA 1NJYA 3ZGZA 4O95A 1VLBA 1OTRB 3LWMA 1KFTA 4DLGA 3KKAA 4DQIA 5AZHA 3R7QA 1WGRA 1C78A 1ECQA 2WXQA 1RDFA 3JPSA 4J1OA 4JN7A 1HIWA 1D5MC 3MSYA 1SJBA 3IK4A 1GRGA 1XD3B 3QXGA 2ASDA 3IM1A 2D3BA 2BQUA 3ETRA 3PZ8A 1SJDA 3Q8MA 2HDEA 3UIPB 3JPQA 4ANVA 4PHAA 1F1HA 3RCZA 1SJCA 4GXJA 2N9XA 3BOXA 2MHJA 4NZLB 2V3BA 3PX0A 1VDVA 2R8GA 3NVZB 2MUTB 3RF9A 2NRZA 4NXZA 2VZKB 4F4RA 4EWJA 3ICXA 4USAA 4IM3A 2MRLA 2W03A 4TUSA 2A19A 2NYVA 2P3HA 3GD4A 1TZZA 2I1KA 3N1XC 2MCNB 3N6HA 3JW7A 1N63C 9ICLA 5E6JA 1ZX9A 1HEZE 3V6JA 3KOOA 1MG4A 5AM2A 2HTME 1MRAA 2X50A 3FV9A 1JXEA 1HTQA 3BYTB 1WE7A 4J9NA 4JWMA 5BOEA 4S17A 1URJA 4ED2A 2P66A 3CMMB 2NPXA 2L0TA 4H4YA 2PFPA 5J0XA 3ZDDA 2A1JB 4EE2A 1U49A 3ZDEA 5KFHA 4R65A 2GGJA 3MUCA 4CNQA 1ZQFA 4JGHB 8ICZA 3BQ7A 3LYSA 4L1BA 5KG0A 2DYOA 4OCZA 2KDFB 4QZHA 1UA0A 3W5UB 1D6EC 5AI8A 5CRXA 5AE1A 3JSVB 4P2HA 4KX3A 1JEHA 2VFTA 2KZMA 4S0RA 2WB1C 3MKCA 2KMMA 9ICJA 1UH6A 2INPE 3U7ZA 2KKVA 3EZ5A 2G4SA 4O3PA 3I3TB 3IAM1 1YN4A 5HR7A 4N58A 4I6PA 3T5LA 2PP3A 5IILA 2HCFA 4ELTA 5CP2A 4C4TA 3QIJA 4HCDA 1ET6A 4W9LA 4GSWA 4AJYB 2GI9A 3EECA 1P1AA 4IL2A 2CS4A 4W9EA 5TR5A 4E71A 4PVEA 1T3NA 2KEYA 4C7YA 1JCKB 3PV8A 2YN4A 2D07B 4DL7A 3ZNGC 5JZEB 5KFJA 2LJIA 4A6QA 4OVZA 3FILA 1KD0A 2OFJA 4IQUA 1WI0A 3WANA 2CHWA 3HRDD 3NVYA 1M6YA 4DSFA 4IKGA 4YT0B 4F72A 2POZA 4UARA 9ICQA 4I29A 3V7KA 2FAZA 4XGAB 1BPXA 2ZIWB 2K22A 3N32A 2QJNA 3Q45A 1RFKA 4QWCA 4B9TA 3A33B 4WAFA 4O9MA 1N62A 3QK0A 4M6UA 1UPHA 1GAQB 2XH2A 1Z00B 1K50A 2IO2B 2VFVA 2PI4A 5CX3A 3DIPA 3IJIA 1VZ7A 2WPFA 5IIMA 3ALRA 4KV2A 1T3QC 2MNRA 5KNIA 1C20A 1D8BA 3AEEB 3Q6BA 2AL2A 3BJYA 7ENLA 4QZFA 4BXOA 1N61A 5ADZA 1AHUA 4GN1A 4ADWA 3D6JA 1LO5D 1XLPA 4GYPC 5D46A 4Y2XA 1ET9A 3GD3A 1UELA 1A6SA 2Q5WD 3E56A 3NZGA 2I5HA 2HHXA 3STPA 3ZDTA 1LKYB 2P8CA 1RWSA 3CWIA 3CXBA 4F71A 3ZLHA 2ZUCA 1ZQAA 1F77A 1TTNA 1EF1A 3LYYA 4WJ3B 7ICIA 4KT2A 3GIIA 2BYEA 1YJJA 3BWUD 3QFBA 5D2MB 1T8EA 2JEFA 4EOYA 4MFFA 2LGXA 2W0HA 3H70A 4DFPA 4H4VA 1T3QA 2KQ7A 1NYQA 2IBKA 2E6XA 4TUQA 1UWXA 2XBBC 3WIMA 2V4IB 4RM8A 1E10A 2GR2A 4MGKE 3R07C 4NEWA 4H1ZA 2G07A 1L3SA 3G6YA 1FRDA 2WX1A 2KXJA 4J9SA 1NI2A 3Q3OC 3SN0A 1RZTA 1PFDA 2J0MA 3DQVA 1ED1A 3D2QA 4PPXA 2F8KA 4NAWB 1DIIA 1N5WC 2VZKD 4KLHA 1P48A 2JZBA 3U4FA 1TS4A 2BYFA 5CHVC 1JPDX 1YMHE 3EJDB 3UQBA 2ATLA 1WGKA 1VZ8A 3M7DA 2ZCBA 3KWLA 4DQPA 1NVID 1F0ZA 2IO1B 3ENLA 2I2YA 1TFRA 4PL1A 4OJPA 5AKLA 1TY2A 5IIJA 1EC7A 4RM9A 3D2SA 4IOIE 4GC6A 3FXGA 2PPGA 4DN1A 5AM4A 4M8MA 2LVQA 3HHMA 1KFSA 1FXTB 2INDC 3L08A 1V1PB 4KPLA 2IBIB 4RNNA 1ZJNA 3KWVA 2WU5B 1KKRA 1DXLA 3APFA 1K5OA 2KVZA 4CF4A 4F3OA 1F9JA 2ZJ5A 5DKWA 5J0PA 2QB0B 4C8OA 3ZVIA 3W8ZA 4RCOA 2FMSA 1L4DB 4MH8A 2PEAA 4RQ2A 3ZRFA 3QCAA 3OHAA 3DVGY 2GSHA 1A5RA 4FBUA 4DF4A 2OAIA 2ZIUA 4M04A 3B1LX 4QIWC 2AEHA 5DLFA 1U48A 5AEKB 3Q14C 1ZQGA 1WXAA 3ISDA 2K4EA 5I4DA 2AWTA 2DNFA 3KJMA 2Z0EB 2O2VA 3BQTA 1K8RB 2C3CA 2EQ8A 5J2BA 1TYPA 1JI7A 4HJGE 3NVWB 3QPEA 4YQWA 3OJUA 3BS5A 3L10B 4RNOA 2JF5A 1GO3F 1Q5WB 2AL6A 5IDZA 1D3ZA 2M0NA 4QW9A 2D3AA 5BPCA 3PMLA 4EM3A 4KMOB 2OQHA 1HZ5A 3QU7A 3DBLI 5AM0A 2JK6A 1ZQWA 5J2HA 4HPNA 5FJRA 5ALIA 3C2MA 5FS6A 2AL1A 1V59A 1IG6A 3BVGA 1Z4NA 5HHHA 3RNMA 5ALWA 5J8YA 4NY0A 3II4A 2ZIVB 5AM3A 3MGVA 4DSKA 1WFYA 1PK3A 2JYEA 3VAWA 1SL1A 1V6EA 4EBDA 1XSLA 1ROEA 2MA9B 4YTMB 3MJ5A 3ZNZB 3MTNB 2RLTA 2Y5BB 4DL3A 4KITB 5KT6A 3TMPB 4WURA 3R10A 4H4RA 3RJHA 4BKSD 1T7PA 1Q3VA 1D8YA 1M94A 3PHWB 4Q2JA 1FCLA 2G45B 2LWPA 1DK3A 2YX8A 4A8XC 2AQ2B 2JPHA 2C2EA 3H40A 3RTVA 3NVZA 2YMQA 3NGDA 2FUHB 2MRPA 2K39A 3O65B 2Y5CA 8ICMA 4E74A 1YQZA 4EYHB 2FMQA 7ICUA 3DESA 1E8ZA 1Y8RC 1SZPA 3SI8A 2IGHA 4M8NA 3C5FA 3TFSA 2CXYA 2CU1A 4JWSC 3D47A 5AI5A 3MP9A 4IR9A 1X6IA 3K75D 4M9JA 5DBCA 5J2IA 2KD0A 4G0NB 3RAQA 2BPFA 1DRGA 1GC7A 5HNKA 9ICMA 5J0QA 2REXA 1N5WA 4BJQA 3OSPA 4UBBA 3WKAA 2WDTB 4BC9A 2BR0A 3OSNA 2QJLA 2VA3A 2BVCA 4HNLA 1DOYA 3LJ3A 5FK9C 1U45A 5BMHA 3OP2A 3TEYA 1LVHA 2IHMA 5ALNA 3VC8A 4WWNA 2EQ7A 3SQPA 2XI9A 3BQ1A 1ZQ1C 1ZDVA 2ONEA 4FA6A 4RQ1A 1VJKA 3PO0A 3CP8A 2V9WA 1PDZA 2EQ9A 4M0XA 3QARA 4YR3A 1L3TA 3DFHA 3FW7A 3KHHA 7ICJA 1R6WA 1D5ZC 2G4DB 5JCNA 4FS2A 2O3GA 2N9KA 3RD2A 3RFAA 1L7NA 2BW2A 2KC1A 3TSHA 3FG2P 3VHTC 1P43A 3ONNA 1IGDA 4I2JA 3X23A 5K8EA 3KUMA 4R8UB 2OJRA 3NHEB 3P93A 4DHZB 4C80A 4BV6A 2BPSA 5FXDA 1KRPA 1E8GA 4JWNA 5AKIA 2OWOA 3UMBA 1ZK7A 3DFYA 3OTRA 8ICTA 2MLBA 5KVIA 5AWVA 1ZQKA 3MFIA 1H4RA 4YG2A 5L1JA 2P8BA 1Z19A 1P98A 1YOVB 4FZLA 4ZH4A 5JXVA 9ICEA 2JQRB 2ASJA 2HD5B 9ICNA 1TGZB 1ZD3A 2H3QA 4DOCA 2KJRA 3T5HA 2ZNVB 2WP9B 1NK6A 3FCPA 2PTXA 2FE8A 3X0WA 3NVYB 2ZZPB 3VRAB 3Q8SB 1F2RI 3DHIC 5KT7A 5ALPA 1AQ6A 2KSOA 9ICSA 3MABA 3IV6A 2B6GA 3KVFB 3GFKB 2PIAA 5DCNA 2DW7A 5JH5C 2MAXA 3PTFC 4BWJA 3I6EA 1UXYA 1IBXA 4OJOA 2HHVA 5JCLA 8ICEA 3PZ7A 1WVEA 3S1CA 4Y2UA 3SENA 4XLOA 2J53A 7ICOA 1V5OA 2ZZCA 1ELSA 2IDYA 5JCMA 3S1EA 3BK2A 5E79U 2J3NA 3SN4A 2VA8A 1FFUA 1TK0A 4LLGM 2ON8A 3K1RB 4W9DA 3OWEB 2YB1A 5G5HA 1L7PA 4BXOB 3P63A 5J04A 3KTQA 2INCC 2BKFA 3S6JA 3PR4A 5KG6A 4BUGA 4QZAA 4F4YA 1MA7A 1WWVA 2G5IB 1XF5L 4ZCWA 1WJNA 3H8SA 3NZ3A 5IOIA 1U9LA 4QAYA 5FJUA 3AUOA 1UT8A 5LLIA 3KW5B 2WP5A 2IOHA 1BNPA 3ETRB 3C8YA 3PT2B 3AB5A 3CRXA 3DDMA 2Y1JA 4MJSB 2DKXA 1V86A 2WGSA 2PW9A 3ETLA 3IT6B 3P1MA 1EBDA 1E0YA 2HHTA 1L5PA 1SGGA 3J81j 4NLNA 1GB4A 2NTSA 2VAOA 2HZGA 4K3BA 3EPIA 2LBOA 4MSQB 2E5AA 3GD6A 3VUYA 3DG6A 3LVVA 2WPEA 3DH9A 1H6VA 4A35A 4NLGA 4KLIA 1ZETA 4IRDA 2AYOB 3UIOB 3GV8B 1E6EB 5BMGA 3DEQA 3CGDA 1X9XA 2J4XA 2IOFK 3N7PD 4IS7A 3PW2A 4YN4A 3BK1A 4ECZA 4GIRA 2B3AA 4YMOA 3H8MA 3RAXA 2DENB 2L83A 1K53A 4HPMB 1T4GA 3VTVA 2ZW1A 4R63A 4P0PA 3D2DA 4M9LA 1TAUA 1WGYA 3MR5A 2AGQA 4KLGA 2EELA 1PYWD 4UB3A 2E1EA 1WYGA 3TADC 5FJOA 2JSVX 3N4FA 1IPGA 2FLPA 1TKGA 2N4FA 3RMKC 2GO7A 4UB2A 2K89A 1XO0A 1MJDA 3ZNID 3FWAA 4A6GA 4MACA 1LB2B 1C4PA 2OG9A 1Z4OA 4IDIA 3DV9A 4FJVB 4K7SA 2WXOA 1FHVA 4KLOA 2R8DA 2CJNA 4R3DA 4RPXA 1BWCA 2IY0B 4LNFA 1FFVA 2EMSA 3MFGA 1OUQA 2XN9C 1X9WA 3NVVA 4HLEA 1UGMA 5AK3A 4PS7A 3LAEA 2NRVA 1E90A 3PSFA 2PFQA 1JQ4A 4Q44A 3HPOA 2Y4GA 4F4XA 1T0RC 1X1MA 2MWSB 3U26A 5KFPA 1G6JA 4P4MA 4YXMA 2F5ZA 2DFLA 2MA1A 2KFKB 3CGEA 2F2AB 1C3TA 1JROA 3DPDA 1E9IA 2JR5A 4RQ0A 2M56B 2RDHA 2RQ5A 2C2RA 2DX5B 3GV5B 2KTRA 1DK2A 2I0KA 3KZXA 2I9GA 4NNJB 3LB8A 4IC9A 2OLAA 3H7IA 3DK9A 5L95C 3S5SA 2GR3A 5AM1A 2UVUA 1SV0C 2JHDA 4BGDA 5KVHA 2C7MB 1P0RA 2Q4TA 4DFMA 4DXGA 5KFGA 2KQSA 4K1WA 2BCRA 4IWQA 3LXFA 2YTUA 2AXTU 4C8LA 1ESFA 4P1CC 3K4GA 1KOTA 2D3DA 3PZPA 3NRWA 2JEIA 2AKZA 2MJDA 3UXPA 1X66A 1W1RA 1R7SA 1OEYJ 4DQRA 2JXTA 5GXGB 1TBEA 3PW0A 3TARA 3VTUA 3Q8AA 3IJLA 3VVWB 3KZIU 1H8CA 3RBEA 4CHKA 1YT3A 5EE3A 5G5HB 4X5VA 4F5NA 1J8CA 1W1QA 2GQWA 4NLCA 1W1MA 4ZRJA 3Q8FA 2HMXA 5D79A 3EFUA 4FHKA 2K3UA 3Q8BA 3B9JB 4JN8A 1ZQBA 4KLMA 5T8IA 2F1JA 5ALRA 4H4PA 2KWVB 2LRUA 2NBWB 3DWMA 3FYYA 2ICIA 1C77A 1ZQPA 4MJSA 2R8HA 4HWIB 4YWGG 2HW3A 2H3IA 3UXOA 3SEBA 3V6CB 4DS4A 2WHIA 1K1SA 4I2FA 3ED5A 1JWUD 2I1JA 3AU4A 2VJ5A 3CSFA 3RZFA 1WSPA 4IP4A 2K8AA 2BQ3A 1RYJA 1JDFA 7ICVA 2ZVOA 2KACA 3VR9B 1TJEA 2M19A 2O6VD 2K0PA 2D11A 2VFUA 2B21A 1XS9D 2ZJAA 2J6TA 1WRDB 4F8RA 2LVPA 4CYEA 1ZQTA 2IPIA 2VKQA 1OQQA 1JX4A 2TPRA 2KWUB 4KX5A 3PSIA 1ZKQA 4F91B 3DBHI 3ZO5B 4APNA 4MT5A 3WK5A 2W04A 2N7JA 3C1YA 3FAHA 1S7MA 1DOIA 4II3B 3T6CA 2BVFA 1WJUA 1HA5A 4KZCA 4RU9A 2PTLA 3DDCB 4EX7A 4II2B 4MM3B 3QZ8A 3TEZA 3RI7C 4M6WA 2L1AA 2MJEA 5KTQA 2LHDA 1ZQUA 2G5HB 3ECIA 4NJ6A 5E6NA 2W43A 2AAQA 1LPFA 4RQ4A 3T3NA 2WNMA 2D3GA 4EZ6A 2YVJA 2WXMA 2WYQA 5J2DA 1F44A 8ICQA 1KH0A 2KX3A 3ZDCA 3IG3A 4KIKA 5HMRA 4BDPA 1MO9A 3DGBA 2KKCA 3ZRCA 5DPWA 3UINB 1QLTA 2W82A 2PU0A 1A77A 3C5GA 4GXIA 2V3SA 4OJLA 2ZG6A 3K1ZA 3NZUA 3VH4B 2PFOA 2BC1A 4EEWA 2QEJC 3MGHA 2F1HA 2K5PA 3A7UA 3AEAB 2FI1A 3TCAA 3N3KB 2KWDA 3OZMA 3V05A 3QUCA 2M0AA 3ES7A 9ICUA 1QZEA 3SD5A 4GYPA 2DKZA 1ZXIC 1UNSA 1AROP 3O0FA 3TKAA 3RFZB 3R3MA 2WPCA 3R25A 1WJ4A 3LXDA 3LVWA 5BYSA 4UB5A 2GRTA 1TS5A 1QILA 3URYA 2NVKX 4I27A 2D5GA 5AKHA 3BVMA 4K2SA 3B0AA 1YN5A 3TWBA 3G6XA 3HILA 4HVBA 4QW8A 3U52E 1KKOA 2OQYA 3GY1A 2LYBA 2DF4B 2YB4A 4DX3A 2JUOA 3RYTA 3M62B 3Q69A 3IG5A 2G08A 4GXKA 4TVYA 3ML9A 5AE3A 2KZRA 2RRDA 4AJWA 2DZMA 3MDCA 3UXKA 1FXAA 1L7YA 1WUFA 2PP0A 2EXRA 3ZI4A 2MEKA 4IM2A 4ZRPA 2LHEA 3RULA 3QN3A 1J7BA 3RJJA 2V9HA 5ALXA 3DWGC 2BYVE 5K4LA 2P0IA 1JMLA 4B0MA 2WXJA 4I2EA 5E6PA 3SD7A 1SJED 3BY4B 4NPNA 4I2CA 2EZYA 2ODGA 3AE5B 3EFCA 1N60A 4BFRA 2N1VA 5KG3A 4DF8A 3RNGC 3PR5B 3QU4A 1L0YB 4EENA 2KTFA 4A90A 2D10A 3IRUA 1GETA 2BKRB 3FJ4A 3HW2A 3MR3A 3GIMA 3TBLD 2LHTA 4ED0A 3WA0A 4WWMA 1COOA 8ICJA 1BPZA 4M47A 4KGTA 2GOWA 3I1YA 1O03A 3ZDAA 2XNAC 3TJIA 2P35A 4HAIA 1S0NA 5D49A 1L0VB 1R4NI 2DHZA 2JV3A 1WCLA 1YIWA 3UGVA 2BPGA 1TKDA 1UBQA 1WJ6A 4H19A 2ZC8A 3R2IA 1WZ3A 1XQQA 1Q8KA 3RH5A 1ZOLA 1QSLA 2NRXA 5E6OA 1EWYC 3T8QA 3AH7A 1D9DA 5IIKA 2E8NA 4NWIA 3AXCA 4FO6A 3UJEA 2ZUDA 1WUDA 3IBEA 4MGIE 5J0UA 4EX6A 1NBFC 1EBHA 3THUA 2XVTA 4ECRA 3HUIA 3K9PB 3TJ4A 3JVAA 1F9CA 3F2BA 4C7ZA 2PGWA 2I6XA 4NV0A 5AKKA 4RQ3A 9ICBA 1FEAA 5HHIA 5J2JA 5JTIA 4IZGA 3RR1A 4IL0A 2BZFA 1QLNA 4ZA0A 3MC0B 4PT5A 3CGCA 2FLNA 2ASQA 2XY6A 2R2OA 5U25A 4GLXA 1FM0D 4US9A 5D7GA 3CNHA 2LM1A 2BCPA 2JY6A 4JB3A 1DZNA 4MH0E 3B2FA 2BC0A 4DNSA 1Z1BA 5J2CA 2MH7A 3KHRA 1GUAB 3NJTA 5BYRA 1FFUC 3F2DA 4N9F4 4IC7B 3ZUNA 1SIJA 4YD2A 1KCZA 2E8OA 2ISPA 4C8KA 2PU1A 1RYSA 2HOIA 1S76D 4DK5A 8ICHA 2LMCA 3GE3C 2R8JA 1C1YB 2RMMA 3GZNI 4J9OA 2QLTA 2HI0A 9ICFA 2PFNA 1P9DU 2MP2A 2PE6B 3GQCA 2FPLA 1NK5A 3FYHA 2LGDA 5CTRC 1YJ1A 5KFZA 3PV1A 4IP5A 1L7MA 1TE2A 3IP4B 4I2AA 3A9JA 4YWSA 2BB5A 5JRBA 9ICKA 2ZJDA 1SXEA 2W8LA 1UGJA 2CR5A 3PW5A 2R61A 3GS2A 4NLBA 3TAPA 1TK5A 4I2HA 4EMJA 3VR8B 4FZMA 4DOAA 2PJHA 2LD9A 1N62C 3V6HA 3RR7A 1B22A 1MG8A 4KKJA 1H2IA 1JRPA 1V1OA 4A3PA 4A3RA 2GLSA 7ICNA 5KFDA 4BCAA 2PCEA 1R4MB 1YQ3B 2PA6A 2YEPB 4ZOHB 4KLJA 3TOYA 5ALMA 4RPYA 3KFUF 1F8WA 4QZBA 8ICVA 3ZIMA 2HVIA 1GRHA 4LVSA 3UCCA 4C8NA 2XGPA 3RB0A 1YZ7A 4EQRA 4AP9A 2DL0A 3IG8A 4H2HA 3POPA 3TFRA 9ICHA 2W55A 4PGYA 5CA7A 2ZXIA 2W8KA 2FYMA 1WWUA 2WOVA 1N2XA 4ECSA 4P1BC 9ICRA 1SB3C 2EH9A 3WCQA 3UM9A 5J2GA 3ZDBA 1SZHA 1XLNA 4GMEA 2J0JA 2WQYB 2BWES 4RGMA 3WK6A 2XC9A 1LKYA 1W1KA 1EU3A 3UJFA 3BVZA 5CJ7A 2QHOA 2OVLA 1ZQIA 4TV3A 6ENLA 3I28A 1WF9A 2JXXA 3TX1A 2OZ8A 1WWTA 2NPTB 3QE9Y 4M0AA 2HJ1A 3IAS1 2Z7JA 1WZ0A 4L2YA 2A1AA 3V3WA 2ZZBA 7ICGA 3QJZA 2DWQA 4KGSA 3TL5A 5AUIA 1I4QA 2W9CB 1CMXB 5BOLA 2P4PA 1ZQVA 1TK8A 4DQOC 3QUBA 3TQPA 3E2EA 3AQEA 1X40A 3VA8A 4DWFA 2A8XA 2M0XA 3DCGA 5FP0A 5AI0A 2MBHA 3JPOA 2AQ4A 5L1IA 1XSNA 5IO9A 3W1SC 1HUOA 1VAOA 4PVHA 3GIJA 4DOBA 5FR3A 2OX4A 2KWCA 3WAPA 1PGXA 1ENFA 2WDRB 4FXCA 1D4BA 3PW7A 1NDDA 4FHJA 1WM3A 5D3IB 2A1JA 3H4BA 4X2PA 4F2SA 1S1QB 3MBYA 2HHQA 1ZMDA 2RSUA 1JCTA 3IT4B 4XZ4A 2E8MA 1NJZA 1RPLA 5AI6A 4MM3A 5DBBA 2V4RA 5J17A 4CF5A 1QSYA 4KSKC 4OALA 3B0YA 1I4HA 4X57B 8ICIA 2W7OA 4RUAA 2V4QA 3MY9A 5U1OA 3MC1A 5EOZA 2KJ6A 3RBDA 2GGIA 4RNMA 4IG7B 2Y9UA 1QT9A 1WXMA 3EHVA 5DPTA 3CB3A 3DK4A 2WOIA 2YVCA 4MKSA 4DNAA 5J0RA 2KJ5A 1TAQA 4M9GA 4IHCA 1WXQA 2OHFA 3LDAA 2N1WA 3KLSX 3CK5A 3VCNA 2GR1A 5ALEA 4N59A 4XC2A 2Y08A 2WFAA 2FPMA 2QIEB 4H4TA 1TY0A 2WAQC 2G0AA 4UAYA 4Y2VA 3LK9A 2JX5A 3KYCD 3OAWA 1S3SG 3P2BA 2RPVA 1GV4A 1ZQEA 4KLDA 5AZFA 2C2DA 2BHNA 4M6WB 3TQ1A 3CW2C 2Y3SA 3QEBZ 1DYQA 4DL2A 3FKYA 1YZ6A 2H5XA 4KVGB 2LI5A 3H9DA 3QUTA 1B4FA 4I28A 1SEBD 1T94A 4WWOA 2JYTA 2QDDA 1FD6A 5KFMA 3WU2U 5KFEA 3MR6A 4I2IA 2D8CA 3HVDA 4WJNA 3H4DA 1FHUA 4YL8A 1TKYA 4PS3A 2C28A 2HBKA 5TZVA 3OJ3A 2F44A 3QYPA 5JU5A 3EAOA 1JW9D 2NRWA 2IO3B 4DS5A 4E3CA 4OD0A 5J29A 1CEZA 1S9FA 2JWUA 2GBNA 3T8MA 5KFFA 3A7RA 4KSLC 1QLBB 4YR0A 2VIXA 3Q8QB 7ICTA 3EC8A 1QOAA 1WY8A 4J03A 2WU2B 1XANA 2KLCA 2HQMA 3Q8CA 5TR3A 4W9JA 5KFSA 1SXDA 3Q8PB 3CGBA 2FIFA 4L23A 4LIIA 3W2DA 1MOKA 3GDXA 3EPGA 8ICKA 2JZPA 2W3SA 3K9OB 2GGEA 3BINA 3DJGX 5DB9A 2XK5A 2BBCA 3N28A 2NV3A 3AEDB 1WR1A 3B97A 2KC2A 2JVCA 1X42A 3H8HA 4PH5A 2D2QA 4W9KA 5JRTA 9ICCA 3NXLA 3AULA 3ONSA 3C2LA 2A3VA 1HEKA 3VCCA 3OLMD 3DBSA 5KAIU 4Y2SA 3D2NA 1Q1WA 4KGRA 3SAHA 4AP4C 2X38A 1T6BX 3DBLB 3R66C 4E0DA 3RGTA 3OG5A 3RNCC 3RPFC 1L0XB 5G2NA 4NJ7A 3DBHB 5D4BA 5DG7A 2AGPA 1B1ZA 2M17A 2CDUA 3A1QA 4ANWA 1WM2A 2IOFA 1E8WA 1XU4A 1R4MI 1OGWA 4N6EB 2Y1IA 3RB4A 2LVOA 3T5JA 3R9KA 2H3FA 1WR6E 2QKQA 1TZOA 4MEYA 1W1OA 2YVGA 4A55A 1Q46A 4ZOHC 3RB3A 2MP2B 4DBGA 5FJTA 2KIVA 3PVXA 4H4QA 3QZ7A 2H3ZA 2J6UA 2O2VB 3T3OA 3NO1A 2W54A 3SJNA 4NJ8A 5KT3A 3JPRA 1RFAA 3EUB2 1UA1A 4PVJA 2F3NA 1LFDA 4DQQA 2W7PA 4HG0A 3RNAC 3B08A 2K9XA 1TZ1A 4F50A 7ICLA 2DZJA 2HBLA 4PHEA 1T5XD 3MFHA 3KLJA 4YXJA 1DTNA 5DQGA 1ZDLA 1GJZA 4DFDA 4PYZA 1KEJA 3SFEB 3H7PB 1ZGUB 3R0UA 2KFNA 3KUCB 5AKYA 2Y3AA 2HBJA 4CQNA 4RMAA 2BYTA 2KK8A 2PPHA 2E8PA 4GGHA 2W9NA 4Z6FA 2KP7A 4RQ6A 2JEGA 1C4CA 2GL5A 4LJPB 2P88A 4F4ZA 3EA6A 5KG7A 2DQNB 3O0HA 2WDWA 2RD0A 5BOFA 2BS4B 1V97A 2PTWA 3PRMB 1SE9A 1UHUA 2L76A 5AK4A 1N56A 3AM9A 4ED6A 4IWOA 4F92B 3R2TA 3UMCA 1ZR6A 1AWDA 1CI4A 4RFBA 5FJPA 4FLHA 4WH4A 1TS2A 4UAZA 1ZXIA 5CB1A 4KLLA 4FDCB 3V7JA 1BUIC 2MQJA 3PHXB 2FKPA 3VXWA 2PLSA 2KSOB 1KLVA 3WK9A 5EWFA 2XY7A 3ALBA 1KL9A 5B66U 1NJXA 1SL0A 1J7AA 1V49A 3TAQA 2ZIVA 3TSJA 3KQ4A 1X9MA 1CRXA 4DHGA 2KKPA 2WF8A 4BOZB 5KFUA 4M2YA 1JMSA 5DDMA 4RPZA 1HZ6A 1PGBA 2FCSA 2UVWA 3NUHB 4LNIA 4WQMA 4D2KA 4GFIA 2V4LA 2KK0A 3T5KA 2OEDA 5ALZA 3JW0X 5EE1A 1ZD4A 4B9NA 1ZMCA 3MHSD 4LZDA 1PDXA 5B5EU 2DBYA 4YFKA 3RJEA 1YD8U 5HHZA 3K1GA 1XLQA 3J9CA 4ZYSA 5DPRA 4DHJD 1VZ6A 4RQNA 2XGQA 5IIOA 2N7DA 1FMAD 3HWTA 5FKAC 5FMHA 3I6TA 1NK9A 3P4RB 2F77X 1OXJA 3M6ZA 3S2AA 1TE6A 3BSMA 2IYDB 3TW9A 3DOWA 4ZYNA 2K25A 1ZRNA 2AJQA 1IM4A 1RXWA 2X99A 2DUYA 4B6WA 1RAXA 1RG6A 1XSPA 3VC6A 3GV7B 1HJPA 3R7RA 2LXCA 1OJTA 4EM4A 3B0XA 1FEHA 4QZ8A 2NCNA 3D2HA 3C1ZA 1EBGA 4KKIA 1SE2A 2HE7A 3ZDMC 5ALKA 1XO1A 4IWPA 1SJHD 1BT0A 3BZKA 3AE8B 2BVGA 1MQ3A 2PVOD 3AE1B 4Z1YA 1TKKA 1DIQA 3ZJUA 2R8KA 1EU4A 5KG5A 3Q3MC 4RQMA 5F9LA 2JMGA 4J9QA 2MJ3A 3ZYYX 1CQVA 1TKEA 4ZRKA 4PGQA 1NHPA 1SGHA 3QUQA 4HROA 1WMHB 3AV8A 3CF6E 1V9JA 2XO7A 2AKMA 4B95A 2KAJA 1WGDA 2PVGC 5KL8B 4BBNF 4GDLB 3H6NA 4J9RA 2N9PC 3MHZA 3GU3A 5KFWA 2P3ZA 1J2MA 4R8UA 4LZGA 2JU6X 2EANA 5DQIA 3VQIA 3OZYA 5ER0A 2FE9A 2KYWA 4G3XB 3PGEA 5EWEA 3V4BA 1XS2A 3PNCA 4NLZA 4C4RA 1FECA 3FM9A 2ZEQA 2LI6A 3Q3NC 4KDLB 1BPEA 4UAUA 1IYXA 2ZZ0A 4DO9A 2WXHA 1EF5A 4PYUA 2XGZA 4H4WA 4GFJA 4G3IA 4AYBF 1ZD5A 3ZXRA 2DPIA 2GBKA 3RJAA 1I4PA 5ALTA 4GGQA 4JPSA 3V6EB 4EZKA 3DDHA 1KN5A 1O08A 4KLFA 1XT9B 5FS9A 3EUB3 4EEYA 1S10A 3M6KA 2DGZA 2KFJA 3RJ8A 2KNBA 3A9KB 3KUZA 2PMZF 4YCXA 4EUTA 4JB1A 1HQRD 2WTFA 5J2AA 3RRHA 3M3JA 4MMWA 5J0OA 3PX4A 7ICRA 1I35A 4J57A 1RQLA 2CHZA 5IA7A 4H4ZA 3PS6A 3I4KA 1L7OA 3NFUA 4M0WA 1NENB 2GBJA 1MDRA 2X8GA 3DGHA 3KBBA 4KPRA 1WRIA 1KLNA 4P6VF 4ACFA 3D32A 3UJSA 8ICPA 5J2KA 3LLBA 2QMTA 4EQWA 4Z6EA 4MGGA 3N4MB 2W9BA 1B43A 2YQEA 5J0TA 1BZLA 3QNMA 3RJGA 3ZLGA 1QQRA 2DPJA 1SL2A 1P7EA 4EBEA 3IHQB 4WJOA 1RM6B 3DG7A 3RN9C 2WB1F 4DEZA 4QZEA 4KLTA 3TJPA 2H88B 3I9V1 4UAVA 2GRIA 3DVNU 4HEA1 3VTWA 3W8WA 2JGAA 1S8OA 2LMRA 2WBAA 3HT3A 1SV0A 1GG3A 3NOBA 4NQKE 3ENEA 2NQWA 1SF0A 1Q1OA 4AQ7A 3WK7A 2DYMA 2WXNA 1X2GA 1EM7A 7ICSA 4ZDVA 3PFRA 3QLDA 3BS5B 4XA5A 2KT7A 3L8KA 1LQBA 8ICYA 4HDOA 3V72A 3Q8RB 2AHOB 2M9NA 1L6NA 1GRBA 2L32A 4NL9C 4NM1A 4RF0A 2KDMA 4P0QB 3ES8A 3RH6A 5KFXA 3C0PA 1IUEA 2DYBA 3QAQA 2WS3B 2P6UA 2W9CA 2A5UA 2WX0A 1C7YA 1YX6B 4HNCA 1QQ7A 1J0GA 2HOQA 3BW7A 3SZ2A 2QVHA 1PZNA 2QSDA 3SDLC 1FFVC 1ZQYA 2QC8A 3SV3A 4JE3B 3H7PA 1KFYB 4E6MA 4PWCA 3V60A 3MGIA 8ICAA 2JZ3B 4M02A 8ICNA 3L0WB 1ACCA 4XQ8A 1GC6A 2GR0A
chains in the Genus database with same CATH topology
1TS3A 3NRZB 1TS4A 1GOZA 4PYTA 1YMHE 2V3NA 2B76B 2BS2B 3P42A 1OQRA 3HUIA 2IJ0A 1WGKA 4A9AA 3S1DA 1VZ8A 3KWLA 4C56C 1NVID 1F0ZA 3PQBA 4C7ZA 1KLUD 4DXFA 4ML8A 1QKZA 4OHJA 2I2YA 1TY2A 4OZAA 1MBTA 4IOIE 1W1JA 2V0GA 3EGRA 1I4GA 3MC0B 4PT5A 4PZFA 1VR9A 2WDVB 1V1PB 3KWVA 1A70A 2WU5B 1FM0D 4US9A 5D7GA 3DEDA 4RGTA 1DGJA 1DZNA 3B2FA 1QF6A 2P13A 4J3OD 4DNSA 4XWWA 2Y5PA 2MH7A 4YTNB 3W8ZA 4RCOA 1L4DB 5BYRA 4MH8A 1FFUC 3FW8A 1SIJA 4YSZB 3IXSA 4OZCA 4JWUC 1ZE3D 1YNTE 2LMCA 2OAIA 1K52A 3B2GA 2NTTA 1FIQB 2RMMA 3AE9B 1L4ZB 4JAYA 3I99A 4MLAA 5I4DA 4YSYB 2H89B 3KJMA 4PWBA 5G5GA 4LK0M 4HJGE 3NVWB 4XE0A 2AXRA 2BB5A 4HKQA 1UGJA 3GS2A 2BVHA 2R61A 3FILB 1HZ5A 3VR8B 1N62C 5HG2A 4KKJA 3BVGA 4RF1A 1JRPA 1UUPA 1V1OA 3L4PA 4BC7A 1GPXA 3W1SA 4BCAA 1AYFA 1AN8A 1YQ3B 2YEPB 4ZOHB 1MVKA 2JYEA 2LEKA 2VFSA 1W1SA 1ROEA 4YTMB 3MJ5A 1SE4A 3POPA 5EE0A 4WURA 2W55A 1DIIA 4ZHOA 2IGGA 3S1FA 1AHZA 4Q2JA 1FRRA 4REZA 1FCLA 1HXYD 2WLBA 1JWBD 5BYQA 1SB3C 5C2TB 3WCQA 4XWTA 1XLNA 2AQ2B 3UI3A 4A8XC 1IBXB 2WQYB 3NVZA 4RGMA 2Y5CA 1I19A 1W1KA 1EU3A 1Y56A 2IGHA 3BVZA 2Z8LA 1PUTA 2G9HD 1J7CA 3TX1A 3NS1B 4JWSC 1WWTA 5AE2A 1W1LA 3IAS1 3MP9A 4KX6B 4L2YA 2LUMA 3ZQ4A 1NI3A 3TUOA 2DWQA 1ZUD2 4ZHPA 4KGSA 5AUIA 1E9MA 1I4QA 4XDDA 2P4PA 1N5WA 2Q4WA 4BC9A 4DQOC 2QJLA 4RNAA 1STEA 3P4QB 1DOYA 5FK9C 5BMHA 1DOXA 3TEYA 1SSNA 5MPOA 3B9JA 1E7PB 4EC3A 1ZDVA 1PGAA 1VAOA 4PVHA 1VJKA 3PO0A 3ZJTA 2QILA 5FR3A 4UD8A 1PGXA 1ENFA 2WDRB 4HKZE 1KLGD 4FXCA 1XLOA 1D4BA 1D5ZC 3FW7A 2O3GA 5D3IB 2N9KA 3PM9A 5HQXA 2BW2A 3AEFB 3TSHA 1HSKA 3IT4B 1IGDA 3R8BA 3NVVB 5FXFA 5K8EA 2IPKD 4NAMA 1N60C 4C80A 1JWSD 5FXDA 4US8A 1E8GA 4OALA 1I4RA 1I4HA 5AWVA 1V1PA 3AMZA 1ZXHA 2R2ZA 2J52A 3CIRB 1XXGA 3GB1A 2ACZB 5JXVA 1JALA 4TVWA 1QOFA 2JQRB 2WXPA 3N9YC 4B0EA 1QT9A 3U2SC 3HRDC 2ZW0A 4ARIA 1JWAD 3FW9A 1WXQA 2OHFA 2WP9B 3KLSX 2FE8A 1M4VA 1ZDXA 4N59A 4TSSA 1C9FA 3VRAB 3NVYB 2Y08A 1F2RI 2QIEB 2WXLA 2WXRA 4P16A 1TY0A 1V8CA 2JX5A 4LTUA 1MHHE 2RPVA 2PIAA 2INNE 1MI0A 1UXYA 2GB1A 1IBXA 1DYQA 2Y3SA 3PZ7A 3S1CA 1WVEA 1QOGA 4XLOA 2J53A 1NEKB 1SEBD 2IDYA 2IGDA 2VFRA 2JYTA 2W3RA 1FD6A 1KTKA 3S1EA 1SBBB 3BK2A 3AEGB 4LLGM 1FFUA 1CJEA 3HVDA 2ON8A 3AEBB 3Q8EA 3OWEB 5G5HA 3P63A 2PMVA 1L6UA 1TKYA 5EE9A 2EKIA 1JW9D 1XF5L 3AE6B 3NZ3A 3A7RA 2JWUA 3ABVB 2RDGA 1BMLC 2PLPA 1QLBB 1OFFA 1MBBA 3JS8A 3NRZA 4RGNA 1QOAA 2WU2B 3C8YA 3Q8CA 1XCQL 3AB5A 3ZJVA 4L23A 3IT6B 3P1MA 3W2DA 2PW9A 2JZPA 1E0YA 2W3SA 2NMQA 1L5PA 1YQ4B 5TSSA 3BIID 4ITKA 2BBCA 1GB4A 2NTSA 2VAOA 3SR6B 2CU3A 2LGIA 2E5AA 3AEDB 3U4EG 1ZP0B 3H8HA 2PKOA 3P4PB 1SB3B 1E6EB 5BMGA 2J4XA 1Q10A 3VTEA 2FUG1 2AQ1B 1SE3A 4KGRA 2WXKA 3BK1A 2X38A 1T6BX 1K51A 3AE4B 4RGOS 3D2JA 2L83A 1K53A 3RPFC 1L0XB 5L6FA 1AW7A 2ZW1A 3D2DA 2TSSA 2I38A 1B1ZA 2AX5A 2DLBA 3GSYA 1KRHA 2EELA 1PYWD 1YN3A 1FNWA 4N6EB 1WYGA 1C76A 1FNUA 2JSVX 2E3TA 3W5VB 3AE7B 1NYRA 1TZOA 1TKGA 1W1OA 3ETRB 4A55A 4ZOHC 3BYYB 4XDCA 4UDUC 1F0XA 3FWAA 4MACA 1C4PA 5FXPA 2LFIA 3T3OA 1QOBA 2W54A 4IDIA 5G5GB 3EUB2 2WXOA 4TQ1A 2BB6A 4PVJA 2YVSA 1P7FA 3P4SB 5L6GA 2R8DA 2CJNA 4R3DA 4HG0A 5I1WA 2K9XA 2Y3RA 1RM6C 3LB8C 5D3DA 1T5XD 1N5XA 3GP7A 4OW0A 5HFYA 5LNK1 1FFVA 5BMIA 3BZDB 3MFGA 4TMAB 5AUKA 2XN9C 3NVVA 2FBWB 3SFEB 2BTEA 3LAEA 2Y3AA 4TQ0A 3VRBB 4CQNA 1JQ4A 2BYTA 2Y4GA 2ONQA 3I57A 3SFDB 3E9SA 3V3XA 3AE2B 1C4CA 2MBRA 2YEPF 3EA6A 2J42A 5HHDG 2WDWA 5C3JB 3NVWA 2BS4B 1V97A 1JROA 1ZPSA 2M56B 2RDHA 2PLIA 4OZBA 3AM9A 3R2TA 4HRSA 2WXFA 1AWDA 1FIQA 1ZR6A 2I0KA 4RFBA 1XO3A 4AS1A 4WH4A 1TS2A 1I4XA 1ZXIA 1E8HA 1WVFA 4ARCA 1BUIC 5FXEA 2WDQB 1XEEA 1YJIA 2PLSA 1MPEA 2SEBD 4DXGA 3DQ0A 4H2AA 1UWMA 3SR6A 1J7AA 1MHXA 2GQTA 3TSJA 3LXFA 3KQ4A 1ESFA 1HZ6A 1ZOYB 3NUHB 1PGBA 4WQMA 4D2KA 4PVKA 2UUUA 2MJDA 1FNVA 2UUVA 4JX1C 1W1RA 1R7SA 2OEDA 3W9CB 2JXTA 1X2HA 5GXGB 5EE1A 5H8YE 4GLSC 2G1EA 4O1NA 3Q8AA 1E0ZA 2NQWA 3ZGZA 1PDXA 5HHZA 2DBYA 4O95A 1VLBA 1XLQA 3J9CA 2V3PA 4ZYSA 5EE3A 5G5HB 1W1QA 1SXTA 3AN1A 1C78A 1VZ6A 1VQZA 2WXQA 4NAWB 1W1MA 1FMAD 3W8XA 1D5MC 3Q8FA 5FKAC 5D79A 2K3UA 3FC4A 3Q8BA 3B9JB 3P4RB 5T8IA 3TSSA 3ETRA 3PZ8A 3DWMA 2HDEA 2ICIA 1C77A 1B9RA 4YWGG 4YTPB 1E8FA 2KQ4X 3TEXA 4NZLB 3SEBA 2Q85A 1VRAB 1VDVA 3NVZB 1FEHA 3D2HA 2VZKB 4KKIA 1FCCC 1SE2A 1JWUD 1IGCA 4USAA 1WSPA 1SJHD 1RYJA 3AE8B 1N63A 2L52A 2BVGA 3O13A 3AE1B 2PVOD 2KACA 2P3HA 1CK1A 1TJEA 3VR9B 2M19A 5E6JA 1DIQA 2K0PA 1HEZE 3ZJUA 1N63C 2VFUA 1EU4A 2HTME 2N9LA 2IPIA 1QLUA 2MJ3A 1FXIA 1CQVA 1OQQA 1TKEA 3BYTB 3ZYYX 2AQ3B 4WIPA 1EWCA 4HROA 5I1VA 3A7AA 3AV8A 4YSXB 4MT5A 2N7JA 4EE2A 2RK5A 3FAHA 1DOIA 2KAJA 2PVGC 4GDLB 2BVFA 1HA5A 3MHZA 4L1BA 2QPMA 2DYOA 3W5UB 2PTLA 4MM3B 2JU6X 3VQIA 3TEZA 1D6EC 4NJCA 4GDKB 5AE1A 2L1AA 2MJEA 2LHDA 2VFTA 2KMMA 1C79A 2INPE 1I7HA 1N61C 3U7ZA 3T3NA 2WNMA 2WXHA 2SAKA 4BBYA 2WXMA 3IAM1 1YN4A 1L6VA 4N58A 1KH0A 3RJAA 5HMRA 1F2RC 1I4PA 4JPSA 1EWYC 1ET6A 1QLTA 2W82A 2GI9A 3EUB3 3RJ8A 4PVEA 4JB1A 1HQRD 2QEJC 4C7YA 1JCKB 2K5PA 1GB1A 3A7UA 3AEAB 1C4AA 2LJIA 2KWDA 4A6QA 3V05A 2M0AA 4OVZA 1CZPA 3FILA 1ZXIC 4M0WA 1NENB 1UNSA 3RFZB 4ZRQA 1WRIA 5BYSA 4P6VF 3HRDD 3NVYA 1AHVA 1TS5A 1QILA 3URYA 4YT0B 4IKGA 2D5GA 3BVMA 2GQUA 3LLBA 2WXIA 2QMTA 1YN5A 1XCTL 2K22A 3U52E 1RFKA 4WAFA 5H92C 1N62A 1QQRA 3Q69A 1GAQB 1P7EA 4TVYA 5AE3A 1RM6B 1K50A 2N0SB 2VFVA 3AECB 1TYGB 1FXAA 1VZ7A 2H88B 3I9V1 2GRIA 1T3QC 4HEA1 2MEKA 4ZRPA 3AEEB 2EXRA 2LHEA 3W8WA 1J7BA 1N61A 5ADZA 1AHUA 3DWGC 3HVZA 1XLPA 1LO5D 5HI1A 1JMLA 1D5XC 1ET9A 4B0MA 2KN4A 2WXJA 3TEWA 1SJED 2Q5WD 3E56A 1SF0A 1X2GA 1KF6B 4YXDB 2DYMA 2WXNA 1N60A 3AE5B 4AQ7A 1EM7A 1RWSA 3CWIA 2BT6A 2WXGA 2QKNA 1F77A 3LYYA 3NS1A 1L0YB 4A90A 2CJOA 2L32A 1YJJA 3BWUD 4RF0A 2KDMA 2BS3B 4WWMA 3C0PA 1BXTA 1T3QA 1IUEA 1NYQA 4KGTA 3HSUA 2WS3B 2E6XA 1UWXA 3R07C 2V4IB 1E10A 2XNAC 4RH6A 3AE3B 3BW7A 1FRDA 1L0VB 2QSDA 1FFVC 1PFDA 4JE3B 1KFYB 3R2IA 4PWCA 1FO4A 1JWMD 1ACCA 3AH7A 1N5WC 2VZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRZ B;  4PYT A;  2B76 B;  2BS2 B;  1OQR A;  3HUI A;  4A9A A;  1WGK A;  3S1D A;  3KWL A;  1NVI D;  1F0Z A;  4C7Z A;  4ML8 A;  1MBT A;  1W1J A;  4PZF A;  2WDV B;  1A70 A;  2WU5 B;  1FM0 D;  4US9 A;  3DED A;  1DGJ A;  1DZN A;  3B2F A;  1QF6 A;  2P13 A;  4DNS A;  2MH7 A;  4YTN B;  3W8Z A;  1FFU C;  3FW8 A;  1SIJ A;  4YSZ B;  4JWU C;  2OAI A;  3B2G A;  1FIQ B;  4JAY A;  3AE9 B;  3I99 A;  4MLA A;  4YSY B;  2H89 B;  3KJM A;  4PWB A;  5G5G A;  3NVW B;  2AXR A;  2BVH A;  3VR8 B;  1N62 C;  1JRP A;  4BC7 A;  3L4P A;  1GPX A;  4BCA A;  1AYF A;  1YQ3 B;  4ZOH B;  2LEK A;  2VFS A;  1W1S A;  1ROE A;  4YTM B;  5EE0 A;  2W55 A;  4ZHO A;  3S1F A;  1AHZ A;  1FRR A;  2WLB A;  1JWB D;  1SB3 C;  5C2T B;  3WCQ A;  1XLN A;  2WQY B;  3NVZ A;  2Y5C A;  1I19 A;  1W1K A;  1PUT A;  1J7C A;  3TX1 A;  3NS1 B;  4JWS C;  1WWT A;  5AE2 A;  1W1L A;  4KX6 B;  1NI3 A;  2DWQ A;  1ZUD 2;  4ZHP A;  1E9M A;  2P4P A;  1N5W A;  2Q4W A;  4BC9 A;  2QJL A;  1DOY A;  3P4Q B;  1DOX A;  5MPO A;  3B9J A;  1E7P B;  4EC3 A;  1VAO A;  4PVH A;  1VJK A;  3PO0 A;  4UD8 A;  3FW7 A;  2WDR B;  4FXC A;  1XLO A;  2O3G A;  3PM9 A;  5HQX A;  3AEF B;  3TSH A;  1HSK A;  3NVV B;  5FXF A;  1N60 C;  4C80 A;  5FXD A;  4US8 A;  1E8G A;  4OAL A;  3AMZ A;  2R2Z A;  3CIR B;  2ACZ B;  1JAL A;  4TVW A;  1QOF A;  2JQR B;  1QT9 A;  3HRD C;  3FW9 A;  1JWA D;  1WXQ A;  2OHF A;  2WP9 B;  4N59 A;  3NVY B;  3VRA B;  2QIE B;  1V8C A;  2JX5 A;  4LTU A;  2PIA A;  1UXY A;  3S1C A;  1WVE A;  1QOG A;  4XLO A;  1NEK B;  2VFR A;  2W3R A;  3S1E A;  3AEG B;  1FFU A;  1CJE A;  3AEB B;  5G5H A;  3P63 A;  1L6U A;  1TKY A;  5EE9 A;  2EKI A;  1JW9 D;  3AE6 B;  3A7R A;  3ABV B;  1QLB B;  1OFF A;  1MBB A;  3JS8 A;  3NRZ A;  1QOA A;  2WU2 B;  3AB5 A;  3P1M A;  1E0Y A;  2W3S A;  1L5P A;  1YQ4 B;  3BII D;  4ITK A;  2VAO A;  3SR6 B;  2CU3 A;  2E5A A;  3AED B;  1ZP0 B;  2PKO A;  3P4P B;  1SB3 B;  1E6E B;  3VTE A;  3AE4 B;  3D2J A;  2L83 A;  3RPF C;  3D2D A;  2AX5 A;  3GSY A;  1KRH A;  4N6E B;  1WYG A;  2E3T A;  3W5V B;  3AE7 B;  1NYR A;  1TKG A;  1W1O A;  3ETR B;  4ZOH C;  3FWA A;  1F0X A;  5FXP A;  1QOB A;  2W54 A;  4IDI A;  5G5G B;  3EUB 2;  4PVJ A;  2YVS A;  3P4S B;  2R8D A;  2CJN A;  4HG0 A;  2K9X A;  1RM6 C;  3LB8 C;  1N5X A;  1FFV A;  5AUK A;  3NVV A;  2FBW B;  3SFE B;  3LAE A;  3VRB B;  1JQ4 A;  3SFD B;  3AE2 B;  2MBR A;  5C3J B;  3NVW A;  2BS4 B;  1V97 A;  1JRO A;  2M56 B;  2PLI A;  3AM9 A;  4HRS A;  1ZR6 A;  1AWD A;  1FIQ A;  2I0K A;  1XO3 A;  1ZXI A;  1E8H A;  1WVF A;  5FXE A;  2WDQ B;  1YJI A;  2PLS A;  3DQ0 A;  1UWM A;  3SR6 A;  1J7A A;  2GQT A;  3TSJ A;  3LXF A;  1ZOY B;  4WQM A;  4PVK A;  2MJD A;  4JX1 C;  1W1R A;  1R7S A;  1X2H A;  3W9C B;  5GXG B;  5EE1 A;  5H8Y E;  2G1E A;  1E0Z A;  5HHZ A;  1PDX A;  2DBY A;  4O95 A;  1VLB A;  1XLQ A;  5EE3 A;  5G5H B;  1W1Q A;  1VQZ A;  3AN1 A;  1W1M A;  1FMA D;  3W8X A;  5D79 A;  3FC4 A;  3B9J B;  3P4R B;  3ETR A;  3DWM A;  1B9R A;  4YTP B;  1E8F A;  2Q85 A;  1VDV A;  3NVZ B;  3D2H A;  4USA A;  1RYJ A;  3AE8 B;  1N63 A;  2L52 A;  2BVG A;  2P3H A;  3AE1 B;  2PVO D;  3VR9 B;  1TJE A;  2M19 A;  1DIQ A;  1N63 C;  2VFU A;  2HTM E;  1QLU A;  2MJ3 A;  3ZYY X;  1OQQ A;  1TKE A;  1FXI A;  4HRO A;  3A7A A;  3AV8 A;  4YSX B;  2RK5 A;  3FAH A;  1DOI A;  2KAJ A;  2PVG C;  2BVF A;  2QPM A;  3W5U B;  5AE1 A;  2MJE A;  2VFT A;  2KMM A;  1I7H A;  1N61 C;  4BBY A;  4N58 A;  1L6V A;  5HMR A;  1QLT A;  3AH7 A;  3EUB 3;  4PVE A;  4JB1 A;  4C7Y A;  2K5P A;  3A7U A;  3AEA B;  1CZP A;  1ZXI C;  1NEN B;  1WRI A;  1AHV A;  4P6V F;  3HRD D;  3NVY A;  4YT0 B;  3LLB A;  2GQU A;  2K22 A;  1RFK A;  5H92 C;  1N62 A;  1GAQ B;  4TVY A;  5AE3 A;  1RM6 B;  2N0S B;  2VFV A;  3AEC B;  1TYG B;  1FXA A;  2H88 B;  1T3Q C;  2EXR A;  3W8W A;  3AEE B;  1J7B A;  1N61 A;  5ADZ A;  1AHU A;  3DWG C;  3HVZ A;  1XLP A;  2Q5W D;  2NQW A;  1SF0 A;  1X2G A;  1KF6 B;  4YXD B;  3AE5 B;  1N60 A;  1RWS A;  3CWI A;  2BT6 A;  2QKN A;  3NS1 A;  2CJO A;  1YJJ A;  2BS3 B;  4WWM A;  3C0P A;  1T3Q A;  1IUE A;  1NYQ A;  2WS3 B;  3R07 C;  1E10 A;  3AE3 B;  3BW7 A;  1FRD A;  1L0V B;  1FFV C;  1PFD A;  1KFY B;  4PWC A;  1FO4 A;  1EWY C;  5AUI A;  1DII A;  1N5W C; 
#chains in the Genus database with same CATH topology
 3DVN V;  1TS3 A;  1GOZ A;  3ZVH B;  2KO3 A;  3IN5 A;  7ICE A;  2OH2 A;  2OO6 A;  4B9M A;  3CST A;  2RP5 A;  1OQR A;  2OXO A;  1ZQR A;  4A9A A;  5CHG A;  3S1D A;  4C56 C;  3VFC A;  5KFN A;  3PQB A;  2NO4 A;  1KLU D;  4DXF A;  3GIK A;  3EEZ A;  4ECQ A;  1FEB A;  2CHR A;  4YMN A;  4K3C A;  3PLU A;  2QAR A;  5BOM A;  1QTM A;  4OZA A;  1KN0 A;  4HXD A;  4OVV A;  3QU5 A;  1W1J A;  1PVP A;  1NKB A;  3DBR B;  1I4G A;  4QZD A;  4GR1 A;  4HPP A;  3A0B U;  2VH2 A;  1ZRM A;  1EC9 A;  1A70 A;  2QJJ A;  1SWV A;  2AU0 A;  4HJK A;  2K60 A;  4RGT A;  4DQS A;  1DGJ A;  4QZI A;  9ICI A;  5ALY A;  1QF6 A;  2P13 A;  2OM6 A;  4WJQ A;  4XWW A;  3R1Z A;  4Z6D A;  1NK4 A;  2KJ8 A;  1K1Q A;  4G8T A;  2JH7 A;  4UAW A;  2ES6 A;  4P0P B;  5J2R A;  2AQ0 A;  2X8H A;  1V81 A;  7ICF A;  4BKS A;  4YSZ B;  9ICX A;  5FR6 A;  2OPJ A;  4R66 A;  1JOA A;  1NPX A;  2PE9 A;  1K52 A;  1ZD2 P;  4IR1 A;  3N97 B;  3B2G A;  1YQB A;  4H4U A;  1PVQ A;  1L4Z B;  3PO4 A;  5IAA C;  4JQW C;  1PVR A;  3BZC A;  1A0P A;  1F52 A;  3NS8 A;  3A9K A;  1VJ5 A;  7ICK A;  2WF6 A;  4FBT A;  4LK0 M;  7ICM A;  1KKX A;  2XY5 A;  4LDT B;  2EZX A;  1NEL A;  4NQL B;  1WCN A;  4O3M A;  4FZN A;  4CRX A;  2RDX A;  5AKX A;  3FIL B;  3RZW C;  4B9V A;  2K6D B;  5HG2 A;  2E1F A;  4ED8 A;  2LUE A;  4MEX A;  4RF1 A;  3WAO A;  1GER A;  4BC7 A;  1GPX A;  3W1S A;  2X8C A;  4UW9 A;  3HJE A;  1AYF A;  1AN8 A;  1TVA A;  3MJW A;  4C4V B;  1MVK A;  5DGB A;  5HMM A;  2LEK A;  1UF0 A;  4K8D A;  4PHP A;  4FBJ B;  1W1S A;  4PZN A;  3RR8 A;  3TIX A;  5EE0 A;  4GGB A;  2GBR A;  2DAF A;  3UQ0 A;  4ZHO A;  2IGG A;  3GRS A;  1MSW D;  1WX9 A;  3S1F A;  1AHZ A;  1NK0 A;  1WMH A;  1S0M A;  4GXB A;  1UD7 A;  2RGF A;  1Q1R A;  3MC8 A;  3MZN A;  2PMQ A;  5BYQ A;  4BZA A;  1MC8 A;  4YVZ A;  2KIC A;  2IY1 B;  3UI3 A;  2GBM A;  4K7U A;  4ICA A;  4GDL A;  4TKN A;  1IBX B;  1KJT A;  2KIW A;  2WP6 A;  3JPN A;  4LA1 A;  4ASW C;  2I5Q A;  1FEZ A;  3LDZ E;  4JLC A;  1PUT A;  2G9H D;  2PGE A;  1J7C A;  1T0S C;  3VUW A;  5AE2 A;  2QAE A;  5J2F A;  4HCP B;  4KX6 B;  2OOB B;  1RXV A;  3M9O B;  3ZQ4 A;  4A20 A;  3EKG A;  1NI3 A;  2QCZ A;  2N1R A;  2KJH B;  2EMT A;  4DDI D;  1MN8 A;  4HN8 A;  2C7H A;  2CPR A;  1NZB A;  2FPK A;  1ZUD 2;  4M01 A;  4EZJ A;  1E9M A;  4XDD A;  2DW6 A;  5AHX A;  4J9L A;  2HTH A;  2N9E B;  4I2B A;  3C21 A;  2MBO A;  2NVU I;  5C1Z A;  1STE A;  1H38 A;  3UXN A;  1WXS A;  3P4Q B;  3HP6 A;  4M00 A;  1DOX A;  1RRB A;  1N6Z A;  1IYF A;  2H3V A;  1XC9 A;  1SSN A;  4C0Z A;  3L3F X;  3B9J A;  2IMW P;  1E7P B;  3APD A;  5AM5 A;  1PGA A;  5IKC M;  1NZP A;  3T9P A;  5HKH A;  2KN7 A;  1IXR A;  2POD A;  2A4Z A;  3ZJT A;  2QIL A;  2EAP A;  1GRE A;  4AYB C;  1S97 A;  5C23 A;  4A3O A;  4C00 A;  3VUX A;  4UD8 A;  2PS2 A;  3Q8K A;  4HKZ E;  1KLG D;  2BPC A;  4I6N B;  4KEM A;  5D94 A;  5DDY A;  3UGB B;  5KT2 A;  3L54 A;  1HSK A;  2ZAD A;  3R8B A;  3NVV B;  1W6T A;  3U9I A;  5HR6 A;  5JCI A;  4RUC A;  4NM2 A;  5F3X B;  3BQ2 A;  2IPK D;  4NAM A;  1JWS D;  2JRI B;  2HSZ A;  4K4H A;  4GDK A;  3AEV A;  1U4A A;  3BDP A;  5ALL A;  2W9B B;  3AMZ A;  3JPP A;  2BQR A;  4EQS A;  1ECW A;  2L5Y A;  1T0Y A;  1ZXH A;  3WAL A;  5EBK A;  1L8L A;  2LRW A;  3HIZ A;  4O3O A;  2ACZ B;  3JZU A;  3OC4 A;  1JAL A;  4MEM A;  4TVW A;  1QOF A;  2YLM A;  4FAD A;  2WXP A;  3N9Y C;  4QWB A;  3U2S C;  3GRT A;  1VD2 A;  2LAS A;  4ARI A;  3RRG A;  1EO6 A;  1U47 A;  1JWA D;  1LXD A;  4M0W B;  3WAM A;  4BKG A;  3Q6J A;  3BS7 A;  1R4N B;  4DXK A;  1M4V A;  4BVU C;  4C8M A;  3L16 A;  4KLU A;  4O0I A;  5GMV A;  2PTZ A;  4H4X A;  3T3F A;  4QNL A;  3H0R B;  1JUD A;  3TAC B;  3PG6 A;  2INN E;  1ZQX A;  4ECY A;  3JSV A;  3L5O A;  3QKE A;  2GB1 A;  1UT5 A;  3AL0 B;  5L1K A;  5KFT A;  2DZI A;  3HM6 X;  2K8H A;  2NBU A;  1XPY A;  1XNS A;  2L0F A;  1QOG A;  2ISO A;  4PK1 A;  2WOW A;  4R64 A;  2BQQ A;  4URK A;  2NPT A;  1SBB B;  4J56 A;  3ZLF A;  1CJE A;  4K4I A;  2E5S A;  2XCA A;  5GTH U;  5IIN A;  3AEB B;  4OVU A;  4HCN B;  1NK7 A;  1LVL A;  5EDS A;  4EFO A;  5DPS A;  4KWS A;  3BJS A;  1KW4 A;  4PGX A;  2PMZ C;  4DL5 A;  4ICU A;  4LNO A;  4F5Q A;  1JXL A;  4W9F A;  3RNB C;  3AE6 B;  2DZK A;  5J0S A;  4EYI B;  2RAB A;  2OJW A;  3N1Z C;  1BML C;  1JN3 A;  1MBB A;  1E8X A;  3ZVV A;  4JL9 A;  5ALV A;  4EZ9 A;  3ZVH A;  1XCQ L;  4LNK A;  3UF8 A;  4F7Z A;  5KFO A;  4QWA A;  4F1S A;  5BO4 B;  1DGS A;  3ZW3 A;  3E58 A;  2NMQ A;  1YQ4 B;  4TUR A;  3MC9 A;  3BII D;  4LDT D;  3Q4D A;  3GZN B;  4M9N A;  4F8C B;  3SR6 B;  5KG1 A;  5JUM A;  2JRZ A;  3MR2 A;  3C29 A;  2KHV A;  2BCV A;  2CU3 A;  5JHA A;  2R9Z A;  2L05 A;  4H50 A;  4MFA A;  4WWP A;  2EAO A;  3PW4 A;  2Q0Z X;  2KZ3 A;  2PKO A;  1SB3 B;  3UCD A;  3N7R C;  4ED3 A;  1NNL A;  3WKE A;  4LJO B;  5L9X A;  1Q10 A;  4UAS A;  4P0Q A;  2FUG 1;  4MFC A;  4BBN C;  4NAW A;  3OJS A;  1SE3 A;  2HXU A;  2EZZ A;  1K51 A;  3AE4 B;  4RGO S;  3D2J A;  1BPB A;  2KZZ A;  1V5T A;  1AW7 A;  2AL3 A;  2I38 A;  2N7E A;  4ICV A;  3GSY A;  5ENL A;  2NQL A;  4JDR A;  4Y2Y A;  3PRE A;  2VH1 A;  2XH4 A;  3JPT A;  5C5J A;  4O5K A;  9ICT A;  4QZC A;  1FNU A;  1RYR A;  2E3T A;  4M52 A;  3VDZ A;  3AE7 B;  1NYR A;  2FNJ B;  3PVL A;  3W5V B;  4EEL A;  4JHM A;  5FS7 A;  3VH3 B;  4GOC A;  4B9K A;  3BYY B;  3H8J A;  3QC8 B;  3QHT A;  2LFI A;  4B6J A;  3QU2 A;  2FDR A;  2R18 A;  8ICS A;  2KOB A;  1NKE A;  4TQ1 A;  1Z2M A;  2BB6 A;  2KDI A;  2KVC A;  3LAD A;  1P7F A;  4FUL A;  3P4S B;  5L6G A;  1ISN A;  5I1W A;  2YAU A;  4EQX A;  3TCS A;  5KG2 A;  4O5C A;  2BWF A;  2CRX A;  3LB8 C;  1DOQ A;  2ZPN A;  5D3D A;  5IN7 A;  5CHW A;  4OW0 A;  3E0F A;  5HFY A;  5LNK 1;  1XWL A;  4O3N A;  4RQ7 A;  4ELV A;  2Z59 B;  1ZQC A;  3BZD B;  3MDA A;  2D3C A;  3UMG A;  4TMA B;  4EMI A;  2BKE A;  2KNJ A;  3HM3 A;  1V85 A;  3V6K A;  4ANU A;  4TQ0 A;  2JH1 A;  2LPE A;  3N4E A;  3ZNH B;  3APC A;  2RDB C;  1UQV A;  3SFD B;  2UVV A;  3E9S A;  4G11 A;  2MBR A;  2L00 B;  3SN1 A;  3WKB A;  4KMU A;  1VCB A;  5C3J B;  5KT4 A;  2UU7 A;  1BQG A;  2OZ3 A;  4JK1 A;  3SBF A;  2K8B B;  2W9M A;  4OZB A;  2CHX A;  5ALU A;  2WXF A;  3ZTC A;  1N48 A;  4HCH A;  1XO3 A;  1D8L A;  4AS1 A;  5AI4 A;  3ZLZ A;  1Q0W B;  5AZG A;  1I4X A;  3QQ8 B;  1E8H A;  4GRT A;  4QZ9 A;  1ZQJ A;  1V9P A;  1NHR A;  2G3Q B;  1YJI A;  4UQG A;  1MPE A;  2SEB D;  2FLL A;  4IM0 A;  2ZUB A;  2DAJ A;  1IIP A;  3C0R B;  1MHX A;  3U30 A;  1L5U A;  2UYZ B;  3D46 A;  1ZOY B;  4IW0 A;  4PVK A;  4ECW A;  3RB6 A;  2UUU A;  8ICX A;  5KT5 A;  2HOF A;  3OPX A;  1FNV A;  1F3P A;  2BGF A;  2HHW A;  4JX1 C;  1J19 A;  8ICU A;  3TWA A;  2FCM A;  3PZD A;  1X2H A;  3W9C B;  3WK8 A;  4BX9 C;  5KL1 B;  8ICC A;  5H8Y E;  3T9L A;  8ICO A;  2LZ6 A;  4O1N A;  4G9B A;  2UWQ A;  2X8X X;  5KFI A;  4DSE A;  3V62 A;  4F5R A;  4C4S A;  2V3P A;  2KG5 A;  2QGY A;  3M95 A;  3I76 A;  3AN1 A;  1SXT A;  5KFQ A;  1I42 A;  1VQZ A;  3SEI A;  2C60 A;  3EF6 A;  3W8X A;  2UVR A;  3SMV A;  1R0M A;  4JV2 A;  3N7S C;  4LNN A;  3FC4 A;  4O3Q A;  1Y88 A;  3TSS A;  1UCV A;  4Q45 A;  4IQV A;  3IHP C;  5DB7 A;  1V2Y A;  2KE7 A;  1GEU A;  2XH7 A;  2NRT A;  2Y9T A;  2GWS A;  3DGZ A;  4A8E A;  3ZKJ C;  2GGG A;  3Q8L A;  1GRA A;  1B9R A;  4ZRI A;  1BGX T;  4YTP B;  1E8F A;  4JMU A;  4M9H A;  2KQ4 X;  1MQ2 A;  3KHG A;  3OJ4 B;  3QA8 A;  5CEH A;  4Y2T A;  1HUZ A;  1MFW A;  1VRA B;  3PSE B;  4DSI A;  3QX1 A;  5DG9 A;  2Q85 A;  4K7Z A;  3SV4 A;  3H1U A;  5KFR A;  3ISC A;  4KLS A;  2XK5 B;  5LXI B;  3PSP A;  3GIL A;  4Z6C A;  1FCC C;  2HDO A;  2ALZ A;  2HHS A;  1IGC A;  4MEL A;  1A76 A;  3NAS A;  1OW5 A;  4I2G A;  1N63 A;  3OW1 A;  2L52 A;  2L3Z A;  3O13 A;  5ALO A;  1ZQS A;  1CK1 A;  3HK0 A;  1CUK A;  2ASL A;  3H0M B;  1EC8 A;  3SYZ A;  2N9L A;  2KHW B;  1ZQN A;  4W9C A;  1QLU A;  3QWZ B;  1FXI A;  3N6J A;  2AQ3 B;  4WIP A;  1EWC A;  2KMD A;  3QU9 A;  5I1V A;  1KFD A;  3A7A A;  1D9F A;  2FCN A;  1XDI A;  1GNU A;  2QDF A;  4YSX B;  2KFK A;  2M8S A;  2RK5 A;  1PK1 A;  3F5E A;  2QPM A;  1RQN A;  4YR2 A;  4GU2 A;  1ZJM A;  3CXO A;  3OHB A;  1SKW A;  5EU9 A;  3S47 A;  4KDI C;  1GSN A;  4NJC A;  4GDK B;  4PL2 A;  3PST A;  5AK5 A;  1YEY A;  2QB0 A;  2I1Q A;  2KHQ A;  1TV9 A;  3N20 C;  3H7S A;  1C79 A;  3W1Y A;  4DHZ E;  1I7H A;  1N61 C;  1JPM A;  1NHQ A;  5AI9 A;  2BDU A;  2PXI A;  3ZD8 A;  2ZVN A;  2SAK A;  4NLK A;  5KFY A;  4BBY A;  2VA2 A;  4ELU A;  3UQ2 A;  3VC5 A;  1L6V A;  3TAD A;  1GRF A;  2ZIU B;  2FID A;  4AUQ C;  2XIC A;  1T0Q C;  1F2R C;  3VDG A;  3HW8 A;  4GC7 A;  2G06 A;  3NUQ A;  2EQY A;  5HP4 A;  2BCS A;  2IHN A;  2GH1 A;  2ESE A;  2EAM A;  9ICA A;  4DXA B;  4TUU A;  3EYZ A;  4F5P A;  3V5C A;  5A0L A;  4G50 A;  1FPY A;  1GB1 A;  1WGH A;  1AOG A;  1C4A A;  4IQT A;  4U6P A;  2GLE A;  4FJZ A;  2K8C B;  4TQS A;  3A9J B;  3AU6 A;  1S5L U;  1SJA A;  3HPF A;  4G7F A;  1CZP A;  4PS8 A;  5J18 A;  3KD3 A;  2BCQ A;  3GE8 C;  2O6K A;  4ZRQ A;  3SSZ A;  4BAX A;  1AHV A;  2K8B A;  2PKE A;  5DBA A;  2GQU A;  2WXI A;  5J0W A;  4WQO B;  1XCT L;  3H8A A;  1U4B A;  2K4I A;  1WH3 A;  3H7V A;  2QQ6 A;  3GOE A;  4KTQ A;  2J0K A;  4EBC A;  4DWD A;  2VAN A;  5H92 C;  3MWC A;  4DHJ B;  4QWE A;  3I5J C;  2HHU A;  3H4K A;  3ISB A;  5CWR A;  2KDE B;  2N0S B;  2WWZ A;  3R0K A;  2HVH A;  3AEC B;  1TYG B;  2MX2 A;  3AI5 A;  3AU5 A;  4DFJ A;  2IA6 A;  1ZQM A;  2GGH A;  4FP1 A;  2YML A;  1X2I A;  3L5K A;  3PPA A;  2ZIX A;  2KDB A;  5JCK A;  4RT3 A;  9ICP A;  4DDG D;  2OZT A;  4B9S A;  1ZW7 A;  1TT5 B;  1L3V A;  4B9U A;  2KFZ A;  3RJI A;  9ICO A;  3HVZ A;  4GB9 A;  4CE6 A;  5HML A;  5HI1 A;  1D5X C;  1NU5 A;  3TEW A;  2KN4 A;  2V3A A;  4MHV A;  1KF6 B;  4YXD B;  1ZQZ A;  1J2N A;  5AIA A;  2B0C A;  2BT6 A;  2WXG A;  2QKN A;  4Q8F A;  3Q3F A;  1P3Q U;  1F5S A;  3NS1 A;  5CR0 A;  3A4S C;  2CJO A;  3F53 A;  4W9G A;  3R11 A;  3AQF A;  3UPQ A;  3PY8 A;  4O3S A;  4JIO U;  1OEP A;  2CN1 A;  2BS3 B;  4NEV A;  1ZQO A;  2EQ6 A;  1BXT A;  2L8J A;  2K4H A;  3HSU A;  3DVG X;  3DHG C;  1STZ A;  3DG3 A;  5KHO A;  2OEH A;  5AIC A;  4XX5 A;  3GO2 A;  3SU8 X;  4E4U A;  4RH6 A;  5DG8 A;  3AE3 B;  4Y2R A;  3RIT A;  4IL6 U;  3GC2 A;  1Z3E B;  1NJW A;  2KVR A;  3RT3 B;  2MUC A;  4J9M A;  5KHQ A;  2MU2 A;  2WHE A;  3C19 A;  3H12 A;  1FO4 A;  4PJ0 U;  1JWM D;  2KMA A;  4UB1 A;  4KIK B;  3M8R A;  3DHH C;  3NRZ B;  4XUS A;  2F76 X;  3KHL A;  1IP9 A;  4PYT A;  2V3N A;  4UB4 A;  4P7I A;  2NO5 A;  2B76 B;  2BS2 B;  3P42 A;  4J3Z A;  4EMW A;  1BNO A;  3HKZ C;  5J8Y C;  2BDP A;  3SAG A;  3EW9 A;  2GMI C;  2IJ0 A;  3RO6 A;  5F9N A;  2MSN A;  4FS1 A;  4W9I A;  5EWG A;  1P7D A;  3A1Q B;  4ML8 A;  1QKZ A;  4OHJ A;  2HBM A;  3M63 B;  1MBT A;  2O56 A;  1ZKH A;  3C2K A;  3CYM A;  2V0G A;  4ED1 A;  1AAR A;  3EGR A;  4MGY E;  4PZF A;  1VR9 A;  2WDV B;  5DB6 A;  2JRH A;  2LGY A;  2LGS A;  4H4S A;  3M1Y A;  3UXL A;  4B9L A;  2K1F A;  3T79 A;  1J97 A;  3KKA C;  3DED A;  2EKE C;  3IFW B;  3HX0 A;  4EEK A;  3IVF A;  4I6L B;  4J3O D;  2YY6 A;  4UB8 U;  5ALH A;  4O3R A;  2Y5P A;  1KSP A;  2JXJ A;  4ROP A;  4YTN B;  4EZL A;  4NL9 A;  4DSL A;  3N1Y C;  3FW8 A;  3IXS A;  2LXA A;  4OZC A;  4JWU C;  1ZE3 D;  4F4K A;  1EUV B;  1YNT E;  4HYR A;  1KQQ A;  2Y0S F;  3QTP A;  1MNS A;  3PWI A;  2NTT A;  1FIQ B;  3AE9 B;  7ICP A;  3C23 A;  1ZQL A;  4KN4 A;  4JAY A;  3I99 A;  3PRP B;  4IQW A;  5J2E A;  4MLA A;  1S0O A;  2C9W B;  4HDQ A;  1NKC A;  9ICW A;  4YSY B;  1MUC A;  4FX9 A;  2WF5 A;  4TUP A;  2H89 B;  4YP3 A;  7ICH A;  4PWB A;  5G5G A;  5AKJ A;  3RUI B;  1COK A;  2L7R A;  2FJ6 A;  4BOS C;  1RVK A;  4XE0 A;  4WJP A;  3ORY A;  5KAF U;  3UQA A;  2AXR A;  4JQ9 A;  2GOL A;  2AGO A;  3Q3J A;  4HKQ A;  2BVH A;  4F5O A;  4GIV A;  3EAN A;  4K8G A;  2XSX A;  4Y2J A;  2XEW A;  3SQI A;  2GH5 A;  4CF3 A;  9ICV A;  1OQY A;  1UUP A;  2MUT A;  2K4P A;  3L4P A;  2MBB B;  4XYC A;  2YMP A;  4E4F A;  5G55 A;  1GRT A;  5JHB A;  4TQR A;  2XID A;  1PDY A;  1E8Y A;  1SV4 A;  4J6I A;  1UBI A;  1WXV A;  4QIW F;  3SAF A;  4KLE A;  2VFS A;  2Y0S C;  3SQS A;  3ZD9 A;  5AKE A;  4FJY A;  3N30 A;  4ECV A;  1SE4 A;  3TAN A;  9ICG A;  5FS8 A;  3L17 A;  4HPL B;  8ICB A;  4K7W A;  2R8I A;  3QX7 A;  1FRR A;  1PQS A;  2PI5 A;  4REZ A;  5LXH A;  1HXY D;  3OGU A;  2FCQ A;  2WLB A;  1JWB D;  4MDK E;  5C2T B;  4XWT A;  5AIB A;  1ONE A;  4IUM B;  8ICL A;  1I19 A;  4DYE A;  3PX6 A;  4K81 A;  1Y56 A;  1JRU A;  5GTI U;  1S77 D;  1ZQQ A;  2Z8L A;  2PSN A;  2QDE A;  3NS1 B;  2OKT A;  1W1L A;  2ZPY A;  2KVS A;  1WG8 A;  2D6F C;  2LUM A;  1NHS A;  5KFV A;  4GIB A;  1UZX B;  4YD1 A;  3TUO A;  1NOM A;  2WF7 A;  4RZR A;  3TTE A;  3VCB A;  4ZHP A;  4KZ0 A;  1E7V A;  2NR2 A;  2WF9 A;  2LYA A;  3GZF A;  5KFK A;  1Z5S B;  3IJQ A;  4F93 B;  2Q4W A;  5ALS A;  2ZTE A;  1KDH A;  2NS5 A;  2KX0 A;  4RNA A;  3OTQ A;  4UBC A;  4JV0 A;  2O6V A;  4ECT A;  2RPQ A;  2JT4 B;  4ANX A;  7ICQ A;  5IP4 D;  1DNC A;  5MPO A;  2JWZ A;  2C7N B;  4EC3 A;  4QZG A;  3TI0 A;  2RDJ A;  1X9S A;  2KAN A;  2M1M A;  3V61 A;  4JV1 A;  1WX8 A;  1M6I A;  1IV8 A;  3AU2 A;  1QSS A;  1RYU A;  1BPD A;  1TYT A;  3PWG A;  2XCP A;  2MBQ A;  2P6R A;  4KN7 A;  4BKT A;  1XLO A;  3MQT A;  8ICR A;  4YMM A;  3PM9 A;  2PP1 A;  1TIF A;  5HQX A;  3IC9 A;  3QFA A;  5AK6 A;  3M9N B;  4Q8E A;  2MW5 A;  3AEF B;  1QH9 A;  3T4W A;  3ZXV A;  4FN2 A;  3FDS A;  4Q43 A;  5FXF A;  5DGA A;  3P0W A;  2JEJ A;  1E5W A;  2QJM A;  1N60 C;  2BF8 B;  4US8 A;  3NG0 A;  1D7Y A;  2YMM A;  5ALQ A;  4ECX A;  1I4R A;  2J7Q B;  3JVZ X;  2ZTC A;  3EWA A;  1KBU A;  1V1P A;  5AKZ A;  1WUE A;  1NDA A;  3M9M B;  2MBE A;  3ML8 A;  2J52 A;  3CIR B;  2VRR B;  4ED7 A;  2R2Z A;  3IDW A;  1XXG A;  3GB1 A;  5AKG A;  4J9K A;  4DFK A;  3H8W A;  4B0E A;  3CT2 A;  2LKY A;  3C28 A;  3HRD C;  2KTR B;  4JUZ A;  2ZW0 A;  5KG4 A;  3FW9 A;  1TAM A;  2KLG A;  4GMV A;  4MGZ E;  1B0X A;  2EDU A;  2RDI A;  3WKC A;  1GES A;  1F0M A;  2WAQ F;  2BCU A;  1ZDX A;  4TSS A;  4FE3 A;  1C9F A;  4FI4 A;  4Z17 A;  1PK1 B;  4K4G A;  3VFK A;  2WXL A;  2FMP A;  2WXR A;  2KJ9 A;  4QJF B;  4P16 A;  4BUR A;  1V8C A;  1SIF A;  4LTU A;  5KFL A;  1MHH E;  3RNE C;  3JYU A;  4CO7 A;  1ZYQ A;  1SKR A;  4MF2 A;  2KN5 A;  4IT1 A;  3ZTD A;  4HCL A;  3UJ2 A;  2OYY A;  4I2D A;  1MI0 A;  3FVD A;  5L83 A;  3PMN A;  1YX5 B;  2HJ8 A;  4DLE A;  1ZQD A;  1ZQH A;  3RJF A;  4IRC A;  1NEK B;  1Z00 A;  4UAT A;  2IGD A;  2VFR A;  3PK7 A;  5H2F U;  2ZXH A;  2W3R A;  3CAW A;  1KTK A;  3D9X A;  1V38 A;  1X6J A;  2IZV B;  5KFA A;  3AEG B;  1L8P A;  2Z0D B;  1S0V A;  3Q8E A;  3CYJ A;  4HYK A;  4MSM B;  1K4Q A;  1JIH A;  2G09 A;  2ZIW A;  2PMV A;  1L6U A;  3U8Z A;  1RLF A;  4F2R A;  5EE9 A;  2EKI A;  3KYD D;  1L3U A;  1HTO A;  4AOF A;  3EJB B;  2ZTD A;  2CFY A;  5L1M A;  3WKD A;  3I63 C;  3ABV B;  2RDG A;  4KLQ A;  2PLP A;  1BPY A;  4DL4 A;  1OFF A;  3JS8 A;  3NRZ A;  4RQ8 A;  4RGN A;  3DK8 A;  3ZJV A;  4PZO A;  1MDL A;  3A4R A;  3TEX A;  1DXS A;  1WGG A;  8ICW A;  3RCY A;  2YVF A;  4U7C A;  5D6J B;  5TSS A;  4UB6 U;  4ITK A;  4LCD E;  2GDQ A;  8ICF A;  4FFD A;  1BVS A;  2LGI A;  2YQU A;  4F4W A;  2KTQ A;  3U4E G;  4QWD A;  1ZP0 B;  4PHD A;  5KFB A;  5C0Y A;  3P4P B;  3SHQ A;  3RH4 A;  1Z1V A;  3WK4 A;  1QQ6 A;  3F2C A;  4ACO A;  4P4O A;  2ZNV C;  3L13 A;  3VTE A;  4H83 A;  4O5E A;  2AQ1 B;  3DEE A;  4CDG A;  1XHC A;  3M8S A;  3V5F A;  4HK2 A;  2ZJ8 A;  5ALF A;  1NK8 A;  2WXK A;  1WYW B;  2XH0 A;  2RR9 A;  5CHF A;  4Y2Q A;  1EXN A;  2ZIX B;  2V1Y A;  2C3D A;  2KV2 A;  2KMC A;  4E5T A;  5L6F A;  1PUZ A;  4RT2 A;  2TSS A;  3U7D A;  4RQ5 A;  5DLG A;  2AX5 A;  2C5L C;  2R2Q A;  2DLB A;  2PTY A;  4ECU A;  3Q2A C;  3EJE B;  1KRH A;  5GRT A;  5ALJ A;  2J6S A;  4DCC A;  1FNW A;  1YN3 A;  1L8O A;  2KOX A;  2ZCC A;  4E8G A;  1C76 A;  3RJK A;  1BKH A;  3G6V A;  4W9H A;  2O6V B;  2JZB B;  4J9P A;  3DBR I;  2M4N A;  3NZS A;  4OJ6 A;  2NBV B;  1OEY A;  3RNF C;  4XDC A;  2LYH A;  4UDU C;  2W11 A;  1F0X A;  5FXP A;  1QOB A;  5G5G B;  1QCK A;  1SKS A;  3V7L A;  4MF8 A;  1V80 A;  2YVS A;  2LM4 A;  3THV A;  2VJ4 A;  4LJX A;  1E7U A;  5ALD A;  5DQH A;  3H0L B;  4OJ5 A;  5DB8 A;  4OO1 J;  1RM6 C;  2Y3R A;  1N5X A;  3QEA Z;  1KM7 A;  3GP7 A;  3NY5 A;  5J0Y A;  5BMI A;  2QB1 A;  5AUK A;  2HXT A;  2F1I A;  5III A;  4CCH A;  2BTE A;  2FBW B;  3PO5 A;  3KUD B;  1WE6 A;  1QQ5 A;  3LWL A;  3VRB B;  3RRA A;  3KH0 A;  3URH A;  1KTQ A;  2W9A A;  2ONQ A;  2K8C A;  3I57 A;  3V3X A;  4AWJ A;  3AE2 B;  2HNE A;  4DSJ A;  2KD1 A;  4BWM A;  2J42 A;  2YEP F;  5HHD G;  4WAA A;  3NTU A;  3P3B A;  3NVW A;  3F5A A;  1WIA A;  1ZY8 A;  1ZPS A;  5L1L A;  4IRK A;  4CGZ A;  3DER A;  2PLI A;  1L2N A;  1SWW A;  4P4P A;  4K1R B;  1HE8 A;  2QAR B;  3DJJ A;  2LJ5 A;  4HRS A;  1FIQ A;  3A0H U;  2RHF A;  2OCE A;  5KFC A;  1WX7 A;  4DL6 A;  4EKU A;  1WVF A;  4ARC A;  5FXE A;  4NY8 A;  2WDQ B;  1Q3U A;  4XRH A;  1XEE A;  3HKZ F;  2CKH B;  1LGR A;  2IO0 B;  3OPS A;  3BQ0 A;  4DWI A;  3UJR A;  2C22 A;  5ALG A;  1UWM A;  3SR6 A;  2BGW A;  4H2A A;  2GQT A;  3DQ0 A;  5TIS U;  4Y2P A;  1ONF A;  4YWO A;  5T14 A;  4C4V A;  1GXF A;  2AH5 A;  2V6O A;  2JZZ A;  4ENL A;  2K6Q A;  2MSE D;  3PLV A;  2AL2 B;  2UUV A;  1LM8 B;  3PRZ A;  2F8L A;  1LV5 A;  8ICG A;  2G1E A;  4GLS C;  1E0Z A;  4GIS A;  1NJY A;  3ZGZ A;  4O95 A;  1VLB A;  1OTR B;  3LWM A;  1KFT A;  4DLG A;  3KKA A;  4DQI A;  5AZH A;  3R7Q A;  1WGR A;  1C78 A;  1ECQ A;  2WXQ A;  1RDF A;  3JPS A;  4J1O A;  4JN7 A;  1HIW A;  1D5M C;  3MSY A;  1SJB A;  3IK4 A;  1GRG A;  1XD3 B;  3QXG A;  2ASD A;  3IM1 A;  2D3B A;  2BQU A;  3ETR A;  3PZ8 A;  1SJD A;  3Q8M A;  2HDE A;  3UIP B;  3JPQ A;  4ANV A;  4PHA A;  1F1H A;  3RCZ A;  1SJC A;  4GXJ A;  2N9X A;  3BOX A;  2MHJ A;  4NZL B;  2V3B A;  3PX0 A;  1VDV A;  2R8G A;  3NVZ B;  2MUT B;  3RF9 A;  2NRZ A;  4NXZ A;  2VZK B;  4F4R A;  4EWJ A;  3ICX A;  4USA A;  4IM3 A;  2MRL A;  2W03 A;  4TUS A;  2A19 A;  2NYV A;  2P3H A;  3GD4 A;  1TZZ A;  2I1K A;  3N1X C;  2MCN B;  3N6H A;  3JW7 A;  1N63 C;  9ICL A;  5E6J A;  1ZX9 A;  1HEZ E;  3V6J A;  3KOO A;  1MG4 A;  5AM2 A;  2HTM E;  1MRA A;  2X50 A;  3FV9 A;  1JXE A;  1HTQ A;  3BYT B;  1WE7 A;  4J9N A;  4JWM A;  5BOE A;  4S17 A;  1URJ A;  4ED2 A;  2P66 A;  3CMM B;  2NPX A;  2L0T A;  4H4Y A;  2PFP A;  5J0X A;  3ZDD A;  2A1J B;  4EE2 A;  1U49 A;  3ZDE A;  5KFH A;  4R65 A;  2GGJ A;  3MUC A;  4CNQ A;  1ZQF A;  4JGH B;  8ICZ A;  3BQ7 A;  3LYS A;  4L1B A;  5KG0 A;  2DYO A;  4OCZ A;  2KDF B;  4QZH A;  1UA0 A;  3W5U B;  1D6E C;  5AI8 A;  5CRX A;  5AE1 A;  3JSV B;  4P2H A;  4KX3 A;  1JEH A;  2VFT A;  2KZM A;  4S0R A;  2WB1 C;  3MKC A;  2KMM A;  9ICJ A;  1UH6 A;  2INP E;  3U7Z A;  2KKV A;  3EZ5 A;  2G4S A;  4O3P A;  3I3T B;  3IAM 1;  1YN4 A;  5HR7 A;  4N58 A;  4I6P A;  3T5L A;  2PP3 A;  5IIL A;  2HCF A;  4ELT A;  5CP2 A;  4C4T A;  3QIJ A;  4HCD A;  1ET6 A;  4W9L A;  4GSW A;  4AJY B;  2GI9 A;  3EEC A;  1P1A A;  4IL2 A;  2CS4 A;  4W9E A;  5TR5 A;  4E71 A;  4PVE A;  1T3N A;  2KEY A;  4C7Y A;  1JCK B;  3PV8 A;  2YN4 A;  2D07 B;  4DL7 A;  3ZNG C;  5JZE B;  5KFJ A;  2LJI A;  4A6Q A;  4OVZ A;  3FIL A;  1KD0 A;  2OFJ A;  4IQU A;  1WI0 A;  3WAN A;  2CHW A;  3HRD D;  3NVY A;  1M6Y A;  4DSF A;  4IKG A;  4YT0 B;  4F72 A;  2POZ A;  4UAR A;  9ICQ A;  4I29 A;  3V7K A;  2FAZ A;  4XGA B;  1BPX A;  2ZIW B;  2K22 A;  3N32 A;  2QJN A;  3Q45 A;  1RFK A;  4QWC A;  4B9T A;  3A33 B;  4WAF A;  4O9M A;  1N62 A;  3QK0 A;  4M6U A;  1UPH A;  1GAQ B;  2XH2 A;  1Z00 B;  1K50 A;  2IO2 B;  2VFV A;  2PI4 A;  5CX3 A;  3DIP A;  3IJI A;  1VZ7 A;  2WPF A;  5IIM A;  3ALR A;  4KV2 A;  1T3Q C;  2MNR A;  5KNI A;  1C20 A;  1D8B A;  3AEE B;  3Q6B A;  2AL2 A;  3BJY A;  7ENL A;  4QZF A;  4BXO A;  1N61 A;  5ADZ A;  1AHU A;  4GN1 A;  4ADW A;  3D6J A;  1LO5 D;  1XLP A;  4GYP C;  5D46 A;  4Y2X A;  1ET9 A;  3GD3 A;  1UEL A;  1A6S A;  2Q5W D;  3E56 A;  3NZG A;  2I5H A;  2HHX A;  3STP A;  3ZDT A;  1LKY B;  2P8C A;  1RWS A;  3CWI A;  3CXB A;  4F71 A;  3ZLH A;  2ZUC A;  1ZQA A;  1F77 A;  1TTN A;  1EF1 A;  3LYY A;  4WJ3 B;  7ICI A;  4KT2 A;  3GII A;  2BYE A;  1YJJ A;  3BWU D;  3QFB A;  5D2M B;  1T8E A;  2JEF A;  4EOY A;  4MFF A;  2LGX A;  2W0H A;  3H70 A;  4DFP A;  4H4V A;  1T3Q A;  2KQ7 A;  1NYQ A;  2IBK A;  2E6X A;  4TUQ A;  1UWX A;  2XBB C;  3WIM A;  2V4I B;  4RM8 A;  1E10 A;  2GR2 A;  4MGK E;  3R07 C;  4NEW A;  4H1Z A;  2G07 A;  1L3S A;  3G6Y A;  1FRD A;  2WX1 A;  2KXJ A;  4J9S A;  1NI2 A;  3Q3O C;  3SN0 A;  1RZT A;  1PFD A;  2J0M A;  3DQV A;  1ED1 A;  3D2Q A;  4PPX A;  2F8K A;  4NAW B;  1DII A;  1N5W C;  2VZK D;  4KLH A;  1P48 A;  2JZB A;  3U4F A;  1TS4 A;  2BYF A;  5CHV C;  1JPD X;  1YMH E;  3EJD B;  3UQB A;  2ATL A;  1WGK A;  1VZ8 A;  3M7D A;  2ZCB A;  3KWL A;  4DQP A;  1NVI D;  1F0Z A;  2IO1 B;  3ENL A;  2I2Y A;  1TFR A;  4PL1 A;  4OJP A;  5AKL A;  1TY2 A;  5IIJ A;  1EC7 A;  4RM9 A;  3D2S A;  4IOI E;  4GC6 A;  3FXG A;  2PPG A;  4DN1 A;  5AM4 A;  4M8M A;  2LVQ A;  3HHM A;  1KFS A;  1FXT B;  2IND C;  3L08 A;  1V1P B;  4KPL A;  2IBI B;  4RNN A;  1ZJN A;  3KWV A;  2WU5 B;  1KKR A;  1DXL A;  3APF A;  1K5O A;  2KVZ A;  4CF4 A;  4F3O A;  1F9J A;  2ZJ5 A;  5DKW A;  5J0P A;  2QB0 B;  4C8O A;  3ZVI A;  3W8Z A;  4RCO A;  2FMS A;  1L4D B;  4MH8 A;  2PEA A;  4RQ2 A;  3ZRF A;  3QCA A;  3OHA A;  3DVG Y;  2GSH A;  1A5R A;  4FBU A;  4DF4 A;  2OAI A;  2ZIU A;  4M04 A;  3B1L X;  4QIW C;  2AEH A;  5DLF A;  1U48 A;  5AEK B;  3Q14 C;  1ZQG A;  1WXA A;  3ISD A;  2K4E A;  5I4D A;  2AWT A;  2DNF A;  3KJM A;  2Z0E B;  2O2V A;  3BQT A;  1K8R B;  2C3C A;  2EQ8 A;  5J2B A;  1TYP A;  1JI7 A;  4HJG E;  3NVW B;  3QPE A;  4YQW A;  3OJU A;  3BS5 A;  3L10 B;  4RNO A;  2JF5 A;  1GO3 F;  1Q5W B;  2AL6 A;  5IDZ A;  1D3Z A;  2M0N A;  4QW9 A;  2D3A A;  5BPC A;  3PML A;  4EM3 A;  4KMO B;  2OQH A;  1HZ5 A;  3QU7 A;  3DBL I;  5AM0 A;  2JK6 A;  1ZQW A;  5J2H A;  4HPN A;  5FJR A;  5ALI A;  3C2M A;  5FS6 A;  2AL1 A;  1V59 A;  1IG6 A;  3BVG A;  1Z4N A;  5HHH A;  3RNM A;  5ALW A;  5J8Y A;  4NY0 A;  3II4 A;  2ZIV B;  5AM3 A;  3MGV A;  4DSK A;  1WFY A;  1PK3 A;  2JYE A;  3VAW A;  1SL1 A;  1V6E A;  4EBD A;  1XSL A;  1ROE A;  2MA9 B;  4YTM B;  3MJ5 A;  3ZNZ B;  3MTN B;  2RLT A;  2Y5B B;  4DL3 A;  4KIT B;  5KT6 A;  3TMP B;  4WUR A;  3R10 A;  4H4R A;  3RJH A;  4BKS D;  1T7P A;  1Q3V A;  1D8Y A;  1M94 A;  3PHW B;  4Q2J A;  1FCL A;  2G45 B;  2LWP A;  1DK3 A;  2YX8 A;  4A8X C;  2AQ2 B;  2JPH A;  2C2E A;  3H40 A;  3RTV A;  3NVZ A;  2YMQ A;  3NGD A;  2FUH B;  2MRP A;  2K39 A;  3O65 B;  2Y5C A;  8ICM A;  4E74 A;  1YQZ A;  4EYH B;  2FMQ A;  7ICU A;  3DES A;  1E8Z A;  1Y8R C;  1SZP A;  3SI8 A;  2IGH A;  4M8N A;  3C5F A;  3TFS A;  2CXY A;  2CU1 A;  4JWS C;  3D47 A;  5AI5 A;  3MP9 A;  4IR9 A;  1X6I A;  3K75 D;  4M9J A;  5DBC A;  5J2I A;  2KD0 A;  4G0N B;  3RAQ A;  2BPF A;  1DRG A;  1GC7 A;  5HNK A;  9ICM A;  5J0Q A;  2REX A;  1N5W A;  4BJQ A;  3OSP A;  4UBB A;  3WKA A;  2WDT B;  4BC9 A;  2BR0 A;  3OSN A;  2QJL A;  2VA3 A;  2BVC A;  4HNL A;  1DOY A;  3LJ3 A;  5FK9 C;  1U45 A;  5BMH A;  3OP2 A;  3TEY A;  1LVH A;  2IHM A;  5ALN A;  3VC8 A;  4WWN A;  2EQ7 A;  3SQP A;  2XI9 A;  3BQ1 A;  1ZQ1 C;  1ZDV A;  2ONE A;  4FA6 A;  4RQ1 A;  1VJK A;  3PO0 A;  3CP8 A;  2V9W A;  1PDZ A;  2EQ9 A;  4M0X A;  3QAR A;  4YR3 A;  1L3T A;  3DFH A;  3FW7 A;  3KHH A;  7ICJ A;  1R6W A;  1D5Z C;  2G4D B;  5JCN A;  4FS2 A;  2O3G A;  2N9K A;  3RD2 A;  3RFA A;  1L7N A;  2BW2 A;  2KC1 A;  3TSH A;  3FG2 P;  3VHT C;  1P43 A;  3ONN A;  1IGD A;  4I2J A;  3X23 A;  5K8E A;  3KUM A;  4R8U B;  2OJR A;  3NHE B;  3P93 A;  4DHZ B;  4C80 A;  4BV6 A;  2BPS A;  5FXD A;  1KRP A;  1E8G A;  4JWN A;  5AKI A;  2OWO A;  3UMB A;  1ZK7 A;  3DFY A;  3OTR A;  8ICT A;  2MLB A;  5KVI A;  5AWV A;  1ZQK A;  3MFI A;  1H4R A;  4YG2 A;  5L1J A;  2P8B A;  1Z19 A;  1P98 A;  1YOV B;  4FZL A;  4ZH4 A;  5JXV A;  9ICE A;  2JQR B;  2ASJ A;  2HD5 B;  9ICN A;  1TGZ B;  1ZD3 A;  2H3Q A;  4DOC A;  2KJR A;  3T5H A;  2ZNV B;  2WP9 B;  1NK6 A;  3FCP A;  2PTX A;  2FE8 A;  3X0W A;  3NVY B;  2ZZP B;  3VRA B;  3Q8S B;  1F2R I;  3DHI C;  5KT7 A;  5ALP A;  1AQ6 A;  2KSO A;  9ICS A;  3MAB A;  3IV6 A;  2B6G A;  3KVF B;  3GFK B;  2PIA A;  5DCN A;  2DW7 A;  5JH5 C;  2MAX A;  3PTF C;  4BWJ A;  3I6E A;  1UXY A;  1IBX A;  4OJO A;  2HHV A;  5JCL A;  8ICE A;  3PZ7 A;  1WVE A;  3S1C A;  4Y2U A;  3SEN A;  4XLO A;  2J53 A;  7ICO A;  1V5O A;  2ZZC A;  1ELS A;  2IDY A;  5JCM A;  3S1E A;  3BK2 A;  5E79 U;  2J3N A;  3SN4 A;  2VA8 A;  1FFU A;  1TK0 A;  4LLG M;  2ON8 A;  3K1R B;  4W9D A;  3OWE B;  2YB1 A;  5G5H A;  1L7P A;  4BXO B;  3P63 A;  5J04 A;  3KTQ A;  2INC C;  2BKF A;  3S6J A;  3PR4 A;  5KG6 A;  4BUG A;  4QZA A;  4F4Y A;  1MA7 A;  1WWV A;  2G5I B;  1XF5 L;  4ZCW A;  1WJN A;  3H8S A;  3NZ3 A;  5IOI A;  1U9L A;  4QAY A;  5FJU A;  3AUO A;  1UT8 A;  5LLI A;  3KW5 B;  2WP5 A;  2IOH A;  1BNP A;  3ETR B;  3C8Y A;  3PT2 B;  3AB5 A;  3CRX A;  3DDM A;  2Y1J A;  4MJS B;  2DKX A;  1V86 A;  2WGS A;  2PW9 A;  3ETL A;  3IT6 B;  3P1M A;  1EBD A;  1E0Y A;  2HHT A;  1L5P A;  1SGG A;  3J81 j;  4NLN A;  1GB4 A;  2NTS A;  2VAO A;  2HZG A;  4K3B A;  3EPI A;  2LBO A;  4MSQ B;  2E5A A;  3GD6 A;  3VUY A;  3DG6 A;  3LVV A;  2WPE A;  3DH9 A;  1H6V A;  4A35 A;  4NLG A;  4KLI A;  1ZET A;  4IRD A;  2AYO B;  3UIO B;  3GV8 B;  1E6E B;  5BMG A;  3DEQ A;  3CGD A;  1X9X A;  2J4X A;  2IOF K;  3N7P D;  4IS7 A;  3PW2 A;  4YN4 A;  3BK1 A;  4ECZ A;  4GIR A;  2B3A A;  4YMO A;  3H8M A;  3RAX A;  2DEN B;  2L83 A;  1K53 A;  4HPM B;  1T4G A;  3VTV A;  2ZW1 A;  4R63 A;  4P0P A;  3D2D A;  4M9L A;  1TAU A;  1WGY A;  3MR5 A;  2AGQ A;  4KLG A;  2EEL A;  1PYW D;  4UB3 A;  2E1E A;  1WYG A;  3TAD C;  5FJO A;  2JSV X;  3N4F A;  1IPG A;  2FLP A;  1TKG A;  2N4F A;  3RMK C;  2GO7 A;  4UB2 A;  2K89 A;  1XO0 A;  1MJD A;  3ZNI D;  3FWA A;  4A6G A;  4MAC A;  1LB2 B;  1C4P A;  2OG9 A;  1Z4O A;  4IDI A;  3DV9 A;  4FJV B;  4K7S A;  2WXO A;  1FHV A;  4KLO A;  2R8D A;  2CJN A;  4R3D A;  4RPX A;  1BWC A;  2IY0 B;  4LNF A;  1FFV A;  2EMS A;  3MFG A;  1OUQ A;  2XN9 C;  1X9W A;  3NVV A;  4HLE A;  1UGM A;  5AK3 A;  4PS7 A;  3LAE A;  2NRV A;  1E90 A;  3PSF A;  2PFQ A;  1JQ4 A;  4Q44 A;  3HPO A;  2Y4G A;  4F4X A;  1T0R C;  1X1M A;  2MWS B;  3U26 A;  5KFP A;  1G6J A;  4P4M A;  4YXM A;  2F5Z A;  2DFL A;  2MA1 A;  2KFK B;  3CGE A;  2F2A B;  1C3T A;  1JRO A;  3DPD A;  1E9I A;  2JR5 A;  4RQ0 A;  2M56 B;  2RDH A;  2RQ5 A;  2C2R A;  2DX5 B;  3GV5 B;  2KTR A;  1DK2 A;  2I0K A;  3KZX A;  2I9G A;  4NNJ B;  3LB8 A;  4IC9 A;  2OLA A;  3H7I A;  3DK9 A;  5L95 C;  3S5S A;  2GR3 A;  5AM1 A;  2UVU A;  1SV0 C;  2JHD A;  4BGD A;  5KVH A;  2C7M B;  1P0R A;  2Q4T A;  4DFM A;  4DXG A;  5KFG A;  2KQS A;  4K1W A;  2BCR A;  4IWQ A;  3LXF A;  2YTU A;  2AXT U;  4C8L A;  1ESF A;  4P1C C;  3K4G A;  1KOT A;  2D3D A;  3PZP A;  3NRW A;  2JEI A;  2AKZ A;  2MJD A;  3UXP A;  1X66 A;  1W1R A;  1R7S A;  1OEY J;  4DQR A;  2JXT A;  5GXG B;  1TBE A;  3PW0 A;  3TAR A;  3VTU A;  3Q8A A;  3IJL A;  3VVW B;  3KZI U;  1H8C A;  3RBE A;  4CHK A;  1YT3 A;  5EE3 A;  5G5H B;  4X5V A;  4F5N A;  1J8C A;  1W1Q A;  2GQW A;  4NLC A;  1W1M A;  4ZRJ A;  3Q8F A;  2HMX A;  5D79 A;  3EFU A;  4FHK A;  2K3U A;  3Q8B A;  3B9J B;  4JN8 A;  1ZQB A;  4KLM A;  5T8I A;  2F1J A;  5ALR A;  4H4P A;  2KWV B;  2LRU A;  2NBW B;  3DWM A;  3FYY A;  2ICI A;  1C77 A;  1ZQP A;  4MJS A;  2R8H A;  4HWI B;  4YWG G;  2HW3 A;  2H3I A;  3UXO A;  3SEB A;  3V6C B;  4DS4 A;  2WHI A;  1K1S A;  4I2F A;  3ED5 A;  1JWU D;  2I1J A;  3AU4 A;  2VJ5 A;  3CSF A;  3RZF A;  1WSP A;  4IP4 A;  2K8A A;  2BQ3 A;  1RYJ A;  1JDF A;  7ICV A;  2ZVO A;  2KAC A;  3VR9 B;  1TJE A;  2M19 A;  2O6V D;  2K0P A;  2D11 A;  2VFU A;  2B21 A;  1XS9 D;  2ZJA A;  2J6T A;  1WRD B;  4F8R A;  2LVP A;  4CYE A;  1ZQT A;  2IPI A;  2VKQ A;  1OQQ A;  1JX4 A;  2TPR A;  2KWU B;  4KX5 A;  3PSI A;  1ZKQ A;  4F91 B;  3DBH I;  3ZO5 B;  4APN A;  4MT5 A;  3WK5 A;  2W04 A;  2N7J A;  3C1Y A;  3FAH A;  1S7M A;  1DOI A;  4II3 B;  3T6C A;  2BVF A;  1WJU A;  1HA5 A;  4KZC A;  4RU9 A;  2PTL A;  3DDC B;  4EX7 A;  4II2 B;  4MM3 B;  3QZ8 A;  3TEZ A;  3RI7 C;  4M6W A;  2L1A A;  2MJE A;  5KTQ A;  2LHD A;  1ZQU A;  2G5H B;  3ECI A;  4NJ6 A;  5E6N A;  2W43 A;  2AAQ A;  1LPF A;  4RQ4 A;  3T3N A;  2WNM A;  2D3G A;  4EZ6 A;  2YVJ A;  2WXM A;  2WYQ A;  5J2D A;  1F44 A;  8ICQ A;  1KH0 A;  2KX3 A;  3ZDC A;  3IG3 A;  4KIK A;  5HMR A;  4BDP A;  1MO9 A;  3DGB A;  2KKC A;  3ZRC A;  5DPW A;  3UIN B;  1QLT A;  2W82 A;  2PU0 A;  1A77 A;  3C5G A;  4GXI A;  2V3S A;  4OJL A;  2ZG6 A;  3K1Z A;  3NZU A;  3VH4 B;  2PFO A;  2BC1 A;  4EEW A;  2QEJ C;  3MGH A;  2F1H A;  2K5P A;  3A7U A;  3AEA B;  2FI1 A;  3TCA A;  3N3K B;  2KWD A;  3OZM A;  3V05 A;  3QUC A;  2M0A A;  3ES7 A;  9ICU A;  1QZE A;  3SD5 A;  4GYP A;  2DKZ A;  1ZXI C;  1UNS A;  1ARO P;  3O0F A;  3TKA A;  3RFZ B;  3R3M A;  2WPC A;  3R25 A;  1WJ4 A;  3LXD A;  3LVW A;  5BYS A;  4UB5 A;  2GRT A;  1TS5 A;  1QIL A;  3URY A;  2NVK X;  4I27 A;  2D5G A;  5AKH A;  3BVM A;  4K2S A;  3B0A A;  1YN5 A;  3TWB A;  3G6X A;  3HIL A;  4HVB A;  4QW8 A;  3U52 E;  1KKO A;  2OQY A;  3GY1 A;  2LYB A;  2DF4 B;  2YB4 A;  4DX3 A;  2JUO A;  3RYT A;  3M62 B;  3Q69 A;  3IG5 A;  2G08 A;  4GXK A;  4TVY A;  3ML9 A;  5AE3 A;  2KZR A;  2RRD A;  4AJW A;  2DZM A;  3MDC A;  3UXK A;  1FXA A;  1L7Y A;  1WUF A;  2PP0 A;  2EXR A;  3ZI4 A;  2MEK A;  4IM2 A;  4ZRP A;  2LHE A;  3RUL A;  3QN3 A;  1J7B A;  3RJJ A;  2V9H A;  5ALX A;  3DWG C;  2BYV E;  5K4L A;  2P0I A;  1JML A;  4B0M A;  2WXJ A;  4I2E A;  5E6P A;  3SD7 A;  1SJE D;  3BY4 B;  4NPN A;  4I2C A;  2EZY A;  2ODG A;  3AE5 B;  3EFC A;  1N60 A;  4BFR A;  2N1V A;  5KG3 A;  4DF8 A;  3RNG C;  3PR5 B;  3QU4 A;  1L0Y B;  4EEN A;  2KTF A;  4A90 A;  2D10 A;  3IRU A;  1GET A;  2BKR B;  3FJ4 A;  3HW2 A;  3MR3 A;  3GIM A;  3TBL D;  2LHT A;  4ED0 A;  3WA0 A;  4WWM A;  1COO A;  8ICJ A;  1BPZ A;  4M47 A;  4KGT A;  2GOW A;  3I1Y A;  1O03 A;  3ZDA A;  2XNA C;  3TJI A;  2P35 A;  4HAI A;  1S0N A;  5D49 A;  1L0V B;  1R4N I;  2DHZ A;  2JV3 A;  1WCL A;  1YIW A;  3UGV A;  2BPG A;  1TKD A;  1UBQ A;  1WJ6 A;  4H19 A;  2ZC8 A;  3R2I A;  1WZ3 A;  1XQQ A;  1Q8K A;  3RH5 A;  1ZOL A;  1QSL A;  2NRX A;  5E6O A;  1EWY C;  3T8Q A;  3AH7 A;  1D9D A;  5IIK A;  2E8N A;  4NWI A;  3AXC A;  4FO6 A;  3UJE A;  2ZUD A;  1WUD A;  3IBE A;  4MGI E;  5J0U A;  4EX6 A;  1NBF C;  1EBH A;  3THU A;  2XVT A;  4ECR A;  3HUI A;  3K9P B;  3TJ4 A;  3JVA A;  1F9C A;  3F2B A;  4C7Z A;  2PGW A;  2I6X A;  4NV0 A;  5AKK A;  4RQ3 A;  9ICB A;  1FEA A;  5HHI A;  5J2J A;  5JTI A;  4IZG A;  3RR1 A;  4IL0 A;  2BZF A;  1QLN A;  4ZA0 A;  3MC0 B;  4PT5 A;  3CGC A;  2FLN A;  2ASQ A;  2XY6 A;  2R2O A;  5U25 A;  4GLX A;  1FM0 D;  4US9 A;  5D7G A;  3CNH A;  2LM1 A;  2BCP A;  2JY6 A;  4JB3 A;  1DZN A;  4MH0 E;  3B2F A;  2BC0 A;  4DNS A;  1Z1B A;  5J2C A;  2MH7 A;  3KHR A;  1GUA B;  3NJT A;  5BYR A;  1FFU C;  3F2D A;  4N9F 4;  4IC7 B;  3ZUN A;  1SIJ A;  4YD2 A;  1KCZ A;  2E8O A;  2ISP A;  4C8K A;  2PU1 A;  1RYS A;  2HOI A;  1S76 D;  4DK5 A;  8ICH A;  2LMC A;  3GE3 C;  2R8J A;  1C1Y B;  2RMM A;  3GZN I;  4J9O A;  2QLT A;  2HI0 A;  9ICF A;  2PFN A;  1P9D U;  2MP2 A;  2PE6 B;  3GQC A;  2FPL A;  1NK5 A;  3FYH A;  2LGD A;  5CTR C;  1YJ1 A;  5KFZ A;  3PV1 A;  4IP5 A;  1L7M A;  1TE2 A;  3IP4 B;  4I2A A;  3A9J A;  4YWS A;  2BB5 A;  5JRB A;  9ICK A;  2ZJD A;  1SXE A;  2W8L A;  1UGJ A;  2CR5 A;  3PW5 A;  2R61 A;  3GS2 A;  4NLB A;  3TAP A;  1TK5 A;  4I2H A;  4EMJ A;  3VR8 B;  4FZM A;  4DOA A;  2PJH A;  2LD9 A;  1N62 C;  3V6H A;  3RR7 A;  1B22 A;  1MG8 A;  4KKJ A;  1H2I A;  1JRP A;  1V1O A;  4A3P A;  4A3R A;  2GLS A;  7ICN A;  5KFD A;  4BCA A;  2PCE A;  1R4M B;  1YQ3 B;  2PA6 A;  2YEP B;  4ZOH B;  4KLJ A;  3TOY A;  5ALM A;  4RPY A;  3KFU F;  1F8W A;  4QZB A;  8ICV A;  3ZIM A;  2HVI A;  1GRH A;  4LVS A;  3UCC A;  4C8N A;  2XGP A;  3RB0 A;  1YZ7 A;  4EQR A;  4AP9 A;  2DL0 A;  3IG8 A;  4H2H A;  3POP A;  3TFR A;  9ICH A;  2W55 A;  4PGY A;  5CA7 A;  2ZXI A;  2W8K A;  2FYM A;  1WWU A;  2WOV A;  1N2X A;  4ECS A;  4P1B C;  9ICR A;  1SB3 C;  2EH9 A;  3WCQ A;  3UM9 A;  5J2G A;  3ZDB A;  1SZH A;  1XLN A;  4GME A;  2J0J A;  2WQY B;  2BWE S;  4RGM A;  3WK6 A;  2XC9 A;  1LKY A;  1W1K A;  1EU3 A;  3UJF A;  3BVZ A;  5CJ7 A;  2QHO A;  2OVL A;  1ZQI A;  4TV3 A;  6ENL A;  3I28 A;  1WF9 A;  2JXX A;  3TX1 A;  2OZ8 A;  1WWT A;  2NPT B;  3QE9 Y;  4M0A A;  2HJ1 A;  3IAS 1;  2Z7J A;  1WZ0 A;  4L2Y A;  2A1A A;  3V3W A;  2ZZB A;  7ICG A;  3QJZ A;  2DWQ A;  4KGS A;  3TL5 A;  5AUI A;  1I4Q A;  2W9C B;  1CMX B;  5BOL A;  2P4P A;  1ZQV A;  1TK8 A;  4DQO C;  3QUB A;  3TQP A;  3E2E A;  3AQE A;  1X40 A;  3VA8 A;  4DWF A;  2A8X A;  2M0X A;  3DCG A;  5FP0 A;  5AI0 A;  2MBH A;  3JPO A;  2AQ4 A;  5L1I A;  1XSN A;  5IO9 A;  3W1S C;  1HUO A;  1VAO A;  4PVH A;  3GIJ A;  4DOB A;  5FR3 A;  2OX4 A;  2KWC A;  3WAP A;  1PGX A;  1ENF A;  2WDR B;  4FXC A;  1D4B A;  3PW7 A;  1NDD A;  4FHJ A;  1WM3 A;  5D3I B;  2A1J A;  3H4B A;  4X2P A;  4F2S A;  1S1Q B;  3MBY A;  2HHQ A;  1ZMD A;  2RSU A;  1JCT A;  3IT4 B;  4XZ4 A;  2E8M A;  1NJZ A;  1RPL A;  5AI6 A;  4MM3 A;  5DBB A;  2V4R A;  5J17 A;  4CF5 A;  1QSY A;  4KSK C;  4OAL A;  3B0Y A;  1I4H A;  4X57 B;  8ICI A;  2W7O A;  4RUA A;  2V4Q A;  3MY9 A;  5U1O A;  3MC1 A;  5EOZ A;  2KJ6 A;  3RBD A;  2GGI A;  4RNM A;  4IG7 B;  2Y9U A;  1QT9 A;  1WXM A;  3EHV A;  5DPT A;  3CB3 A;  3DK4 A;  2WOI A;  2YVC A;  4MKS A;  4DNA A;  5J0R A;  2KJ5 A;  1TAQ A;  4M9G A;  4IHC A;  1WXQ A;  2OHF A;  3LDA A;  2N1W A;  3KLS X;  3CK5 A;  3VCN A;  2GR1 A;  5ALE A;  4N59 A;  4XC2 A;  2Y08 A;  2WFA A;  2FPM A;  2QIE B;  4H4T A;  1TY0 A;  2WAQ C;  2G0A A;  4UAY A;  4Y2V A;  3LK9 A;  2JX5 A;  3KYC D;  3OAW A;  1S3S G;  3P2B A;  2RPV A;  1GV4 A;  1ZQE A;  4KLD A;  5AZF A;  2C2D A;  2BHN A;  4M6W B;  3TQ1 A;  3CW2 C;  2Y3S A;  3QEB Z;  1DYQ A;  4DL2 A;  3FKY A;  1YZ6 A;  2H5X A;  4KVG B;  2LI5 A;  3H9D A;  3QUT A;  1B4F A;  4I28 A;  1SEB D;  1T94 A;  4WWO A;  2JYT A;  2QDD A;  1FD6 A;  5KFM A;  3WU2 U;  5KFE A;  3MR6 A;  4I2I A;  2D8C A;  3HVD A;  4WJN A;  3H4D A;  1FHU A;  4YL8 A;  1TKY A;  4PS3 A;  2C28 A;  2HBK A;  5TZV A;  3OJ3 A;  2F44 A;  3QYP A;  5JU5 A;  3EAO A;  1JW9 D;  2NRW A;  2IO3 B;  4DS5 A;  4E3C A;  4OD0 A;  5J29 A;  1CEZ A;  1S9F A;  2JWU A;  2GBN A;  3T8M A;  5KFF A;  3A7R A;  4KSL C;  1QLB B;  4YR0 A;  2VIX A;  3Q8Q B;  7ICT A;  3EC8 A;  1QOA A;  1WY8 A;  4J03 A;  2WU2 B;  1XAN A;  2KLC A;  2HQM A;  3Q8C A;  5TR3 A;  4W9J A;  5KFS A;  1SXD A;  3Q8P B;  3CGB A;  2FIF A;  4L23 A;  4LII A;  3W2D A;  1MOK A;  3GDX A;  3EPG A;  8ICK A;  2JZP A;  2W3S A;  3K9O B;  2GGE A;  3BIN A;  3DJG X;  5DB9 A;  2XK5 A;  2BBC A;  3N28 A;  2NV3 A;  3AED B;  1WR1 A;  3B97 A;  2KC2 A;  2JVC A;  1X42 A;  3H8H A;  4PH5 A;  2D2Q A;  4W9K A;  5JRT A;  9ICC A;  3NXL A;  3AUL A;  3ONS A;  3C2L A;  2A3V A;  1HEK A;  3VCC A;  3OLM D;  3DBS A;  5KAI U;  4Y2S A;  3D2N A;  1Q1W A;  4KGR A;  3SAH A;  4AP4 C;  2X38 A;  1T6B X;  3DBL B;  3R66 C;  4E0D A;  3RGT A;  3OG5 A;  3RNC C;  3RPF C;  1L0X B;  5G2N A;  4NJ7 A;  3DBH B;  5D4B A;  5DG7 A;  2AGP A;  1B1Z A;  2M17 A;  2CDU A;  3A1Q A;  4ANW A;  1WM2 A;  2IOF A;  1E8W A;  1XU4 A;  1R4M I;  1OGW A;  4N6E B;  2Y1I A;  3RB4 A;  2LVO A;  3T5J A;  3R9K A;  2H3F A;  1WR6 E;  2QKQ A;  1TZO A;  4MEY A;  1W1O A;  2YVG A;  4A55 A;  1Q46 A;  4ZOH C;  3RB3 A;  2MP2 B;  4DBG A;  5FJT A;  2KIV A;  3PVX A;  4H4Q A;  3QZ7 A;  2H3Z A;  2J6U A;  2O2V B;  3T3O A;  3NO1 A;  2W54 A;  3SJN A;  4NJ8 A;  5KT3 A;  3JPR A;  1RFA A;  3EUB 2;  1UA1 A;  4PVJ A;  2F3N A;  1LFD A;  4DQQ A;  2W7P A;  4HG0 A;  3RNA C;  3B08 A;  2K9X A;  1TZ1 A;  4F50 A;  7ICL A;  2DZJ A;  2HBL A;  4PHE A;  1T5X D;  3MFH A;  3KLJ A;  4YXJ A;  1DTN A;  5DQG A;  1ZDL A;  1GJZ A;  4DFD A;  4PYZ A;  1KEJ A;  3SFE B;  3H7P B;  1ZGU B;  3R0U A;  2KFN A;  3KUC B;  5AKY A;  2Y3A A;  2HBJ A;  4CQN A;  4RMA A;  2BYT A;  2KK8 A;  2PPH A;  2E8P A;  4GGH A;  2W9N A;  4Z6F A;  2KP7 A;  4RQ6 A;  2JEG A;  1C4C A;  2GL5 A;  4LJP B;  2P88 A;  4F4Z A;  3EA6 A;  5KG7 A;  2DQN B;  3O0H A;  2WDW A;  2RD0 A;  5BOF A;  2BS4 B;  1V97 A;  2PTW A;  3PRM B;  1SE9 A;  1UHU A;  2L76 A;  5AK4 A;  1N56 A;  3AM9 A;  4ED6 A;  4IWO A;  4F92 B;  3R2T A;  3UMC A;  1ZR6 A;  1AWD A;  1CI4 A;  4RFB A;  5FJP A;  4FLH A;  4WH4 A;  1TS2 A;  4UAZ A;  1ZXI A;  5CB1 A;  4KLL A;  4FDC B;  3V7J A;  1BUI C;  2MQJ A;  3PHX B;  2FKP A;  3VXW A;  2PLS A;  2KSO B;  1KLV A;  3WK9 A;  5EWF A;  2XY7 A;  3ALB A;  1KL9 A;  5B66 U;  1NJX A;  1SL0 A;  1J7A A;  1V49 A;  3TAQ A;  2ZIV A;  3TSJ A;  3KQ4 A;  1X9M A;  1CRX A;  4DHG A;  2KKP A;  2WF8 A;  4BOZ B;  5KFU A;  4M2Y A;  1JMS A;  5DDM A;  4RPZ A;  1HZ6 A;  1PGB A;  2FCS A;  2UVW A;  3NUH B;  4LNI A;  4WQM A;  4D2K A;  4GFI A;  2V4L A;  2KK0 A;  3T5K A;  2OED A;  5ALZ A;  3JW0 X;  5EE1 A;  1ZD4 A;  4B9N A;  1ZMC A;  3MHS D;  4LZD A;  1PDX A;  5B5E U;  2DBY A;  4YFK A;  3RJE A;  1YD8 U;  5HHZ A;  3K1G A;  1XLQ A;  3J9C A;  4ZYS A;  5DPR A;  4DHJ D;  1VZ6 A;  4RQN A;  2XGQ A;  5IIO A;  2N7D A;  1FMA D;  3HWT A;  5FKA C;  5FMH A;  3I6T A;  1NK9 A;  3P4R B;  2F77 X;  1OXJ A;  3M6Z A;  3S2A A;  1TE6 A;  3BSM A;  2IYD B;  3TW9 A;  3DOW A;  4ZYN A;  2K25 A;  1ZRN A;  2AJQ A;  1IM4 A;  1RXW A;  2X99 A;  2DUY A;  4B6W A;  1RAX A;  1RG6 A;  1XSP A;  3VC6 A;  3GV7 B;  1HJP A;  3R7R A;  2LXC A;  1OJT A;  4EM4 A;  3B0X A;  1FEH A;  4QZ8 A;  2NCN A;  3D2H A;  3C1Z A;  1EBG A;  4KKI A;  1SE2 A;  2HE7 A;  3ZDM C;  5ALK A;  1XO1 A;  4IWP A;  1SJH D;  1BT0 A;  3BZK A;  3AE8 B;  2BVG A;  1MQ3 A;  2PVO D;  3AE1 B;  4Z1Y A;  1TKK A;  1DIQ A;  3ZJU A;  2R8K A;  1EU4 A;  5KG5 A;  3Q3M C;  4RQM A;  5F9L A;  2JMG A;  4J9Q A;  2MJ3 A;  3ZYY X;  1CQV A;  1TKE A;  4ZRK A;  4PGQ A;  1NHP A;  1SGH A;  3QUQ A;  4HRO A;  1WMH B;  3AV8 A;  3CF6 E;  1V9J A;  2XO7 A;  2AKM A;  4B95 A;  2KAJ A;  1WGD A;  2PVG C;  5KL8 B;  4BBN F;  4GDL B;  3H6N A;  4J9R A;  2N9P C;  3MHZ A;  3GU3 A;  5KFW A;  2P3Z A;  1J2M A;  4R8U A;  4LZG A;  2JU6 X;  2EAN A;  5DQI A;  3VQI A;  3OZY A;  5ER0 A;  2FE9 A;  2KYW A;  4G3X B;  3PGE A;  5EWE A;  3V4B A;  1XS2 A;  3PNC A;  4NLZ A;  4C4R A;  1FEC A;  3FM9 A;  2ZEQ A;  2LI6 A;  3Q3N C;  4KDL B;  1BPE A;  4UAU A;  1IYX A;  2ZZ0 A;  4DO9 A;  2WXH A;  1EF5 A;  4PYU A;  2XGZ A;  4H4W A;  4GFJ A;  4G3I A;  4AYB F;  1ZD5 A;  3ZXR A;  2DPI A;  2GBK A;  3RJA A;  1I4P A;  5ALT A;  4GGQ A;  4JPS A;  3V6E B;  4EZK A;  3DDH A;  1KN5 A;  1O08 A;  4KLF A;  1XT9 B;  5FS9 A;  3EUB 3;  4EEY A;  1S10 A;  3M6K A;  2DGZ A;  2KFJ A;  3RJ8 A;  2KNB A;  3A9K B;  3KUZ A;  2PMZ F;  4YCX A;  4EUT A;  4JB1 A;  1HQR D;  2WTF A;  5J2A A;  3RRH A;  3M3J A;  4MMW A;  5J0O A;  3PX4 A;  7ICR A;  1I35 A;  4J57 A;  1RQL A;  2CHZ A;  5IA7 A;  4H4Z A;  3PS6 A;  3I4K A;  1L7O A;  3NFU A;  4M0W A;  1NEN B;  2GBJ A;  1MDR A;  2X8G A;  3DGH A;  3KBB A;  4KPR A;  1WRI A;  1KLN A;  4P6V F;  4ACF A;  3D32 A;  3UJS A;  8ICP A;  5J2K A;  3LLB A;  2QMT A;  4EQW A;  4Z6E A;  4MGG A;  3N4M B;  2W9B A;  1B43 A;  2YQE A;  5J0T A;  1BZL A;  3QNM A;  3RJG A;  3ZLG A;  1QQR A;  2DPJ A;  1SL2 A;  1P7E A;  4EBE A;  3IHQ B;  4WJO A;  1RM6 B;  3DG7 A;  3RN9 C;  2WB1 F;  4DEZ A;  4QZE A;  4KLT A;  3TJP A;  2H88 B;  3I9V 1;  4UAV A;  2GRI A;  3DVN U;  4HEA 1;  3VTW A;  3W8W A;  2JGA A;  1S8O A;  2LMR A;  2WBA A;  3HT3 A;  1SV0 A;  1GG3 A;  3NOB A;  4NQK E;  3ENE A;  2NQW A;  1SF0 A;  1Q1O A;  4AQ7 A;  3WK7 A;  2DYM A;  2WXN A;  1X2G A;  1EM7 A;  7ICS A;  4ZDV A;  3PFR A;  3QLD A;  3BS5 B;  4XA5 A;  2KT7 A;  3L8K A;  1LQB A;  8ICY A;  4HDO A;  3V72 A;  3Q8R B;  2AHO B;  2M9N A;  1L6N A;  1GRB A;  2L32 A;  4NL9 C;  4NM1 A;  4RF0 A;  2KDM A;  4P0Q B;  3ES8 A;  3RH6 A;  5KFX A;  3C0P A;  1IUE A;  2DYB A;  3QAQ A;  2WS3 B;  2P6U A;  2W9C A;  2A5U A;  2WX0 A;  1C7Y A;  1YX6 B;  4HNC A;  1QQ7 A;  1J0G A;  2HOQ A;  3BW7 A;  3SZ2 A;  2QVH A;  1PZN A;  2QSD A;  3SDL C;  1FFV C;  1ZQY A;  2QC8 A;  3SV3 A;  4JE3 B;  3H7P A;  1KFY B;  4E6M A;  4PWC A;  3V60 A;  3MGI A;  8ICA A;  2JZ3 B;  4M02 A;  8ICN A;  3L0W B;  1ACC A;  4XQ8 A;  1GC6 A;  2GR0 A; 
#chains in the Genus database with same CATH homology
 1TS3 A;  3NRZ B;  1TS4 A;  1GOZ A;  4PYT A;  1YMH E;  2V3N A;  2B76 B;  2BS2 B;  3P42 A;  1OQR A;  3HUI A;  2IJ0 A;  1WGK A;  4A9A A;  3S1D A;  1VZ8 A;  3KWL A;  4C56 C;  1NVI D;  1F0Z A;  3PQB A;  4C7Z A;  1KLU D;  4DXF A;  4ML8 A;  1QKZ A;  4OHJ A;  2I2Y A;  1TY2 A;  4OZA A;  1MBT A;  4IOI E;  1W1J A;  2V0G A;  3EGR A;  1I4G A;  3MC0 B;  4PT5 A;  4PZF A;  1VR9 A;  2WDV B;  1V1P B;  3KWV A;  1A70 A;  2WU5 B;  1FM0 D;  4US9 A;  5D7G A;  3DED A;  4RGT A;  1DGJ A;  1DZN A;  3B2F A;  1QF6 A;  2P13 A;  4J3O D;  4DNS A;  4XWW A;  2Y5P A;  2MH7 A;  4YTN B;  3W8Z A;  4RCO A;  1L4D B;  5BYR A;  4MH8 A;  1FFU C;  3FW8 A;  1SIJ A;  4YSZ B;  3IXS A;  4OZC A;  4JWU C;  1ZE3 D;  1YNT E;  2LMC A;  2OAI A;  1K52 A;  3B2G A;  2NTT A;  1FIQ B;  2RMM A;  3AE9 B;  1L4Z B;  4JAY A;  3I99 A;  4MLA A;  5I4D A;  4YSY B;  2H89 B;  3KJM A;  4PWB A;  5G5G A;  4LK0 M;  4HJG E;  3NVW B;  4XE0 A;  2AXR A;  2BB5 A;  4HKQ A;  1UGJ A;  3GS2 A;  2BVH A;  2R61 A;  3FIL B;  1HZ5 A;  3VR8 B;  1N62 C;  5HG2 A;  4KKJ A;  3BVG A;  4RF1 A;  1JRP A;  1UUP A;  1V1O A;  3L4P A;  4BC7 A;  1GPX A;  3W1S A;  4BCA A;  1AYF A;  1AN8 A;  1YQ3 B;  2YEP B;  4ZOH B;  1MVK A;  2JYE A;  2LEK A;  2VFS A;  1W1S A;  1ROE A;  4YTM B;  3MJ5 A;  1SE4 A;  3POP A;  5EE0 A;  4WUR A;  2W55 A;  1DII A;  4ZHO A;  2IGG A;  3S1F A;  1AHZ A;  4Q2J A;  1FRR A;  4REZ A;  1FCL A;  1HXY D;  2WLB A;  1JWB D;  5BYQ A;  1SB3 C;  5C2T B;  3WCQ A;  4XWT A;  1XLN A;  2AQ2 B;  3UI3 A;  4A8X C;  1IBX B;  2WQY B;  3NVZ A;  4RGM A;  2Y5C A;  1I19 A;  1W1K A;  1EU3 A;  1Y56 A;  2IGH A;  3BVZ A;  2Z8L A;  1PUT A;  2G9H D;  1J7C A;  3TX1 A;  3NS1 B;  4JWS C;  1WWT A;  5AE2 A;  1W1L A;  3IAS 1;  3MP9 A;  4KX6 B;  4L2Y A;  2LUM A;  3ZQ4 A;  1NI3 A;  3TUO A;  2DWQ A;  1ZUD 2;  4ZHP A;  4KGS A;  5AUI A;  1E9M A;  1I4Q A;  4XDD A;  2P4P A;  1N5W A;  2Q4W A;  4BC9 A;  4DQO C;  2QJL A;  4RNA A;  1STE A;  3P4Q B;  1DOY A;  5FK9 C;  5BMH A;  1DOX A;  3TEY A;  1SSN A;  5MPO A;  3B9J A;  1E7P B;  4EC3 A;  1ZDV A;  1PGA A;  1VAO A;  4PVH A;  1VJK A;  3PO0 A;  3ZJT A;  2QIL A;  5FR3 A;  4UD8 A;  1PGX A;  1ENF A;  2WDR B;  4HKZ E;  1KLG D;  4FXC A;  1XLO A;  1D4B A;  1D5Z C;  3FW7 A;  2O3G A;  5D3I B;  2N9K A;  3PM9 A;  5HQX A;  2BW2 A;  3AEF B;  3TSH A;  1HSK A;  3IT4 B;  1IGD A;  3R8B A;  3NVV B;  5FXF A;  5K8E A;  2IPK D;  4NAM A;  1N60 C;  4C80 A;  1JWS D;  5FXD A;  4US8 A;  1E8G A;  4OAL A;  1I4R A;  1I4H A;  5AWV A;  1V1P A;  3AMZ A;  1ZXH A;  2R2Z A;  2J52 A;  3CIR B;  1XXG A;  3GB1 A;  2ACZ B;  5JXV A;  1JAL A;  4TVW A;  1QOF A;  2JQR B;  2WXP A;  3N9Y C;  4B0E A;  1QT9 A;  3U2S C;  3HRD C;  2ZW0 A;  4ARI A;  1JWA D;  3FW9 A;  1WXQ A;  2OHF A;  2WP9 B;  3KLS X;  2FE8 A;  1M4V A;  1ZDX A;  4N59 A;  4TSS A;  1C9F A;  3VRA B;  3NVY B;  2Y08 A;  1F2R I;  2QIE B;  2WXL A;  2WXR A;  4P16 A;  1TY0 A;  1V8C A;  2JX5 A;  4LTU A;  1MHH E;  2RPV A;  2PIA A;  2INN E;  1MI0 A;  1UXY A;  2GB1 A;  1IBX A;  1DYQ A;  2Y3S A;  3PZ7 A;  3S1C A;  1WVE A;  1QOG A;  4XLO A;  2J53 A;  1NEK B;  1SEB D;  2IDY A;  2IGD A;  2VFR A;  2JYT A;  2W3R A;  1FD6 A;  1KTK A;  3S1E A;  1SBB B;  3BK2 A;  3AEG B;  4LLG M;  1FFU A;  1CJE A;  3HVD A;  2ON8 A;  3AEB B;  3Q8E A;  3OWE B;  5G5H A;  3P63 A;  2PMV A;  1L6U A;  1TKY A;  5EE9 A;  2EKI A;  1JW9 D;  1XF5 L;  3AE6 B;  3NZ3 A;  3A7R A;  2JWU A;  3ABV B;  2RDG A;  1BML C;  2PLP A;  1QLB B;  1OFF A;  1MBB A;  3JS8 A;  3NRZ A;  4RGN A;  1QOA A;  2WU2 B;  3C8Y A;  3Q8C A;  1XCQ L;  3AB5 A;  3ZJV A;  4L23 A;  3IT6 B;  3P1M A;  3W2D A;  2PW9 A;  2JZP A;  1E0Y A;  2W3S A;  2NMQ A;  1L5P A;  1YQ4 B;  5TSS A;  3BII D;  4ITK A;  2BBC A;  1GB4 A;  2NTS A;  2VAO A;  3SR6 B;  2CU3 A;  2LGI A;  2E5A A;  3AED B;  3U4E G;  1ZP0 B;  3H8H A;  2PKO A;  3P4P B;  1SB3 B;  1E6E B;  5BMG A;  2J4X A;  1Q10 A;  3VTE A;  2FUG 1;  2AQ1 B;  1SE3 A;  4KGR A;  2WXK A;  3BK1 A;  2X38 A;  1T6B X;  1K51 A;  3AE4 B;  4RGO S;  3D2J A;  2L83 A;  1K53 A;  3RPF C;  1L0X B;  5L6F A;  1AW7 A;  2ZW1 A;  3D2D A;  2TSS A;  2I38 A;  1B1Z A;  2AX5 A;  2DLB A;  3GSY A;  1KRH A;  2EEL A;  1PYW D;  1YN3 A;  1FNW A;  4N6E B;  1WYG A;  1C76 A;  1FNU A;  2JSV X;  2E3T A;  3W5V B;  3AE7 B;  1NYR A;  1TZO A;  1TKG A;  1W1O A;  3ETR B;  4A55 A;  4ZOH C;  3BYY B;  4XDC A;  4UDU C;  1F0X A;  3FWA A;  4MAC A;  1C4P A;  5FXP A;  2LFI A;  3T3O A;  1QOB A;  2W54 A;  4IDI A;  5G5G B;  3EUB 2;  2WXO A;  4TQ1 A;  2BB6 A;  4PVJ A;  2YVS A;  1P7F A;  3P4S B;  5L6G A;  2R8D A;  2CJN A;  4R3D A;  4HG0 A;  5I1W A;  2K9X A;  2Y3R A;  1RM6 C;  3LB8 C;  5D3D A;  1T5X D;  1N5X A;  3GP7 A;  4OW0 A;  5HFY A;  5LNK 1;  1FFV A;  5BMI A;  3BZD B;  3MFG A;  4TMA B;  5AUK A;  2XN9 C;  3NVV A;  2FBW B;  3SFE B;  2BTE A;  3LAE A;  2Y3A A;  4TQ0 A;  3VRB B;  4CQN A;  1JQ4 A;  2BYT A;  2Y4G A;  2ONQ A;  3I57 A;  3SFD B;  3E9S A;  3V3X A;  3AE2 B;  1C4C A;  2MBR A;  2YEP F;  3EA6 A;  2J42 A;  5HHD G;  2WDW A;  5C3J B;  3NVW A;  2BS4 B;  1V97 A;  1JRO A;  1ZPS A;  2M56 B;  2RDH A;  2PLI A;  4OZB A;  3AM9 A;  3R2T A;  4HRS A;  2WXF A;  1AWD A;  1FIQ A;  1ZR6 A;  2I0K A;  4RFB A;  1XO3 A;  4AS1 A;  4WH4 A;  1TS2 A;  1I4X A;  1ZXI A;  1E8H A;  1WVF A;  4ARC A;  1BUI C;  5FXE A;  2WDQ B;  1XEE A;  1YJI A;  2PLS A;  1MPE A;  2SEB D;  4DXG A;  3DQ0 A;  4H2A A;  1UWM A;  3SR6 A;  1J7A A;  1MHX A;  2GQT A;  3TSJ A;  3LXF A;  3KQ4 A;  1ESF A;  1HZ6 A;  1ZOY B;  3NUH B;  1PGB A;  4WQM A;  4D2K A;  4PVK A;  2UUU A;  2MJD A;  1FNV A;  2UUV A;  4JX1 C;  1W1R A;  1R7S A;  2OED A;  3W9C B;  2JXT A;  1X2H A;  5GXG B;  5EE1 A;  5H8Y E;  4GLS C;  2G1E A;  4O1N A;  3Q8A A;  1E0Z A;  2NQW A;  3ZGZ A;  1PDX A;  5HHZ A;  2DBY A;  4O95 A;  1VLB A;  1XLQ A;  3J9C A;  2V3P A;  4ZYS A;  5EE3 A;  5G5H B;  1W1Q A;  1SXT A;  3AN1 A;  1C78 A;  1VZ6 A;  1VQZ A;  2WXQ A;  4NAW B;  1W1M A;  1FMA D;  3W8X A;  1D5M C;  3Q8F A;  5FKA C;  5D79 A;  2K3U A;  3FC4 A;  3Q8B A;  3B9J B;  3P4R B;  5T8I A;  3TSS A;  3ETR A;  3PZ8 A;  3DWM A;  2HDE A;  2ICI A;  1C77 A;  1B9R A;  4YWG G;  4YTP B;  1E8F A;  2KQ4 X;  3TEX A;  4NZL B;  3SEB A;  2Q85 A;  1VRA B;  1VDV A;  3NVZ B;  1FEH A;  3D2H A;  2VZK B;  4KKI A;  1FCC C;  1SE2 A;  1JWU D;  1IGC A;  4USA A;  1WSP A;  1SJH D;  1RYJ A;  3AE8 B;  1N63 A;  2L52 A;  2BVG A;  3O13 A;  3AE1 B;  2PVO D;  2KAC A;  2P3H A;  1CK1 A;  1TJE A;  3VR9 B;  2M19 A;  5E6J A;  1DIQ A;  2K0P A;  1HEZ E;  3ZJU A;  1N63 C;  2VFU A;  1EU4 A;  2HTM E;  2N9L A;  2IPI A;  1QLU A;  2MJ3 A;  1FXI A;  1CQV A;  1OQQ A;  1TKE A;  3BYT B;  3ZYY X;  2AQ3 B;  4WIP A;  1EWC A;  4HRO A;  5I1V A;  3A7A A;  3AV8 A;  4YSX B;  4MT5 A;  2N7J A;  4EE2 A;  2RK5 A;  3FAH A;  1DOI A;  2KAJ A;  2PVG C;  4GDL B;  2BVF A;  1HA5 A;  3MHZ A;  4L1B A;  2QPM A;  2DYO A;  3W5U B;  2PTL A;  4MM3 B;  2JU6 X;  3VQI A;  3TEZ A;  1D6E C;  4NJC A;  4GDK B;  5AE1 A;  2L1A A;  2MJE A;  2LHD A;  2VFT A;  2KMM A;  1C79 A;  2INP E;  1I7H A;  1N61 C;  3U7Z A;  3T3N A;  2WNM A;  2WXH A;  2SAK A;  4BBY A;  2WXM A;  3IAM 1;  1YN4 A;  1L6V A;  4N58 A;  1KH0 A;  3RJA A;  5HMR A;  1F2R C;  1I4P A;  4JPS A;  1EWY C;  1ET6 A;  1QLT A;  2W82 A;  2GI9 A;  3EUB 3;  3RJ8 A;  4PVE A;  4JB1 A;  1HQR D;  2QEJ C;  4C7Y A;  1JCK B;  2K5P A;  1GB1 A;  3A7U A;  3AEA B;  1C4A A;  2LJI A;  2KWD A;  4A6Q A;  3V05 A;  2M0A A;  4OVZ A;  1CZP A;  3FIL A;  1ZXI C;  4M0W A;  1NEN B;  1UNS A;  3RFZ B;  4ZRQ A;  1WRI A;  5BYS A;  4P6V F;  3HRD D;  3NVY A;  1AHV A;  1TS5 A;  1QIL A;  3URY A;  4YT0 B;  4IKG A;  2D5G A;  3BVM A;  2GQU A;  3LLB A;  2WXI A;  2QMT A;  1YN5 A;  1XCT L;  2K22 A;  3U52 E;  1RFK A;  4WAF A;  5H92 C;  1N62 A;  1QQR A;  3Q69 A;  1GAQ B;  1P7E A;  4TVY A;  5AE3 A;  1RM6 B;  1K50 A;  2N0S B;  2VFV A;  3AEC B;  1TYG B;  1FXA A;  1VZ7 A;  2H88 B;  3I9V 1;  2GRI A;  1T3Q C;  4HEA 1;  2MEK A;  4ZRP A;  3AEE B;  2EXR A;  2LHE A;  3W8W A;  1J7B A;  1N61 A;  5ADZ A;  1AHU A;  3DWG C;  3HVZ A;  1XLP A;  1LO5 D;  5HI1 A;  1JML A;  1D5X C;  1ET9 A;  4B0M A;  2KN4 A;  2WXJ A;  3TEW A;  1SJE D;  2Q5W D;  3E56 A;  1SF0 A;  1X2G A;  1KF6 B;  4YXD B;  2DYM A;  2WXN A;  1N60 A;  3AE5 B;  4AQ7 A;  1EM7 A;  1RWS A;  3CWI A;  2BT6 A;  2WXG A;  2QKN A;  1F77 A;  3LYY A;  3NS1 A;  1L0Y B;  4A90 A;  2CJO A;  2L32 A;  1YJJ A;  3BWU D;  4RF0 A;  2KDM A;  2BS3 B;  4WWM A;  3C0P A;  1BXT A;  1T3Q A;  1IUE A;  1NYQ A;  4KGT A;  3HSU A;  2WS3 B;  2E6X A;  1UWX A;  3R07 C;  2V4I B;  1E10 A;  2XNA C;  4RH6 A;  3AE3 B;  3BW7 A;  1FRD A;  1L0V B;  2QSD A;  1FFV C;  1PFD A;  4JE3 B;  1KFY B;  3R2I A;  4PWC A;  1FO4 A;  1JWM D;  1ACC A;  3AH7 A;  1N5W C;  2VZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...