2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
molecule tags Oxidoreductase
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
4ITKA 2PVGC 2WDQB 5AE2A 3DWGC 1KF6B 1TKEA 1I7HA 4PVKA 3SFEB 3JS8A 1ZP0B 2ACZB 1WRIA 3HVZA 3C0PA 1E0YA 2BVHA 5FXFA 3W8WA 5FXDA 3VR8B 2KAJA 2R8DA 1XLNA 4ZHOA 1GPXA 2WP9B 2P13A 1RM6B 4WWMA 3B2GA 3VRBB 2GQTA 1DGJA 3FC4A 4ZOHB 2DWQA 3NVYB 1EWYC 1FFUC 3DQ0A 1T3QC 1NI3A 3AV8A 4C7YA 4FXCA 3ZYYX 1SIJA 3DEDA 3PM9A 3A7RA 5ADZA 1DOXA 5MPOA 1ZXIC 2LEKA 4EC3A 4BC7A 1FM0D 3ETRB 1IUEA 3VTEA 3KWLA 3FAHA 4PVEA 2YVSA 1WWTA 3NS1A 4YTPB 2OAIA 3CIRB 1RM6C 1E8GA 3R07C 2RK5A 4ZOHC 1MBBA 1GAQB 5AE3A 1FRDA 1QLBB 5HQXA 1N63C 4XLOA 2HTME 2AXRA 1OFFA 1OQRA 1FMAD 2VFUA 1E0ZA 4C7ZA 3AN1A 1N61C 3TSJA 1NVID 3S1EA 1PFDA 1V97A 2E5AA 4IDIA 4YT0B 1SF0A 1CJEA 3AEGB 3SFDB 1F0ZA 1XO3A 2M19A 2Q4WA 1E6EB 4YTMB 2VFRA 2VFVA 4JX1C 3LLBA 3ABVB 1XLOA 3KJMA 3VRAB 3P4QB 1YJJA 1AHVA 1AYFA 3AMZA 2H89B 4N59A 2WLBA 1E8HA 1W1MA 3NVZB 1W1JA 1DIIA 2OHFA 1TJEA 3CWIA 2QKNA 3NVWB 2N0SB 1JALA 3AEAB 1KFYB 2VFTA 3TX1A 4PWBA 2PIAA 3P4PB 1YQ4B 5AE1A 1DOIA 1JW9D 3HUIA 3LXFA 3B9JA 1FIQA 3AE4B 5D79A 1E10A 3NVVA 2BS4B 1CZPA 1RFKA 4N58A 4YTNB 1A70A 2GQUA 1RWSA 1E7PB 2AX5A 1WGKA 3D2JA 5FXPA 5G5GA 4PVHA 3A7UA 4BBYA 1L5PA 1L6UA 2L52A 1AHUA 3AE8B 2PLSA 1AWDA 1QLTA 1NEKB 3P63A 1ROEA 4MLAA 1FXAA 1TYGB 5EE3A 1KRHA 1ZR6A 2B76B 3AEDB 2PLIA 4HG0A 2L83A 4HROA 5EE1A 2JX5A 3L4PA 1RYJA 2PVOD 1FO4A 2G1EA 2WU2B 4O95A 3AE3B 5G5HB 1VDVA 3S1FA 2DBYA 4PYTA 3PO0A 3NRZA 5C3JB 1FXIA 1VLBA 2MH7A 4TVWA 1N5XA 4DNSA 1QOBA 2QIEB 1JWBD 4WQMA 2H88B 1VJKA 5FXEA 2MBRA 3W9CB 3FWAA 1W1KA 1W1LA 1L0VB 3FW7A 1NENB 2Y5CA 3NVVB 2Q5WD 1V8CA 1QLUA 4UD8A 1QOAA 4N6EB 2EKIA 2NQWA 2BVFA 1J7CA 3AE6B 4BCAA 2BVGA 3AH7A 3W5UB 2VAOA 4BC9A 4ML8A 4YSZB 1AHZA 1DZNA 1N62A 4HRSA 2WQYB 2WU5B 3GSYA 4PWCA 3AB5A 1SB3C 3NVYA 1N5WC 2WDRB 2WS3B 1FFVA 3AEEB 3A7AA 4OALA 4YSYB 3AEFB 5H92C 2WDVB 2K5PA 3AECB 1N60A 1N5WA 5EE9A 2E3TA 3EUB2 2CJNA 2MJDA 4PVJA 2CU3A 3AE7B 4JB1A 3ETRA 3AE5B 1JWAD 3NS1B 2K9XA 1J7BA 2M56B 1W1QA 1WVEA 2P4PA 1YJIA 2W3SA 4US9A 1QOGA 1QF6A 1W1RA 2EXRA 2K22A 2QJLA 1B9RA 3AE2B 1JQ4A 2CJOA 3BW7A 1PDXA 1OQQA 4KX6B 1X2GA 5HHZA 2W54A 2Q85A 1VAOA 1HSKA 1F0XA 5H8YE 1WXQA 2VFSA 3AE1B 3AE9B 2BS3B 2FBWB 5C2TB 3SR6A 2PKOA 2W55A 2JQRB 3EUB3 3VR9B 1E8FA 1YQ3B 1XLPA 1SB3B 3I99A 1FRRA 1FFUA 2KMMA 1X2HA 3NVZA 3D2HA 1T3QA 3FW8A 1VQZA 4YSXB 1L6VA 3NVWA 4ZHPA 1QT9A 1MBTA 2O3GA 1W1OA 4JAYA 1NYQA 3LB8C 3B9JB 1FIQB 3TSHA 2MJ3A 3AEBB 2I0KA 1JROA 1R7SA 3WCQA 2BT6A 1ZXIA 1TKYA 1N62C 1QOFA 3S1CA 3BIID 2QPMA 1DIQA 1I19A 2P3HA 4LTUA 5G5GB 5GXGB 1W1SA 1PUTA 5HMRA 1UXYA 1UWMA 1FFVC 5EE0A 3W5VB 3W8ZA 1NYRA 4JWUC 2MJEA 3FW9A 1WVFA 4US8A 3D2DA 1ZOYB 1E9MA 1N60C 4TVYA 3P4RB 4PZFA 1N63A 2W3RA 4YXDB 4P6VF 3DWMA 3AM9A 3HRDD 1WYGA 1DOYA 1ZUD2 4JWSC 4USAA 1XLQA 3RPFC 1N61A 5AUIA 3HRDC 2BS2B 3NRZB 3P4SB 5G5HA 3SR6B 3P1MA 3W8XA 1J7AA 4C80A 3S1DA 1JRPA 3B2FA 3LAEA 1TKGA 4A9AA 2R2ZA 5AUKA
chains in the Genus database with same CATH superfamily
3CXBA 1MC8A 4E3CA 1DOQA 3IVFA 9ICKA 3A4SC 4LCDE 3HKZF 2WXOA 2XN9C 2WDQB 2JZPA 2OJRA 4OVVA 1SWWA 5C0YA 3RR8A 5AK5A 2IOFK 2GL5A 2PTXA 4DOCA 3PZDA 4ARCA 1I7HA 1F2RC 3K9OB 1WRIA 2H3FA 3QLDA 2HNEA 2LD9A 4O3PA 3TFRA 2O2VB 2WAQF 3HVZA 1UT8A 4IM0A 1NZBA 2C3CA 3GIMA 3M8RA 2V4QA 3H4KA 3C5FA 4M6WB 1JPMA 2FLPA 4YWGG 4QWEA 4HPNA 1B0XA 2F2AB 4ZHOA 1QQ7A 1UCVA 8ICVA 1QH9A 2M9NA 3PX6A 2JRHA 3DG6A 2DQNB 4TUPA 2R18A 2C3DA 5J2JA 3B2GA 5KAIU 4WWMA 5KFMA 3KYCD 3FC4A 1LV5A 2DWQA 4BVUC 3NVYB 2BCPA 1FFUC 4QWDA 3HW8A 1VCBA 4J9LA 3V3XA 5L1IA 5ALWA 1Q1OA 3TKAA 5ALRA 3ZTDA 1JWMD 2NRWA 4TUQA 4ZYNA 1S97A 2Z7JA 3UXOA 3JVAA 5CHGA 1PYWD 1URJA 3RCYA 8ICLA 8ICQA 1J97A 3ORYA 4EWJA 1UQVA 5B66U 2WOWA 3CYJA 4GDKB 3GB1A 1FD6A 2KYWA 1GXFA 4J9QA 2LJ5A 2GR2A 2WTFA 2OKTA 2LEKA 4W9EA 1GC7A 3U7DA 4HYRA 2I2YA 1MOKA 3B08A 5CHVC 3BJSA 4RQMA 3TEXA 3VC5A 5AM0A 5ALEA 2D6FC 3ETRB 8ICAA 4H4QA 2BC0A 2BQRA 3D46A 3DPDA 3VTEA 3EANA 3ZDCA 2PI5A 3BQ1A 2J0JA 3APDA 3PHWB 2GOLA 4PVEA 3AL0B 4Q8FA 2YVSA 3R2TA 4IUMB 1XNSA 3UQAA 1IP9A 1QKZA 2KFJA 3NASA 5KFYA 1WCNA 1RXVA 3ZUNA 4B9KA 9ICRA 1P0RA 3ZXVA 4DLEA 1XCTL 2ISPA 2KNBA 2JZ3B 3ISCA 2RK5A 3HSUA 1RG6A 2LYAA 4LNFA 3KVFB 2L1AA 2KDEB 3SZ2A 1ZK7A 3URHA 2B6GA 2VRRB 5L1JA 3SJNA 3BZDB 4XLOA 1KTKA 2M17A 2AXRA 4JMUA 3P42A 2ZCBA 1OFFA 3I76A 5J17A 3Q8QB 4DQIA 1OQRA 3CB3A 4E8GA 7ICRA 2VFUA 2NO5A 2O6VB 1B22A 5D3DA 4KGTA 3BINA 4NAMA 3PPAA 4EZJA 2BWFA 3BS5B 3S1EA 1KM7A 2HD5B 1V97A 3AXCA 3DVGX 4TSSA 3R3MA 2VKQA 4KLOA 1ZMDA 3HKZC 4PJ0U 4YMMA 2AQ0A 3KLSX 2P8CA 4NJ6A 2FNJB 2MWSB 3AEGB 3GZNB 2FPKA 4TKNA 3H8SA 3DFHA 2M19A 4H4UA 3RGTA 2Q4WA 2C5LC 2YVGA 2K3UA 4NV0A 2WXKA 5AKKA 5KG0A 3ABVB 1XLOA 2UWQA 4P1CC 1VRAB 5HHHA 1FEHA 2BKFA 2N7JA 3KJMA 3H8JA 4ROPA 4JK1A 2BQ3A 1TS2A 3PT2B 2PGWA 4HLEA 4K81A 1YJJA 1ZDVA 2VA8A 3CYMA 1ZJNA 1AYFA 2ZNVC 2PFOA 2EAOA 1M4VA 5AK6A 1TKDA 3V05A 5DB9A 3C5GA 3SI8A 4DSJA 1L2NA 4P7IA 2ALZA 1SWVA 4DQQA 1WH3A 3AI5A 2ZJDA 5AM3A 4O9MA 9ICIA 3RZFA 2AU0A 1D8BA 4NY8A 2NVUI 1YZ7A 1S76D 2PCEA 3R10A 3ZTCA 2AL2B 1U45A 3I3TB 1C7YA 4M8NA 3P4PB 3SHQA 3ZDEA 3BK1A 3CGEA 3H7VA 4RNNA 1JW9D 3PV1A 2Y5PA 3B9JA 2MP2B 2KJRA 3H12A 5K4LA 2L8JA 2XICA 3NVVA 3E9SA 1HTOA 2LASA 1TAMA 5EOZA 4EM3A 4DX3A 4YTNB 2JU6X 2JZBB 1E7PB 3VCCA 1WGKA 3ZLZA 2NPTA 3CGCA 3I5JC 1TK8A 4EZKA 2KANA 3IM1A 3KUZA 1G6JA 1NJYA 2LUMA 4X2PA 2I1JA 4PVHA 4KZ0A 1I4QA 3LK9A 4DEZA 3UXKA 1V9PA 2G0AA 1TZ1A 3SMVA 2L52A 1AHUA 2PLSA 2EZZA 1BQGA 3UJ2A 1VZ7A 4APNA 2IGGA 4F72A 4J56A 4JN7A 4RQNA 2K0PA 2FE8A 1STEA 2KX3A 2OPJA 2EELA 3C23A 1ECQA 2RP5A 1UHUA 5CRXA 3SN4A 4MLAA 3ZI4A 4A3RA 1TYGB 2J42A 3RJJA 5EE3A 3KYDD 3SD5A 2BZFA 2Y0SC 2I6XA 2HHTA 2L00B 3EA6A 3FKYA 1XT9B 1ZR6A 2LPEA 3JPTA 4ZA0A 2ZADA 1IXRA 3AEDB 2OH2A 2NBVB 2P3ZA 9ICLA 1V2YA 2CHWA 4OD0A 2EZXA 2HOQA 4AOFA 1H4RA 1MUCA 4WAFA 3H4BA 1JX4A 4ZRIA 1L4DB 2BVCA 2G1EA 2TSSA 2WXIA 2ZZ0A 3OGUA 1P7FA 1TAQA 5ALGA 5G5HB 3MP9A 4FS2A 1WMHA 2K4EA 2BYEA 1Z2MA 2PP0A 2KFKA 2BTEA 2DBYA 4QZAA 1ZKHA 4FO6A 4PYTA 2KVZA 3RB3A 4OJPA 2K8BA 3TOYA 1P1AA 1FXIA 2KMCA 1FNWA 4W9FA 4DWDA 4HXDA 2YMMA 1JN3A 4IOIE 4KIKB 4LK0M 4DNSA 1JIHA 1OJTA 1K5OA 2C7NB 4IM2A 2F77X 5HKHA 2QIEB 4YCXA 1Q3UA 4W9DA 1ZQLA 4IW0A 4Y2SA 2KDIA 4L1BA 2HZGA 2ZUCA 4HN8A 3DJGX 3UJFA 1XEEA 3C21A 2BDPA 5FXEA 1ISNA 2CHZA 2IZVB 2UYZB 5KFFA 3VUYA 1Z19A 4NJ8A 2YMPA 2HI0A 2RHFA 4ACFA 1L6NA 2V4RA 2G06A 4MACA 4II2B 3H0RB 3HJEA 3EHVA 2J53A 3ZVHA 3ZVIA 4RQ6A 2MSED 3MC9A 1L0VB 3O13A 4A3PA 2A19A 2Y5CA 2J4XA 4YXJA 3X0WA 4OO1J 2HHQA 4DFDA 4QZBA 2RDIA 3C2MA 3D32A 4UD8A 4J3ZA 1ZQVA 2KKCA 2NQWA 2LGSA 5KFSA 2GBJA 2BCVA 2Y9UA 1I4PA 2BVGA 5GMVA 4JB1A 8ICBA 5IIOA 2FI1A 2WGSA 5CP2A 1ED1A 3DG3A 3WAOA 4BC9A 2W8KA 1UF0A 3K75D 1YJ1A 4EBDA 4CRXA 2UU7A 5KHOA 1AHZA 4IWPA 1V38A 2RSUA 1Q1RA 1GOZA 5FJUA 4RNAA 2JEIA 9ICEA 1DXLA 3WK6A 2X8CA 3WIMA 4F3OA 1ZQSA 3WK8A 4RF1A 4R64A 3TARA 1BWCA 4HCDA 4TUUA 5J2CA 2XGPA 3PSEB 1N5WC 3MABA 3Q8CA 2H3IA 3I57A 1WXVA 2LKYA 4H4RA 1NK8A 9ICTA 3DFYA 1SBBB 3T3FA 5ALDA 2BGWA 3BVGA 2RR9A 2MNRA 1XXGA 2EQYA 2KKVA 2N7EA 1UGJA 3WKBA 4YSYB 4GXIA 2XGZA 1ENFA 1YN3A 5DPSA 2XK5B 3U2SC 1DTNA 1WIAA 1C76A 4R3DA 1ECWA 3AU4A 3RNFC 3TMPB 2E3TA 4WJQA 1WUEA 4RZRA 1QLNA 2XO7A 1FEZA 4RUCA 4Z1YA 1N2XA 3PNCA 3M1YA 2CU3A 3AE7B 2NR2A 3UMGA 2J0KA 1OW5A 5KFIA 4NNJB 2MU2A 1GB1A 4O3RA 3H8MA 2X8XX 1HA5A 3VTWA 4I2IA 4XGAB 4HAIA 1XS2A 2XCPA 4I2GA 3NS1B 2V4IB 2H5XA 4BAXA 1F9CA 5DBCA 2IMWP 3C1ZA 3BY4B 3KD3A 3QX7A 3IK4A 3X23A 2K9XA 5KFUA 2BQQA 3N3KB 2M56B 3ML9A 4M02A 2ZZCA 4JN8A 4E5TA 1S8OA 1UA0A 2GGGA 1KEJA 3PW0A 2DKXA 2VH2A 3JYUA 3H6NA 4I2EA 2Y5BB 1JRUA 3LYYA 4K3BA 4FZLA 2GWSA 3H9DA 4M0WB 4DDGD 1W6TA 4RCOA 3LXDA 4YR0A 3N30A 2ZPNA 2XH7A 4DK5A 4YR3A 3VTVA 4JDRA 1QF6A 4TQRA 1WZ3A 2LM4A 1ZY8A 3DJJA 2QJLA 3WK4A 1LM8B 4RT2A 2LHEA 3EWAA 1XSPA 3D2QA 1B9RA 4JQWC 4KLJA 1NDDA 4ED2A 3GDXA 1NI2A 4CDGA 4K7UA 4PHDA 4PHEA 5D7GA 5DLFA 3KOOA 3LVWA 8ICUA 1K1SA 3DBSA 4MH0E 4OZCA 4FBJB 4HKZE 2W9BB 5EU9A 1CQVA 4P4OA 5HMLA 2LHDA 2CN1A 3Q8PB 4NLBA 3R9KA 1ZQIA 2KOBA 1PDXA 1OQQA 3A33B 3AU5A 1SIFA 5ENLA 2AL1A 1LB2B 1PDZA 2D11A 4I2JA 4DSLA 3JSVB 2Q85A 2FCSA 3D9XA 4AP4C 1F0XA 3ZW3A 4I2HA 4GXJA 5AM5A 3AUOA 3DBHB 3IHPC 1WXQA 5DG7A 2K6DB 3SQIA 2FIDA 3O65B 5KL1B 1I42A 2UVVA 5KT7A 2PKOA 3PZ7A 3BS7A 3T79A 4I27A 1T8EA 4H4VA 2KD1A 4UB8U 4G50A 1GNUA 3EUB3 2JXXA 3APCA 5ALUA 1XLPA 2PMVA 1SB3B 3I99A 2HJ8A 2QLTA 4YMNA 1EC9A 5L95C 1EU4A 1FFUA 2KMMA 3MQTA 3NVZA 3OSPA 1D9DA 2IGDA 4QIWF 3STPA 2C7HA 4YSXB 4I2BA 1L6VA 1KDHA 4K7ZA 3NVWA 1AQ6A 1XF5L 4ZHPA 3OPXA 3DCGA 5J2KA 2B3AA 2BPGA 1NYQA 2RDJA 2BB6A 5IIMA 4TMAB 3EKGA 5EWEA 3QCAA 2W9AA 1IYFA 1L7NA 3TSHA 2FMQA 3JPSA 2FJ6A 2MJ3A 3DK8A 3EYZA 1IBXB 1F2RI 3KTQA 4J9OA 3NG0A 5KFNA 2X8GA 1TKYA 1N62C 1GG3A 5ALOA 2GLEA 4IHCA 2PPGA 4GU2A 3HPOA 3F53A 1S1QB 3BZCA 8ICWA 1WGYA 5FJTA 1L7YA 2KNJA 1QZEA 3SN0A 5JCNA 3IAS1 3S5SA 2GI9A 5GXGB 5KFCA 4BX9C 3RFAA 5IIJA 4GGHA 2W43A 2CS4A 3Q8AA 4I2CA 2E5SA 1S9FA 3PRPB 5LXHA 1UXYA 1L8LA 1PVRA 3K9PB 1HEZE 3NUHB 4NQLB 3W5VB 2AYOB 2F1JA 3UIPB 2V9HA 3KZXA 5ALVA 4H4PA 2UUVA 4GFJA 2DF4B 4EEYA 4US8A 3N7RC 2N9XA 1WVFA 2JV3A 4RGTA 3M7DA 3UCCA 4Q45A 4XX5A 1BMLC 2QSDA 1N60C 3P4RB 2YB4A 1JPDX 3D2NA 4IS7A 5ALFA 2WB1C 5HHIA 4H4TA 2ZW1A 4F7ZA 8ICGA 2M0NA 3ZJUA 1E90A 4UARA 2R8HA 3A9JA 4LJOB 1S7MA 2BDUA 2PMQA 3TWBA 2AGPA 4USAA 4J6IA 4KDLB 4BKGA 3CF6E 5FKAC 4BKTA 1WE7A 4YXMA 4O3NA 1F8WA 2YB1A 1N48A 4UBCA 3JZUA 4MJSB 4QW9A 5KT3A 3UQ2A 5AI8A 5KFQA 4IRDA 2DZJA 4O0IA 3BQ0A 1WXAA 2DZKA 3KWVA 1V1OA 4ARIA 1GRHA 1ZQKA 2Q0ZX 1VD2A 4KTQA 2RPQA 1TE2A 2NBUA 2JGAA 3Q4DA 1TKGA 4A9AA 1GRGA 4HJKA 3G6XA 4ANXA 3EFUA 3APFA 4PH5A 1YMHE 4XE0A 5AUKA 4E74A 4ITKA 3QTPA 4P4PA 3IG3A 5AKEA 2ZXHA 2FDRA 9ICXA 3EGRA 5AK4A 4MGIE 5KG3A 4RGMA 3OTRA 3AU2A 2D07B 3K1RB 4W9JA 4ZRJA 5IAAC 5AE2A 2RLTA 4KPRA 4XQ8A 2L0FA 2QAEA 4RQ4A 4C8LA 1E7VA 3TQ1A 3KZIU 5IDZA 4FFDA 1KF6B 3ZKJC 4KDIC 3E58A 4M9GA 3SFEB 3JS8A 1ZP0B 2ACZB 3OTQA 5J0YA 1TS3A 3UMBA 4LA1A 5FJPA 2G4DB 4K8DA 3U26A 2BVHA 3GZFA 4YD1A 1C78A 1NK5A 4MGKE 3N28A 4W9HA 4EUTA 1PUZA 5EWGA 1WCLA 2RMMA 1STZA 4ENLA 2ZTCA 4DHJB 3PK7A 4QIWC 3KHLA 4YQWA 4JE3B 5EDSA 4BV6A 4II3B 2PP1A 1XLNA 4JLCA 3PX0A 5E6OA 3M9OB 5FR3A 1TTNA 5AZGA 5I1VA 5IKCM 1YEYA 2DPJA 2Y3RA 4XYCA 1RM6B 3VRBB 4FJVB 3H8AA 1DGJA 3J81j 4ZOHB 2WP6A 1BNOA 4KGRA 3CMMB 2K60A 2L0TA 1WJNA 1Z4NA 2JRZA 4RQ1A 4KLHA 2RDBC 3I9V1 3QXGA 2XEWA 1BPEA 3PREA 4C7YA 4A6QA 3OW1A 4M8MA 3DGBA 2RDXA 3JPPA 3MSYA 3SEBA 1SIJA 2JY6A 3WK9A 5AI5A 2YLMA 2PS2A 3UGVA 1FECA 2D3GA 3NZUA 3TJ4A 5EWFA 4K3CA 4KN7A 2IDYA 5ADZA 3L10B 2OYYA 5AM2A 4EZ6A 2WXHA 1WR6E 3W1SC 2NV3A 5B5EU 7ICOA 1N6ZA 2OFJA 3E2EA 1V86A 1PVQA 1TZOA 5JU5A 3MC8A 2DUYA 2RDHA 3Q2AC 4W9CA 1QSYA 4WWNA 4ZRQA 8ICTA 1NHRA 2E8OA 5L9XA 1YQBA 1RDFA 2GB1A 3WA0A 1IPGA 3KHRA 5ALMA 3Q69A 1FM0D 5JHBA 2CPRA 5KTQA 4TQSA 1BPBA 4IC7B 4UQGA 4FN2A 1P43A 8ICIA 2ZIVB 1ZGUB 2JUOA 5J2FA 1S10A 1WWTA 2AQ3B 3VCBA 2KFNA 3AU6A 3CGBA 2OCEA 2BWES 3ONNA 4QZEA 3DK4A 4URKA 3VC6A 1KSPA 4KV2A 4QZ9A 1T0YA 2HDEA 2XH4A 1FRDA 1XWLA 5JCKA 1IGDA 1QLBB 1K1QA 5KG4A 4Z6DA 7ICQA 2D2QA 1JUDA 1ZQQA 1A6SA 3C0RB 4ZH4A 4B9SA 1H6VA 2J7QB 4DL3A 1XDIA 3FCPA 4C4VA 4MGYE 2CXYA 4F5RA 4DO9A 1HUOA 4BDPA 3H1UA 2BPFA 4QZHA 2FPMA 3OP2A 4C7ZA 4HWIB 3SQPA 3MR6A 2KK0A 2CHRA 2E5AA 1F77A 3RH6A 7ICJA 4YT0B 1HZ6A 3CP8A 2HXUA 2IOHA 3EJEB 1XSNA 1CJEA 1E8XA 1FNVA 1YNTE 3EEZA 3MDCA 3HW2A 2KV2A 5BPCA 1IV8A 3NUQA 4XC2A 3ZLHA 5J0RA 3QU4A 2MCNB 5BMIA 3UGBB 4QZ8A 5LNK1 1GSNA 1NK4A 3BDPA 3T3OA 3TSSA 4M00A 4YVZA 2XY7A 4YTMB 2VFRA 4MH8A 3U30A 4MFAA 5E6NA 4Q44A 3OAWA 1TYTA 1PK1A 4QW8A 8ICMA 1BXTA 3A4RA 4KLMA 3TBLD 2J6TA 3PRMB 3FILA 2FUHB 3ZO5B 1AHVA 1C79A 3PW2A 1T0RC 2FCMA 1SJBA 3V7JA 3THUA 1ZOLA 3MC1A 4RNOA 4DXFA 4F50A 4QZIA 3KFUF 2F1HA 3TACB 2BCQA 4JV1A 1U4AA 2H89B 3BK2A 4NL9C 3V4BA 2VZKD 1ZD3A 4AYBF 2MUTA 2OHFA 1SE9A 2V0GA 2OQHA 2EMTA 2IY0B 3FYHA 1MDLA 2N0SB 2YQEA 4FHJA 1ZJMA 1Q1WA 2C2RA 1JALA 3AEAB 1WG8A 4JPSA 1D5MC 1SE2A 5KFDA 2WFAA 2J52A 4NQKE 2ZG6A 4GSWA 8ICEA 4GC6A 1EF5A 4I6PA 3S2AA 3PX4A 4JGHB 5JZEB 3F2DA 3IDWA 2W9NA 3K1ZA 4Y2TA 4OJ6A 4FHKA 3CRXA 4C4RA 4PHPA 1UH6A 2JH1A 5BO4B 4M52A 3HUIA 2KTQA 1HEKA 3AE4B 1FIQA 3L16A 4HCNB 5AK3A 2XNAC 2MSNA 2WOIA 3BQ7A 4EQSA 2ZIXB 3ZD9A 4DFMA 2BS4B 1WM3A 4ACOA 4UDUC 1Z3EB 4DSFA 4EENA 2L76A 5FS6A 3ZRFA 1RWSA 2MUCA 3MFIA 1MHHE 3DGHA 3PR4A 5AKGA 4F5QA 3Q45A 5FXPA 5G5GA 5L1MA 4M9JA 2YQUA 2LZ6A 4P4MA 5AI9A 4M0AA 3HM6X 3L0WB 1HTQA 4M9HA 4J3OD 4ECVA 1K50A 2KWCA 3R11A 1NEKB 1ZQTA 1KRPA 1TYPA 1ROEA 5JHAA 2WHEA 1NK7A 5CTRC 4L2YA 4IP5A 1Q8KA 4UB2A 1I4GA 1KRHA 1ZQHA 4LDTB 4RGOS 2LRWA 3TWAA 5J2AA 1MQ2A 2B76B 3RAQA 2JEJA 2OXOA 4HNLA 2PLIA 2AH5A 1OQYA 3PWGA 3MFHA 4BOSC 4J9RA 5KG2A 4OHJA 3DVNU 2MBQA 1HUZA 3ZDMC 3FYYA 1KKRA 4KLFA 4IL6U 3IJQA 3A1QB 2QGYA 2ZW0A 3PMNA 1ZQNA 3A9KA 2YVFA 4E4FA 4MF2A 1RQLA 3SU8X 5AKZA 3U4EG 4GR1A 1SXTA 2C2DA 3GE8C 1ESFA 3Q8BA 2PMZF 3PQBA 2F76X 3KBBA 4LVSA 4MM3B 3VHTC 3PGEA 5C3JB 1KOTA 3LDAA 2H3ZA 2DKZA 3WKDA 1WX7A 5ALKA 2ZXIA 1FCLA 2IBIB 2H3VA 5AM1A 1QOBA 2JWUA 2K8HA 4GN1A 2R2OA 1KFTA 3KH0A 3R66C 1AROP 5DDMA 2WX0A 3PS6A 4BXOA 2KX0A 1WRDB 4KSLC 3QU9A 2A8XA 3U4FA 2Y0SF 1N56A 3C28A 2H88B 2ZVNA 2GR1A 4LZDA 1ZW7A 4GC7A 3VC8A 2R8JA 1V49A 4YWOA 5KT5A 2G5IB 4Q43A 5KFWA 2JEGA 3W9CB 3FWAA 2TPRA 1X1MA 4MT5A 4J9KA 2L3ZA 2ZVOA 2HBLA 2XVTA 1UBIA 3L54A 3N20C 9ICSA 3RITA 4MKSA 4UAVA 1D5ZC 1TT5B 3DVNV 1W1KA 1XD3B 3FW7A 2WPFA 2X8HA 1J19A 3LJ3A 4EBCA 3NVVB 2Q5WD 2GBNA 2P8BA 1V8CA 5ALIA 5ALTA 5C5JA 3QYPA 2N9KA 1QOAA 1M94A 2WXGA 1QLUA 2X99A 3QIJA 3IN5A 1VZ8A 5AWVA 2PTZA 2O2VA 2QJMA 4AYBC 5CWRA 2JRIB 2JEFA 2NPTB 4BCAA 3W5UB 7ICUA 3Q8FA 2KLCA 5IN7A 3CGDA 1K4QA 2HBMA 2FCQA 3HVDA 3QJZA 1ZQWA 4OJ5A 3R8BA 3ZNID 5E6PA 3V3WA 3VA8A 4Y2PA 5DG9A 4BGDA 2EANA 2C7MB 1N62A 4I2AA 2LVOA 4NM1A 1NBFC 3NHEB 3SQSA 3B0YA 3ETLA 3QE9Y 1T7PA 3NJTA 2IHNA 3GSYA 4EYIB 1WZ0A 3SAGA 4PWCA 1O08A 3AB5A 2KJ5A 4C4SA 2KT7A 1SB3C 1D3ZA 3NVYA 4Y2UA 2ZPYA 2XCAA 1GRAA 1T4GA 5HG2A 1IGCA 1LQBA 2WF6A 2F44A 2WDRB 5JH5C 1QQRA 1YN4A 2V9WA 1ZQOA 2Z59B 4H2HA 6ENLA 3KUDB 1E8YA 3NXLA 3DHGC 3V6JA 4M9NA 5D46A 2LI6A 4DQSA 3GD6A 1JCTA 2WXFA 2K5PA 1DRGA 3AECB 2GSHA 2UUUA 1N60A 3EAOA 5EE9A 3NZSA 5DPTA 2CJNA 5IILA 3HX0A 2KC1A 2QMTA 5FK9C 4QWAA 4GMVA 4NAWB 1TY2A 1WUDA 1C77A 5J18A 1ZQJA 3BSMA 3G6VA 3OLMD 3UINB 4PVJA 3C29A 1E7UA 3ETRA 2W11A 4YMOA 4HCPB 4F8CB 5L6GA 3OZMA 4OJOA 1SGHA 1ZD2P 1JWUD 4WH4A 3OHBA 1Y56A 2IO0B 2O6VD 1LVLA 5KFOA 3QC8B 1MNSA 5J2IA 4ECYA 3QU5A 2KZRA 5J2DA 3GIIA 3TTEA 4DQPA 5HHDG 1P7EA 1UNSA 2P6UA 2HBJA 2VA2A 2IPKD 3M62B 2KN5A 5JUMA 3OG5A 4B0EA 3TQPA 2PMZC 2N9LA 1W1RA 2KACA 2E1FA 2LVPA 1HIWA 2GGIA 2HSZA 2K22A 9ICPA 1PQSA 4DF8A 3UXLA 5JCLA 2JWZA 2KK8A 3AE2B 2K89A 1F0MA 2O6VA 3Q3MC 3L13A 2PXIA 3P0WA 3Q6JA 2GDQA 4FULA 2V3NA 4DL2A 3DBRB 4MEMA 1XANA 5CA7A 1V80A 2DZIA 2AKMA 1NK6A 3UJRA 3K1GA 4RQ0A 3HIZA 2KICA 3RNMA 1SJED 2CR5A 3RB0A 1VAOA 4OZBA 2DZMA 1HSKA 1M6IA 5TZVA 2B21A 1KL9A 3RJGA 3ZJVA 1NKEA 1HJPA 2AXTU 1PVPA 1EBHA 2REXA 5IINA 2LJIA 3LYSA 2I38A 5H8YE 5IIKA 1KD0A 1JMSA 4RM8A 3AE9B 5JXVA 1QQ6A 2BS3B 5C2TB 3SR6A 4F5OA 1TK0A 2LGXA 3R0UA 2BF8B 2K39A 4MELA 5KG5A 2IO3B 7ICMA 3IAM1 1ZQYA 1E8FA 4WAAA 5DKWA 2IO2B 2NO4A 4UAWA 1CMXB 1D4BA 3KQ4A 4OCZA 4O5EA 4DCCA 5ALHA 3RB4A 1T3NA 1PK3A 2XC9A 1EF1A 4H83A 3RRGA 2WXPA 4BURA 4DXKA 3SN1A 2WHIA 2CRXA 3Q6BA 5CJ7A 4IC9A 3Q3FA 1EBDA 1QT9A 3WANA 3DOWA 1R4NB 5KG7A 4J9NA 5IIIA 2DYOA 4NJ7A 1W1OA 4JAYA 2KWVB 4XZ4A 2AL2A 3L17A 2JF5A 3AEBB 3GV5B 4HDQA 4XDDA 3RJKA 1JROA 4DSKA 3WCQA 3VH3B 3W1SA 1MJDA 8ICPA 2BKRB 5F9LA 2KZZA 1HXYD 2MP2A 1S77D 2KG5A 3GZNI 3TEZA 4PGYA 1DIQA 2DLBA 2ZUBA 2DENB 1MO9A 2HBKA 2KSOA 2P3HA 1C1YB 1CUKA 1SV0C 3RBEA 1LO5D 1WJUA 3NO1A 1R4MB 2HOIA 1LXDA 2JZBA 4AWJA 3V6KA 5KFKA 5ER0A 5HMRA 5TR3A 5U1OA 1UWMA 5KFRA 4M01A 1Z4OA 1YD8U 2EQ9A 1FFVC 4A55A 3MJWA 4EM4A 2KHWB 2KJ6A 1RRBA 4YFKA 1NYRA 4JWUC 2NRZA 2DPIA 2OZTA 1WGRA 4PGXA 5AKIA 5AM4A 4JUZA 5AIBA 2KN7A 4RT3A 4DF4A 8ICZA 1E9MA 1ZOYB 3DQVA 3GY1A 3L3FX 3L08A 1D6EC 3PR5B 2HTHA 3S47A 1I4HA 4I2DA 1T5XD 4FADA 2QEJC 2PFQA 1FEBA 3AQFA 3F5EA 4OVUA 4P6VF 3T5LA 2LI5A 1KLUD 1WGDA 1KCZA 4EBEA 4W9GA 1YZ6A 3AM9A 3HRDD 5J2BA 5FJOA 4CF5A 1S0MA 3ICXA 1V1PB 2MRPA 4U6PA 3GQCA 5E6JA 4QZFA 3P2BA 2CFYA 3MJ5A 4CHKA 1BT0A 3PLVA 4S0RA 2BS2B 2NRXA 3QEAZ 7ICGA 3NRZB 5G5HA 5J0WA 4XWWA 2FLLA 3ONSA 2GRTA 3H7PB 3ML8A 1TS5A 3Q3NC 4EQRA 2X50A 2NCNA 4FS1A 2MX2A 2MBOA 1L8PA 1FXTB 3Q3JA 4XDCA 1Z1VA 1XC9A 2B0CA 3H8HA 1COOA 3B2FA 2QJNA 2XGQA 3LAEA 5J0TA 1IYXA 4DWIA 4PL2A 2NTSA 2V1YA 4GDLA 4KIKA 3TCAA 1MDRA 4TURA 1NK0A 1Z00B 2BYFA 2PVGC 2AKZA 2F5ZA 3QK0A 2WB1F 8ICRA 5J0OA 3H40A 3VH4B 5CHFA 2K4IA 3CSTA 1SL2A 1ZD5A 4XUSA 4KZCA 4DHZE 2EQ7A 2WWZA 2F3NA 1H8CA 1NU5A 3OHAA 5KFEA 5DQHA 1WJ4A 3VQIA 4KVGB 2K8CB 3DH9A 3I6TA 3I4KA 2KHQA 4UB1A 3DBRI 1T6BX 3I6EA 4PVKA 2IPIA 4NL9A 3W2DA 4R65A 4WQOB 5AEKB 2V3BA 4H4ZA 5J2EA 2JMGA 1CRXA 2O6KA 3C0PA 2WF8A 1ET6A 1EC8A 1MG4A 5BYQA 2DNFA 2JXJA 5J0SA 3T5KA 3UMCA 3ALBA 1KFDA 2VH1A 3VR8B 1I4XA 2PJHA 3DVGY 1SJAA 4R8UB 2R8DA 5AIAA 5F3XB 2ICIA 3RYTA 3ZGZA 2KQ7A 1GPXA 1C4CA 4ANVA 5KHQA 3T9LA 2P13A 1UT5A 4RGNA 3QZ8A 7ICSA 2GQTA 1UPHA 4FLHA 1XPYA 1SE3A 3PSPA 2LYHA 2OEDA 2ZJ5A 1EWYC 1RAXA 4WJPA 4C00A 5IP4D 3OJSA 1CEZA 1KN0A 1R6WA 3SBFA 4NLCA 3I63C 1KKXA 1MRAA 2ZZPB 4B9UA 4EX6A 3IHQB 2V3PA 2KTRA 4F4RA 2BC1A 2KHVA 4FE3A 2E1EA 3ZJTA 3IC9A 3ZYYX 3BOXA 3N6HA 4UB3A 3RH4A 2DX5B 4HK2A 4ECTA 2LXCA 3PM9A 3A7RA 4H19A 1C20A 4Y2XA 2JYTA 3MC0B 3OJ4B 4QAYA 4LIIA 2PFNA 1JOAA 2DFLA 5ALSA 3UF8A 4ED7A 1GESA 3ENLA 2XK5A 4GMEA 2UVWA 3V72A 1MFWA 2MA1A 4IT1A 2QDEA 3B0AA 5JCMA 5DB7A 1LVHA 1SE4A 4M04A 3R7QA 1OUQA 3KWLA 4IM3A 3FAHA 1LPFA 2OLAA 2WNMA 4G9BA 1K53A 1R4MI 4DWFA 4F93B 4WWOA 2JK6A 3THVA 4B6JA 4CCHA 5T8IA 4X5VA 1V5TA 2M8SA 5TSSA 3T4WA 4YG2A 1AW7A 2N1VA 3ZVVA 3NS1A 4UB5A 4YTPB 3CIRB 1FPYA 2AEHA 3SD7A 5AHXA 5KVIA 3M9MB 3C2LA 1ZQAA 2FLNA 4CGZA 1E8GA 2KXJA 4ECQA 1I35A 3FG2P 2G5HB 4YD2A 2D3AA 1MBBA 5HR6A 4Z6FA 2G4SA 3RR1A 3BZKA 1EWCA 2A1AA 2LM1A 3PVXA 1X9MA 2ZNVB 2KDMA 1YIWA 3MR3A 4ANWA 1N63C 1L5UA 4NLKA 3DK9A 4ECXA 2HTME 2LFIA 2KWDA 2Y1IA 4M0WA 5D2MB 2Q4TA 3PSIA 5AICA 1T94A 3N4EA 2KE7A 5DLGA 1GERA 4HJGE 4Q8EA 3H70A 2WDWA 3QQ8B 1E0ZA 4G8TA 3RO6A 2W04A 1L3VA 4P0PA 2OG9A 2XSXA 3DESA 2EAMA 1NVID 2EH9A 1PFDA 3RTVA 3KUMA 2UVUA 3GFKB 5AKYA 2W9BA 1A76A 2ZTDA 1SF0A 3HT3A 5KG1A 7ICEA 1NK9A 2M1MA 1NNLA 4DDID 3C1YA 3EZ5A 2C9WB 3T6CA 2NVKX 4F5NA 2DW7A 3TADC 3DBLB 4NXZA 4KITB 4K7SA 3JSVA 5FS8A 2QJJA 1TBEA 4NEWA 3ISBA 3QAQA 1V5OA 1WE6A 4FBUA 3SENA 3EFCA 4O1NA 2Y3SA 3T8MA 4NLZA 4JWMA 4JWNA 1GJZA 4BWMA 4EELA 4KT2A 4TQ0A 3QFAA 1Z5SB 3S6JA 4LNOA 2D3DA 3RNGC 2F8LA 4K4HA 4MSMB 4PYUA 3RBDA 4ZCWA 3RAXA 1E8HA 4P0QB 3D6JA 4PPXA 3RT3B 4IQUA 4DQOC 3TEWA 1W1MA 1DIIA 4QNLA 2KTFA 3EF6A 4EMWA 2DYBA 4PZOA 1ET9A 2CDUA 2ISOA 4NJCA 1TJEA 4W9LA 1TY0A 2AGQA 1WWUA 2PODA 5AZFA 2YX8A 4CF4A 3JW7A 4L23A 2LYBA 5DB6A 1ZYQA 1KFYB 4KLLA 1V59A 1WUFA 3W1YA 1F9JA 1ZMCA 2VFTA 4E6MA 2MA9B 1XU4A 1QSSA 2PIAA 4PWBA 1B1ZA 2DYMA 2KZ3A 1YQ4B 4I2FA 5AE1A 1PDYA 2AAQA 3QUQA 1DOIA 3V7LA 4O5KA 4E71A 4ECZA 4JV2A 3LXFA 3UQBA 1TS4A 2NPXA 4GOCA 5DG8A 5DBBA 5FP0A 4KLQA 2VJ4A 2ZIWB 2OM6A 4M47A 2Z0DB 5C1ZA 1IBXA 1ZQZA 2W9CB 4TUSA 4BJQA 2HHUA 1A70A 2V4LA 2GQUA 3KLJA 2KWUB 2YVCA 4Z6CA 4B9MA 3Q8MA 3D2JA 1UA1A 4B6WA 1U9LA 3DBHI 3GS2A 4IZGA 5KVHA 2YN4A 1JXEA 2DAFA 5L1KA 3A7UA 2QVHA 4BBYA 3CAWA 4ECSA 1L5PA 4K4IA 5CEHA 1L6UA 3SAFA 2ZJ8A 9ICNA 4EQXA 1OEPA 2QB0B 1HQRD 2ZIUB 1AWDA 1QLTA 2L05A 9ICJA 3SDLC 4YP3A 2M4NA 2QDDA 4JV0A 1TKKA 3ZNZB 4A3OA 3PW4A 1KQQA 1L8OA 3T5JA 7ICNA 3JPOA 4F4ZA 1WY8A 4HG0A 2L83A 2OZ8A 3F5AA 5EE1A 3EECA 2JX5A 4Y2RA 1RYJA 1E8WA 1WGHA 2FUG1 1FO4A 4Y2YA 3UQ0A 2AGOA 1C4PA 3N32A 4YL8A 5ALPA 1EM7A 5ALQA 1QCKA 4IWQA 1ELSA 4KLEA 2HOFA 1L0XB 2ASLA 3RZWC 2GGEA 3V5FA 2INCC 2N9EB 1VDVA 2KD0A 4DOBA 1VR9A 4EKUA 1LKYA 1X66A 2JH7A 2FAZA 2MQJA 4CNQA 1L4ZB 4CO7A 4K1WA 3WK7A 2A1JA 5J8YC 2QARB 1VLBA 9ICFA 2CHXA 2MH7A 2WX1A 3RULA 4TVWA 1ONEA 4I6LB 2XY6A 1L3TA 4IKGA 5ALYA 2R2QA 2NYVA 1F52A 2BPSA 1GETA 4FJZA 4F4XA 1NZPA 4NWIA 4WQMA 4WJOA 4OVZA 4GYPC 5AI4A 4I28A 2KZMA 1SL1A 1ZQDA 1GV4A 2IJ0A 5KT4A 4F4KA 3F2CA 1V85A 1ZQBA 2MBRA 1YQZA 1ZDLA 2OX4A 4IWOA 3QPEA 1FEAA 3ZDBA 4K8GA 1JMLA 3FV9A 4ECUA 4HDOA 3VDZA 2GR3A 4Y2JA 1X6JA 3O0FA 2I1KA 1W1LA 7ICFA 1NENB 1I4RA 2LVQA 3B0XA 4WJ3B 4UAUA 1YX6B 2BCRA 3QFBA 1J2NA 2VZKB 4N6EB 4LNNA 3RI7C 1OXJA 2PTLA 2PGEA 2SAKA 5D94A 1ZD4A 2JXTA 3DBLI 3NOBA 5T14A 3PY8A 3ZXRA 4PYZA 4H4WA 2AL3A 3RFZB 4KLIA 3RB6A 2VAOA 4GLXA 5IO9A 5L6FA 2BPCA 3I28A 3NGDA 4H2AA 4YSZB 4ML8A 2F8KA 3EJDB 3R1ZA 1DZNA 1KJTA 2XH2A 4DHGA 2W03A 5J29A 3GILA 4DHZB 2WQYB 1MVKA 5D49A 1L7OA 2ZZBA 8ICOA 5FJRA 2A3VA 3MDAA 2NMQA 1HZ5A 4CYEA 3ZIMA 1VJ5A 1SV0A 2K4HA 2ASDA 1J8CA 3V62A 3BQ2A 1D8YA 3VXWA 1OEYA 1SZPA 4W9KA 5HNKA 3ZD8A 2INPE 4HEA1 1JEHA 5IA7A 2WXMA 3DG7A 1ZQPA 5F9NA 1EU3A 3EW9A 4MHVA 1FFVA 3AEEB 4Z17A 4DFJA 2GGJA 2ZTEA 3A7AA 3WK5A 1TZZA 2LRUA 3DHIC 4OALA 3L8KA 1BGXT 1PGAA 1BPYA 4YN4A 5H92C 4S17A 2KN4A 3LADA 1KH0A 1M6YA 1PGBA 1N5WA 3PW5A 2NS5A 2NTTA 2NQLA 3ED5A 7ICIA 2SEBD 2BCSA 3OJUA 2MJDA 4KLSA 2PEAA 2N1RA 2RPVA 2VA3A 2YMLA 2QQ6A 3UCDA 3SYZA 1TVAA 2I1QA 3ES8A 5LLIA 2PPHA 2PU0A 5TR5A 2KFZA 3ZRCA 5ALLA 5D4BA 4BKSD 2ON8A 3CXOA 4H4YA 1C4AA 2LMCA 1WWVA 3PZ8A 2KDFB 2ZUDA 2ZJAA 3MTNB 4QWCA 2FIFA 2LGDA 8ICXA 1W1QA 4ASWC 1WVEA 3RJIA 4ICAA 4HPPA 4G7FA 1YJIA 2W3SA 1X6IA 1NJXA 1ACCA 2FCNA 2KQ4X 3RF9A 4KEMA 1WM2A 3V5CA 4ELTA 3QKEA 4C4TA 5E79U 2Z8LA 5KFVA 8ICJA 1SJCA 4RUAA 1ZQMA 3UM9A 2H3QA 5CB1A 5AKLA 1JQ4A 2OWOA 4BKSA 2PA6A 2MHJA 2XY5A 2FMSA 4GGQA 2CJOA 3BW7A 3IP4B 4LZGA 1AARA 1S3SG 3IJIA 4LNIA 4HKQA 1ZQCA 2HVIA 4ED3A 2PLPA 4WWPA 2GLSA 2ZC8A 2IO1B 2HHVA 5HHZA 1WFYA 4DS5A 4K4GA 1KLGD 1X40A 3N7SC 1Q3VA 4UAYA 4HPLB 5BYSA 5ALXA 2WXRA 3PRZA 2XIDA 4B9LA 4DLGA 2G07A 1TGZB 3DDCB 4F91B 4EQWA 4DL6A 3GD4A 3AE1B 1ZRMA 1KFSA 2HE7A 1D5XC 2K1FA 2KLGA 2FBWB 3ZLGA 2KVSA 2W55A 5KT6A 1YX5B 3DV9A 4IP4A 1ZQRA 2JQRB 2PKEA 3SEIA 2ASQA 2AWTA 2QHOA 3VR9B 1XS9D 2BYVE 1YQ3B 9ICAA 3SSZA 4RM9A 3RRHA 1Q0WB 7ICHA 1FRRA 1GB4A 4DYEA 5AZHA 4Y2VA 5HMMA 1NJZA 3TEYA 4KMOB 5BYRA 2DW6A 3FW8A 2JPHA 4ZRKA 1UELA 1J2MA 4BUGA 3GV8B 3MZNA 3UIOB 1RLFA 1MA7A 2ES6A 3PTFC 4ANUA 5HFYA 7ICVA 3HHMA 4WJNA 3N6JA 4O3QA 3PMLA 4C8NA 1MBTA 1JWSD 2O3GA 5BOMA 4FBTA 3LB8C 2JYEA 2V6OA 5DQIA 3IXSA 3B9JB 3FM9A 1L3SA 1GRBA 4MMWA 2MEKA 2I0KA 1D7YA 5J0QA 3JPQA 4F4WA 3OZYA 3KHGA 1P3QU 1QOFA 4IQTA 1P7DA 8ICNA 1DYQA 3H0MB 3NS8A 2ZIXA 4GXBA 1EC7A 4UATA 5BOEA 2HHWA 3RJAA 4LDTD 2JHDA 1A77A 2MBHA 2PU1A 3T9PA 4J9PA 2C28A 4M6WA 3Q8LA 2E6XA 4ZDVA 2UVRA 4IQVA 1PUTA 1BNPA 1XQQA 2MW5A 3Q8RB 1ZDXA 3MHZA 3ALRA 2IYDB 5I1WA 1UGMA 1T0SC 1SL0A 2KJ8A 3Q8KA 4TV3A 4H1ZA 3MKCA 2GMIC 4RMAA 4RF0A 2R61A 3RD2A 3P3BA 3FW9A 4LLGM 4EYHB 2AHOB 4OZAA 3NZ3A 4DL5A 4TVYA 1QILA 1DXSA 3WKEA 4PZNA 2EZYA 5KL8B 4FZMA 1BUIC 1WXSA 4EMIA 4PZFA 1N63A 2KEYA 3QZ7A 1R0MA 1WX8A 5J0PA 3E0FA 1SEBD 5AI0A 3OPSA 5K8EA 1COKA 5KFLA 4I29A 1BZLA 3MGVA 4YXDB 1DK3A 2C2EA 2XBBC 1NKBA 3DWMA 3GRTA 2NBWB 1WYGA 3IRUA 3IT4B 1ZUD2 1DOYA 4JWSC 3RPFC 5HR7A 4GDKA 2Y9TA 3AQEA 4MGZE 2P88A 4KKJA 3UJEA 2JSVX 1WMHB 5AUIA 3BJYA 4K1RB 2KFKB 4MF8A 3TCSA 3V7KA 5A0LA 9ICHA 3PHXB 3HP6A 3A1QA 2WBAA 3P4SB 3PW7A 3VTUA 2K8BB 2AQ4A 3SR6B 2DL0A 7ICPA 1RXWA 2WAQC 4RU9A 9ICGA 2BW2A 3PO5A 3W8XA 1SGGA 2W7PA 3QX1A 1BKHA 1YT3A 3QU7A 3GRSA 3ZLFA 2YEPB 4A35A 1B43A 4MM3A 4MGGA 4R66A 4GGBA 1V9JA 3VUXA 1JRPA 1TE6A 3RNCC 3TADA 4AP9A 3OSNA 1RQNA 2LMRA 2NRTA 2IBKA 2J3NA 2P0IA 4KSKC 2MRLA 3DHHC 1ZRNA 5KFZA 4DFKA 2OO6A 3JPRA 3VFCA 1Q46A 4NM2A 4KWSA 3KHHA 2IA6A 4M2YA 2GRIA 2IGHA 3ZVHB 3DWGC 3MBYA 3Q3OC 1TKEA 1WYWB 2KC2A 3PVLA 3QUCA 3L5KA 1K52A 1MSWD 2KOXA 3CNHA 3H8WA 5GTHU 1DK2A 2LGIA 1BPZA 2YY6A 3FJ4A 4REZA 1JI7A 1Z1BA 2L7RA 2FPLA 3UPQA 1P9DU 1HE8A 3GU3A 2WF7A 2KSOB 1E0YA 1QTMA 2PTWA 1SKRA 3LDZE 5FXFA 3CW2C 4PHAA 4G3XB 2HJ1A 3OC4A 3W8WA 2EQ6A 2Y08A 4GB9A 1RPLA 2KMDA 5FXDA 1B4FA 3BS5A 4O3OA 3VAWA 4O5CA 1KN5A 2A5UA 3CSFA 4Q2JA 4RNMA 3PV8A 4M9LA 2KAJA 3PLUA 5BOFA 2GO7A 3DEEA 5KFXA 1F44A 3C8YA 3HILA 2W82A 5J0XA 2WP9B 3MFGA 5J04A 2P6RA 1AN8A 4W9IA 3BQTA 4TQ1A 2O56A 5KNIA 4EZLA 1WSPA 4J1OA 1UWXA 3RN9C 2HW3A 4R63A 2L5YA 2OEHA 2DHZA 4ELUA 7ICLA 4NY0A 1L7MA 1XO0A 3DQ0A 2HVHA 4FA6A 1T3QC 4PS3A 1NI3A 3AV8A 1CI4A 2QKQA 1U47A 2VJ5A 4WURA 4J9SA 1XCQL 4AUQC 2XH0A 3B97A 5KFAA 4DXAB 4G11A 2YMQA 4FXCA 3WU2U 4NEVA 1K51A 1MPEA 1TK5A 3JPNA 5DCNA 3B1LX 1TFRA 1YN5A 3QA8A 2ONEA 3GC2A 3DEDA 2Y4GA 4ADWA 2W0HA 1ZKQA 4RPYA 3RNAC 5KFBA 1DOXA 5KG6A 4H4SA 3BYTB 4BZAA 5MPOA 4PT5A 2BQUA 2KQSA 1ZXIC 3IJLA 2AQ1B 1RYUA 1TV9A 5D3IB 4GXKA 1D8LA 2W9MA 9ICOA 1V81A 3N97B 4O3SA 1JDFA 1P48A 3FVDA 4EC3A 4OW0A 3MY9A 4BC7A 1NHQA 8ICCA 1TIFA 2PP3A 4NAWA 2D3CA 5JCIA 3WALA 1IUEA 1Y8RC 3N1ZC 4MSQB 3O0HA 4GDLB 3A0HU 4BBNF 2K8AA 3N7PD 2LUEA 4RH6A 5DPWA 3KKAC 4JB3A 1GEUA 1S0VA 4F1SA 2QDFA 5CR0A 2QILA 2FYMA 2OAIA 1EBGA 1KTQA 2KJ9A 1RM6C 4PL1A 4QZCA 4KLUA 2A4ZA 3RCZA 3R07C 4ZOHC 5GRTA 3IG5A 1GAQB 4EE2A 3I1YA 5AE3A 2ZEQA 3VDGA 5J8YA 2BCUA 1IIPA 1U48A 5TISU 4IRKA 2KJHB 5HQXA 1X42A 3OJ3A 2JR5A 2IOFA 2HCFA 3R0KA 5AI6A 9ICCA 4Z6EA 3V6EB 4BFRA 2YTUA 4ED8A 1FMAD 4GIVA 3GE3C 4GYPA 4FX9A 3RJHA 1FHUA 4B9VA 2ONQA 2RABA 2KIVA 3AN1A 1N61C 3TSJA 1RFAA 2C60A 1MI0A 3ZNGC 4C56C 9ICMA 3WAPA 4IDIA 1A0PA 3IBEA 4A90A 1WX9A 1KLNA 2P35A 2J6UA 2RD0A 2KIWA 3RUIB 2PSNA 3TJIA 2GBKA 1IM4A 4NLNA 3C2KA 9ICBA 3HWTA 3SFDB 4A6GA 1SKSA 1F0ZA 4B9NA 4KX3A 1JCKB 1XO3A 1E6EB 3MWCA 2EKEC 2INNE 3GO2A 1J0GA 1SXDA 2BKEA 3FXGA 2VFVA 4JX1C 2KP7A 1XSLA 4X57B 1S0NA 3LLBA 3VFKA 2KTRB 3RNEC 1C3TA 3PFRA 1TAUA 2MAXA 3VRAB 4MEYA 2N1WA 4RQ2A 3P4QB 4EEKA 1XO1A 4P2HA 1NOMA 3H4DA 4ZRPA 2DGZA 3GIKA 4OJLA 4NPNA 3AMZA 4N59A 3N9YC 2WLBA 3TJPA 4EZ9A 3NVZB 1W1JA 3H0LB 3QNMA 3QEBZ 3QU2A 4EMJA 5KAFU 1SJDA 3POPA 3CWIA 1Y88A 2QKNA 1F1HA 3NVWB 1IG6A 3QUTA 4DQRA 2GOWA 3MUCA 4UBBA 3GIJA 4C8KA 3ZQ4A 4BWJA 4ICVA 1SKWA 3V61A 3HM3A 2I5QA 4FI4A 3ZNHB 4IRCA 1S5LU 4DFPA 4G3IA 2D10A 3QUBA 4E0DA 4G0NB 4HVBA 3ENEA 3MR5A 5D79A 2E8MA 4DS4A 3FDSA 1E10A 2HXTA 2IHMA 8ICSA 2E8PA 5FS9A 1BPXA 1CZPA 1RFKA 2I9GA 4N58A 5G2NA 1EXNA 2V3SA 1X9WA 1QSLA 1C9FA 4QZGA 1D9FA 4C8OA 2AX5A 3V60A 2EQ8A 3DERA 1ZPSA 2J0MA 3DDMA 2X38A 2KMAA 4Y2QA 2GR0A 3IG8A 1RYRA 5DBAA 2BB5A 2RDGA 2POZA 2AQ2B 3LWLA 3AULA 4DSIA 4F5PA 4RPXA 5I4DA 2HMXA 3AE8B 2AJQA 3SAHA 1KW4A 4BBNC 2OVLA 4P0PB 4A8EA 5J2RA 4KN4A 3P63A 1WI0A 4P1BC 2EMSA 3URYA 3BYYB 1FXAA 3N1YC 3TI0A 2MBBB 3WKAA 4MDKE 4A8XC 4I6NB 1FCCC 4F2RA 3A9JB 2YAUA 5IOIA 3RJFA 4UAZA 4HROA 4RQ8A 4A20A 5H2FU 1O03A 3RRAA 2WPCA 3QHTA 1R4NI 3EPGA 3L4PA 2J6SA 5KFGA 2PVOD 1NHPA 1Q5WB 2WU2B 4J9MA 4O95A 5BMHA 1V1PA 4KLGA 3EC8A 2I5HA 3AE3B 4GFIA 3TL5A 3S1FA 3TUOA 1K8RB 4AQ7A 3PO0A 1DGSA 4FZNA 2W7OA 3NRZA 4DSEA 1H2IA 2PFPA 1GRFA 4PGQA 4CE6A 5FS7A 3H7PA 5HI1A 2BR0A 4JQ9A 4RQ5A 4NLGA 1MG8A 1N5XA 3NFUA 4GIRA 2WF9A 5J2HA 1BPDA 5AKXA 3KW5B 4RFBA 1ZQUA 5CX3A 4H4XA 4QJFB 4N9F4 1JWBD 3E56A 2Y1JA 1VJKA 2BHNA 2INDC 4E4UA 3PZPA 3DGZA 1Z00A 5L1LA 4BOZB 2P66A 2KVRA 4KKIA 4ELVA 2D5GA 4K2SA 1X2IA 5DPRA 1XHCA 1NJWA 8ICHA 1NELA 3G6YA 2YEPF 2K8CA 2FMPA 3RH5A 4ZYSA 3RJ8A 5ALNA 1BVSA 2R8KA 2QCZA 4KLDA 2VIXA 3TAPA 3PWIA 5BMGA 1OEYJ 2OZ3A 4O3MA 1PZNA 2VANA 1L0YB 2EKIA 4F71A 5J0UA 2BVFA 4JL9A 1J7CA 3AE6B 1AOGA 1UZXB 4B0MA 1SXEA 3AH7A 3LB8A 1RVKA 4AJWA 4QWBA 4R8UA 5JRTA 2AL6A 3MHSD 2RRDA 4P16A 1GREA 1SSNA 2PI4A 3TFSA 1NHSA 4DNAA 5DQGA 2G08A 2HHXA 1MHXA 2WU5B 2PE6B 4HRSA 4RPZA 3JVZX 3ES7A 4ECWA 3M63B 3T5HA 3PO4A 4HPMB 1E8ZA 2M0XA 2F1IA 4J57A 2BGFA 2KDBA 2JVCA 4C0ZA 1A5RA 4HCLA 4RQ7A 4C8MA 3C19A 1RZTA 3H7IA 3WKCA 5J2GA 1E5WA 4KGSA 3PSFA 3RMKC 1NDAA 1VZ6A 2WS3B 2QB1A 2XI9A 4JIOU 9ICQA 3BVZA 2G09A 3M3JA 3CT2A 4GRTA 1P98A 3SV3A 2RQ5A 4YWSA 3K4GA 1ZQ1C 1SV4A 2EAPA 2K25A 3AEFB 7ICTA 2WDVB 4XA5A 3AEVA 3RNBC 3N4MB 2KKPA 2D8CA 3EUB2 1LKYB 5ALJA 4EX7A 2A1JB 3U52E 4LNKA 3LVVA 5FMHA 3WAMA 1SZHA 1WXMA 1FHVA 4PK1A 1X9XA 3AE5B 2WPEA 1KKOA 4DL4A 1JWAD 3GD3A 3M95A 4U7CA 4KX5A 1GRTA 1NPXA 1ZX9A 5LXIB 9ICWA 3SV4A 5L83A 2QC8A 2WOVA 3LWMA 1J7BA 5DDYA 1UUPA 2N9PC 3VCNA 3DEQA 4UASA 1L3UA 2LHTA 9ICVA 2C22A 2L32A 3HPFA 2P4PA 2BYTA 4US9A 3M8SA 1WF9A 5FR6A 3A0BU 8ICYA 2W8LA 3J9CA 4C4VB 4DN1A 3DDHA 2EDUA 2LBOA 1QOGA 2LGYA 4LJPB 2EXRA 3M6ZA 2R8GA 2Z0EB 5G55A 3RR7A 2PE9A 3TIXA 3ZDTA 4M0XA 5EBKA 4F92B 2R9ZA 3ECIA 1E9IA 4YR2A 2Y3AA 3R7RA 3II4A 3QN3A 3V6HA 2GQWA 4WIPA 4DBGA 4EEWA 2IY1B 1U49A 1F3PA 1QQ5A 2OQYA 4IR9A 4KX6B 1X2GA 2GGHA 1OTRB 3ZDDA 2W54A 1WGGA 4F8RA 2WDTB 3QARA 2WXLA 2G45B 3H7SA 2NRVA 2D3BA 1EUVB 1MN8A 5KFTA 8ICKA 2OJWA 4KMUA 3KUCB 2HQMA 3DIPA 5KFPA 1PK1B 2DAJA 4M6UA 4MJSA 4FDCB 4F2SA 3ZDAA 2VFSA 3CK5A 2V3AA 4GIBA 4D2KA 3FILB 1MQ3A 1F5SA 1KBUA 1EO6A 1GC6A 3R2IA 3GV7B 1UBQA 2LXAA 2WYQA 4MFFA 5DB8A 5JRBA 1ZQXA 2G3QB 2G9HD 4CQNA 1X9SA 4F4YA 3GOEA 1KLVA 1ZETA 1WR1A 4JHMA 3RJEA 3MGHA 3HK0A 4B9TA 2MUTB 3VVWB 4H50A 1X2HA 2FE9A 4FJYA 3D2HA 3U8ZA 3D47A 1T3QA 4P0QA 5D6JB 8ICFA 2GBRA 5BOLA 2GH5A 1RYSA 2KVCA 2MBEA 1VQZA 7ICKA 4DHJD 2FKPA 3L5OA 4ED0A 4MFCA 3M6KA 3UJSA 2R8IA 2ASJA 2WF5A 2HDOA 3MR2A 3Q14C 3EJBB 3UXNA 1FIQB 3F2BA 2N4FA 1ONFA 3NTUA 1V6EA 4CF3A 5KT2A 1R7SA 2BT6A 4IQWA 4PS8A 1ZXIA 1DNCA 7ENLA 4ED1A 3EPIA 3NY5A 4KLTA 3BVMA 3TX1A 3S1CA 3QWZB 3NRWA 4UW9A 4DOAA 4HYKA 3BIID 3P93A 2QPMA 2ZIWA 5KFHA 4UB4A 5AKHA 4EFOA 3JW0X 3IT6B 2W9CA 1I19A 4GISA 4LTUA 2K6QA 2WXQA 4GLSC 1ZXHA 4IL2A 5G5GB 2LWPA 3Q8EA 3R25A 2ATLA 1CK1A 1SJHD 4XRHA 2RGFA 4B95A 2JZZA 1W1SA 3PG6A 1U4BA 3TANA 4EOYA 3KKAA 1WJ6A 5JTIA 3IV6A 4ECRA 3UI3A 5EE0A 2GBMA 2N7DA 2M0AA 4FP1A 4LJXA 1Q10A 3W8ZA 1T0QC 3ISDA 2MJEA 2PW9A 4IR1A 3M9NB 4QZDA 4MEXA 2QB0A 4UB6U 3D2DA 5GTIU 2ZIUA 4DXGA 2ODGA 9ICUA 4K7WA 3T8QA 5DGBA 3UXPA 5KFJA 1FNUA 5C23A 1H38A 1UD7A 4ICUA 5CHWA 5AKJA 2MLBA 1ZQEA 4PS7A 4IL0A 5DGAA 1ZQGA 2W3RA 2CKHB 3IFWB 2KO3A 3OWEB 4IG7B 4XWTA 2K4PA 2PTYA 4HNCA 3D2SA 3U7ZA 1XLQA 1LGRA 3V6CB 4AS1A 1JXLA 3A9KB 5U25A 1N61A 2WXJA 4NZLB 3N4FA 2JT4B 2HHSA 3HRDC 2WXNA 4HCHA 3Q8SB 3TW9A 3NZGA 3BWUD 2YVJA 1PGXA 4J03A 3GP7A 1ZE3D 2CU1A 3P1MA 4ED6A 4DL7A 1L7PA 1J7AA 1OGWA 1GO3F 2BBCA 2E8NA 1YOVB 4C80A 2ZCCA 3S1DA 4AJYB 5ALZA 2WP5A 3PSTA 2QARA 1NKCA 3T3NA 1GUAB 2OOBB 5HP4A 4BXOB 3TAQA 3VUWA 1LFDA 2R2ZA 2ZIVA 1S0OA 1ZQFA 2GH1A 3MGIA 4KPLA 3U9IA 2ESEA 3N1XC 4RQ3A
chains in the Genus database with same CATH topology
4ITKA 2PVGC 3EGRA 2WXOA 2XN9C 4RGMA 2WDQB 2JZPA 5AE2A 2GRIA 2IGHA 3VQIA 3DWGC 1KF6B 1TKEA 1T6BX 1I7HA 1K52A 4ARCA 3SFEB 4PVKA 3JS8A 1F2RC 2IPIA 3W2DA 2LGIA 1ZP0B 2ACZB 1WRIA 4REZA 1TS3A 3HVZA 3C0PA 1E0YA 1ET6A 1C78A 2BVHA 5BYQA 5FXFA 2Y08A 3W8WA 2RMMA 5FXDA 4JE3B 3VR8B 4YWGG 1I4XA 4Q2JA 2KAJA 2R8DA 1XLNA 4ZHOA 2ICIA 3ZGZA 5FR3A 3MFGA 3C8YA 1GPXA 2W82A 2WP9B 5I1VA 1C4CA 1AN8A 4TQ1A 2P13A 4RGNA 2Y3RA 1RM6B 3B2GA 4WWMA 3VRBB 1WSPA 2GQTA 1UWXA 1DGJA 3FC4A 1SE3A 4ZOHB 2DWQA 3NVYB 2OEDA 1EWYC 4KGRA 1FFUC 3DQ0A 1T3QC 1NI3A 3AV8A 3V3XA 3I9V1 4WURA 1XCQL 2V3PA 1JWMD 4C7YA 4A6QA 3ZJTA 4FXCA 3ZYYX 1K51A 1MPEA 1PYWD 1SIJA 3SEBA 3DEDA 1YN5A 2UUUA 3PM9A 3A7RA 4GDKB 2Y4GA 2JYTA 3GB1A 3MC0B 2IDYA 1FD6A 5ADZA 1DOXA 2WXHA 3BYTB 5MPOA 1ZXIC 4PT5A 2LEKA 2AQ1B 5D3IB 1TZOA 2I2YA 2RDHA 4ZRQA 2GB1A 4EC3A 4OW0A 3TEXA 4BC7A 3Q69A 1FM0D 3ETRB 1SE4A 1IUEA 3VTEA 3KWLA 3FAHA 2WNMA 1K53A 4GDLB 4PVEA 4RH6A 5T8IA 5TSSA 2YVSA 1WWTA 3R2TA 2AQ3B 1AW7A 1QKZA 3NS1A 2QILA 4YTPB 3CIRB 2OAIA 1RM6C 1E8GA 3R07C 1XCTL 2RK5A 4ZOHC 3HSUA 4EE2A 1GAQB 1MBBA 2HDEA 5AE3A 1EWCA 1FRDA 2L1AA 1IGDA 1QLBB 2KDMA 5HQXA 1N63C 3BZDB 4XLOA 1KTKA 2HTME 2LFIA 2KWDA 4M0WA 2AXRA 3P42A 1OFFA 1OQRA 1FMAD 2VFUA 4HJGE 5D3DA 2WDWA 1E0ZA 4KGTA 2ONQA 4C7ZA 4NAMA 3AN1A 1N61C 3TSJA 1NVID 3S1EA 1MI0A 1PFDA 4C56C 1V97A 2E5AA 4TSSA 1F77A 4IDIA 4YT0B 1HZ6A 4A90A 1SF0A 1CJEA 1YNTE 1FNVA 3KLSX 3AEGB 5BMIA 3SFDB 1F0ZA 1JCKB 1XO3A 5LNK1 2M19A 2Q4WA 1E6EB 2INNE 3T3OA 3TSSA 2K3UA 2WXKA 4YTMB 2VFRA 4MH8A 2VFVA 4JX1C 4O1NA 3ABVB 2Y3SA 3LLBA 1XLOA 1VRAB 1BXTA 1FEHA 2N7JA 3KJMA 3VRAB 4TQ0A 1TS2A 3P4QB 3FILA 1YJJA 1C79A 1AHVA 1ZDVA 1AYFA 4ZRPA 4DXFA 1M4VA 3V05A 3AMZA 2H89B 3N9YC 2WLBA 4N59A 1E8HA 1W1MA 3NVZB 3BK2A 4DQOC 3TEWA 1W1JA 1DIIA 2VZKD 1ET9A 2OHFA 2V0GA 3POPA 4NJCA 1TJEA 1TY0A 3CWIA 2QKNA 3NVWB 2N0SB 4L23A 1JALA 3AEAB 1KFYB 4JPSA 3ZQ4A 1D5MC 1SE2A 2J52A 2VFTA 3TX1A 4PWBA 2PIAA 1B1ZA 2DYMA 3P4PB 1YQ4B 5AE1A 3BK1A 1DOIA 1JW9D 2Y5PA 3HUIA 3LXFA 3B9JA 1FIQA 3AE4B 1TS4A 5D79A 2XNAC 1E10A 1IBXA 3NVVA 3E9SA 2BS4B 1CZPA 4UDUC 1RFKA 4N58A 4YTNB 2JU6X 1A70A 2GQUA 1RWSA 1C9FA 1E7PB 2AX5A 1WGKA 1ZPSA 1MHHE 3D2JA 2X38A 5FXPA 5G5GA 3GS2A 2LUMA 2BB5A 2RDGA 4PVHA 3A7UA 2AQ2B 4BBYA 1I4QA 1L5PA 5I4DA 1L6UA 2L52A 1AHUA 3AE8B 2PLSA 1VZ7A 4J3OD 2IGGA 1HQRD 1K50A 2K0PA 1AWDA 1STEA 2FE8A 1QLTA 1NEKB 3P63A 2EELA 3URYA 1ROEA 3BYYB 4MLAA 1FXAA 1TYGB 2J42A 4L2YA 5EE3A 1KRHA 1I4GA 3EA6A 4RGOS 1ZR6A 4A8XC 1FCCC 2B76B 3AEDB 2PLIA 4HG0A 2L83A 4HROA 5EE1A 2JX5A 4OHJA 2FUG1 3L4PA 1RYJA 2PVOD 4WAFA 1FO4A 1L4DB 2WXIA 2G1EA 2TSSA 1C4PA 2WU2B 1EM7A 1P7FA 5BMHA 4O95A 1V1PA 2ZW0A 3AE3B 5G5HB 1L0XB 3MP9A 1VDVA 3S1FA 3TUOA 3U4EG 2DBYA 2BTEA 1VR9A 3PO0A 1SXTA 4AQ7A 4PYTA 1ESFA 3NRZA 3Q8BA 1L4ZB 3PQBA 4MM3B 5C3JB 1FXIA 1VLBA 1FNWA 2MH7A 5HI1A 4LK0M 4IOIE 1FCLA 4TVWA 4IKGA 1N5XA 4DNSA 1QOBA 2JWUA 2QIEB 4RFBA 4L1BA 1JWBD 4WQMA 2H88B 3E56A 1VJKA 4OVZA 1XEEA 2IJ0A 5FXEA 4KKIA 2MBRA 2D5GA 3W9CB 3FWAA 4MT5A 4MACA 1JMLA 2J53A 2YEPF 4ZYSA 1W1KA 1D5ZC 3O13A 1L0VB 1W1LA 1NENB 1I4RA 3FW7A 3RJ8A 2Y5CA 2J4XA 3NVVB 2Q5WD 1V8CA 5BMGA 1QLUA 2N9KA 1QOAA 2VZKB 2WXGA 4N6EB 4UD8A 2PTLA 1L0YB 1VZ8A 2EKIA 5AWVA 2NQWA 2BVFA 1J7CA 2SAKA 3AE6B 2JXTA 4BCAA 1I4PA 2BVGA 4B0MA 3AH7A 3RFZB 3W5UB 3Q8FA 2VAOA 4BC9A 3HVDA 5L6FA 3R8BA 4H2AA 4ML8A 4P16A 4YSZB 1AHZA 1DZNA 1SSNA 1N62A 4HRSA 2WQYB 2WU5B 1MHXA 1MVKA 1GOZA 3GSYA 4RNAA 2NMQA 1HZ5A 4PWCA 3AB5A 1SB3C 3NVYA 4RF1A 5HG2A 1IGCA 4KGSA 1N5WC 2INPE 1VZ6A 2WDRB 2WS3B 3I57A 1QQRA 1YN4A 2WXMA 3BVZA 3Q8CA 4HEA1 1EU3A 1FFVA 3AEEB 1SBBB 3BVGA 3A7AA 4OALA 1XXGA 4YSYB 1PGAA 1UGJA 3AEFB 5H92C 1ENFA 1YN3A 2WDVB 3U2SC 2WXFA 2K5PA 2KN4A 1C76A 1KH0A 1N60A 3AECB 4R3DA 1PGBA 1N5WA 2NTTA 5EE9A 2E3TA 3EUB2 2CJNA 2QMTA 5FK9C 2SEBD 4NAWB 1TY2A 3U52E 1C77A 2MJDA 4PVJA 2CU3A 3AE7B 2RPVA 4JB1A 1GB1A 1HA5A 3ETRA 3AE5B 5L6GA 1JWAD 3NS1B 2V4IB 1JWUD 2ON8A 4WH4A 1Y56A 2K9XA 1C4AA 2LMCA 1J7BA 1UUPA 2M56B 3PZ8A 1W1QA 1WVEA 2L32A 2P4PA 1YJIA 2W3SA 5HHDG 2BYTA 3LYYA 4US9A 1P7EA 1ACCA 1UNSA 2IPKD 4RCOA 2KQ4X 3J9CA 4B0EA 2N9LA 1QOGA 1QF6A 1W1RA 2KACA 2EXRA 2Z8LA 2K22A 2LHEA 2QJLA 1B9RA 5D7GA 2Y3AA 3AE2B 1JQ4A 4OZCA 4WIPA 4HKZE 1CQVA 2LHDA 2V3NA 2CJOA 3BW7A 1PDXA 1OQQA 4KX6B 4HKQA 1X2GA 2PLPA 5HHZA 2W54A 1SJED 1KLGD 2WXLA 2Q85A 5BYSA 1VAOA 4OZBA 2WXRA 1HSKA 1F0XA 3ZJVA 5H8YE 2LJIA 2I38A 1WXQA 2VFSA 3AE1B 3AE9B 5JXVA 1D5XC 2BS3B 4D2KA 2FBWB 5C2TB 3FILB 3SR6A 2PKOA 3PZ7A 2W55A 3R2IA 2JQRB 3EUB3 3VR9B 3IAM1 4CQNA 2G9HD 1YQ3B 1E8FA 1XLPA 2PMVA 1SB3B 3I99A 1EU4A 1FFUA 1FRRA 1GB4A 2KMMA 1D4BA 3KQ4A 1X2HA 3NVZA 3D2HA 1T3QA 3TEYA 2IGDA 5BYRA 3FW8A 1VQZA 2WXPA 4YSXB 1L6VA 5HFYA 3NVWA 4ZHPA 1XF5L 1QT9A 1MBTA 1JWSD 2O3GA 1W1OA 4JAYA 2DYOA 1NYQA 2BB6A 3LB8C 2JYEA 4TMAB 3IXSA 3B9JB 1FIQB 3TSHA 2MJ3A 2MEKA 3AEBB 2I0KA 4XDDA 1IBXB 1JROA 1F2RI 1R7SA 3WCQA 2BT6A 3W1SA 1ZXIA 1TKYA 1N62C 1QOFA 1HXYD 3BVMA 3S1CA 1DYQA 3BIID 3TEZA 1DIQA 2QPMA 2DLBA 3IT6B 1I19A 2P3HA 4LTUA 1LO5D 2WXQA 3IAS1 3RJAA 4GLSC 1ZXHA 2GI9A 5G5GB 5GXGB 3Q8EA 1CK1A 1SJHD 2E6XA 1W1SA 1PUTA 3Q8AA 1ZDXA 5HMRA 1UXYA 1UWMA 3MHZA 3UI3A 5I1WA 1HEZE 5EE0A 1FFVC 2M0AA 3NUHB 3W5VB 4A55A 1Q10A 3W8ZA 4RF0A 2R61A 1NYRA 4JWUC 2MJEA 2PW9A 4LLGM 3FW9A 2UUVA 1WVFA 4US8A 3D2DA 4OZAA 4RGTA 3NZ3A 4DXGA 1ZOYB 1E9MA 1QILA 1BMLC 2QSDA 1FNUA 1N60C 3P4RB 4TVYA 1BUIC 1D6EC 4PZFA 1N63A 1I4HA 1T5XD 1SEBD 2QEJC 2ZW1A 5K8EA 2W3RA 3OWEB 4P6VF 4XWTA 4YXDB 3ZJUA 1KLUD 3DWMA 3AM9A 3HRDD 3U7ZA 1WYGA 3IT4B 1DOYA 1ZUD2 4JWSC 4USAA 1XLQA 3RPFC 1V1PB 5FKAC 5E6JA 4AS1A 4KKJA 2JSVX 1N61A 2WXJA 3MJ5A 4NZLB 5AUIA 3HRDC 2BS2B 2WXNA 3NRZB 3P4SB 5G5HA 4XWWA 3BWUD 3SR6B 1PGXA 2BW2A 3GP7A 1ZE3D 1TS5A 3KWVA 1V1OA 3P1MA 4ARIA 3W8XA 1J7AA 2BBCA 4C80A 3S1DA 2YEPB 4XDCA 3H8HA 1JRPA 3B2FA 3T3NA 3LAEA 1TKGA 4A9AA 2R2ZA 2NTSA 1YMHE 4XE0A 5AUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ITK A;  2PVG C;  2WDQ B;  5AE2 A;  3DWG C;  1KF6 B;  1TKE A;  1I7H A;  4PVK A;  3SFE B;  3JS8 A;  1ZP0 B;  2ACZ B;  1WRI A;  3HVZ A;  3C0P A;  1E0Y A;  2BVH A;  5FXF A;  3W8W A;  5FXD A;  3VR8 B;  2KAJ A;  2R8D A;  1XLN A;  4ZHO A;  1GPX A;  2WP9 B;  2P13 A;  1RM6 B;  4WWM A;  3B2G A;  3VRB B;  2GQT A;  1DGJ A;  3FC4 A;  4ZOH B;  2DWQ A;  3NVY B;  1EWY C;  1FFU C;  3DQ0 A;  1T3Q C;  1NI3 A;  3AV8 A;  4C7Y A;  4FXC A;  3ZYY X;  1SIJ A;  3DED A;  3PM9 A;  3A7R A;  5ADZ A;  1DOX A;  5MPO A;  1ZXI C;  2LEK A;  4EC3 A;  4BC7 A;  1FM0 D;  3ETR B;  1IUE A;  3VTE A;  3KWL A;  3FAH A;  4PVE A;  2YVS A;  1WWT A;  3NS1 A;  4YTP B;  2OAI A;  3CIR B;  1RM6 C;  1E8G A;  3R07 C;  2RK5 A;  4ZOH C;  1MBB A;  1GAQ B;  5AE3 A;  1FRD A;  1QLB B;  5HQX A;  1N63 C;  4XLO A;  2HTM E;  2AXR A;  1OFF A;  1OQR A;  1FMA D;  2VFU A;  1E0Z A;  4C7Z A;  3AN1 A;  1N61 C;  3TSJ A;  1NVI D;  3S1E A;  1PFD A;  1V97 A;  2E5A A;  4IDI A;  4YT0 B;  1SF0 A;  1CJE A;  3AEG B;  3SFD B;  1F0Z A;  1XO3 A;  2M19 A;  2Q4W A;  1E6E B;  4YTM B;  2VFR A;  2VFV A;  4JX1 C;  3LLB A;  3ABV B;  1XLO A;  3KJM A;  3VRA B;  3P4Q B;  1YJJ A;  1AHV A;  1AYF A;  3AMZ A;  2H89 B;  4N59 A;  2WLB A;  1E8H A;  1W1M A;  3NVZ B;  1W1J A;  1DII A;  2OHF A;  1TJE A;  3CWI A;  2QKN A;  3NVW B;  2N0S B;  1JAL A;  3AEA B;  1KFY B;  2VFT A;  3TX1 A;  4PWB A;  2PIA A;  3P4P B;  1YQ4 B;  5AE1 A;  1DOI A;  1JW9 D;  3HUI A;  3LXF A;  3B9J A;  1FIQ A;  3AE4 B;  5D79 A;  1E10 A;  3NVV A;  2BS4 B;  1CZP A;  1RFK A;  4N58 A;  4YTN B;  1A70 A;  2GQU A;  1RWS A;  1E7P B;  2AX5 A;  1WGK A;  3D2J A;  5FXP A;  5G5G A;  4PVH A;  3A7U A;  4BBY A;  1L5P A;  1L6U A;  2L52 A;  1AHU A;  3AE8 B;  2PLS A;  1AWD A;  1QLT A;  1NEK B;  3P63 A;  1ROE A;  4MLA A;  1FXA A;  1TYG B;  5EE3 A;  1KRH A;  1ZR6 A;  2B76 B;  3AED B;  2PLI A;  4HG0 A;  2L83 A;  4HRO A;  5EE1 A;  2JX5 A;  3L4P A;  1RYJ A;  2PVO D;  1FO4 A;  2G1E A;  2WU2 B;  4O95 A;  3AE3 B;  5G5H B;  1VDV A;  3S1F A;  2DBY A;  4PYT A;  3PO0 A;  3NRZ A;  5C3J B;  1FXI A;  1VLB A;  2MH7 A;  4TVW A;  1N5X A;  4DNS A;  1QOB A;  2QIE B;  1JWB D;  4WQM A;  2H88 B;  1VJK A;  5FXE A;  2MBR A;  3W9C B;  3FWA A;  1W1K A;  1W1L A;  1L0V B;  3FW7 A;  1NEN B;  2Y5C A;  3NVV B;  2Q5W D;  1V8C A;  1QLU A;  4UD8 A;  1QOA A;  4N6E B;  2EKI A;  2NQW A;  2BVF A;  1J7C A;  3AE6 B;  4BCA A;  2BVG A;  3AH7 A;  3W5U B;  2VAO A;  4BC9 A;  4ML8 A;  4YSZ B;  1AHZ A;  1DZN A;  1N62 A;  4HRS A;  2WQY B;  2WU5 B;  3GSY A;  4PWC A;  3AB5 A;  1SB3 C;  3NVY A;  1N5W C;  2WDR B;  2WS3 B;  1FFV A;  3AEE B;  3A7A A;  4OAL A;  4YSY B;  3AEF B;  5H92 C;  2WDV B;  2K5P A;  3AEC B;  1N60 A;  1N5W A;  5EE9 A;  2E3T A;  3EUB 2;  2CJN A;  2MJD A;  4PVJ A;  2CU3 A;  3AE7 B;  4JB1 A;  3ETR A;  3AE5 B;  1JWA D;  3NS1 B;  2K9X A;  1J7B A;  2M56 B;  1W1Q A;  1WVE A;  2P4P A;  1YJI A;  2W3S A;  4US9 A;  1QOG A;  1QF6 A;  1W1R A;  2EXR A;  2K22 A;  2QJL A;  1B9R A;  3AE2 B;  1JQ4 A;  2CJO A;  3BW7 A;  1PDX A;  1OQQ A;  4KX6 B;  1X2G A;  5HHZ A;  2W54 A;  2Q85 A;  1VAO A;  1HSK A;  1F0X A;  5H8Y E;  1WXQ A;  2VFS A;  3AE1 B;  3AE9 B;  2BS3 B;  2FBW B;  5C2T B;  3SR6 A;  2PKO A;  2W55 A;  2JQR B;  3EUB 3;  3VR9 B;  1E8F A;  1YQ3 B;  1XLP A;  1SB3 B;  3I99 A;  1FRR A;  1FFU A;  2KMM A;  1X2H A;  3NVZ A;  3D2H A;  1T3Q A;  3FW8 A;  1VQZ A;  4YSX B;  1L6V A;  3NVW A;  4ZHP A;  1QT9 A;  1MBT A;  2O3G A;  1W1O A;  4JAY A;  1NYQ A;  3LB8 C;  3B9J B;  1FIQ B;  3TSH A;  2MJ3 A;  3AEB B;  2I0K A;  1JRO A;  1R7S A;  3WCQ A;  2BT6 A;  1ZXI A;  1TKY A;  1N62 C;  1QOF A;  3S1C A;  3BII D;  2QPM A;  1DIQ A;  1I19 A;  2P3H A;  4LTU A;  5G5G B;  5GXG B;  1W1S A;  1PUT A;  5HMR A;  1UXY A;  1UWM A;  1FFV C;  5EE0 A;  3W5V B;  3W8Z A;  1NYR A;  4JWU C;  2MJE A;  3FW9 A;  1WVF A;  4US8 A;  3D2D A;  1ZOY B;  1E9M A;  1N60 C;  4TVY A;  3P4R B;  4PZF A;  1N63 A;  2W3R A;  4YXD B;  4P6V F;  3DWM A;  3AM9 A;  3HRD D;  1WYG A;  1DOY A;  1ZUD 2;  4JWS C;  4USA A;  1XLQ A;  3RPF C;  1N61 A;  5AUI A;  3HRD C;  2BS2 B;  3NRZ B;  3P4S B;  5G5H A;  3SR6 B;  3P1M A;  3W8X A;  1J7A A;  4C80 A;  3S1D A;  1JRP A;  3B2F A;  3LAE A;  1TKG A;  4A9A A;  2R2Z A;  5AUK A; 
#chains in the Genus database with same CATH topology
 3CXB A;  1MC8 A;  4E3C A;  1DOQ A;  3IVF A;  9ICK A;  3A4S C;  4LCD E;  3HKZ F;  2WXO A;  2XN9 C;  2WDQ B;  2JZP A;  2OJR A;  4OVV A;  1SWW A;  5C0Y A;  3RR8 A;  5AK5 A;  2IOF K;  2GL5 A;  2PTX A;  4DOC A;  3PZD A;  4ARC A;  1I7H A;  1F2R C;  3K9O B;  1WRI A;  2H3F A;  3QLD A;  2HNE A;  2LD9 A;  4O3P A;  3TFR A;  2O2V B;  2WAQ F;  3HVZ A;  1UT8 A;  4IM0 A;  1NZB A;  2C3C A;  3GIM A;  3M8R A;  2V4Q A;  3H4K A;  3C5F A;  4M6W B;  1JPM A;  2FLP A;  4YWG G;  4QWE A;  4HPN A;  1B0X A;  2F2A B;  4ZHO A;  1QQ7 A;  1UCV A;  8ICV A;  1QH9 A;  2M9N A;  3PX6 A;  2JRH A;  3DG6 A;  2DQN B;  4TUP A;  2R18 A;  2C3D A;  5J2J A;  3B2G A;  5KAI U;  4WWM A;  5KFM A;  3KYC D;  3FC4 A;  1LV5 A;  2DWQ A;  4BVU C;  3NVY B;  2BCP A;  1FFU C;  4QWD A;  3HW8 A;  1VCB A;  4J9L A;  3V3X A;  5L1I A;  5ALW A;  1Q1O A;  3TKA A;  5ALR A;  3ZTD A;  1JWM D;  2NRW A;  4TUQ A;  4ZYN A;  1S97 A;  2Z7J A;  3UXO A;  3JVA A;  5CHG A;  1PYW D;  1URJ A;  3RCY A;  8ICL A;  8ICQ A;  1J97 A;  3ORY A;  4EWJ A;  1UQV A;  5B66 U;  2WOW A;  3CYJ A;  4GDK B;  3GB1 A;  1FD6 A;  2KYW A;  1GXF A;  4J9Q A;  2LJ5 A;  2GR2 A;  2WTF A;  2OKT A;  2LEK A;  4W9E A;  1GC7 A;  3U7D A;  4HYR A;  2I2Y A;  1MOK A;  3B08 A;  5CHV C;  3BJS A;  4RQM A;  3TEX A;  3VC5 A;  5AM0 A;  5ALE A;  2D6F C;  3ETR B;  8ICA A;  4H4Q A;  2BC0 A;  2BQR A;  3D46 A;  3DPD A;  3VTE A;  3EAN A;  3ZDC A;  2PI5 A;  3BQ1 A;  2J0J A;  3APD A;  3PHW B;  2GOL A;  4PVE A;  3AL0 B;  4Q8F A;  2YVS A;  3R2T A;  4IUM B;  1XNS A;  3UQA A;  1IP9 A;  1QKZ A;  2KFJ A;  3NAS A;  5KFY A;  1WCN A;  1RXV A;  3ZUN A;  4B9K A;  9ICR A;  1P0R A;  3ZXV A;  4DLE A;  1XCT L;  2ISP A;  2KNB A;  2JZ3 B;  3ISC A;  2RK5 A;  3HSU A;  1RG6 A;  2LYA A;  4LNF A;  3KVF B;  2L1A A;  2KDE B;  3SZ2 A;  1ZK7 A;  3URH A;  2B6G A;  2VRR B;  5L1J A;  3SJN A;  3BZD B;  4XLO A;  1KTK A;  2M17 A;  2AXR A;  4JMU A;  3P42 A;  2ZCB A;  1OFF A;  3I76 A;  5J17 A;  3Q8Q B;  4DQI A;  1OQR A;  3CB3 A;  4E8G A;  7ICR A;  2VFU A;  2NO5 A;  2O6V B;  1B22 A;  5D3D A;  4KGT A;  3BIN A;  4NAM A;  3PPA A;  4EZJ A;  2BWF A;  3BS5 B;  3S1E A;  1KM7 A;  2HD5 B;  1V97 A;  3AXC A;  3DVG X;  4TSS A;  3R3M A;  2VKQ A;  4KLO A;  1ZMD A;  3HKZ C;  4PJ0 U;  4YMM A;  2AQ0 A;  3KLS X;  2P8C A;  4NJ6 A;  2FNJ B;  2MWS B;  3AEG B;  3GZN B;  2FPK A;  4TKN A;  3H8S A;  3DFH A;  2M19 A;  4H4U A;  3RGT A;  2Q4W A;  2C5L C;  2YVG A;  2K3U A;  4NV0 A;  2WXK A;  5AKK A;  5KG0 A;  3ABV B;  1XLO A;  2UWQ A;  4P1C C;  1VRA B;  5HHH A;  1FEH A;  2BKF A;  2N7J A;  3KJM A;  3H8J A;  4ROP A;  4JK1 A;  2BQ3 A;  1TS2 A;  3PT2 B;  2PGW A;  4HLE A;  4K81 A;  1YJJ A;  1ZDV A;  2VA8 A;  3CYM A;  1ZJN A;  1AYF A;  2ZNV C;  2PFO A;  2EAO A;  1M4V A;  5AK6 A;  1TKD A;  3V05 A;  5DB9 A;  3C5G A;  3SI8 A;  4DSJ A;  1L2N A;  4P7I A;  2ALZ A;  1SWV A;  4DQQ A;  1WH3 A;  3AI5 A;  2ZJD A;  5AM3 A;  4O9M A;  9ICI A;  3RZF A;  2AU0 A;  1D8B A;  4NY8 A;  2NVU I;  1YZ7 A;  1S76 D;  2PCE A;  3R10 A;  3ZTC A;  2AL2 B;  1U45 A;  3I3T B;  1C7Y A;  4M8N A;  3P4P B;  3SHQ A;  3ZDE A;  3BK1 A;  3CGE A;  3H7V A;  4RNN A;  1JW9 D;  3PV1 A;  2Y5P A;  3B9J A;  2MP2 B;  2KJR A;  3H12 A;  5K4L A;  2L8J A;  2XIC A;  3NVV A;  3E9S A;  1HTO A;  2LAS A;  1TAM A;  5EOZ A;  4EM3 A;  4DX3 A;  4YTN B;  2JU6 X;  2JZB B;  1E7P B;  3VCC A;  1WGK A;  3ZLZ A;  2NPT A;  3CGC A;  3I5J C;  1TK8 A;  4EZK A;  2KAN A;  3IM1 A;  3KUZ A;  1G6J A;  1NJY A;  2LUM A;  4X2P A;  2I1J A;  4PVH A;  4KZ0 A;  1I4Q A;  3LK9 A;  4DEZ A;  3UXK A;  1V9P A;  2G0A A;  1TZ1 A;  3SMV A;  2L52 A;  1AHU A;  2PLS A;  2EZZ A;  1BQG A;  3UJ2 A;  1VZ7 A;  4APN A;  2IGG A;  4F72 A;  4J56 A;  4JN7 A;  4RQN A;  2K0P A;  2FE8 A;  1STE A;  2KX3 A;  2OPJ A;  2EEL A;  3C23 A;  1ECQ A;  2RP5 A;  1UHU A;  5CRX A;  3SN4 A;  4MLA A;  3ZI4 A;  4A3R A;  1TYG B;  2J42 A;  3RJJ A;  5EE3 A;  3KYD D;  3SD5 A;  2BZF A;  2Y0S C;  2I6X A;  2HHT A;  2L00 B;  3EA6 A;  3FKY A;  1XT9 B;  1ZR6 A;  2LPE A;  3JPT A;  4ZA0 A;  2ZAD A;  1IXR A;  3AED B;  2OH2 A;  2NBV B;  2P3Z A;  9ICL A;  1V2Y A;  2CHW A;  4OD0 A;  2EZX A;  2HOQ A;  4AOF A;  1H4R A;  1MUC A;  4WAF A;  3H4B A;  1JX4 A;  4ZRI A;  1L4D B;  2BVC A;  2G1E A;  2TSS A;  2WXI A;  2ZZ0 A;  3OGU A;  1P7F A;  1TAQ A;  5ALG A;  5G5H B;  3MP9 A;  4FS2 A;  1WMH A;  2K4E A;  2BYE A;  1Z2M A;  2PP0 A;  2KFK A;  2BTE A;  2DBY A;  4QZA A;  1ZKH A;  4FO6 A;  4PYT A;  2KVZ A;  3RB3 A;  4OJP A;  2K8B A;  3TOY A;  1P1A A;  1FXI A;  2KMC A;  1FNW A;  4W9F A;  4DWD A;  4HXD A;  2YMM A;  1JN3 A;  4IOI E;  4KIK B;  4LK0 M;  4DNS A;  1JIH A;  1OJT A;  1K5O A;  2C7N B;  4IM2 A;  2F77 X;  5HKH A;  2QIE B;  4YCX A;  1Q3U A;  4W9D A;  1ZQL A;  4IW0 A;  4Y2S A;  2KDI A;  4L1B A;  2HZG A;  2ZUC A;  4HN8 A;  3DJG X;  3UJF A;  1XEE A;  3C21 A;  2BDP A;  5FXE A;  1ISN A;  2CHZ A;  2IZV B;  2UYZ B;  5KFF A;  3VUY A;  1Z19 A;  4NJ8 A;  2YMP A;  2HI0 A;  2RHF A;  4ACF A;  1L6N A;  2V4R A;  2G06 A;  4MAC A;  4II2 B;  3H0R B;  3HJE A;  3EHV A;  2J53 A;  3ZVH A;  3ZVI A;  4RQ6 A;  2MSE D;  3MC9 A;  1L0V B;  3O13 A;  4A3P A;  2A19 A;  2Y5C A;  2J4X A;  4YXJ A;  3X0W A;  4OO1 J;  2HHQ A;  4DFD A;  4QZB A;  2RDI A;  3C2M A;  3D32 A;  4UD8 A;  4J3Z A;  1ZQV A;  2KKC A;  2NQW A;  2LGS A;  5KFS A;  2GBJ A;  2BCV A;  2Y9U A;  1I4P A;  2BVG A;  5GMV A;  4JB1 A;  8ICB A;  5IIO A;  2FI1 A;  2WGS A;  5CP2 A;  1ED1 A;  3DG3 A;  3WAO A;  4BC9 A;  2W8K A;  1UF0 A;  3K75 D;  1YJ1 A;  4EBD A;  4CRX A;  2UU7 A;  5KHO A;  1AHZ A;  4IWP A;  1V38 A;  2RSU A;  1Q1R A;  1GOZ A;  5FJU A;  4RNA A;  2JEI A;  9ICE A;  1DXL A;  3WK6 A;  2X8C A;  3WIM A;  4F3O A;  1ZQS A;  3WK8 A;  4RF1 A;  4R64 A;  3TAR A;  1BWC A;  4HCD A;  4TUU A;  5J2C A;  2XGP A;  3PSE B;  1N5W C;  3MAB A;  3Q8C A;  2H3I A;  3I57 A;  1WXV A;  2LKY A;  4H4R A;  1NK8 A;  9ICT A;  3DFY A;  1SBB B;  3T3F A;  5ALD A;  2BGW A;  3BVG A;  2RR9 A;  2MNR A;  1XXG A;  2EQY A;  2KKV A;  2N7E A;  1UGJ A;  3WKB A;  4YSY B;  4GXI A;  2XGZ A;  1ENF A;  1YN3 A;  5DPS A;  2XK5 B;  3U2S C;  1DTN A;  1WIA A;  1C76 A;  4R3D A;  1ECW A;  3AU4 A;  3RNF C;  3TMP B;  2E3T A;  4WJQ A;  1WUE A;  4RZR A;  1QLN A;  2XO7 A;  1FEZ A;  4RUC A;  4Z1Y A;  1N2X A;  3PNC A;  3M1Y A;  2CU3 A;  3AE7 B;  2NR2 A;  3UMG A;  2J0K A;  1OW5 A;  5KFI A;  4NNJ B;  2MU2 A;  1GB1 A;  4O3R A;  3H8M A;  2X8X X;  1HA5 A;  3VTW A;  4I2I A;  4XGA B;  4HAI A;  1XS2 A;  2XCP A;  4I2G A;  3NS1 B;  2V4I B;  2H5X A;  4BAX A;  1F9C A;  5DBC A;  2IMW P;  3C1Z A;  3BY4 B;  3KD3 A;  3QX7 A;  3IK4 A;  3X23 A;  2K9X A;  5KFU A;  2BQQ A;  3N3K B;  2M56 B;  3ML9 A;  4M02 A;  2ZZC A;  4JN8 A;  4E5T A;  1S8O A;  1UA0 A;  2GGG A;  1KEJ A;  3PW0 A;  2DKX A;  2VH2 A;  3JYU A;  3H6N A;  4I2E A;  2Y5B B;  1JRU A;  3LYY A;  4K3B A;  4FZL A;  2GWS A;  3H9D A;  4M0W B;  4DDG D;  1W6T A;  4RCO A;  3LXD A;  4YR0 A;  3N30 A;  2ZPN A;  2XH7 A;  4DK5 A;  4YR3 A;  3VTV A;  4JDR A;  1QF6 A;  4TQR A;  1WZ3 A;  2LM4 A;  1ZY8 A;  3DJJ A;  2QJL A;  3WK4 A;  1LM8 B;  4RT2 A;  2LHE A;  3EWA A;  1XSP A;  3D2Q A;  1B9R A;  4JQW C;  4KLJ A;  1NDD A;  4ED2 A;  3GDX A;  1NI2 A;  4CDG A;  4K7U A;  4PHD A;  4PHE A;  5D7G A;  5DLF A;  3KOO A;  3LVW A;  8ICU A;  1K1S A;  3DBS A;  4MH0 E;  4OZC A;  4FBJ B;  4HKZ E;  2W9B B;  5EU9 A;  1CQV A;  4P4O A;  5HML A;  2LHD A;  2CN1 A;  3Q8P B;  4NLB A;  3R9K A;  1ZQI A;  2KOB A;  1PDX A;  1OQQ A;  3A33 B;  3AU5 A;  1SIF A;  5ENL A;  2AL1 A;  1LB2 B;  1PDZ A;  2D11 A;  4I2J A;  4DSL A;  3JSV B;  2Q85 A;  2FCS A;  3D9X A;  4AP4 C;  1F0X A;  3ZW3 A;  4I2H A;  4GXJ A;  5AM5 A;  3AUO A;  3DBH B;  3IHP C;  1WXQ A;  5DG7 A;  2K6D B;  3SQI A;  2FID A;  3O65 B;  5KL1 B;  1I42 A;  2UVV A;  5KT7 A;  2PKO A;  3PZ7 A;  3BS7 A;  3T79 A;  4I27 A;  1T8E A;  4H4V A;  2KD1 A;  4UB8 U;  4G50 A;  1GNU A;  3EUB 3;  2JXX A;  3APC A;  5ALU A;  1XLP A;  2PMV A;  1SB3 B;  3I99 A;  2HJ8 A;  2QLT A;  4YMN A;  1EC9 A;  5L95 C;  1EU4 A;  1FFU A;  2KMM A;  3MQT A;  3NVZ A;  3OSP A;  1D9D A;  2IGD A;  4QIW F;  3STP A;  2C7H A;  4YSX B;  4I2B A;  1L6V A;  1KDH A;  4K7Z A;  3NVW A;  1AQ6 A;  1XF5 L;  4ZHP A;  3OPX A;  3DCG A;  5J2K A;  2B3A A;  2BPG A;  1NYQ A;  2RDJ A;  2BB6 A;  5IIM A;  4TMA B;  3EKG A;  5EWE A;  3QCA A;  2W9A A;  1IYF A;  1L7N A;  3TSH A;  2FMQ A;  3JPS A;  2FJ6 A;  2MJ3 A;  3DK8 A;  3EYZ A;  1IBX B;  1F2R I;  3KTQ A;  4J9O A;  3NG0 A;  5KFN A;  2X8G A;  1TKY A;  1N62 C;  1GG3 A;  5ALO A;  2GLE A;  4IHC A;  2PPG A;  4GU2 A;  3HPO A;  3F53 A;  1S1Q B;  3BZC A;  8ICW A;  1WGY A;  5FJT A;  1L7Y A;  2KNJ A;  1QZE A;  3SN0 A;  5JCN A;  3IAS 1;  3S5S A;  2GI9 A;  5GXG B;  5KFC A;  4BX9 C;  3RFA A;  5IIJ A;  4GGH A;  2W43 A;  2CS4 A;  3Q8A A;  4I2C A;  2E5S A;  1S9F A;  3PRP B;  5LXH A;  1UXY A;  1L8L A;  1PVR A;  3K9P B;  1HEZ E;  3NUH B;  4NQL B;  3W5V B;  2AYO B;  2F1J A;  3UIP B;  2V9H A;  3KZX A;  5ALV A;  4H4P A;  2UUV A;  4GFJ A;  2DF4 B;  4EEY A;  4US8 A;  3N7R C;  2N9X A;  1WVF A;  2JV3 A;  4RGT A;  3M7D A;  3UCC A;  4Q45 A;  4XX5 A;  1BML C;  2QSD A;  1N60 C;  3P4R B;  2YB4 A;  1JPD X;  3D2N A;  4IS7 A;  5ALF A;  2WB1 C;  5HHI A;  4H4T A;  2ZW1 A;  4F7Z A;  8ICG A;  2M0N A;  3ZJU A;  1E90 A;  4UAR A;  2R8H A;  3A9J A;  4LJO B;  1S7M A;  2BDU A;  2PMQ A;  3TWB A;  2AGP A;  4USA A;  4J6I A;  4KDL B;  4BKG A;  3CF6 E;  5FKA C;  4BKT A;  1WE7 A;  4YXM A;  4O3N A;  1F8W A;  2YB1 A;  1N48 A;  4UBC A;  3JZU A;  4MJS B;  4QW9 A;  5KT3 A;  3UQ2 A;  5AI8 A;  5KFQ A;  4IRD A;  2DZJ A;  4O0I A;  3BQ0 A;  1WXA A;  2DZK A;  3KWV A;  1V1O A;  4ARI A;  1GRH A;  1ZQK A;  2Q0Z X;  1VD2 A;  4KTQ A;  2RPQ A;  1TE2 A;  2NBU A;  2JGA A;  3Q4D A;  1TKG A;  4A9A A;  1GRG A;  4HJK A;  3G6X A;  4ANX A;  3EFU A;  3APF A;  4PH5 A;  1YMH E;  4XE0 A;  5AUK A;  4E74 A;  4ITK A;  3QTP A;  4P4P A;  3IG3 A;  5AKE A;  2ZXH A;  2FDR A;  9ICX A;  3EGR A;  5AK4 A;  4MGI E;  5KG3 A;  4RGM A;  3OTR A;  3AU2 A;  2D07 B;  3K1R B;  4W9J A;  4ZRJ A;  5IAA C;  5AE2 A;  2RLT A;  4KPR A;  4XQ8 A;  2L0F A;  2QAE A;  4RQ4 A;  4C8L A;  1E7V A;  3TQ1 A;  3KZI U;  5IDZ A;  4FFD A;  1KF6 B;  3ZKJ C;  4KDI C;  3E58 A;  4M9G A;  3SFE B;  3JS8 A;  1ZP0 B;  2ACZ B;  3OTQ A;  5J0Y A;  1TS3 A;  3UMB A;  4LA1 A;  5FJP A;  2G4D B;  4K8D A;  3U26 A;  2BVH A;  3GZF A;  4YD1 A;  1C78 A;  1NK5 A;  4MGK E;  3N28 A;  4W9H A;  4EUT A;  1PUZ A;  5EWG A;  1WCL A;  2RMM A;  1STZ A;  4ENL A;  2ZTC A;  4DHJ B;  3PK7 A;  4QIW C;  3KHL A;  4YQW A;  4JE3 B;  5EDS A;  4BV6 A;  4II3 B;  2PP1 A;  1XLN A;  4JLC A;  3PX0 A;  5E6O A;  3M9O B;  5FR3 A;  1TTN A;  5AZG A;  5I1V A;  5IKC M;  1YEY A;  2DPJ A;  2Y3R A;  4XYC A;  1RM6 B;  3VRB B;  4FJV B;  3H8A A;  1DGJ A;  3J81 j;  4ZOH B;  2WP6 A;  1BNO A;  4KGR A;  3CMM B;  2K60 A;  2L0T A;  1WJN A;  1Z4N A;  2JRZ A;  4RQ1 A;  4KLH A;  2RDB C;  3I9V 1;  3QXG A;  2XEW A;  1BPE A;  3PRE A;  4C7Y A;  4A6Q A;  3OW1 A;  4M8M A;  3DGB A;  2RDX A;  3JPP A;  3MSY A;  3SEB A;  1SIJ A;  2JY6 A;  3WK9 A;  5AI5 A;  2YLM A;  2PS2 A;  3UGV A;  1FEC A;  2D3G A;  3NZU A;  3TJ4 A;  5EWF A;  4K3C A;  4KN7 A;  2IDY A;  5ADZ A;  3L10 B;  2OYY A;  5AM2 A;  4EZ6 A;  2WXH A;  1WR6 E;  3W1S C;  2NV3 A;  5B5E U;  7ICO A;  1N6Z A;  2OFJ A;  3E2E A;  1V86 A;  1PVQ A;  1TZO A;  5JU5 A;  3MC8 A;  2DUY A;  2RDH A;  3Q2A C;  4W9C A;  1QSY A;  4WWN A;  4ZRQ A;  8ICT A;  1NHR A;  2E8O A;  5L9X A;  1YQB A;  1RDF A;  2GB1 A;  3WA0 A;  1IPG A;  3KHR A;  5ALM A;  3Q69 A;  1FM0 D;  5JHB A;  2CPR A;  5KTQ A;  4TQS A;  1BPB A;  4IC7 B;  4UQG A;  4FN2 A;  1P43 A;  8ICI A;  2ZIV B;  1ZGU B;  2JUO A;  5J2F A;  1S10 A;  1WWT A;  2AQ3 B;  3VCB A;  2KFN A;  3AU6 A;  3CGB A;  2OCE A;  2BWE S;  3ONN A;  4QZE A;  3DK4 A;  4URK A;  3VC6 A;  1KSP A;  4KV2 A;  4QZ9 A;  1T0Y A;  2HDE A;  2XH4 A;  1FRD A;  1XWL A;  5JCK A;  1IGD A;  1QLB B;  1K1Q A;  5KG4 A;  4Z6D A;  7ICQ A;  2D2Q A;  1JUD A;  1ZQQ A;  1A6S A;  3C0R B;  4ZH4 A;  4B9S A;  1H6V A;  2J7Q B;  4DL3 A;  1XDI A;  3FCP A;  4C4V A;  4MGY E;  2CXY A;  4F5R A;  4DO9 A;  1HUO A;  4BDP A;  3H1U A;  2BPF A;  4QZH A;  2FPM A;  3OP2 A;  4C7Z A;  4HWI B;  3SQP A;  3MR6 A;  2KK0 A;  2CHR A;  2E5A A;  1F77 A;  3RH6 A;  7ICJ A;  4YT0 B;  1HZ6 A;  3CP8 A;  2HXU A;  2IOH A;  3EJE B;  1XSN A;  1CJE A;  1E8X A;  1FNV A;  1YNT E;  3EEZ A;  3MDC A;  3HW2 A;  2KV2 A;  5BPC A;  1IV8 A;  3NUQ A;  4XC2 A;  3ZLH A;  5J0R A;  3QU4 A;  2MCN B;  5BMI A;  3UGB B;  4QZ8 A;  5LNK 1;  1GSN A;  1NK4 A;  3BDP A;  3T3O A;  3TSS A;  4M00 A;  4YVZ A;  2XY7 A;  4YTM B;  2VFR A;  4MH8 A;  3U30 A;  4MFA A;  5E6N A;  4Q44 A;  3OAW A;  1TYT A;  1PK1 A;  4QW8 A;  8ICM A;  1BXT A;  3A4R A;  4KLM A;  3TBL D;  2J6T A;  3PRM B;  3FIL A;  2FUH B;  3ZO5 B;  1AHV A;  1C79 A;  3PW2 A;  1T0R C;  2FCM A;  1SJB A;  3V7J A;  3THU A;  1ZOL A;  3MC1 A;  4RNO A;  4DXF A;  4F50 A;  4QZI A;  3KFU F;  2F1H A;  3TAC B;  2BCQ A;  4JV1 A;  1U4A A;  2H89 B;  3BK2 A;  4NL9 C;  3V4B A;  2VZK D;  1ZD3 A;  4AYB F;  2MUT A;  2OHF A;  1SE9 A;  2V0G A;  2OQH A;  2EMT A;  2IY0 B;  3FYH A;  1MDL A;  2N0S B;  2YQE A;  4FHJ A;  1ZJM A;  1Q1W A;  2C2R A;  1JAL A;  3AEA B;  1WG8 A;  4JPS A;  1D5M C;  1SE2 A;  5KFD A;  2WFA A;  2J52 A;  4NQK E;  2ZG6 A;  4GSW A;  8ICE A;  4GC6 A;  1EF5 A;  4I6P A;  3S2A A;  3PX4 A;  4JGH B;  5JZE B;  3F2D A;  3IDW A;  2W9N A;  3K1Z A;  4Y2T A;  4OJ6 A;  4FHK A;  3CRX A;  4C4R A;  4PHP A;  1UH6 A;  2JH1 A;  5BO4 B;  4M52 A;  3HUI A;  2KTQ A;  1HEK A;  3AE4 B;  1FIQ A;  3L16 A;  4HCN B;  5AK3 A;  2XNA C;  2MSN A;  2WOI A;  3BQ7 A;  4EQS A;  2ZIX B;  3ZD9 A;  4DFM A;  2BS4 B;  1WM3 A;  4ACO A;  4UDU C;  1Z3E B;  4DSF A;  4EEN A;  2L76 A;  5FS6 A;  3ZRF A;  1RWS A;  2MUC A;  3MFI A;  1MHH E;  3DGH A;  3PR4 A;  5AKG A;  4F5Q A;  3Q45 A;  5FXP A;  5G5G A;  5L1M A;  4M9J A;  2YQU A;  2LZ6 A;  4P4M A;  5AI9 A;  4M0A A;  3HM6 X;  3L0W B;  1HTQ A;  4M9H A;  4J3O D;  4ECV A;  1K50 A;  2KWC A;  3R11 A;  1NEK B;  1ZQT A;  1KRP A;  1TYP A;  1ROE A;  5JHA A;  2WHE A;  1NK7 A;  5CTR C;  4L2Y A;  4IP5 A;  1Q8K A;  4UB2 A;  1I4G A;  1KRH A;  1ZQH A;  4LDT B;  4RGO S;  2LRW A;  3TWA A;  5J2A A;  1MQ2 A;  2B76 B;  3RAQ A;  2JEJ A;  2OXO A;  4HNL A;  2PLI A;  2AH5 A;  1OQY A;  3PWG A;  3MFH A;  4BOS C;  4J9R A;  5KG2 A;  4OHJ A;  3DVN U;  2MBQ A;  1HUZ A;  3ZDM C;  3FYY A;  1KKR A;  4KLF A;  4IL6 U;  3IJQ A;  3A1Q B;  2QGY A;  2ZW0 A;  3PMN A;  1ZQN A;  3A9K A;  2YVF A;  4E4F A;  4MF2 A;  1RQL A;  3SU8 X;  5AKZ A;  3U4E G;  4GR1 A;  1SXT A;  2C2D A;  3GE8 C;  1ESF A;  3Q8B A;  2PMZ F;  3PQB A;  2F76 X;  3KBB A;  4LVS A;  4MM3 B;  3VHT C;  3PGE A;  5C3J B;  1KOT A;  3LDA A;  2H3Z A;  2DKZ A;  3WKD A;  1WX7 A;  5ALK A;  2ZXI A;  1FCL A;  2IBI B;  2H3V A;  5AM1 A;  1QOB A;  2JWU A;  2K8H A;  4GN1 A;  2R2O A;  1KFT A;  3KH0 A;  3R66 C;  1ARO P;  5DDM A;  2WX0 A;  3PS6 A;  4BXO A;  2KX0 A;  1WRD B;  4KSL C;  3QU9 A;  2A8X A;  3U4F A;  2Y0S F;  1N56 A;  3C28 A;  2H88 B;  2ZVN A;  2GR1 A;  4LZD A;  1ZW7 A;  4GC7 A;  3VC8 A;  2R8J A;  1V49 A;  4YWO A;  5KT5 A;  2G5I B;  4Q43 A;  5KFW A;  2JEG A;  3W9C B;  3FWA A;  2TPR A;  1X1M A;  4MT5 A;  4J9K A;  2L3Z A;  2ZVO A;  2HBL A;  2XVT A;  1UBI A;  3L54 A;  3N20 C;  9ICS A;  3RIT A;  4MKS A;  4UAV A;  1D5Z C;  1TT5 B;  3DVN V;  1W1K A;  1XD3 B;  3FW7 A;  2WPF A;  2X8H A;  1J19 A;  3LJ3 A;  4EBC A;  3NVV B;  2Q5W D;  2GBN A;  2P8B A;  1V8C A;  5ALI A;  5ALT A;  5C5J A;  3QYP A;  2N9K A;  1QOA A;  1M94 A;  2WXG A;  1QLU A;  2X99 A;  3QIJ A;  3IN5 A;  1VZ8 A;  5AWV A;  2PTZ A;  2O2V A;  2QJM A;  4AYB C;  5CWR A;  2JRI B;  2JEF A;  2NPT B;  4BCA A;  3W5U B;  7ICU A;  3Q8F A;  2KLC A;  5IN7 A;  3CGD A;  1K4Q A;  2HBM A;  2FCQ A;  3HVD A;  3QJZ A;  1ZQW A;  4OJ5 A;  3R8B A;  3ZNI D;  5E6P A;  3V3W A;  3VA8 A;  4Y2P A;  5DG9 A;  4BGD A;  2EAN A;  2C7M B;  1N62 A;  4I2A A;  2LVO A;  4NM1 A;  1NBF C;  3NHE B;  3SQS A;  3B0Y A;  3ETL A;  3QE9 Y;  1T7P A;  3NJT A;  2IHN A;  3GSY A;  4EYI B;  1WZ0 A;  3SAG A;  4PWC A;  1O08 A;  3AB5 A;  2KJ5 A;  4C4S A;  2KT7 A;  1SB3 C;  1D3Z A;  3NVY A;  4Y2U A;  2ZPY A;  2XCA A;  1GRA A;  1T4G A;  5HG2 A;  1IGC A;  1LQB A;  2WF6 A;  2F44 A;  2WDR B;  5JH5 C;  1QQR A;  1YN4 A;  2V9W A;  1ZQO A;  2Z59 B;  4H2H A;  6ENL A;  3KUD B;  1E8Y A;  3NXL A;  3DHG C;  3V6J A;  4M9N A;  5D46 A;  2LI6 A;  4DQS A;  3GD6 A;  1JCT A;  2WXF A;  2K5P A;  1DRG A;  3AEC B;  2GSH A;  2UUU A;  1N60 A;  3EAO A;  5EE9 A;  3NZS A;  5DPT A;  2CJN A;  5IIL A;  3HX0 A;  2KC1 A;  2QMT A;  5FK9 C;  4QWA A;  4GMV A;  4NAW B;  1TY2 A;  1WUD A;  1C77 A;  5J18 A;  1ZQJ A;  3BSM A;  3G6V A;  3OLM D;  3UIN B;  4PVJ A;  3C29 A;  1E7U A;  3ETR A;  2W11 A;  4YMO A;  4HCP B;  4F8C B;  5L6G A;  3OZM A;  4OJO A;  1SGH A;  1ZD2 P;  1JWU D;  4WH4 A;  3OHB A;  1Y56 A;  2IO0 B;  2O6V D;  1LVL A;  5KFO A;  3QC8 B;  1MNS A;  5J2I A;  4ECY A;  3QU5 A;  2KZR A;  5J2D A;  3GII A;  3TTE A;  4DQP A;  5HHD G;  1P7E A;  1UNS A;  2P6U A;  2HBJ A;  2VA2 A;  2IPK D;  3M62 B;  2KN5 A;  5JUM A;  3OG5 A;  4B0E A;  3TQP A;  2PMZ C;  2N9L A;  1W1R A;  2KAC A;  2E1F A;  2LVP A;  1HIW A;  2GGI A;  2HSZ A;  2K22 A;  9ICP A;  1PQS A;  4DF8 A;  3UXL A;  5JCL A;  2JWZ A;  2KK8 A;  3AE2 B;  2K89 A;  1F0M A;  2O6V A;  3Q3M C;  3L13 A;  2PXI A;  3P0W A;  3Q6J A;  2GDQ A;  4FUL A;  2V3N A;  4DL2 A;  3DBR B;  4MEM A;  1XAN A;  5CA7 A;  1V80 A;  2DZI A;  2AKM A;  1NK6 A;  3UJR A;  3K1G A;  4RQ0 A;  3HIZ A;  2KIC A;  3RNM A;  1SJE D;  2CR5 A;  3RB0 A;  1VAO A;  4OZB A;  2DZM A;  1HSK A;  1M6I A;  5TZV A;  2B21 A;  1KL9 A;  3RJG A;  3ZJV A;  1NKE A;  1HJP A;  2AXT U;  1PVP A;  1EBH A;  2REX A;  5IIN A;  2LJI A;  3LYS A;  2I38 A;  5H8Y E;  5IIK A;  1KD0 A;  1JMS A;  4RM8 A;  3AE9 B;  5JXV A;  1QQ6 A;  2BS3 B;  5C2T B;  3SR6 A;  4F5O A;  1TK0 A;  2LGX A;  3R0U A;  2BF8 B;  2K39 A;  4MEL A;  5KG5 A;  2IO3 B;  7ICM A;  3IAM 1;  1ZQY A;  1E8F A;  4WAA A;  5DKW A;  2IO2 B;  2NO4 A;  4UAW A;  1CMX B;  1D4B A;  3KQ4 A;  4OCZ A;  4O5E A;  4DCC A;  5ALH A;  3RB4 A;  1T3N A;  1PK3 A;  2XC9 A;  1EF1 A;  4H83 A;  3RRG A;  2WXP A;  4BUR A;  4DXK A;  3SN1 A;  2WHI A;  2CRX A;  3Q6B A;  5CJ7 A;  4IC9 A;  3Q3F A;  1EBD A;  1QT9 A;  3WAN A;  3DOW A;  1R4N B;  5KG7 A;  4J9N A;  5III A;  2DYO A;  4NJ7 A;  1W1O A;  4JAY A;  2KWV B;  4XZ4 A;  2AL2 A;  3L17 A;  2JF5 A;  3AEB B;  3GV5 B;  4HDQ A;  4XDD A;  3RJK A;  1JRO A;  4DSK A;  3WCQ A;  3VH3 B;  3W1S A;  1MJD A;  8ICP A;  2BKR B;  5F9L A;  2KZZ A;  1HXY D;  2MP2 A;  1S77 D;  2KG5 A;  3GZN I;  3TEZ A;  4PGY A;  1DIQ A;  2DLB A;  2ZUB A;  2DEN B;  1MO9 A;  2HBK A;  2KSO A;  2P3H A;  1C1Y B;  1CUK A;  1SV0 C;  3RBE A;  1LO5 D;  1WJU A;  3NO1 A;  1R4M B;  2HOI A;  1LXD A;  2JZB A;  4AWJ A;  3V6K A;  5KFK A;  5ER0 A;  5HMR A;  5TR3 A;  5U1O A;  1UWM A;  5KFR A;  4M01 A;  1Z4O A;  1YD8 U;  2EQ9 A;  1FFV C;  4A55 A;  3MJW A;  4EM4 A;  2KHW B;  2KJ6 A;  1RRB A;  4YFK A;  1NYR A;  4JWU C;  2NRZ A;  2DPI A;  2OZT A;  1WGR A;  4PGX A;  5AKI A;  5AM4 A;  4JUZ A;  5AIB A;  2KN7 A;  4RT3 A;  4DF4 A;  8ICZ A;  1E9M A;  1ZOY B;  3DQV A;  3GY1 A;  3L3F X;  3L08 A;  1D6E C;  3PR5 B;  2HTH A;  3S47 A;  1I4H A;  4I2D A;  1T5X D;  4FAD A;  2QEJ C;  2PFQ A;  1FEB A;  3AQF A;  3F5E A;  4OVU A;  4P6V F;  3T5L A;  2LI5 A;  1KLU D;  1WGD A;  1KCZ A;  4EBE A;  4W9G A;  1YZ6 A;  3AM9 A;  3HRD D;  5J2B A;  5FJO A;  4CF5 A;  1S0M A;  3ICX A;  1V1P B;  2MRP A;  4U6P A;  3GQC A;  5E6J A;  4QZF A;  3P2B A;  2CFY A;  3MJ5 A;  4CHK A;  1BT0 A;  3PLV A;  4S0R A;  2BS2 B;  2NRX A;  3QEA Z;  7ICG A;  3NRZ B;  5G5H A;  5J0W A;  4XWW A;  2FLL A;  3ONS A;  2GRT A;  3H7P B;  3ML8 A;  1TS5 A;  3Q3N C;  4EQR A;  2X50 A;  2NCN A;  4FS1 A;  2MX2 A;  2MBO A;  1L8P A;  1FXT B;  3Q3J A;  4XDC A;  1Z1V A;  1XC9 A;  2B0C A;  3H8H A;  1COO A;  3B2F A;  2QJN A;  2XGQ A;  3LAE A;  5J0T A;  1IYX A;  4DWI A;  4PL2 A;  2NTS A;  2V1Y A;  4GDL A;  4KIK A;  3TCA A;  1MDR A;  4TUR A;  1NK0 A;  1Z00 B;  2BYF A;  2PVG C;  2AKZ A;  2F5Z A;  3QK0 A;  2WB1 F;  8ICR A;  5J0O A;  3H40 A;  3VH4 B;  5CHF A;  2K4I A;  3CST A;  1SL2 A;  1ZD5 A;  4XUS A;  4KZC A;  4DHZ E;  2EQ7 A;  2WWZ A;  2F3N A;  1H8C A;  1NU5 A;  3OHA A;  5KFE A;  5DQH A;  1WJ4 A;  3VQI A;  4KVG B;  2K8C B;  3DH9 A;  3I6T A;  3I4K A;  2KHQ A;  4UB1 A;  3DBR I;  1T6B X;  3I6E A;  4PVK A;  2IPI A;  4NL9 A;  3W2D A;  4R65 A;  4WQO B;  5AEK B;  2V3B A;  4H4Z A;  5J2E A;  2JMG A;  1CRX A;  2O6K A;  3C0P A;  2WF8 A;  1ET6 A;  1EC8 A;  1MG4 A;  5BYQ A;  2DNF A;  2JXJ A;  5J0S A;  3T5K A;  3UMC A;  3ALB A;  1KFD A;  2VH1 A;  3VR8 B;  1I4X A;  2PJH A;  3DVG Y;  1SJA A;  4R8U B;  2R8D A;  5AIA A;  5F3X B;  2ICI A;  3RYT A;  3ZGZ A;  2KQ7 A;  1GPX A;  1C4C A;  4ANV A;  5KHQ A;  3T9L A;  2P13 A;  1UT5 A;  4RGN A;  3QZ8 A;  7ICS A;  2GQT A;  1UPH A;  4FLH A;  1XPY A;  1SE3 A;  3PSP A;  2LYH A;  2OED A;  2ZJ5 A;  1EWY C;  1RAX A;  4WJP A;  4C00 A;  5IP4 D;  3OJS A;  1CEZ A;  1KN0 A;  1R6W A;  3SBF A;  4NLC A;  3I63 C;  1KKX A;  1MRA A;  2ZZP B;  4B9U A;  4EX6 A;  3IHQ B;  2V3P A;  2KTR A;  4F4R A;  2BC1 A;  2KHV A;  4FE3 A;  2E1E A;  3ZJT A;  3IC9 A;  3ZYY X;  3BOX A;  3N6H A;  4UB3 A;  3RH4 A;  2DX5 B;  4HK2 A;  4ECT A;  2LXC A;  3PM9 A;  3A7R A;  4H19 A;  1C20 A;  4Y2X A;  2JYT A;  3MC0 B;  3OJ4 B;  4QAY A;  4LII A;  2PFN A;  1JOA A;  2DFL A;  5ALS A;  3UF8 A;  4ED7 A;  1GES A;  3ENL A;  2XK5 A;  4GME A;  2UVW A;  3V72 A;  1MFW A;  2MA1 A;  4IT1 A;  2QDE A;  3B0A A;  5JCM A;  5DB7 A;  1LVH A;  1SE4 A;  4M04 A;  3R7Q A;  1OUQ A;  3KWL A;  4IM3 A;  3FAH A;  1LPF A;  2OLA A;  2WNM A;  4G9B A;  1K53 A;  1R4M I;  4DWF A;  4F93 B;  4WWO A;  2JK6 A;  3THV A;  4B6J A;  4CCH A;  5T8I A;  4X5V A;  1V5T A;  2M8S A;  5TSS A;  3T4W A;  4YG2 A;  1AW7 A;  2N1V A;  3ZVV A;  3NS1 A;  4UB5 A;  4YTP B;  3CIR B;  1FPY A;  2AEH A;  3SD7 A;  5AHX A;  5KVI A;  3M9M B;  3C2L A;  1ZQA A;  2FLN A;  4CGZ A;  1E8G A;  2KXJ A;  4ECQ A;  1I35 A;  3FG2 P;  2G5H B;  4YD2 A;  2D3A A;  1MBB A;  5HR6 A;  4Z6F A;  2G4S A;  3RR1 A;  3BZK A;  1EWC A;  2A1A A;  2LM1 A;  3PVX A;  1X9M A;  2ZNV B;  2KDM A;  1YIW A;  3MR3 A;  4ANW A;  1N63 C;  1L5U A;  4NLK A;  3DK9 A;  4ECX A;  2HTM E;  2LFI A;  2KWD A;  2Y1I A;  4M0W A;  5D2M B;  2Q4T A;  3PSI A;  5AIC A;  1T94 A;  3N4E A;  2KE7 A;  5DLG A;  1GER A;  4HJG E;  4Q8E A;  3H70 A;  2WDW A;  3QQ8 B;  1E0Z A;  4G8T A;  3RO6 A;  2W04 A;  1L3V A;  4P0P A;  2OG9 A;  2XSX A;  3DES A;  2EAM A;  1NVI D;  2EH9 A;  1PFD A;  3RTV A;  3KUM A;  2UVU A;  3GFK B;  5AKY A;  2W9B A;  1A76 A;  2ZTD A;  1SF0 A;  3HT3 A;  5KG1 A;  7ICE A;  1NK9 A;  2M1M A;  1NNL A;  4DDI D;  3C1Y A;  3EZ5 A;  2C9W B;  3T6C A;  2NVK X;  4F5N A;  2DW7 A;  3TAD C;  3DBL B;  4NXZ A;  4KIT B;  4K7S A;  3JSV A;  5FS8 A;  2QJJ A;  1TBE A;  4NEW A;  3ISB A;  3QAQ A;  1V5O A;  1WE6 A;  4FBU A;  3SEN A;  3EFC A;  4O1N A;  2Y3S A;  3T8M A;  4NLZ A;  4JWM A;  4JWN A;  1GJZ A;  4BWM A;  4EEL A;  4KT2 A;  4TQ0 A;  3QFA A;  1Z5S B;  3S6J A;  4LNO A;  2D3D A;  3RNG C;  2F8L A;  4K4H A;  4MSM B;  4PYU A;  3RBD A;  4ZCW A;  3RAX A;  1E8H A;  4P0Q B;  3D6J A;  4PPX A;  3RT3 B;  4IQU A;  4DQO C;  3TEW A;  1W1M A;  1DII A;  4QNL A;  2KTF A;  3EF6 A;  4EMW A;  2DYB A;  4PZO A;  1ET9 A;  2CDU A;  2ISO A;  4NJC A;  1TJE A;  4W9L A;  1TY0 A;  2AGQ A;  1WWU A;  2POD A;  5AZF A;  2YX8 A;  4CF4 A;  3JW7 A;  4L23 A;  2LYB A;  5DB6 A;  1ZYQ A;  1KFY B;  4KLL A;  1V59 A;  1WUF A;  3W1Y A;  1F9J A;  1ZMC A;  2VFT A;  4E6M A;  2MA9 B;  1XU4 A;  1QSS A;  2PIA A;  4PWB A;  1B1Z A;  2DYM A;  2KZ3 A;  1YQ4 B;  4I2F A;  5AE1 A;  1PDY A;  2AAQ A;  3QUQ A;  1DOI A;  3V7L A;  4O5K A;  4E71 A;  4ECZ A;  4JV2 A;  3LXF A;  3UQB A;  1TS4 A;  2NPX A;  4GOC A;  5DG8 A;  5DBB A;  5FP0 A;  4KLQ A;  2VJ4 A;  2ZIW B;  2OM6 A;  4M47 A;  2Z0D B;  5C1Z A;  1IBX A;  1ZQZ A;  2W9C B;  4TUS A;  4BJQ A;  2HHU A;  1A70 A;  2V4L A;  2GQU A;  3KLJ A;  2KWU B;  2YVC A;  4Z6C A;  4B9M A;  3Q8M A;  3D2J A;  1UA1 A;  4B6W A;  1U9L A;  3DBH I;  3GS2 A;  4IZG A;  5KVH A;  2YN4 A;  1JXE A;  2DAF A;  5L1K A;  3A7U A;  2QVH A;  4BBY A;  3CAW A;  4ECS A;  1L5P A;  4K4I A;  5CEH A;  1L6U A;  3SAF A;  2ZJ8 A;  9ICN A;  4EQX A;  1OEP A;  2QB0 B;  1HQR D;  2ZIU B;  1AWD A;  1QLT A;  2L05 A;  9ICJ A;  3SDL C;  4YP3 A;  2M4N A;  2QDD A;  4JV0 A;  1TKK A;  3ZNZ B;  4A3O A;  3PW4 A;  1KQQ A;  1L8O A;  3T5J A;  7ICN A;  3JPO A;  4F4Z A;  1WY8 A;  4HG0 A;  2L83 A;  2OZ8 A;  3F5A A;  5EE1 A;  3EEC A;  2JX5 A;  4Y2R A;  1RYJ A;  1E8W A;  1WGH A;  2FUG 1;  1FO4 A;  4Y2Y A;  3UQ0 A;  2AGO A;  1C4P A;  3N32 A;  4YL8 A;  5ALP A;  1EM7 A;  5ALQ A;  1QCK A;  4IWQ A;  1ELS A;  4KLE A;  2HOF A;  1L0X B;  2ASL A;  3RZW C;  2GGE A;  3V5F A;  2INC C;  2N9E B;  1VDV A;  2KD0 A;  4DOB A;  1VR9 A;  4EKU A;  1LKY A;  1X66 A;  2JH7 A;  2FAZ A;  2MQJ A;  4CNQ A;  1L4Z B;  4CO7 A;  4K1W A;  3WK7 A;  2A1J A;  5J8Y C;  2QAR B;  1VLB A;  9ICF A;  2CHX A;  2MH7 A;  2WX1 A;  3RUL A;  4TVW A;  1ONE A;  4I6L B;  2XY6 A;  1L3T A;  4IKG A;  5ALY A;  2R2Q A;  2NYV A;  1F52 A;  2BPS A;  1GET A;  4FJZ A;  4F4X A;  1NZP A;  4NWI A;  4WQM A;  4WJO A;  4OVZ A;  4GYP C;  5AI4 A;  4I28 A;  2KZM A;  1SL1 A;  1ZQD A;  1GV4 A;  2IJ0 A;  5KT4 A;  4F4K A;  3F2C A;  1V85 A;  1ZQB A;  2MBR A;  1YQZ A;  1ZDL A;  2OX4 A;  4IWO A;  3QPE A;  1FEA A;  3ZDB A;  4K8G A;  1JML A;  3FV9 A;  4ECU A;  4HDO A;  3VDZ A;  2GR3 A;  4Y2J A;  1X6J A;  3O0F A;  2I1K A;  1W1L A;  7ICF A;  1NEN B;  1I4R A;  2LVQ A;  3B0X A;  4WJ3 B;  4UAU A;  1YX6 B;  2BCR A;  3QFB A;  1J2N A;  2VZK B;  4N6E B;  4LNN A;  3RI7 C;  1OXJ A;  2PTL A;  2PGE A;  2SAK A;  5D94 A;  1ZD4 A;  2JXT A;  3DBL I;  3NOB A;  5T14 A;  3PY8 A;  3ZXR A;  4PYZ A;  4H4W A;  2AL3 A;  3RFZ B;  4KLI A;  3RB6 A;  2VAO A;  4GLX A;  5IO9 A;  5L6F A;  2BPC A;  3I28 A;  3NGD A;  4H2A A;  4YSZ B;  4ML8 A;  2F8K A;  3EJD B;  3R1Z A;  1DZN A;  1KJT A;  2XH2 A;  4DHG A;  2W03 A;  5J29 A;  3GIL A;  4DHZ B;  2WQY B;  1MVK A;  5D49 A;  1L7O A;  2ZZB A;  8ICO A;  5FJR A;  2A3V A;  3MDA A;  2NMQ A;  1HZ5 A;  4CYE A;  3ZIM A;  1VJ5 A;  1SV0 A;  2K4H A;  2ASD A;  1J8C A;  3V62 A;  3BQ2 A;  1D8Y A;  3VXW A;  1OEY A;  1SZP A;  4W9K A;  5HNK A;  3ZD8 A;  2INP E;  4HEA 1;  1JEH A;  5IA7 A;  2WXM A;  3DG7 A;  1ZQP A;  5F9N A;  1EU3 A;  3EW9 A;  4MHV A;  1FFV A;  3AEE B;  4Z17 A;  4DFJ A;  2GGJ A;  2ZTE A;  3A7A A;  3WK5 A;  1TZZ A;  2LRU A;  3DHI C;  4OAL A;  3L8K A;  1BGX T;  1PGA A;  1BPY A;  4YN4 A;  5H92 C;  4S17 A;  2KN4 A;  3LAD A;  1KH0 A;  1M6Y A;  1PGB A;  1N5W A;  3PW5 A;  2NS5 A;  2NTT A;  2NQL A;  3ED5 A;  7ICI A;  2SEB D;  2BCS A;  3OJU A;  2MJD A;  4KLS A;  2PEA A;  2N1R A;  2RPV A;  2VA3 A;  2YML A;  2QQ6 A;  3UCD A;  3SYZ A;  1TVA A;  2I1Q A;  3ES8 A;  5LLI A;  2PPH A;  2PU0 A;  5TR5 A;  2KFZ A;  3ZRC A;  5ALL A;  5D4B A;  4BKS D;  2ON8 A;  3CXO A;  4H4Y A;  1C4A A;  2LMC A;  1WWV A;  3PZ8 A;  2KDF B;  2ZUD A;  2ZJA A;  3MTN B;  4QWC A;  2FIF A;  2LGD A;  8ICX A;  1W1Q A;  4ASW C;  1WVE A;  3RJI A;  4ICA A;  4HPP A;  4G7F A;  1YJI A;  2W3S A;  1X6I A;  1NJX A;  1ACC A;  2FCN A;  2KQ4 X;  3RF9 A;  4KEM A;  1WM2 A;  3V5C A;  4ELT A;  3QKE A;  4C4T A;  5E79 U;  2Z8L A;  5KFV A;  8ICJ A;  1SJC A;  4RUA A;  1ZQM A;  3UM9 A;  2H3Q A;  5CB1 A;  5AKL A;  1JQ4 A;  2OWO A;  4BKS A;  2PA6 A;  2MHJ A;  2XY5 A;  2FMS A;  4GGQ A;  2CJO A;  3BW7 A;  3IP4 B;  4LZG A;  1AAR A;  1S3S G;  3IJI A;  4LNI A;  4HKQ A;  1ZQC A;  2HVI A;  4ED3 A;  2PLP A;  4WWP A;  2GLS A;  2ZC8 A;  2IO1 B;  2HHV A;  5HHZ A;  1WFY A;  4DS5 A;  4K4G A;  1KLG D;  1X40 A;  3N7S C;  1Q3V A;  4UAY A;  4HPL B;  5BYS A;  5ALX A;  2WXR A;  3PRZ A;  2XID A;  4B9L A;  4DLG A;  2G07 A;  1TGZ B;  3DDC B;  4F91 B;  4EQW A;  4DL6 A;  3GD4 A;  3AE1 B;  1ZRM A;  1KFS A;  2HE7 A;  1D5X C;  2K1F A;  2KLG A;  2FBW B;  3ZLG A;  2KVS A;  2W55 A;  5KT6 A;  1YX5 B;  3DV9 A;  4IP4 A;  1ZQR A;  2JQR B;  2PKE A;  3SEI A;  2ASQ A;  2AWT A;  2QHO A;  3VR9 B;  1XS9 D;  2BYV E;  1YQ3 B;  9ICA A;  3SSZ A;  4RM9 A;  3RRH A;  1Q0W B;  7ICH A;  1FRR A;  1GB4 A;  4DYE A;  5AZH A;  4Y2V A;  5HMM A;  1NJZ A;  3TEY A;  4KMO B;  5BYR A;  2DW6 A;  3FW8 A;  2JPH A;  4ZRK A;  1UEL A;  1J2M A;  4BUG A;  3GV8 B;  3MZN A;  3UIO B;  1RLF A;  1MA7 A;  2ES6 A;  3PTF C;  4ANU A;  5HFY A;  7ICV A;  3HHM A;  4WJN A;  3N6J A;  4O3Q A;  3PML A;  4C8N A;  1MBT A;  1JWS D;  2O3G A;  5BOM A;  4FBT A;  3LB8 C;  2JYE A;  2V6O A;  5DQI A;  3IXS A;  3B9J B;  3FM9 A;  1L3S A;  1GRB A;  4MMW A;  2MEK A;  2I0K A;  1D7Y A;  5J0Q A;  3JPQ A;  4F4W A;  3OZY A;  3KHG A;  1P3Q U;  1QOF A;  4IQT A;  1P7D A;  8ICN A;  1DYQ A;  3H0M B;  3NS8 A;  2ZIX A;  4GXB A;  1EC7 A;  4UAT A;  5BOE A;  2HHW A;  3RJA A;  4LDT D;  2JHD A;  1A77 A;  2MBH A;  2PU1 A;  3T9P A;  4J9P A;  2C28 A;  4M6W A;  3Q8L A;  2E6X A;  4ZDV A;  2UVR A;  4IQV A;  1PUT A;  1BNP A;  1XQQ A;  2MW5 A;  3Q8R B;  1ZDX A;  3MHZ A;  3ALR A;  2IYD B;  5I1W A;  1UGM A;  1T0S C;  1SL0 A;  2KJ8 A;  3Q8K A;  4TV3 A;  4H1Z A;  3MKC A;  2GMI C;  4RMA A;  4RF0 A;  2R61 A;  3RD2 A;  3P3B A;  3FW9 A;  4LLG M;  4EYH B;  2AHO B;  4OZA A;  3NZ3 A;  4DL5 A;  4TVY A;  1QIL A;  1DXS A;  3WKE A;  4PZN A;  2EZY A;  5KL8 B;  4FZM A;  1BUI C;  1WXS A;  4EMI A;  4PZF A;  1N63 A;  2KEY A;  3QZ7 A;  1R0M A;  1WX8 A;  5J0P A;  3E0F A;  1SEB D;  5AI0 A;  3OPS A;  5K8E A;  1COK A;  5KFL A;  4I29 A;  1BZL A;  3MGV A;  4YXD B;  1DK3 A;  2C2E A;  2XBB C;  1NKB A;  3DWM A;  3GRT A;  2NBW B;  1WYG A;  3IRU A;  3IT4 B;  1ZUD 2;  1DOY A;  4JWS C;  3RPF C;  5HR7 A;  4GDK A;  2Y9T A;  3AQE A;  4MGZ E;  2P88 A;  4KKJ A;  3UJE A;  2JSV X;  1WMH B;  5AUI A;  3BJY A;  4K1R B;  2KFK B;  4MF8 A;  3TCS A;  3V7K A;  5A0L A;  9ICH A;  3PHX B;  3HP6 A;  3A1Q A;  2WBA A;  3P4S B;  3PW7 A;  3VTU A;  2K8B B;  2AQ4 A;  3SR6 B;  2DL0 A;  7ICP A;  1RXW A;  2WAQ C;  4RU9 A;  9ICG A;  2BW2 A;  3PO5 A;  3W8X A;  1SGG A;  2W7P A;  3QX1 A;  1BKH A;  1YT3 A;  3QU7 A;  3GRS A;  3ZLF A;  2YEP B;  4A35 A;  1B43 A;  4MM3 A;  4MGG A;  4R66 A;  4GGB A;  1V9J A;  3VUX A;  1JRP A;  1TE6 A;  3RNC C;  3TAD A;  4AP9 A;  3OSN A;  1RQN A;  2LMR A;  2NRT A;  2IBK A;  2J3N A;  2P0I A;  4KSK C;  2MRL A;  3DHH C;  1ZRN A;  5KFZ A;  4DFK A;  2OO6 A;  3JPR A;  3VFC A;  1Q46 A;  4NM2 A;  4KWS A;  3KHH A;  2IA6 A;  4M2Y A;  2GRI A;  2IGH A;  3ZVH B;  3DWG C;  3MBY A;  3Q3O C;  1TKE A;  1WYW B;  2KC2 A;  3PVL A;  3QUC A;  3L5K A;  1K52 A;  1MSW D;  2KOX A;  3CNH A;  3H8W A;  5GTH U;  1DK2 A;  2LGI A;  1BPZ A;  2YY6 A;  3FJ4 A;  4REZ A;  1JI7 A;  1Z1B A;  2L7R A;  2FPL A;  3UPQ A;  1P9D U;  1HE8 A;  3GU3 A;  2WF7 A;  2KSO B;  1E0Y A;  1QTM A;  2PTW A;  1SKR A;  3LDZ E;  5FXF A;  3CW2 C;  4PHA A;  4G3X B;  2HJ1 A;  3OC4 A;  3W8W A;  2EQ6 A;  2Y08 A;  4GB9 A;  1RPL A;  2KMD A;  5FXD A;  1B4F A;  3BS5 A;  4O3O A;  3VAW A;  4O5C A;  1KN5 A;  2A5U A;  3CSF A;  4Q2J A;  4RNM A;  3PV8 A;  4M9L A;  2KAJ A;  3PLU A;  5BOF A;  2GO7 A;  3DEE A;  5KFX A;  1F44 A;  3C8Y A;  3HIL A;  2W82 A;  5J0X A;  2WP9 B;  3MFG A;  5J04 A;  2P6R A;  1AN8 A;  4W9I A;  3BQT A;  4TQ1 A;  2O56 A;  5KNI A;  4EZL A;  1WSP A;  4J1O A;  1UWX A;  3RN9 C;  2HW3 A;  4R63 A;  2L5Y A;  2OEH A;  2DHZ A;  4ELU A;  7ICL A;  4NY0 A;  1L7M A;  1XO0 A;  3DQ0 A;  2HVH A;  4FA6 A;  1T3Q C;  4PS3 A;  1NI3 A;  3AV8 A;  1CI4 A;  2QKQ A;  1U47 A;  2VJ5 A;  4WUR A;  4J9S A;  1XCQ L;  4AUQ C;  2XH0 A;  3B97 A;  5KFA A;  4DXA B;  4G11 A;  2YMQ A;  4FXC A;  3WU2 U;  4NEV A;  1K51 A;  1MPE A;  1TK5 A;  3JPN A;  5DCN A;  3B1L X;  1TFR A;  1YN5 A;  3QA8 A;  2ONE A;  3GC2 A;  3DED A;  2Y4G A;  4ADW A;  2W0H A;  1ZKQ A;  4RPY A;  3RNA C;  5KFB A;  1DOX A;  5KG6 A;  4H4S A;  3BYT B;  4BZA A;  5MPO A;  4PT5 A;  2BQU A;  2KQS A;  1ZXI C;  3IJL A;  2AQ1 B;  1RYU A;  1TV9 A;  5D3I B;  4GXK A;  1D8L A;  2W9M A;  9ICO A;  1V81 A;  3N97 B;  4O3S A;  1JDF A;  1P48 A;  3FVD A;  4EC3 A;  4OW0 A;  3MY9 A;  4BC7 A;  1NHQ A;  8ICC A;  1TIF A;  2PP3 A;  4NAW A;  2D3C A;  5JCI A;  3WAL A;  1IUE A;  1Y8R C;  3N1Z C;  4MSQ B;  3O0H A;  4GDL B;  3A0H U;  4BBN F;  2K8A A;  3N7P D;  2LUE A;  4RH6 A;  5DPW A;  3KKA C;  4JB3 A;  1GEU A;  1S0V A;  4F1S A;  2QDF A;  5CR0 A;  2QIL A;  2FYM A;  2OAI A;  1EBG A;  1KTQ A;  2KJ9 A;  1RM6 C;  4PL1 A;  4QZC A;  4KLU A;  2A4Z A;  3RCZ A;  3R07 C;  4ZOH C;  5GRT A;  3IG5 A;  1GAQ B;  4EE2 A;  3I1Y A;  5AE3 A;  2ZEQ A;  3VDG A;  5J8Y A;  2BCU A;  1IIP A;  1U48 A;  5TIS U;  4IRK A;  2KJH B;  5HQX A;  1X42 A;  3OJ3 A;  2JR5 A;  2IOF A;  2HCF A;  3R0K A;  5AI6 A;  9ICC A;  4Z6E A;  3V6E B;  4BFR A;  2YTU A;  4ED8 A;  1FMA D;  4GIV A;  3GE3 C;  4GYP A;  4FX9 A;  3RJH A;  1FHU A;  4B9V A;  2ONQ A;  2RAB A;  2KIV A;  3AN1 A;  1N61 C;  3TSJ A;  1RFA A;  2C60 A;  1MI0 A;  3ZNG C;  4C56 C;  9ICM A;  3WAP A;  4IDI A;  1A0P A;  3IBE A;  4A90 A;  1WX9 A;  1KLN A;  2P35 A;  2J6U A;  2RD0 A;  2KIW A;  3RUI B;  2PSN A;  3TJI A;  2GBK A;  1IM4 A;  4NLN A;  3C2K A;  9ICB A;  3HWT A;  3SFD B;  4A6G A;  1SKS A;  1F0Z A;  4B9N A;  4KX3 A;  1JCK B;  1XO3 A;  1E6E B;  3MWC A;  2EKE C;  2INN E;  3GO2 A;  1J0G A;  1SXD A;  2BKE A;  3FXG A;  2VFV A;  4JX1 C;  2KP7 A;  1XSL A;  4X57 B;  1S0N A;  3LLB A;  3VFK A;  2KTR B;  3RNE C;  1C3T A;  3PFR A;  1TAU A;  2MAX A;  3VRA B;  4MEY A;  2N1W A;  4RQ2 A;  3P4Q B;  4EEK A;  1XO1 A;  4P2H A;  1NOM A;  3H4D A;  4ZRP A;  2DGZ A;  3GIK A;  4OJL A;  4NPN A;  3AMZ A;  4N59 A;  3N9Y C;  2WLB A;  3TJP A;  4EZ9 A;  3NVZ B;  1W1J A;  3H0L B;  3QNM A;  3QEB Z;  3QU2 A;  4EMJ A;  5KAF U;  1SJD A;  3POP A;  3CWI A;  1Y88 A;  2QKN A;  1F1H A;  3NVW B;  1IG6 A;  3QUT A;  4DQR A;  2GOW A;  3MUC A;  4UBB A;  3GIJ A;  4C8K A;  3ZQ4 A;  4BWJ A;  4ICV A;  1SKW A;  3V61 A;  3HM3 A;  2I5Q A;  4FI4 A;  3ZNH B;  4IRC A;  1S5L U;  4DFP A;  4G3I A;  2D10 A;  3QUB A;  4E0D A;  4G0N B;  4HVB A;  3ENE A;  3MR5 A;  5D79 A;  2E8M A;  4DS4 A;  3FDS A;  1E10 A;  2HXT A;  2IHM A;  8ICS A;  2E8P A;  5FS9 A;  1BPX A;  1CZP A;  1RFK A;  2I9G A;  4N58 A;  5G2N A;  1EXN A;  2V3S A;  1X9W A;  1QSL A;  1C9F A;  4QZG A;  1D9F A;  4C8O A;  2AX5 A;  3V60 A;  2EQ8 A;  3DER A;  1ZPS A;  2J0M A;  3DDM A;  2X38 A;  2KMA A;  4Y2Q A;  2GR0 A;  3IG8 A;  1RYR A;  5DBA A;  2BB5 A;  2RDG A;  2POZ A;  2AQ2 B;  3LWL A;  3AUL A;  4DSI A;  4F5P A;  4RPX A;  5I4D A;  2HMX A;  3AE8 B;  2AJQ A;  3SAH A;  1KW4 A;  4BBN C;  2OVL A;  4P0P B;  4A8E A;  5J2R A;  4KN4 A;  3P63 A;  1WI0 A;  4P1B C;  2EMS A;  3URY A;  3BYY B;  1FXA A;  3N1Y C;  3TI0 A;  2MBB B;  3WKA A;  4MDK E;  4A8X C;  4I6N B;  1FCC C;  4F2R A;  3A9J B;  2YAU A;  5IOI A;  3RJF A;  4UAZ A;  4HRO A;  4RQ8 A;  4A20 A;  5H2F U;  1O03 A;  3RRA A;  2WPC A;  3QHT A;  1R4N I;  3EPG A;  3L4P A;  2J6S A;  5KFG A;  2PVO D;  1NHP A;  1Q5W B;  2WU2 B;  4J9M A;  4O95 A;  5BMH A;  1V1P A;  4KLG A;  3EC8 A;  2I5H A;  3AE3 B;  4GFI A;  3TL5 A;  3S1F A;  3TUO A;  1K8R B;  4AQ7 A;  3PO0 A;  1DGS A;  4FZN A;  2W7O A;  3NRZ A;  4DSE A;  1H2I A;  2PFP A;  1GRF A;  4PGQ A;  4CE6 A;  5FS7 A;  3H7P A;  5HI1 A;  2BR0 A;  4JQ9 A;  4RQ5 A;  4NLG A;  1MG8 A;  1N5X A;  3NFU A;  4GIR A;  2WF9 A;  5J2H A;  1BPD A;  5AKX A;  3KW5 B;  4RFB A;  1ZQU A;  5CX3 A;  4H4X A;  4QJF B;  4N9F 4;  1JWB D;  3E56 A;  2Y1J A;  1VJK A;  2BHN A;  2IND C;  4E4U A;  3PZP A;  3DGZ A;  1Z00 A;  5L1L A;  4BOZ B;  2P66 A;  2KVR A;  4KKI A;  4ELV A;  2D5G A;  4K2S A;  1X2I A;  5DPR A;  1XHC A;  1NJW A;  8ICH A;  1NEL A;  3G6Y A;  2YEP F;  2K8C A;  2FMP A;  3RH5 A;  4ZYS A;  3RJ8 A;  5ALN A;  1BVS A;  2R8K A;  2QCZ A;  4KLD A;  2VIX A;  3TAP A;  3PWI A;  5BMG A;  1OEY J;  2OZ3 A;  4O3M A;  1PZN A;  2VAN A;  1L0Y B;  2EKI A;  4F71 A;  5J0U A;  2BVF A;  4JL9 A;  1J7C A;  3AE6 B;  1AOG A;  1UZX B;  4B0M A;  1SXE A;  3AH7 A;  3LB8 A;  1RVK A;  4AJW A;  4QWB A;  4R8U A;  5JRT A;  2AL6 A;  3MHS D;  2RRD A;  4P16 A;  1GRE A;  1SSN A;  2PI4 A;  3TFS A;  1NHS A;  4DNA A;  5DQG A;  2G08 A;  2HHX A;  1MHX A;  2WU5 B;  2PE6 B;  4HRS A;  4RPZ A;  3JVZ X;  3ES7 A;  4ECW A;  3M63 B;  3T5H A;  3PO4 A;  4HPM B;  1E8Z A;  2M0X A;  2F1I A;  4J57 A;  2BGF A;  2KDB A;  2JVC A;  4C0Z A;  1A5R A;  4HCL A;  4RQ7 A;  4C8M A;  3C19 A;  1RZT A;  3H7I A;  3WKC A;  5J2G A;  1E5W A;  4KGS A;  3PSF A;  3RMK C;  1NDA A;  1VZ6 A;  2WS3 B;  2QB1 A;  2XI9 A;  4JIO U;  9ICQ A;  3BVZ A;  2G09 A;  3M3J A;  3CT2 A;  4GRT A;  1P98 A;  3SV3 A;  2RQ5 A;  4YWS A;  3K4G A;  1ZQ1 C;  1SV4 A;  2EAP A;  2K25 A;  3AEF B;  7ICT A;  2WDV B;  4XA5 A;  3AEV A;  3RNB C;  3N4M B;  2KKP A;  2D8C A;  3EUB 2;  1LKY B;  5ALJ A;  4EX7 A;  2A1J B;  3U52 E;  4LNK A;  3LVV A;  5FMH A;  3WAM A;  1SZH A;  1WXM A;  1FHV A;  4PK1 A;  1X9X A;  3AE5 B;  2WPE A;  1KKO A;  4DL4 A;  1JWA D;  3GD3 A;  3M95 A;  4U7C A;  4KX5 A;  1GRT A;  1NPX A;  1ZX9 A;  5LXI B;  9ICW A;  3SV4 A;  5L83 A;  2QC8 A;  2WOV A;  3LWM A;  1J7B A;  5DDY A;  1UUP A;  2N9P C;  3VCN A;  3DEQ A;  4UAS A;  1L3U A;  2LHT A;  9ICV A;  2C22 A;  2L32 A;  3HPF A;  2P4P A;  2BYT A;  4US9 A;  3M8S A;  1WF9 A;  5FR6 A;  3A0B U;  8ICY A;  2W8L A;  3J9C A;  4C4V B;  4DN1 A;  3DDH A;  2EDU A;  2LBO A;  1QOG A;  2LGY A;  4LJP B;  2EXR A;  3M6Z A;  2R8G A;  2Z0E B;  5G55 A;  3RR7 A;  2PE9 A;  3TIX A;  3ZDT A;  4M0X A;  5EBK A;  4F92 B;  2R9Z A;  3ECI A;  1E9I A;  4YR2 A;  2Y3A A;  3R7R A;  3II4 A;  3QN3 A;  3V6H A;  2GQW A;  4WIP A;  4DBG A;  4EEW A;  2IY1 B;  1U49 A;  1F3P A;  1QQ5 A;  2OQY A;  4IR9 A;  4KX6 B;  1X2G A;  2GGH A;  1OTR B;  3ZDD A;  2W54 A;  1WGG A;  4F8R A;  2WDT B;  3QAR A;  2WXL A;  2G45 B;  3H7S A;  2NRV A;  2D3B A;  1EUV B;  1MN8 A;  5KFT A;  8ICK A;  2OJW A;  4KMU A;  3KUC B;  2HQM A;  3DIP A;  5KFP A;  1PK1 B;  2DAJ A;  4M6U A;  4MJS A;  4FDC B;  4F2S A;  3ZDA A;  2VFS A;  3CK5 A;  2V3A A;  4GIB A;  4D2K A;  3FIL B;  1MQ3 A;  1F5S A;  1KBU A;  1EO6 A;  1GC6 A;  3R2I A;  3GV7 B;  1UBQ A;  2LXA A;  2WYQ A;  4MFF A;  5DB8 A;  5JRB A;  1ZQX A;  2G3Q B;  2G9H D;  4CQN A;  1X9S A;  4F4Y A;  3GOE A;  1KLV A;  1ZET A;  1WR1 A;  4JHM A;  3RJE A;  3MGH A;  3HK0 A;  4B9T A;  2MUT B;  3VVW B;  4H50 A;  1X2H A;  2FE9 A;  4FJY A;  3D2H A;  3U8Z A;  3D47 A;  1T3Q A;  4P0Q A;  5D6J B;  8ICF A;  2GBR A;  5BOL A;  2GH5 A;  1RYS A;  2KVC A;  2MBE A;  1VQZ A;  7ICK A;  4DHJ D;  2FKP A;  3L5O A;  4ED0 A;  4MFC A;  3M6K A;  3UJS A;  2R8I A;  2ASJ A;  2WF5 A;  2HDO A;  3MR2 A;  3Q14 C;  3EJB B;  3UXN A;  1FIQ B;  3F2B A;  2N4F A;  1ONF A;  3NTU A;  1V6E A;  4CF3 A;  5KT2 A;  1R7S A;  2BT6 A;  4IQW A;  4PS8 A;  1ZXI A;  1DNC A;  7ENL A;  4ED1 A;  3EPI A;  3NY5 A;  4KLT A;  3BVM A;  3TX1 A;  3S1C A;  3QWZ B;  3NRW A;  4UW9 A;  4DOA A;  4HYK A;  3BII D;  3P93 A;  2QPM A;  2ZIW A;  5KFH A;  4UB4 A;  5AKH A;  4EFO A;  3JW0 X;  3IT6 B;  2W9C A;  1I19 A;  4GIS A;  4LTU A;  2K6Q A;  2WXQ A;  4GLS C;  1ZXH A;  4IL2 A;  5G5G B;  2LWP A;  3Q8E A;  3R25 A;  2ATL A;  1CK1 A;  1SJH D;  4XRH A;  2RGF A;  4B95 A;  2JZZ A;  1W1S A;  3PG6 A;  1U4B A;  3TAN A;  4EOY A;  3KKA A;  1WJ6 A;  5JTI A;  3IV6 A;  4ECR A;  3UI3 A;  5EE0 A;  2GBM A;  2N7D A;  2M0A A;  4FP1 A;  4LJX A;  1Q10 A;  3W8Z A;  1T0Q C;  3ISD A;  2MJE A;  2PW9 A;  4IR1 A;  3M9N B;  4QZD A;  4MEX A;  2QB0 A;  4UB6 U;  3D2D A;  5GTI U;  2ZIU A;  4DXG A;  2ODG A;  9ICU A;  4K7W A;  3T8Q A;  5DGB A;  3UXP A;  5KFJ A;  1FNU A;  5C23 A;  1H38 A;  1UD7 A;  4ICU A;  5CHW A;  5AKJ A;  2MLB A;  1ZQE A;  4PS7 A;  4IL0 A;  5DGA A;  1ZQG A;  2W3R A;  2CKH B;  3IFW B;  2KO3 A;  3OWE B;  4IG7 B;  4XWT A;  2K4P A;  2PTY A;  4HNC A;  3D2S A;  3U7Z A;  1XLQ A;  1LGR A;  3V6C B;  4AS1 A;  1JXL A;  3A9K B;  5U25 A;  1N61 A;  2WXJ A;  4NZL B;  3N4F A;  2JT4 B;  2HHS A;  3HRD C;  2WXN A;  4HCH A;  3Q8S B;  3TW9 A;  3NZG A;  3BWU D;  2YVJ A;  1PGX A;  4J03 A;  3GP7 A;  1ZE3 D;  2CU1 A;  3P1M A;  4ED6 A;  4DL7 A;  1L7P A;  1J7A A;  1OGW A;  1GO3 F;  2BBC A;  2E8N A;  1YOV B;  4C80 A;  2ZCC A;  3S1D A;  4AJY B;  5ALZ A;  2WP5 A;  3PST A;  2QAR A;  1NKC A;  3T3N A;  1GUA B;  2OOB B;  5HP4 A;  4BXO B;  3TAQ A;  3VUW A;  1LFD A;  2R2Z A;  2ZIV A;  1S0O A;  1ZQF A;  2GH1 A;  3MGI A;  4KPL A;  3U9I A;  2ESE A;  3N1X C;  4RQ3 A; 
#chains in the Genus database with same CATH homology
 4ITK A;  2PVG C;  3EGR A;  2WXO A;  2XN9 C;  4RGM A;  2WDQ B;  2JZP A;  5AE2 A;  2GRI A;  2IGH A;  3VQI A;  3DWG C;  1KF6 B;  1TKE A;  1T6B X;  1I7H A;  1K52 A;  4ARC A;  3SFE B;  4PVK A;  3JS8 A;  1F2R C;  2IPI A;  3W2D A;  2LGI A;  1ZP0 B;  2ACZ B;  1WRI A;  4REZ A;  1TS3 A;  3HVZ A;  3C0P A;  1E0Y A;  1ET6 A;  1C78 A;  2BVH A;  5BYQ A;  5FXF A;  2Y08 A;  3W8W A;  2RMM A;  5FXD A;  4JE3 B;  3VR8 B;  4YWG G;  1I4X A;  4Q2J A;  2KAJ A;  2R8D A;  1XLN A;  4ZHO A;  2ICI A;  3ZGZ A;  5FR3 A;  3MFG A;  3C8Y A;  1GPX A;  2W82 A;  2WP9 B;  5I1V A;  1C4C A;  1AN8 A;  4TQ1 A;  2P13 A;  4RGN A;  2Y3R A;  1RM6 B;  3B2G A;  4WWM A;  3VRB B;  1WSP A;  2GQT A;  1UWX A;  1DGJ A;  3FC4 A;  1SE3 A;  4ZOH B;  2DWQ A;  3NVY B;  2OED A;  1EWY C;  4KGR A;  1FFU C;  3DQ0 A;  1T3Q C;  1NI3 A;  3AV8 A;  3V3X A;  3I9V 1;  4WUR A;  1XCQ L;  2V3P A;  1JWM D;  4C7Y A;  4A6Q A;  3ZJT A;  4FXC A;  3ZYY X;  1K51 A;  1MPE A;  1PYW D;  1SIJ A;  3SEB A;  3DED A;  1YN5 A;  2UUU A;  3PM9 A;  3A7R A;  4GDK B;  2Y4G A;  2JYT A;  3GB1 A;  3MC0 B;  2IDY A;  1FD6 A;  5ADZ A;  1DOX A;  2WXH A;  3BYT B;  5MPO A;  1ZXI C;  4PT5 A;  2LEK A;  2AQ1 B;  5D3I B;  1TZO A;  2I2Y A;  2RDH A;  4ZRQ A;  2GB1 A;  4EC3 A;  4OW0 A;  3TEX A;  4BC7 A;  3Q69 A;  1FM0 D;  3ETR B;  1SE4 A;  1IUE A;  3VTE A;  3KWL A;  3FAH A;  2WNM A;  1K53 A;  4GDL B;  4PVE A;  4RH6 A;  5T8I A;  5TSS A;  2YVS A;  1WWT A;  3R2T A;  2AQ3 B;  1AW7 A;  1QKZ A;  3NS1 A;  2QIL A;  4YTP B;  3CIR B;  2OAI A;  1RM6 C;  1E8G A;  3R07 C;  1XCT L;  2RK5 A;  4ZOH C;  3HSU A;  4EE2 A;  1GAQ B;  1MBB A;  2HDE A;  5AE3 A;  1EWC A;  1FRD A;  2L1A A;  1IGD A;  1QLB B;  2KDM A;  5HQX A;  1N63 C;  3BZD B;  4XLO A;  1KTK A;  2HTM E;  2LFI A;  2KWD A;  4M0W A;  2AXR A;  3P42 A;  1OFF A;  1OQR A;  1FMA D;  2VFU A;  4HJG E;  5D3D A;  2WDW A;  1E0Z A;  4KGT A;  2ONQ A;  4C7Z A;  4NAM A;  3AN1 A;  1N61 C;  3TSJ A;  1NVI D;  3S1E A;  1MI0 A;  1PFD A;  4C56 C;  1V97 A;  2E5A A;  4TSS A;  1F77 A;  4IDI A;  4YT0 B;  1HZ6 A;  4A90 A;  1SF0 A;  1CJE A;  1YNT E;  1FNV A;  3KLS X;  3AEG B;  5BMI A;  3SFD B;  1F0Z A;  1JCK B;  1XO3 A;  5LNK 1;  2M19 A;  2Q4W A;  1E6E B;  2INN E;  3T3O A;  3TSS A;  2K3U A;  2WXK A;  4YTM B;  2VFR A;  4MH8 A;  2VFV A;  4JX1 C;  4O1N A;  3ABV B;  2Y3S A;  3LLB A;  1XLO A;  1VRA B;  1BXT A;  1FEH A;  2N7J A;  3KJM A;  3VRA B;  4TQ0 A;  1TS2 A;  3P4Q B;  3FIL A;  1YJJ A;  1C79 A;  1AHV A;  1ZDV A;  1AYF A;  4ZRP A;  4DXF A;  1M4V A;  3V05 A;  3AMZ A;  2H89 B;  3N9Y C;  2WLB A;  4N59 A;  1E8H A;  1W1M A;  3NVZ B;  3BK2 A;  4DQO C;  3TEW A;  1W1J A;  1DII A;  2VZK D;  1ET9 A;  2OHF A;  2V0G A;  3POP A;  4NJC A;  1TJE A;  1TY0 A;  3CWI A;  2QKN A;  3NVW B;  2N0S B;  4L23 A;  1JAL A;  3AEA B;  1KFY B;  4JPS A;  3ZQ4 A;  1D5M C;  1SE2 A;  2J52 A;  2VFT A;  3TX1 A;  4PWB A;  2PIA A;  1B1Z A;  2DYM A;  3P4P B;  1YQ4 B;  5AE1 A;  3BK1 A;  1DOI A;  1JW9 D;  2Y5P A;  3HUI A;  3LXF A;  3B9J A;  1FIQ A;  3AE4 B;  1TS4 A;  5D79 A;  2XNA C;  1E10 A;  1IBX A;  3NVV A;  3E9S A;  2BS4 B;  1CZP A;  4UDU C;  1RFK A;  4N58 A;  4YTN B;  2JU6 X;  1A70 A;  2GQU A;  1RWS A;  1C9F A;  1E7P B;  2AX5 A;  1WGK A;  1ZPS A;  1MHH E;  3D2J A;  2X38 A;  5FXP A;  5G5G A;  3GS2 A;  2LUM A;  2BB5 A;  2RDG A;  4PVH A;  3A7U A;  2AQ2 B;  4BBY A;  1I4Q A;  1L5P A;  5I4D A;  1L6U A;  2L52 A;  1AHU A;  3AE8 B;  2PLS A;  1VZ7 A;  4J3O D;  2IGG A;  1HQR D;  1K50 A;  2K0P A;  1AWD A;  1STE A;  2FE8 A;  1QLT A;  1NEK B;  3P63 A;  2EEL A;  3URY A;  1ROE A;  3BYY B;  4MLA A;  1FXA A;  1TYG B;  2J42 A;  4L2Y A;  5EE3 A;  1KRH A;  1I4G A;  3EA6 A;  4RGO S;  1ZR6 A;  4A8X C;  1FCC C;  2B76 B;  3AED B;  2PLI A;  4HG0 A;  2L83 A;  4HRO A;  5EE1 A;  2JX5 A;  4OHJ A;  2FUG 1;  3L4P A;  1RYJ A;  2PVO D;  4WAF A;  1FO4 A;  1L4D B;  2WXI A;  2G1E A;  2TSS A;  1C4P A;  2WU2 B;  1EM7 A;  1P7F A;  5BMH A;  4O95 A;  1V1P A;  2ZW0 A;  3AE3 B;  5G5H B;  1L0X B;  3MP9 A;  1VDV A;  3S1F A;  3TUO A;  3U4E G;  2DBY A;  2BTE A;  1VR9 A;  3PO0 A;  1SXT A;  4AQ7 A;  4PYT A;  1ESF A;  3NRZ A;  3Q8B A;  1L4Z B;  3PQB A;  4MM3 B;  5C3J B;  1FXI A;  1VLB A;  1FNW A;  2MH7 A;  5HI1 A;  4LK0 M;  4IOI E;  1FCL A;  4TVW A;  4IKG A;  1N5X A;  4DNS A;  1QOB A;  2JWU A;  2QIE B;  4RFB A;  4L1B A;  1JWB D;  4WQM A;  2H88 B;  3E56 A;  1VJK A;  4OVZ A;  1XEE A;  2IJ0 A;  5FXE A;  4KKI A;  2MBR A;  2D5G A;  3W9C B;  3FWA A;  4MT5 A;  4MAC A;  1JML A;  2J53 A;  2YEP F;  4ZYS A;  1W1K A;  1D5Z C;  3O13 A;  1L0V B;  1W1L A;  1NEN B;  1I4R A;  3FW7 A;  3RJ8 A;  2Y5C A;  2J4X A;  3NVV B;  2Q5W D;  1V8C A;  5BMG A;  1QLU A;  2N9K A;  1QOA A;  2VZK B;  2WXG A;  4N6E B;  4UD8 A;  2PTL A;  1L0Y B;  1VZ8 A;  2EKI A;  5AWV A;  2NQW A;  2BVF A;  1J7C A;  2SAK A;  3AE6 B;  2JXT A;  4BCA A;  1I4P A;  2BVG A;  4B0M A;  3AH7 A;  3RFZ B;  3W5U B;  3Q8F A;  2VAO A;  4BC9 A;  3HVD A;  5L6F A;  3R8B A;  4H2A A;  4ML8 A;  4P16 A;  4YSZ B;  1AHZ A;  1DZN A;  1SSN A;  1N62 A;  4HRS A;  2WQY B;  2WU5 B;  1MHX A;  1MVK A;  1GOZ A;  3GSY A;  4RNA A;  2NMQ A;  1HZ5 A;  4PWC A;  3AB5 A;  1SB3 C;  3NVY A;  4RF1 A;  5HG2 A;  1IGC A;  4KGS A;  1N5W C;  2INP E;  1VZ6 A;  2WDR B;  2WS3 B;  3I57 A;  1QQR A;  1YN4 A;  2WXM A;  3BVZ A;  3Q8C A;  4HEA 1;  1EU3 A;  1FFV A;  3AEE B;  1SBB B;  3BVG A;  3A7A A;  4OAL A;  1XXG A;  4YSY B;  1PGA A;  1UGJ A;  3AEF B;  5H92 C;  1ENF A;  1YN3 A;  2WDV B;  3U2S C;  2WXF A;  2K5P A;  2KN4 A;  1C76 A;  1KH0 A;  1N60 A;  3AEC B;  4R3D A;  1PGB A;  1N5W A;  2NTT A;  5EE9 A;  2E3T A;  3EUB 2;  2CJN A;  2QMT A;  5FK9 C;  2SEB D;  4NAW B;  1TY2 A;  3U52 E;  1C77 A;  2MJD A;  4PVJ A;  2CU3 A;  3AE7 B;  2RPV A;  4JB1 A;  1GB1 A;  1HA5 A;  3ETR A;  3AE5 B;  5L6G A;  1JWA D;  3NS1 B;  2V4I B;  1JWU D;  2ON8 A;  4WH4 A;  1Y56 A;  2K9X A;  1C4A A;  2LMC A;  1J7B A;  1UUP A;  2M56 B;  3PZ8 A;  1W1Q A;  1WVE A;  2L32 A;  2P4P A;  1YJI A;  2W3S A;  5HHD G;  2BYT A;  3LYY A;  4US9 A;  1P7E A;  1ACC A;  1UNS A;  2IPK D;  4RCO A;  2KQ4 X;  3J9C A;  4B0E A;  2N9L A;  1QOG A;  1QF6 A;  1W1R A;  2KAC A;  2EXR A;  2Z8L A;  2K22 A;  2LHE A;  2QJL A;  1B9R A;  5D7G A;  2Y3A A;  3AE2 B;  1JQ4 A;  4OZC A;  4WIP A;  4HKZ E;  1CQV A;  2LHD A;  2V3N A;  2CJO A;  3BW7 A;  1PDX A;  1OQQ A;  4KX6 B;  4HKQ A;  1X2G A;  2PLP A;  5HHZ A;  2W54 A;  1SJE D;  1KLG D;  2WXL A;  2Q85 A;  5BYS A;  1VAO A;  4OZB A;  2WXR A;  1HSK A;  1F0X A;  3ZJV A;  5H8Y E;  2LJI A;  2I38 A;  1WXQ A;  2VFS A;  3AE1 B;  3AE9 B;  5JXV A;  1D5X C;  2BS3 B;  4D2K A;  2FBW B;  5C2T B;  3FIL B;  3SR6 A;  2PKO A;  3PZ7 A;  2W55 A;  3R2I A;  2JQR B;  3EUB 3;  3VR9 B;  3IAM 1;  4CQN A;  2G9H D;  1YQ3 B;  1E8F A;  1XLP A;  2PMV A;  1SB3 B;  3I99 A;  1EU4 A;  1FFU A;  1FRR A;  1GB4 A;  2KMM A;  1D4B A;  3KQ4 A;  1X2H A;  3NVZ A;  3D2H A;  1T3Q A;  3TEY A;  2IGD A;  5BYR A;  3FW8 A;  1VQZ A;  2WXP A;  4YSX B;  1L6V A;  5HFY A;  3NVW A;  4ZHP A;  1XF5 L;  1QT9 A;  1MBT A;  1JWS D;  2O3G A;  1W1O A;  4JAY A;  2DYO A;  1NYQ A;  2BB6 A;  3LB8 C;  2JYE A;  4TMA B;  3IXS A;  3B9J B;  1FIQ B;  3TSH A;  2MJ3 A;  2MEK A;  3AEB B;  2I0K A;  4XDD A;  1IBX B;  1JRO A;  1F2R I;  1R7S A;  3WCQ A;  2BT6 A;  3W1S A;  1ZXI A;  1TKY A;  1N62 C;  1QOF A;  1HXY D;  3BVM A;  3S1C A;  1DYQ A;  3BII D;  3TEZ A;  1DIQ A;  2QPM A;  2DLB A;  3IT6 B;  1I19 A;  2P3H A;  4LTU A;  1LO5 D;  2WXQ A;  3IAS 1;  3RJA A;  4GLS C;  1ZXH A;  2GI9 A;  5G5G B;  5GXG B;  3Q8E A;  1CK1 A;  1SJH D;  2E6X A;  1W1S A;  1PUT A;  3Q8A A;  1ZDX A;  5HMR A;  1UXY A;  1UWM A;  3MHZ A;  3UI3 A;  5I1W A;  1HEZ E;  5EE0 A;  1FFV C;  2M0A A;  3NUH B;  3W5V B;  4A55 A;  1Q10 A;  3W8Z A;  4RF0 A;  2R61 A;  1NYR A;  4JWU C;  2MJE A;  2PW9 A;  4LLG M;  3FW9 A;  2UUV A;  1WVF A;  4US8 A;  3D2D A;  4OZA A;  4RGT A;  3NZ3 A;  4DXG A;  1ZOY B;  1E9M A;  1QIL A;  1BML C;  2QSD A;  1FNU A;  1N60 C;  3P4R B;  4TVY A;  1BUI C;  1D6E C;  4PZF A;  1N63 A;  1I4H A;  1T5X D;  1SEB D;  2QEJ C;  2ZW1 A;  5K8E A;  2W3R A;  3OWE B;  4P6V F;  4XWT A;  4YXD B;  3ZJU A;  1KLU D;  3DWM A;  3AM9 A;  3HRD D;  3U7Z A;  1WYG A;  3IT4 B;  1DOY A;  1ZUD 2;  4JWS C;  4USA A;  1XLQ A;  3RPF C;  1V1P B;  5FKA C;  5E6J A;  4AS1 A;  4KKJ A;  2JSV X;  1N61 A;  2WXJ A;  3MJ5 A;  4NZL B;  5AUI A;  3HRD C;  2BS2 B;  2WXN A;  3NRZ B;  3P4S B;  5G5H A;  4XWW A;  3BWU D;  3SR6 B;  1PGX A;  2BW2 A;  3GP7 A;  1ZE3 D;  1TS5 A;  3KWV A;  1V1O A;  3P1M A;  4ARI A;  3W8X A;  1J7A A;  2BBC A;  4C80 A;  3S1D A;  2YEP B;  4XDC A;  3H8H A;  1JRP A;  3B2F A;  3T3N A;  3LAE A;  1TKG A;  4A9A A;  2R2Z A;  2NTS A;  1YMH E;  4XE0 A;  5AUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...