2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
b'MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XANTHINE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Rhodobacter capsulatus
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
3TSHA 3ABVB 3AE5B 3AECB 1SIJA 3FC4A 2DBYA 1VJKA 1R7SA 2AX5A 3VRBB 1W1OA 5G5GA 1E9MA 1W1JA 2KAJA 3NVVA 4PVKA 1RM6C 4YSZB 2WP9B 2E5AA 1TJEA 1VAOA 1TYGB 3NVYB 1ZP0B 4P6VF 1NYQA 2P13A 1QT9A 1WVEA 1XLQA 2MJ3A 1KF6B 1DIIA 5EE3A 4US8A 3NRZB 4EC3A 5AE1A 3DEDA 5FXDA 3D2JA 5MPOA 1E8HA 1L5PA 2E3TA 1E10A 2WQYB 3EUB3 3S1EA 3AEFB 1X2GA 1FIQB 3NVWA 4YSXB 1SB3C 1NYRA 1OFFA 3FWAA 1JALA 1WGKA 3P4PB 3A7UA 1WRIA 3AEGB 3AEDB 1QLBB 1E8GA 1J7CA 2EXRA 3W8XA 3SR6A 3JS8A 1L0VB 2PLIA 3SFDB 1EWYC 4IDIA 1OQRA 2VAOA 1AYFA 1DZNA 1FFVA 1VQZA 1FIQA 1AHUA 1WVFA 3FW9A 3FAHA 1I19A 2MBRA 2KMMA 3NS1A 1L6UA 2W3SA 1KRHA 3NVZA 3W5UB 3HUIA 2BVGA 4PVJA 3I99A 1E6EB 3NRZA 4YSYB 1ROEA 1W1SA 4YTNB 2MH7A 1DOXA 2VFSA 3AE3B 1W1KA 2W54A 3B9JA 3GSYA 5H92C 3NVVB 1TKEA 2WS3B 2NQWA 1FFUC 1QF6A 4LTUA 2RK5A 3LLBA 2WDVB 3AB5A 1E0YA 3P63A 1B9RA 4MLAA 4XLOA 1N62C 4PWBA 1QLUA 2R8DA 2YVSA 3D2HA 3C0PA 3ETRB 2MJDA 5AUKA 1NENB 1FFUA 1T3QA 3HRDD 4PVHA 2Q85A 1WXQA 3R07C 1YQ4B 2VFUA 3AE8B 3P4RB 3TSJA 2K22A 3B9JB 4PWCA 2I0KA 4C7YA 1QOGA 2EKIA 1SB3B 4N6EB 4JWSC 5EE1A 1HSKA 5H8YE 2WLBA 5C2TB 1KFYB 1E7PB 1VDVA 1L6VA 1PDXA 1UXYA 1N62A 1E0ZA 4PZFA 1FXAA 4HROA 2AXRA 3PO0A 4BCAA 1X2HA 2BS2B 5GXGB 5G5HB 3AE4B 3VR9B 4C7ZA 2QJLA 4YT0B 2G1EA 1WWTA 3AE7B 4JB1A 5HHZA 1JW9D 1E8FA 2P4PA 4YXDB 4BBYA 2O3GA 2WDQB 3TX1A 5AE2A 3AE1B 1W1QA 1PFDA 3S1CA 2M19A 5EE9A 3HRDC 2K5PA 4HRSA 1AHVA 4WWMA 4BC9A 2BVHA 3AEEB 3P4QB 2L52A 4JAYA 1MBTA 4YTMB 2R2ZA 1SF0A 2PIAA 1YQ3B 1DGJA 1N63C 3AE9B 1DOYA 4USAA 2W3RA 4PYTA 4US9A 1N60C 1ZXIC 3PM9A 1RWSA 1DOIA 5G5GB 1N5WA 3AMZA 1GAQB 1RYJA 3W8ZA 1FRDA 3L4PA 2BS3B 3RPFC 1PUTA 2CU3A 1JRPA 4JX1C 3ETRA 1FFVC 2GQTA 1N63A 3AH7A 5ADZA 5FXFA 3CWIA 3AE2B 2Q4WA 4KX6B 1FO4A 3DWMA 3FW7A 1IUEA 1QOAA 2GQUA 4PVEA 3AEAB 2QKNA 4YTPB 3VTEA 1NVID 3P1MA 1XLOA 1XLPA 1DIQA 1N5XA 2M56B 2WU5B 5D79A 1GPXA 3NVWB 1YJIA 4TVYA 4ZOHC 1CJEA 4ZHOA 1F0ZA 1V8CA 1OQQA 1JROA 1QLTA 3SFEB 1JWBD 3S1FA 1UWMA 1N61A 3KWLA 3W5VB 1QOBA 5HQXA 2PLSA 1AHZA 2H88B 1JQ4A 5HMRA 3AEBB 3LB8C 2DWQA 5FXPA 2JQRB 2PVOD 4FXCA 1NEKB 1CZPA 2QIEB 2Y5CA 4UD8A 2PVGC 2BS4B 3ZYYX 1XO3A 4HG0A 2WDRB 1N61C 3LXFA 4TVWA 3AV8A 2LEKA 1N60A 4ITKA 1I7HA 1ZUD2 1AWDA 2VFVA 3A7AA 3W9CB 1FXIA 1JWAD 3NVYA 2PKOA 1J7BA 4ML8A 1RFKA 3WCQA 1W1LA 2BT6A 1FMAD 2H89B 2L83A 1YJJA 1FM0D 2JX5A 3S1DA 2ACZB 4ZOHB 3BW7A 1J7AA 1F0XA 2MJEA 5FXEA 1VLBA 1ZR6A 1V97A 2W55A 3AM9A 2WU2B 1N5WC 3NS1B 2FBWB 2P3HA 3DWGC 4JWUC 1W1MA 3P4SB 4O95A 1ZXIA 1MBBA 3A7RA 2OAIA 3FW8A 2Q5WD 1A70A 5C3JB 3KJMA 2CJOA 1TKYA 3SR6B 5EE0A 3B2FA 1QOFA 3B2GA 2K9XA 4BC7A 3EUB2 3DQ0A 3HVZA 3NVZB 4N58A 3AN1A 1ZOYB 3CIRB 3BIID 2HTME 1XLNA 2QPMA 3AE6B 4A9AA 2BVFA 1W1RA 5AUIA 1NI3A 1TKGA 5G5HA 2N0SB 4N59A 1WYGA 1RM6B 4C80A 1FRRA 3D2DA 2VFRA 2OHFA 3VRAB 4OALA 3LAEA 2VFTA 4ZHPA 2CJNA 3W8WA 1T3QC 4DNSA 5AE3A 2B76B 3VR8B 4WQMA
chains in the Genus database with same CATH superfamily
1D8LA 7ICNA 3TSHA 1B4FA 3ABVB 3WK4A 4MT5A 2KC1A 3AE5B 1SIJA 1VD2A 1WFYA 4KIKB 4S17A 4B95A 2Q4TA 2ZNVC 3ED5A 3GFKB 5DBCA 4I2BA 1PDYA 3VRBB 4FJYA 1Z1BA 1KBUA 2KVZA 5DCNA 4DL2A 2O6VD 3DDHA 5L1JA 2P35A 1F0MA 4ED1A 4ECYA 4ANWA 3Q8FA 3URHA 3C5FA 2BCPA 4PVKA 1RM6C 4RH6A 2CPRA 1NHRA 3UJRA 2WP9B 5DG9A 5HR7A 3VH3B 2NV3A 4UAUA 4ECXA 2DAJA 9ICWA 1E8YA 5J2AA 2FLPA 1L6NA 1UZXB 2DAFA 4UB3A 1FNVA 1N6ZA 3DK4A 2AH5A 2QARB 1Z1VA 3CGDA 1YOVB 1MO9A 4F50A 1NDAA 1NYQA 3NXLA 3PHWB 2INDC 4J9PA 1GUAB 4FADA 1XWLA 3AU2A 4M47A 2VH1A 1XANA 5E6OA 1SV0C 5AKIA 1NK9A 8ICOA 2ZW1A 2DW6A 4NNJB 3BYTB 4UQGA 3OSNA 5EE3A 3GIKA 5J0PA 5D7GA 2OPJA 2LYAA 1WJ6A 5DBAA 2PFPA 4C56C 3EGRA 4NAWB 5AIBA 2NR2A 1BMLC 4MKSA 3V5FA 3H4BA 3V7KA 8ICLA 2WQYB 1GEUA 2KJ5A 2ZUDA 4ED2A 2AL2A 3SQSA 1ZDLA 4YSXB 4B9MA 2K8BB 2FMPA 1C78A 2O56A 5AK6A 3H4DA 3A7UA 1WGKA 2WF7A 2P3ZA 4H83A 5JH5C 3AEDB 5KFUA 2TPRA 1HQRD 5ER0A 1XXGA 3JSVB 1J7CA 2JXTA 3EFCA 1UUPA 1ONEA 1Q1RA 1ZQPA 4KLUA 2BZFA 5FJUA 4ARIA 1NK5A 3RH5A 3DG6A 4M2YA 2E8NA 4NJ6A 4ZRIA 3JS8A 2R8IA 4J9MA 3RRAA 2PLIA 4R8UA 3IJQA 1LV5A 1P3QU 1GC6A 1MSWD 3TQ1A 2GQWA 3TW9A 5J18A 5J0RA 4TURA 3EEZA 2ZZ0A 1DOQA 4GGHA 4K8DA 3J81j 4DHGA 1F2RC 8ICMA 4DHZB 1GRTA 1V81A 2KOXA 3DHHC 2NYVA 1LGRA 1FFVA 2V9WA 1VQZA 3W2DA 2AQ2B 4BDPA 2M4NA 2BPSA 4ANVA 1WVFA 4MMWA 2LYHA 3N3KB 3ZD8A 2Y3RA 3EZ5A 2KXJA 4LIIA 1L6UA 1NZPA 2M9NA 2W3SA 4B6JA 1P7DA 2AL6A 2C9WB 3AI5A 4DL6A 2FI1A 1KRHA 1Y88A 2EZXA 4W9DA 3TIXA 1ZQYA 3MC0B 4B0MA 3V3WA 2HW3A 3I99A 2ATLA 1UT5A 2K3UA 3URYA 3MR2A 2X8HA 1WE7A 4II3B 3BZCA 1ZQEA 1ROEA 2ZZPB 9ICNA 4YTNB 1ZW7A 4YMOA 3MDAA 2FPLA 4DDGD 3T5KA 4M9HA 1HUOA 1KKXA 1IP9A 2W03A 2NVKX 4EEKA 4UB6U 3ZNZB 2MBOA 8ICXA 1MN8A 8ICYA 2EAOA 1IV8A 3UCDA 4DWDA 2RHFA 5IP4D 1GESA 1TKEA 1JPDX 4W9EA 3Q8LA 9ICGA 1H4RA 2C7MB 2HHWA 1JX4A 4OZAA 3ZNID 1GRFA 5I4DA 4GDKB 1ZDVA 2V3NA 3V60A 2OOBB 2XIDA 4K4GA 1EU3A 1TYTA 1X9SA 2KX0A 4QZ9A 4RQ6A 2AU0A 2QILA 2WDVB 4F4XA 1JWMD 4LLGM 4X5VA 5I1VA 3P63A 1B9RA 3W1SC 1GNUA 2C5LC 4DHJD 3Q8QB 2EZYA 5JCMA 2WXQA 1XC9A 4F91B 1NHSA 3T79A 3RJIA 1NZBA 1E8ZA 1OQYA 2YAUA 2YVSA 1XS2A 4QZ8A 3C19A 2M0XA 3ETRB 9ICOA 2MJDA 4UDUC 3TJ4A 2PE6B 4EKUA 1D3ZA 3DVGX 1T0QC 4UB8U 3EPGA 3EYZA 4I29A 4HJKA 4EBEA 3K9PB 3L10B 4J56A 4Z17A 2ASQA 1FFUA 2JGAA 1TV9A 3KUMA 2WXRA 5AIAA 3IT4B 1L4DB 2WB1C 2FE8A 3MTNB 1N48A 1WR1A 1MHXA 3ZLFA 4YP3A 4DXGA 5BOFA 3P4RB 2EMTA 1WM3A 3TSJA 4IM2A 4YWGG 2ONEA 5EU9A 2PI5A 2KFJA 2A4ZA 4P4MA 2C2DA 3JPRA 4QWAA 1S77D 3OJSA 2G4DB 3U7DA 4W9GA 4H4VA 1SL0A 1UF0A 2WXJA 1R4MB 4JQ9A 4H4WA 5KFYA 3ZXVA 1SB3B 5KFPA 3OZYA 2ZJ5A 2LYBA 2E5SA 2A1JA 4JMUA 3PNCA 5FKAC 2I5HA 4OJOA 3KTQA 4CE6A 5H8YE 1L5UA 5C2TB 1E7PB 4EBCA 5ALVA 4QWDA 3CAWA 4LJOB 1L6VA 4F92B 3RB0A 2DLBA 2EAMA 1UXYA 2OVLA 2AWTA 4UB2A 3RJJA 3MC1A 1DXSA 3OPXA 3ZKJC 1RQNA 4QZFA 4R66A 2PP3A 1LKYB 4ZA0A 2KOBA 1E5WA 4RF1A 1LVLA 9ICLA 3NOBA 2ESEA 3LADA 3RULA 1YMHE 2KVSA 2MAXA 4BXOA 3IT6B 4J9LA 5GXGB 4OZBA 5G5HB 1NK4A 2IO2B 3AE4B 2MBQA 2I9GA 4C7ZA 4NJCA 1UGMA 1WWTA 2R61A 1COKA 3UF8A 2ZPYA 3CGEA 4HWIB 1Q8KA 4WURA 3MC8A 2P4PA 3IBEA 5ALXA 2FIFA 3R9KA 3RH4A 2JSVX 2L0TA 4NL9C 3W1YA 2O3GA 3PO5A 3AE1B 2F5ZA 4E4UA 4CCHA 2GO7A 4DL4A 3OZMA 3CF6E 4H4UA 3H7SA 4KMOB 1WH3A 3VC5A 2BCUA 5DPSA 3TI0A 2FPMA 4MDKE 2QDDA 2K4IA 1ZOLA 4GIVA 3APCA 3IAS1 4B9LA 2UWQA 3KLJA 4ZRQA 2WAQC 2VZKD 2LZ6A 4PS8A 1RZTA 1MOKA 2Z0EB 2POZA 2PPGA 4CQNA 5J2BA 1HZ5A 1RG6A 3PW2A 3SV3A 1WGHA 2IYDB 2ASLA 2PTWA 5B66U 3ISDA 2DZIA 2JEJA 3PO4A 2R2ZA 1TAUA 1D5ZC 1SF0A 2ON8A 5BYSA 3EJBB 3RJGA 1WX8A 1T5XD 4PYUA 4KKJA 2PIAA 4A90A 9ICQA 1YQ3B 4H4QA 2LXCA 3AE9B 4KLGA 2LASA 4TUSA 3JSVA 1PZNA 4DX3A 3GDXA 4MGYE 2W3RA 1B0XA 3KH0A 4HJGE 1Q46A 5TSSA 1V2YA 4US9A 2ZG6A 1XO1A 1N60C 4UAZA 4YL8A 8ICHA 1DOIA 2D3CA 4BVUC 1KSPA 3DBSA 2V0GA 4KLSA 5CTRC 1GRAA 1ZQOA 1NJWA 1ZQQA 1S76D 2ZCCA 3DFYA 4ED7A 3I4KA 2V4QA 4Y2TA 4RT3A 1FRDA 2NBVB 3M3JA 4JGHB 3RPFC 4A3PA 1HEKA 2CU3A 3UINB 1JRPA 4IG7B 3I1YA 4GIRA 2J7QB 1FFVC 2GQTA 4LDTD 1N63A 3AH7A 2OQHA 3T5HA 3AU5A 4IRDA 3N20C 5ADZA 3ENEA 3T6CA 5IA7A 4YFKA 3JPQA 2PFQA 4PS3A 1L2NA 3E56A 2NBUA 1ZQKA 4LNKA 2MX2A 3TARA 2Q4WA 3NZ3A 4Y2JA 2K25A 3FV9A 3BDPA 4PZOA 4F93B 4UB1A 1QOAA 2JYEA 4I6LB 2C2RA 3DEQA 2YMPA 4JV2A 2KNBA 4AP4C 5ALLA 2EDUA 5U25A 3QKEA 1OW5A 2E8PA 1MJDA 4QW9A 3QX7A 1T7PA 4DSIA 1BVSA 3DDCB 5BPCA 3DJJA 2JEGA 1QSLA 3UXPA 1ZQUA 3OHBA 4XC2A 1N5XA 2ZJ8A 3H70A 2M56B 3R0KA 4WWPA 3CSTA 3NVWB 3LWLA 1YJIA 3SQPA 4ECVA 4DL7A 5DDYA 2XICA 4J1OA 1HE8A 1D4BA 2G09A 1UBIA 3KKAC 3RJAA 1U47A 1F0ZA 3SMVA 4DQOC 3H7PA 5AKHA 2YB1A 2CR5A 4HCLA 3GV7B 3DVNU 1JROA 2WXLA 4EYHB 3Q6JA 4IQWA 4JDRA 3SFEB 3PLVA 5IIJA 1JWBD 1ZD2P 4LK0M 2V3BA 1UWMA 4QWCA 2BPCA 1JWSD 3PGEA 2X8CA 1N61A 1XD3B 2KV2A 4FZNA 5T8IA 3RNCC 3AU6A 2KIVA 4ECRA 1R6WA 3UJEA 4RQ5A 4G0NB 1ZJNA 4XQ8A 2H88B 1AHZA 1GJZA 5DB7A 3N1YC 3RAQA 4KITB 5ALEA 3LB8C 2DWQA 4WWOA 3CW2C 3PSPA 2LVOA 5KVIA 2PVOD 1QCKA 4PK1A 2KTRB 4HEA1 3D2SA 1B43A 4DEZA 2LWPA 1AN8A 1WY8A 2V1YA 3VUXA 2HHVA 2QIEB 2N7JA 3ZO5B 2H3FA 4NY8A 2K6DB 1FD6A 4UD8A 1NHQA 2EAPA 2BKEA 1KFSA 4NAWA 1F5SA 2Z8LA 2XC9A 2L1AA 3FG2P 2FE9A 1ZD4A 2WDRB 1JWUD 2JRIB 3T5JA 3LXFA 4TVWA 2WBAA 3E9SA 4XYCA 4M02A 1V38A 2JT4B 2VIXA 3TCSA 3N97B 1KKRA 2GH5A 2MA1A 3RNMA 3M62B 2K8HA 4BKGA 4EZLA 4LZDA 5KT5A 2ZIVA 2D5GA 3DJGX 1VCBA 1KJTA 3W9CB 3GZFA 4DYEA 1TZ1A 2RDIA 1M94A 3TADA 4RQMA 2A1JB 2Q0ZX 4EX7A 1ZKHA 3BOXA 2PCEA 4Q43A 5AKGA 4K7WA 2WP6A 3PR5B 3M63B 4P4OA 2O2VA 3IJLA 1V6EA 4MM3A 2AEHA 3RNBC 5E6PA 2INNE 3WCQA 2VANA 7ICTA 1Z4NA 1U49A 1W1LA 5J04A 2H89B 4MF8A 2LFIA 4O5EA 1ZKQA 5DGAA 4CNQA 5J2IA 3T3OA 1F52A 1TAMA 5CHVC 3II4A 1LVHA 3RFZB 4IL0A 1XHCA 4ECZA 2W0HA 5D3DA 1UHUA 2KQ4X 1RDFA 5AM4A 1EO6A 2I38A 3MFHA 4Z6DA 3WKCA 4G11A 4G8TA 4ZOHB 3BW7A 2XH0A 3ZVHA 3C21A 1TS4A 4TMAB 4WH4A 5FMHA 2KWCA 2G45B 4X57B 4YXMA 2K4EA 2PE9A 1VLBA 5TZVA 5J0XA 5JU5A 2XNAC 2HXUA 1DYQA 2G5IB 2J53A 4P16A 1I42A 1X40A 2F1HA 1Q3VA 3IFWB 4O3RA 2D07B 3OGUA 2MHJA 3AXCA 4OVZA 1UELA 5IIKA 2WU2B 4H2HA 4KDIC 3NS1B 2ZXIA 2FBWB 1TZZA 2RLTA 1KTQA 1ZQSA 4F4WA 1U4AA 3A1QA 3DWGC 2V3AA 2P3HA 4ELVA 4P0PA 1ZXIA 4ELTA 3A7RA 5KFMA 2OAIA 3FW8A 4KN4A 1YJ1A 3GZNI 1K51A 2MSNA 4KLLA 3MY9A 5IOIA 2QJMA 3H1UA 5DQIA 3Q6BA 3CGCA 3R2TA 4BURA 3NZSA 4DXFA 4WJNA 3N6JA 4MACA 2CJOA 5JTIA 3UGBB 4J9RA 1V9JA 1BNOA 2J0KA 3PRZA 1XSLA 2BYFA 3SU8X 3BQ7A 2FLNA 2REXA 4RNAA 1ZQZA 2NRTA 1GG3A 2LJ5A 1L3UA 3B2FA 3KZXA 3B2GA 1JI7A 4J03A 3EUB2 3BVGA 3F5AA 2V4IB 2INPE 5AHXA 4N58A 1PYWD 3GD3A 4M0AA 2P8CA 3AN1A 3H7PB 1ZOYB 3CIRB 3OJ4B 1J8CA 2DUYA 1WUEA 1XLNA 2BCVA 1VZ8A 3HHMA 4PZNA 4GXJA 1CRXA 1H38A 2A1AA 5HFYA 4A8XC 1MHHE 2PFOA 9ICBA 4AS1A 2RDJA 3QEBZ 1TS3A 4ED8A 1R0MA 3N6HA 5ALYA 3EHVA 4RGMA 2RR9A 4AYBF 4A6QA 3IP4B 3U30A 2RP5A 2ZC8A 1CK1A 2XY6A 3H8MA 2N9XA 2WGSA 2KICA 1ONFA 2NPTA 2HDEA 3ZXRA 2GR3A 2DPJA 3GD6A 1Z00B 4KLDA 2D10A 1WZ0A 2Y0SC 4ICAA 2KKCA 2MU2A 5J0SA 1KOTA 1WSPA 5J8YA 4FO6A 1B22A 2IPIA 5IIIA 4NJ7A 2LHDA 2WX0A 4NAMA 2ZIUB 4ECQA 1S5LU 3VR8B 4DO9A 4WQMA 1H6VA 4RQ7A 2JK6A 1YEYA 3Q4DA 5HMLA 3AECB 3SENA 2IY0B 2NPTB 3EECA 1PUZA 2DBYA 1R7SA 3IVFA 2ODGA 2P6UA 2D3AA 3K9OB 1UA0A 1W1OA 1D7YA 2HBKA 1PDZA 3R0UA 4EMJA 2DPIA 2DKZA 4LDTB 1W1JA 2KAJA 4LNFA 5ALKA 3NVVA 2K89A 3QWZB 4C8KA 3BJSA 3SN0A 3H7VA 4P2HA 2DQNB 2C3DA 3TEYA 5J29A 2JPHA 3V4BA 4M04A 5KFEA 4APNA 1VAOA 1S0MA 5C23A 1MDLA 3Q3NC 2PA6A 2MLBA 3V6EB 2HBMA 2P13A 5HG2A 4J9SA 1C1YB 3IAM1 1EXNA 3E58A 3EPIA 1EF5A 2MJ3A 4HCNB 1KF6B 4MSMB 5D94A 4US8A 5KAFU 3IDWA 2GMIC 3NRZB 4EC3A 2QARA 2OXOA 3LYYA 3Q3JA 3NFUA 2WHEA 3F5EA 3DEDA 2RDBC 5FXDA 2L0FA 1NJZA 1E8HA 2I1QA 4ZYSA 1NHPA 1E10A 4O3PA 3EUB3 3S1EA 3HKZF 5LXHA 1ECQA 3KYCD 1X2GA 3HSUA 1FIQB 1KLVA 2W9BB 1WGYA 4KLIA 3TJIA 5AZFA 1TGZB 2KN4A 1IIPA 1SB3C 2NTTA 1E9IA 1SKSA 4Q8EA 2PTYA 4RGTA 4TQ0A 2KMCA 2MRLA 1NPXA 4FBUA 1QLBB 2EXRA 1QSSA 4DLEA 3I5JC 5U1OA 3SR6A 4DL5A 5L83A 1GRGA 3GP7A 4UARA 4FLHA 3OHAA 2D6FC 3IC9A 5F9LA 4R3DA 5KNIA 1L0VB 5ENLA 4H1ZA 2CHZA 1EWYC 3BK2A 2I1KA 2RD0A 2FCSA 3MABA 4I2CA 3EA6A 4IDIA 4GR1A 3CP8A 1HJPA 9ICFA 5D46A 3N32A 2GOLA 2OCEA 4GU2A 4M8MA 4P1BC 2UUUA 4XA5A 1I4QA 1BT0A 5AM3A 5JHBA 3ONSA 4Q8FA 3ZJVA 4EQRA 4TKNA 1UD7A 2N1VA 1S0OA 3Q8RB 5KFDA 1UWXA 3ZDCA 1SXTA 1LKYA 3JW0X 7ICKA 1F8WA 3SBFA 1XSPA 4QNLA 3FW9A 5EWEA 1UNSA 2XH4A 2KKPA 3D9XA 3PQBA 8ICNA 2MBRA 4KGRA 3NS1A 4WAAA 1VZ7A 5FS8A 2BB5A 4H4ZA 3RB3A 4HN8A 5DGBA 1ZXHA 5JRBA 2JXXA 5KT4A 2HHSA 3M1YA 2R18A 3DQVA 3H0MB 3LVVA 3HUIA 2PFNA 3R25A 4W9FA 5AEKB 1LB2B 1S9FA 4HKZE 5D4BA 1WRDB 2E1EA 2XGQA 1NKBA 1D8BA 5AK3A 1E6EB 2MP2A 2QCZA 4DN1A 1JPMA 4YSYB 3QFBA 3RAXA 5AM5A 5KT3A 4TQRA 4WIPA 1U45A 1EM7A 1QKZA 3L8KA 5FS6A 1WUDA 1NKCA 8ICJA 2SEBD 4BZAA 3IJIA 2DZJA 4TQSA 3AE3B 9ICPA 1DXLA 3S47A 6ENLA 3B9JA 4I6PA 5EBKA 3TFSA 1HZ6A 5FJOA 2LMCA 4ZRJA 5ALUA 2IO1B 1M4VA 3LB8A 3U52E 4KN7A 4L2YA 3CSFA 4DOAA 4BOZB 2H5XA 2RK5A 1FEZA 3M7DA 4HDQA 5G55A 1NOMA 2YLMA 3IRUA 4IT1A 4DFKA 3WKEA 5BYRA 2RSUA 3MGIA 3C1YA 4K1RB 4PH5A 5DDMA 3TBLD 4ANXA 4PWBA 2XI9A 3QZ8A 4GMVA 2YMQA 1LPFA 4RQ0A 2BCSA 2GB1A 2N9LA 3T5LA 4EZ9A 5CB1A 3RBEA 2ZTEA 4YMMA 4II2B 3ZI4A 2QMTA 4IL2A 2HHTA 1D5MC 3PHXB 2LI6A 3SAHA 2ZADA 3CB3A 1JUDA 4OD0A 4O0IA 2KZRA 1ZETA 4DQQA 2Q85A 1MQ2A 1ZJMA 2PLPA 1F9CA 5HKHA 2RPVA 4K7ZA 4NLNA 5AM2A 3MFGA 2KTFA 3BQ1A 4IZGA 7ICLA 3B9JB 3EJEB 3VH4B 4PWCA 2I0KA 3DVGY 4IWOA 2BCRA 5J2GA 4I2AA 1QOGA 3B0YA 3BS5A 9ICXA 5KFRA 2D3BA 5EE1A 1HSKA 1QILA 1ZK7A 1CEZA 3P93A 2WLBA 7ICJA 3ZNGC 2KFKA 1MFWA 4HKQA 4KMUA 4DHZE 2HHQA 1PK3A 1VDVA 4QZEA 2W7OA 4H4TA 1PDXA 3SZ2A 2IOFK 2GWSA 8ICBA 4URKA 3VCBA 3QAQA 3VUYA 5AKEA 3SN1A 1GOZA 1E0ZA 1J2NA 2MWSB 3QUQA 4ACOA 4AQ7A 4JN8A 2E8MA 2JR5A 2D8CA 4UAVA 4BCAA 4F8CB 2FUG1 1F77A 5C5JA 2J42A 3U2SC 4YMNA 2FCQA 4DK5A 5GTIU 1WR6E 4P1CC 2W9CB 3EAOA 1I4HA 4HPPA 1XPYA 3TEWA 1XCQL 1ZQMA 2YVGA 4F5OA 1IGCA 3ZDAA 3P0WA 3NHEB 1OEYJ 2KZMA 2EQ8A 1OTRB 1XSNA 4YT0B 3UPQA 3BYYB 3NUQA 4LA1A 3TOYA 1QLNA 5ALMA 3AE7B 3ZQ4A 3DVNV 4NLKA 1JXEA 2NCNA 5HHZA 1JOAA 4M6WA 3U4EG 3PW5A 3WA0A 1SE9A 1E8FA 4RM9A 2QKQA 1OEYA 3IG5A 1ZQHA 2BB6A 4XX5A 2AQ0A 3IM1A 1FPYA 3PV1A 2CKHB 3PSTA 3AQEA 2KDEB 3S1CA 5AKJA 5EE9A 3HRDC 3KKAA 4H4XA 1KEJA 4I2JA 2QJNA 4PGYA 3K75D 5ALWA 1AHVA 5DBBA 4WWMA 4BC9A 4DL3A 1ZPSA 3R66C 5J0TA 2J0JA 1ZQLA 3B1LX 4KSKC 3RITA 3K1ZA 4RGNA 1KFTA 1T3NA 2BVHA 3ECIA 1SXDA 1ZQFA 3P4QB 5IINA 1Q3UA 4I2FA 3TQPA 5ALQA 1BXTA 3MFIA 2BTEA 3N7RC 2X99A 3UXLA 4RU9A 4TSSA 3V61A 1NJYA 4CO7A 4C0ZA 3ZUNA 2YN4A 2BF8B 4IM0A 1KLNA 1LO5D 2LGIA 1SV4A 4IC7B 1XEEA 4WAFA 1UCVA 2KTQA 4Y2PA 2GBRA 2J6TA 3BQ0A 4IC9A 2HHXA 1WXVA 1SIFA 4NPNA 5DB9A 1SE2A 1OEPA 1C7YA 5ALOA 1D5XC 1K1QA 4KGTA 5BOLA 4O9MA 2R2OA 7ICVA 3DH9A 2PTLA 2CFYA 2HOQA 3H9DA 2AQ4A 3C2MA 2CHWA 2N9KA 5FP0A 3J9CA 2Y0SF 1BPDA 1TKDA 4GOCA 3HVDA 2NPXA 4RQ4A 4LZGA 3D46A 2BS3B 3C0RB 3KHGA 9ICMA 4AJYB 4Z1YA 4HCPB 3K1RB 3QU4A 2IJ0A 4CRXA 4O3QA 4AYBC 2IOHA 2LRWA 4N9F4 3A9KB 1SJCA 4GFJA 3CWIA 3QJZA 3AE2B 3MR6A 5CHWA 4KX6B 1RPLA 4F5QA 3MQTA 1FO4A 1A76A 3DWMA 1S10A 2IBKA 1IUEA 4MH0E 1P48A 3O0HA 3QFAA 4XDCA 3AEAB 1C20A 2JZZA 1ZQBA 4A6GA 2ZIWB 1JXLA 5C1ZA 2QKNA 2KZZA 4FHKA 2UVUA 1FNUA 2VJ4A 3DDMA 3KVFB 1NVID 2KJRA 3G6VA 1YNTE 5IIOA 1XLOA 1XLPA 1PK1A 1TK5A 1DIQA 2NQLA 2UYZB 3SD7A 4I2EA 3WU2U 2WU5B 1RYUA 2GSHA 3VQIA 1GPXA 2ES6A 7ICGA 3ZJTA 2K8BA 3RRGA 1C9FA 4EM3A 1SL2A 4ZHOA 5KFTA 4MGKE 1A6SA 4LCDE 1WYWB 1WCLA 4O3NA 5D49A 4JIOU 3SAFA 4DS4A 3NZGA 4QWBA 2YB4A 5CA7A 3A9JB 2SAKA 3RD2A 3CT2A 4WJQA 5HR6A 3DEEA 4JLCA 2CRXA 2CHRA 2NRZA 2ZW0A 3KWLA 4UB5A 3FVDA 5JCKA 2UVVA 3MJ5A 5HQXA 4AJWA 3WK7A 5CRXA 2JEFA 5J2EA 1FNWA 5HNKA 4ZRKA 5HP4A 2XVTA 3HKZC 2W11A 2C60A 2G3QB 3RT3B 3GRSA 1MVKA 3FCPA 4GLXA 4R63A 3PW7A 2MSED 3RBDA 4EQWA 3TAPA 3DGBA 3QE9Y 3LWMA 1EBGA 5GRTA 1Z2MA 3M6KA 3APFA 3AUOA 2TSSA 4FXCA 5KG1A 4RNNA 1WF9A 3MGVA 4MJSB 1SJBA 1PK1B 4NEVA 4E5TA 2HNEA 3N9YC 4Z6FA 4EOYA 3V62A 3P3BA 2JWZA 3ZYYX 3QU9A 1XO3A 4JV1A 4ICVA 3QUTA 1N61C 3AV8A 2DNFA 1OJTA 3T9LA 5AI6A 4OJPA 4LNIA 3O0FA 4KLJA 4EZKA 4DHJB 4C4SA 3GOEA 4KZ0A 5BMHA 1MA7A 1QQ6A 1UH6A 1ZUD2 1Z00A 3Q3MC 8ICSA 3I57A 1AWDA 1EC8A 2KDFB 4EZJA 1FEHA 1UQVA 4B0EA 5AI8A 2RABA 3A7AA 4F4RA 3BS5B 8ICCA 1JWAD 4U7CA 1ZGUB 3TCAA 2E6XA 4EMWA 4HPMB 5KFQA 2M0NA 3E0FA 4ZCWA 4ML8A 2KJ9A 4CF5A 2CU1A 2HBLA 3RUIB 2BT6A 4EELA 1FMAD 4DFDA 4FBJB 4C8OA 2QB1A 1HTOA 1YJJA 1B1ZA 2ZZCA 2N9PC 2G5HB 1E8XA 2KWUB 1ZD3A 3Q69A 1SKRA 4M9LA 2JX5A 2KIWA 3PY8A 3RI7C 2Y1JA 2O2VB 5J0QA 3PVXA 3UQ0A 4Y2SA 3BK1A 3ZDBA 3GILA 3GU3A 3PSFA 2IY1B 1ZQGA 3KUZA 9ICVA 1MC8A 1J7AA 2KN7A 2E8OA 3HWTA 2BVCA 3DPDA 4K7SA 2W9AA 2PKEA 4F5NA 1WE6A 2BCQA 3QK0A 3PZDA 3STPA 2YEPF 3QX1A 5G2NA 5FS9A 3ISBA 1NK8A 1CI4A 2WB1F 1S97A 4NQLB 3SHQA 2W55A 5KT6A 2KE7A 2FUHB 1EBDA 1VRAB 4NL9A 4IQVA 3MWCA 3TEXA 3HPOA 4JWUC 1YX6B 2GI9A 3P4SB 1W1MA 1K1SA 4H50A 4BKTA 1GO3F 2AYOB 5IDZA 1DK3A 1WI0A 2AL1A 3ZD9A 4YXJA 1QQ5A 3EWAA 4KDLB 1GB1A 4E74A 9ICEA 2ZIWA 5BO4B 3N4MB 1BGXT 3LDAA 4F4YA 4JV0A 2BQUA 4IR1A 4O5KA 1KTKA 5C3JB 1GSNA 2P8BA 3V7JA 2PSNA 2WOWA 3K1GA 2KDBA 2KQSA 5KFIA 3ALRA 1QH9A 4KTQA 4M0WB 4DSEA 5AI9A 2V3SA 3T3FA 2BDPA 1QOFA 4QJFB 3R2IA 4BC7A 3QLDA 4Y2QA 2L76A 3VC6A 2K8AA 3DQ0A 3RFAA 2F1JA 4ZRPA 5FS7A 5J8YC 2FMQA 5DLFA 8ICRA 2OEDA 3A9KA 3D32A 3BIID 3DBHI 2LVQA 2Z59B 2PP0A 9ICJA 4MEXA 2NTSA 2X8XX 3SYZA 4F3OA 1F2RI 3CMMB 1TKGA 1W1RA 4E8GA 3V72A 1P7EA 3RJEA 4BXOB 2WF8A 7ICSA 1TAQA 5L1KA 1WYGA 2BPGA 3CK5A 4GMEA 2EQ6A 4I2HA 2KEYA 3H4KA 5CX3A 2OO6A 4GSWA 1YX5B 4ECTA 4NLCA 2HVHA 3H7IA 2V3PA 3GS2A 2W9MA 3VRAB 4OALA 5DLGA 1S3SG 2GBNA 5DB8A 2JHDA 4ARCA 3GRTA 3GB1A 4I2DA 4ZDVA 4ZHPA 2CJNA 2GGJA 3W8WA 1VR9A 4FZLA 3DK8A 4UBCA 3M9NB 1BKHA 3OAWA 3SV4A 1FCLA 2WPCA 4O1NA 1X9XA 2K6QA 5EWFA 2N7DA 5J0OA 2ZIXA 4HLEA 2G0AA 1VJKA 2JRHA 5KHQA 4LNOA 3MHZA 4B9NA 2AX5A 3MR3A 4F5RA 2KMAA 2BR0A 4J9OA 1N62C 3PMLA 9ICAA 5G5GA 2GLEA 4JPSA 2LM4A 2OYYA 5E6NA 3OC4A 2L5YA 4PL1A 3VCCA 5HMMA 5T14A 2G08A 4DFPA 3RN9C 4YWOA 9ICRA 4YSZB 3RTVA 2A3VA 2ZNVB 2DKXA 4KPLA 3GD4A 3U9IA 4S0RA 3U26A 4HXDA 5AI0A 1TYGB 4WJPA 2HHUA 5J17A 1ZP0B 3JPTA 3L16A 4P6VF 5KFVA 1T0YA 1D9FA 1QT9A 4HDOA 2WWZA 1WVEA 3C23A 1V85A 4OJ6A 5KAIU 2JH1A 1NDDA 1XLQA 7ICEA 1EC7A 2GBKA 3ZW3A 2QDFA 2OJRA 2WXNA 3VC8A 3QU7A 4MSQB 1DIIA 9ICTA 2K4PA 1U9LA 5ALHA 4F8RA 1WM2A 2BPFA 2XK5A 4NQKE 4Q45A 1L7YA 3ZTDA 4E71A 3AULA 1LFDA 5MPOA 3D2JA 1L5PA 3TMPB 3G6XA 3UJFA 4J57A 1M6IA 1M6YA 3AEFB 1ZMDA 3RJHA 4PHPA 3I6TA 5AKKA 5ALJA 3ZRFA 4QZCA 3JPOA 1NYRA 4K7UA 1OFFA 5JCLA 1GERA 4MGZE 3P4PB 1X66A 5AK4A 3L5KA 1E8GA 3HM3A 3UXKA 1STZA 4RFBA 4YG2A 1SSNA 2MA9B 4TUQA 3HW2A 4BWMA 2PPHA 1GETA 1SJAA 5L6FA 4ED3A 2JZ3B 3DK9A 3RNAC 2YMMA 4GC7A 3H0LB 4D2KA 1A5RA 1L8OA 2F8KA 1BZLA 4IRCA 1OQRA 2DW7A 1BWCA 4M6WB 4FS2A 1DK2A 7ICFA 3GIMA 4KEMA 1Q5WB 2VAOA 2BYVE 2FDRA 3AQFA 4ICUA 3RCYA 1WX7A 3KOOA 4QZAA 3KHLA 1RRBA 3Q8MA 4ROPA 2KDIA 3RJ8A 1C4PA 2AL2B 1QQRA 3ETLA 3ML8A 3V3XA 2V4LA 3FAHA 1P1AA 1V80A 5TR5A 3TL5A 5LXIB 3THUA 3HM6X 1UGJA 1KLGD 1TE6A 3N4EA 2F77X 2KYWA 3TUOA 2MUTB 4CDGA 1WXSA 3B08A 5B5EU 3T9PA 5D6JB 3GY1A 3OLMD 2YX8A 2PJHA 2LPEA 1Q1OA 4NY0A 1ZQTA 2E1FA 5KHOA 2MH7A 1JCKB 1T94A 2PW9A 1DOXA 5BMIA 2VFSA 3D2QA 4NZLB 5ALSA 2C3CA 2Y9TA 4H19A 3C8YA 3U8ZA 5CP2A 3ZIMA 2W54A 1TIFA 3TSSA 3GSYA 4F71A 2OZ3A 4TUPA 4Z6EA 3H8AA 4DNAA 1F1HA 3NUHB 4BBNC 4Y2YA 2WS3B 3QCAA 1V86A 1GB4A 2KO3A 2OX4A 1K52A 1FFUC 5KFJA 3AEVA 4B9VA 1QSYA 2IDYA 2WXOA 3KQ4A 3A0HU 4RPXA 4K3CA 4LTUA 4PJ0U 2AQ1B 3LLBA 3H40A 1T8EA 4RUAA 3H8JA 4C4RA 2O6VA 5LNK1 2KSOB 3S6JA 2P6RA 1E0YA 3BINA 4MLAA 2WDWA 3PW4A 2OQYA 1KDHA 4XLOA 2L32A 2G06A 4FBTA 2J6SA 4O5CA 4ED0A 2ZTCA 2BDUA 5IKCM 1YIWA 1L0XB 2EMSA 4Q44A 3VAWA 2WAQF 5KVHA 3SQIA 1XO0A 1NK7A 1SBBB 3VTVA 3D2HA 2PU0A 3V05A 1SXEA 2GDQA 4K81A 4GRTA 4QWEA 5KG2A 4UW9A 4DF8A 5AUKA 3R10A 4RZRA 1NENB 4EYIB 3A9JA 5ALRA 4C00A 4KSLC 4IP4A 2BW2A 2KSOA 4QZDA 1WIAA 4C4VB 1QZEA 5FK9C 2F44A 3T8MA 1KD0A 4CF3A 1IXRA 1TTNA 3R07C 1IBXA 3B0AA 5DQHA 1YQ4B 2LHTA 5ALDA 4JWNA 4MF2A 2KDMA 2VFUA 2WOVA 3AE8B 1V5OA 3A1QB 5KFGA 2HOIA 1KN5A 2W7PA 3C1ZA 3L08A 3QN3A 2KZ3A 1ZQRA 3LVWA 2XK5B 3HJEA 3KWVA 5L1MA 2OM6A 4BOSC 2EKIA 2XSXA 5JUMA 1JIHA 4UATA 4JWSC 4EUTA 2I2YA 2EKEC 5J2DA 5TISU 2UVWA 4NLZA 2FYMA 2D3GA 3KYDD 3IK4A 2JU6X 4K8GA 1C3TA 4P4PA 2LHEA 4ADWA 2A8XA 2ZUCA 3PR4A 2X8GA 2L7RA 5J2RA 3HW8A 5KFSA 5DPWA 2WXMA 3KUDB 4XWTA 3C2KA 1Z4OA 1L4ZB 4P0QA 3TJPA 4KLMA 1KQQA 2XBBC 1RQLA 4DSKA 4PYZA 3VFCA 4DQRA 5KFOA 1JCTA 1FXAA 2IGHA 2A5UA 2K4HA 1S0NA 2KLCA 3NJTA 2IMWP 3PZ7A 4HROA 4DXAB 4E3CA 2QJJA 4ENLA 2EQ9A 1OUQA 3RZWC 2LM1A 3OSPA 2NRWA 4DCCA 2J0MA 4F7ZA 4M6UA 5K4LA 4ACFA 3UJSA 1X2HA 1WX9A 3I76A 2QEJC 2OLAA 3D47A 2KT7A 3M9MB 3VR9B 2I6XA 7ENLA 3LDZE 2LGDA 1ZD5A 2QJLA 3ZLGA 5AM0A 2G1EA 2EQ7A 3UJ2A 3DERA 5JZEB 4HPLB 3JVZX 1HIWA 4XWWA 5J2JA 2IOFA 4AWJA 2WXIA 1ZQAA 1AARA 2F76X 1BPYA 1K53A 3L13A 4YXDB 4BBYA 1MG4A 3TX1A 5AE2A 2KMDA 1PFDA 1G6JA 2OKTA 1Z3EB 3QUBA 3OTQA 4Q2JA 2QDEA 2WXFA 1KCZA 1WJ4A 3A0BU 3WKDA 3MSYA 3N30A 5FJTA 2KKVA 3X0WA 2CHXA 3DGZA 2KC2A 2K5PA 1YN3A 2YEPB 3UQAA 5KFHA 2KD0A 2L8JA 2BQ3A 3WK6A 4IHCA 1C79A 4XGAB 2HJ8A 4H4RA 2KHQA 2ZXHA 1E8WA 3I28A 2LGSA 5DG7A 2FCNA 1STEA 3PPAA 4DF4A 3Q8KA 2WNMA 2MBEA 1O03A 1FXTB 3AEEB 3BZKA 1EUVB 3DGHA 2AHOB 4JAYA 3BJYA 7ICRA 5ALIA 4YTMB 2P88A 2M17A 1IM4A 5KFLA 4ECUA 1BPBA 3OW1A 4K2SA 5KFAA 3QNMA 5KFWA 1RYRA 1NK6A 1K4QA 3H12A 4BWJA 1ED1A 4I28A 2RMMA 2HXTA 1XQQA 4LNNA 2K60A 3DOWA 1N2XA 3MDCA 2Z7JA 5AWVA 3SDLC 3TWBA 3T4WA 4PYTA 4MEYA 5E79U 1C76A 5HHIA 1WUFA 1DGSA 3FILA 4O3OA 1VZ6A 2KJ6A 3ZLZA 4YN4A 1KN0A 1E90A 1TFRA 5J0YA 2ZJAA 4KX3A 3AMZA 2DYBA 4MM3B 4MFCA 3VTUA 1ZQVA 4A55A 3W8ZA 8ICAA 2KG5A 2JEIA 2DGZA 3UMCA 3M8RA 1PQSA 2QAEA 4K3BA 3R1ZA 3G6YA 1PUTA 1WMHB 2PGEA 3DFHA 1URJA 3RR8A 5GMVA 2FLLA 3VDZA 4I2GA 1YN4A 4H4PA 2ISOA 2KX3A 2PMVA 4EQXA 4UAYA 2C7NB 1AW7A 4FULA 2JWUA 4PVEA 4DWFA 2L3ZA 3IV6A 1QTMA 3FW7A 3BS7A 2NS5A 3Q8AA 3QARA 5J0WA 3Q2AC 4KV2A 2OZ8A 3NGDA 1YZ7A 4DQIA 8ICGA 4JQWC 4YTPB 3UCCA 3GIIA 1J2MA 4J9KA 1SGGA 5L1IA 5CJ7A 3TAQA 1ET6A 1D9DA 3THVA 3C5GA 2RDGA 3X23A 4MELA 4NLBA 2W9BA 3WIMA 1LM8B 2QVHA 2P66A 4ZOHC 4TVYA 8ICIA 4F1SA 4QZHA 3PX0A 2LMRA 3ZDEA 2VA3A 3BVZA 2W43A 2QSDA 3PSEB 2ZVOA 1R4NB 1IG6A 3N7PD 3FILB 2PGWA 8ICEA 1V8CA 2DFLA 2OEHA 2IA6A 2FJ6A 4C4VA 1SV0A 2FPKA 3DHIC 4J9QA 1LQBA 3KW5B 4NJ8A 4R8UB 3HK0A 3WALA 2WTFA 2G07A 3S1FA 1I4RA 3Q8BA 4ZH4A 2Z0DB 1QQ7A 4QW8A 3EC8A 2WPFA 3DCGA 4REZA 2JVCA 2LI5A 2PLSA 3PW0A 2W9NA 2GR0A 1KFDA 1Z5SB 1D8YA 2WXHA 1WWUA 4M0WA 3GE8C 3R7RA 5HMRA 1FEBA 2MNRA 2EELA 3PTFC 3ZDTA 3GQCA 3L17A 4IOIE 3AEBB 5AZGA 3DG7A 4KLTA 4W9IA 4AUQC 2PXIA 1EF1A 3PVLA 1CQVA 4EQSA 1RXWA 3FYYA 4W9KA 1NEKB 2ZIXB 3CXOA 3BVMA 1CZPA 2PMZF 3R3MA 4HCHA 2NO5A 2CXYA 2Y3AA 2F3NA 1V9PA 3MC9A 4FI4A 4G3IA 2BS4B 2QHOA 5CHFA 4RF0A 3RNFC 4HK2A 3UXOA 5DG8A 3AU4A 5LLIA 2Y08A 4GIBA 2GLSA 4MGGA 4ELUA 2LBOA 1P98A 3VDGA 2XH7A 4LJXA 3Q8SB 3GIJA 2EQYA 4RQNA 4IR9A 3K4GA 1I7HA 2MP2B 2BWFA 4MGIE 1J97A 2R8GA 8ICFA 2KWVB 1C77A 3SAGA 2YVCA 3A4SC 3VTWA 2BQQA 2VFVA 4GGQA 4PT5A 3IXSA 1FXIA 4EE2A 1GXFA 2A19A 2VA8A 2KVCA 3NVYA 1PVPA 2R8KA 3KFUF 1UBQA 3EJDB 1UT8A 1KL9A 5KFXA 2F1IA 2OJWA 4KKIA 3GZNB 2RDHA 4F72A 4CYEA 1EC9A 4R64A 3IG3A 3UIPB 3EKGA 4UASA 2H3VA 3I6EA 3PZ8A 1YQZA 4KZCA 2ZZBA 3FM9A 3QYPA 5DB6A 4A3OA 3M95A 1WWVA 1K50A 2ZPNA 1FM0D 3RRHA 4FJVB 3UM9A 2KJHB 2JMGA 1BPXA 3CGBA 4IQTA 2ACZB 4P7IA 2D3DA 3NASA 5L1LA 2OWOA 3H0RB 4WJOA 3QA8A 3WANA 4A35A 2JXJA 4PPXA 3L3FX 2M8SA 4TV3A 3Q45A 2LKYA 3ENLA 3RZFA 1ZR6A 2DL0A 4JWMA 2PS2A 4B9TA 2ZTDA 2K39A 5AKLA 2IHNA 4Y2VA 4RQ3A 4QZBA 2XGPA 1V97A 3JVAA 4HNCA 1WMHA 3AM9A 3NS8A 1D6EC 2IPKD 3QTPA 1N5WC 1BUIC 3KHHA 4EWJA 2F2AB 4FZMA 1T4GA 3TWAA 5JRTA 2HE7A 3QHTA 2GH1A 4PS7A 2QQ6A 5D3IB 2WXKA 3RNEC 5ALGA 5ALZA 1I4XA 1MBBA 3HPFA 1C4CA 2Q5WD 3B97A 1OXJA 3S5SA 2AQ3B 1GC7A 3ES8A 2N1WA 1DTNA 3SJNA 2YQUA 1ZQXA 3HT3A 4A20A 3KJMA 1FCCC 1TKYA 5J0UA 1X6JA 2KJ8A 5L95C 3UMGA 3SR6B 1P0RA 2BC0A 2ZVNA 1SWWA 4EM4A 5KT7A 1L7OA 1AROP 4DOCA 5HHDG 3E2EA 1UPHA 2K9XA 3DIPA 3SN4A 3HVZA 3QU2A 5ALFA 3H8HA 2HZGA 3BZDB 4B9SA 2HDOA 3UXNA 3WKBA 4EBDA 2GRTA 1ZQIA 2IBIB 4DQPA 4IW0A 3AE6B 4IWQA 1NBFC 3LK9A 2IGDA 4A9AA 2N7EA 4EENA 3GV5B 4TUUA 1V1OA 5AUIA 4RT2A 4KLQA 3PRPB 2IO0B 5G5HA 2VA2A 3L5OA 1X1MA 2XEWA 1JEHA 4N59A 2QGYA 4FFDA 9ICKA 2JF5A 1WXAA 4DDID 1ACCA 3M6ZA 3BSMA 5KFZA 5KG3A 3QQ8B 1KKOA 1YZ6A 4AP9A 2K1FA 3O13A 1ZY8A 2B21A 4C80A 7ICIA 5CEHA 1FRRA 1ZQNA 4NWIA 4A8EA 1S1QB 2VFRA 3D2DA 3V7LA 4FX9A 4PHEA 3QPEA 3MUCA 1L8LA 2QB0A 2DYOA 2HI0A 2KK0A 4PHAA 4I2IA 2LJIA 1ZX9A 5HI1A 3R7QA 2AAQA 3Q8EA 1T3QC 2Y9UA 2FNJB 1NK0A 2MBBB 4DNSA 4XRHA 2ZJDA 1J0GA 2MUTA 3H8WA 5CWRA 4DOBA 3C28A 1MPEA 3FXGA 2WOIA 5GTHU 2YVJA 3FC4A 2G9HD 3ICXA 3N28A 2AL3A 5E6JA 4HYRA 4MFAA 8ICTA 1TS2A 3SEBA 5BOEA 1T6BX 1SKWA 1EWCA 1L3TA 3N1XC 4M9JA 3CYJA 1E9MA 2AGQA 2C7HA 4J3ZA 2D2QA 4HPNA 3VFKA 1TYPA 3JPPA 1FHVA 4FE3A 1KW4A 2ONQA 4M01A 1GRHA 3PK7A 3M8SA 4Y2UA 4M00A 2UVRA 4DS5A 3UMBA 4IRKA 2XGZA 4P0QB 1ET9A 3OWEB 3SSZA 2EZZA 2MBHA 2B6GA 1TJEA 2E5AA 1A0PA 3ZRCA 3ALBA 3FDSA 3NVYB 3QXGA 3QUCA 2WFAA 3D6JA 3KZIU 1R4NI 1ZQDA 5ALNA 3ZVHB 3C29A 1OGWA 3WK5A 1YN5A 2H3IA 1L8PA 3HIZA 2KVRA 4RGOS 4JE3B 1ZQ1C 4Y2RA 3I63C 2JRZA 7ICUA 2X50A 2HJ1A 2WHIA 4ANUA 2PODA 5AE1A 2WPEA 2H3QA 5HHHA 1MG8A 4FS1A 2J52A 4OZCA 2E3TA 5F3XB 1L3VA 7ICOA 2NBWB 1KLUD 2BGFA 2R2QA 5AZHA 3HP6A 3V6KA 3NVWA 7ICMA 2XH2A 2KANA 3APDA 7ICQA 1L0YB 3JW7A 3NO1A 3FWAA 1H2IA 2DZKA 1JALA 5DPTA 1WRIA 3AEGB 4FA6A 2NRXA 2VZKB 3KLSX 3LJ3A 5A0LA 1Y56A 4KWSA 4RQ8A 1ZE3D 3W8XA 3RH6A 3VA8A 4QIWF 4B9UA 3OTRA 7ICHA 4OJ5A 1XT9B 2C2EA 2ALZA 2LVPA 3SFDB 1SE4A 3BWUD 2VKQA 2NVUI 5KFKA 4KT2A 2KFKB 3UI3A 3EANA 4MHVA 1TY2A 1WGGA 4BX9C 3RR7A 1W6TA 2NO4A 5KFBA 1RVKA 5EWGA 2PU1A 5TR3A 1WXMA 2BWES 2GGHA 1NKEA 4DSJA 9ICCA 4XZ4A 1ZQJA 3TKAA 1AYFA 2MEKA 2MQJA 1DZNA 2JZBB 2W04A 3C2LA 1HUZA 3RO6A 3NRWA 2ASDA 2JV3A 2GRIA 4X2PA 1FIQA 1AHUA 3AL0B 2AKMA 2GGEA 3ZNHB 1U4BA 3MJWA 1I19A 5FJPA 2KMMA 4JL9A 2IO3B 1DNCA 2ZUBA 1JMSA 5IILA 4FJZA 1HXYD 4G7FA 2M0AA 1MNSA 4YR3A 4RPZA 1S0VA 4R65A 4L1BA 2HQMA 3NVZA 4WJ3B 3W5UB 2WYQA 4A3RA 2GR1A 3JPSA 1RXVA 2BVGA 2UU7A 3H8SA 4PVJA 3WAMA 1ZRNA 4KLHA 4EEWA 1RFAA 9ICSA 3NRZA 3OG5A 3IG8A 3MBYA 1W1SA 2UUVA 4GFIA 3ISCA 2DYMA 4CF4A 2G4SA 5IO9A 1NJXA 8ICVA 2MW5A 4IQUA 3DHGC 4GDKA 4KLEA 3R11A 2IGGA 9ICHA 1W1KA 1PVQA 7ICPA 5L6GA 5H92C 1RLFA 4KLFA 1GRBA 2OG9A 3NVVB 4GISA 1ISNA 5AK5A 2LD9A 2KK8A 4ECSA 4EZ6A 2NQWA 2RQ5A 2AGOA 1QF6A 3NZUA 4BV6A 2AKZA 4YR0A 2RRDA 1A77A 2WP5A 4KPRA 4RUCA 2N9EB 4BUGA 2ICIA 3AB5A 4IP5A 3VCNA 1V1PB 1SJDA 4F4KA 2OH2A 3PX6A 2H3ZA 2ZIVB 3TTEA 1QLUA 2R8DA 3RJFA 3C0PA 5IIMA 2RGFA 3UQBA 5J2FA 5H2FU 2O6VB 4JK1A 3QZ7A 1SZHA 3F2DA 4H2AA 5BMGA 2V6OA 1ECWA 3KHRA 2N4FA 3HILA 4GDLB 4GXIA 1Q0WB 1T3QA 2KTRA 3PS6A 3HRDD 2WF9A 4PVHA 3LXDA 1WXQA 4RQ2A 2ZCBA 3DESA 1KH0A 1SJED 1PVRA 2W9CA 1CMXB 4XDDA 4P0PB 3TFRA 1IPGA 2KLGA 2BGWA 3Q14C 1JDFA 2KN5A 3RF9A 2MUCA 1Q1WA 2LRUA 2BKFA 2K22A 2GL5A 3FJ4A 3A4RA 3V5CA 4FHJA 3VXWA 1ENFA 3N1ZC 4C7YA 2KP7A 2KD1A 2I1JA 2L05A 3F2CA 2CDUA 3V6JA 2K8CB 3ORYA 4PHDA 4IUMB 1SE3A 2VH2A 4N6EB 4GXKA 2LUEA 3RCZA 4YCXA 1SWVA 4DFJA 4OCZA 2ASJA 1COOA 1KFYB 4H4SA 5DPRA 4DSFA 1DRGA 2XN9C 8ICKA 2HVIA 4WQOB 5KG6A 1TKKA 5I1WA 1N62A 2WX1A 1P43A 2GBJA 3PMNA 3RB6A 4M9GA 3VUWA 5KTQA 3BY4B 3RMKC 3OPSA 4C8MA 2WF5A 1XCTL 1XF5L 3L54A 1X2IA 3MGHA 4PZFA 4U6PA 3JPNA 2BYTA 2CS4A 5JXVA 2AXRA 4F2SA 3PO0A 4C8LA 3F53A 4FDCB 4IWPA 4GDLA 3ZVVA 1N56A 2BS2B 5L9XA 1IGDA 2R8HA 1RAXA 3DBLI 3MP9A 4QAYA 3BQTA 3N7SC 5KT2A 3LYSA 1NNLA 1AOGA 1TE2A 5AKZA 1P7FA 4O3SA 1IYFA 9ICIA 4JB1A 5AICA 4Y2XA 2PP1A 4OW0A 4NEWA 5ALPA 2YY6A 5KL1B 1JW9D 2GR2A 1BPEA 3QIJA 2WDQB 2ZEQA 3EW9A 4J9NA 1L7NA 1W1QA 3WAOA 2Y3SA 5F9NA 2IHMA 3PRMB 3DG3A 3SI8A 2M19A 4J6IA 5JCNA 4M52A 3ZGZA 2FIDA 3RYTA 2NMQA 1HTQA 3N4FA 4C8NA 3WKAA 4GB9A 2KHWB 4HRSA 2PTZA 1H8CA 2LGXA 5KFNA 2AXTU 2N1RA 3KD3A 4JUZA 1T0SC 3PZPA 5KG4A 2O6KA 1KM7A 3OJUA 2MRPA 1ZQCA 4M9NA 3TACB 4RNMA 3ZJUA 1GREA 2HCFA 4YQWA 3CNHA 4UBBA 2VJ5A 2L52A 2FCMA 1BNPA 1RYSA 1MBTA 4KGSA 2BQRA 4F2RA 3QEAZ 4RCOA 4W9HA 4B6WA 1YD8U 1TY0A 5EOZA 2HSZA 1O08A 4HYKA 4NXZA 3GE3C 2JUOA 1DGJA 1N63C 4CHKA 1DOYA 5JCIA 1KRPA 4M0XA 2BYEA 4USAA 4LVSA 1ELSA 4GGBA 1Z19A 4C4TA 4DWIA 4BKSD 4EX6A 3NG0A 3ZDDA 2MCNB 4DBGA 3PX4A 4J3OD 4H4YA 2RPQA 1ZXIC 4F4ZA 3PM9A 1RWSA 3RNGC 4NM2A 2DENB 2YQEA 4KVGB 5G5GB 1FHUA 4GXBA 1N5WA 8ICQA 2L00B 1GAQB 4ED6A 1RYJA 3ONNA 5IN7A 1PGBA 3OJ3A 2QLTA 4JB3A 1F3PA 4WWNA 3DV9A 3L4PA 5J2HA 3W1SA 4E6MA 1NI2A 2GBMA 3KUCB 3ES7A 4JX1C 3ETRA 3VVWB 4YD1A 4GLSC 4XE0A 5FXFA 8ICUA 4KIKA 1TZOA 5AKXA 3DBRI 3S2AA 1V5TA 3I9V1 5CR0A 3UIOB 4B9KA 3I3TB 1X6IA 5BOMA 8ICWA 3GC2A 5KG5A 3OP2A 3Q3OC 1E7UA 2C28A 2GQUA 4OO1J 1PGXA 4DLGA 3IHQB 4RQ1A 2Y4GA 3VTEA 2YTUA 5DKWA 4PGQA 2DX5B 2JH7A 2W8KA 2J6UA 3P1MA 1ZMCA 3PWIA 1E7VA 2NRVA 2KHVA 3FKYA 2QB0B 3PG6A 4GN1A 3GO2A 2V4RA 5D79A 2AGPA 4NLGA 1FEAA 4RM8A 1V59A 1JMLA 2W82A 4YD2A 5KL8B 9ICUA 2GOWA 2X38A 4PGXA 2PEAA 3SEIA 1CJEA 4PL2A 1YQBA 1GV4A 4L23A 3CRXA 4QIWC 1TS5A 2KFZA 1OQQA 2V9HA 1XU4A 4G50A 1WZ3A 4RMAA 3V6CB 2PTXA 4Z6CA 3RB4A 2PI4A 2BBCA 3A33B 5FR3A 2OZTA 1QLTA 1ZYQA 4YR2A 3IN5A 2K0PA 2PMQA 3TEZA 4FN2A 2J3NA 1T0RC 2LXAA 1VJ5A 3W5VB 1QOBA 2XO7A 4BJQA 3EFUA 1YT3A 4TQ1A 1BQGA 5KFFA 4OVVA 4ASWC 2R8JA 4K4HA 3UQ2A 2R9ZA 3MZNA 1V1PA 3Q3FA 1JQ4A 3MHSD 3QU5A 1ESFA 1P9DU 2HD5B 3GV8B 4O3MA 3U4FA 5AKYA 4HNLA 5JHAA 2XY5A 5FJRA 5FXPA 1HEZE 4W9JA 1TVAA 3M9OB 4K4IA 3F2BA 2XY7A 3BQ2A 2Y1IA 2DZMA 2EANA 2JQRB 4LJPB 1MDRA 2J4XA 3CYMA 1SZPA 5J2KA 4HAIA 2BKRB 2Y5CA 3PFRA 3FYHA 5AM1A 1ZDXA 5AI4A 4DQSA 2PVGC 5FR6A 1WCNA 2B0CA 4HG0A 3CXBA 2LEKA 2WDTB 1XS9D 1N60A 4ITKA 1X9WA 2WF6A 3P42A 2KNJA 3L0WB 3EF6A 1L7PA 2XCAA 1TBEA 1S8OA 2CN1A 2OFJA 2K8CA 1EBHA 3NTUA 3Q8CA 3PWGA 2KQ7A 4OHJA 5K8EA 2PKOA 2GGGA 3U7ZA 1J7BA 4YVZA 4OJLA 2M1MA 2HMXA 3POPA 2WXGA 4XUSA 4DFMA 4QZGA 1RFKA 4K1WA 3ZVIA 2INCC 3PREA 3T3NA 2C22A 4NM1A 2WXPA 2P0IA 4NV0A 1MI0A 2L83A 3VHTC 5KG7A 1JN3A 2VRRB 1I4GA 2IZVB 2Y5PA 1WJUA 4JN7A 3Q8PB 1TK8A 3RJKA 3S1DA 1WGRA 4IKGA 3D2NA 5DQGA 1XNSA 5J2CA 4DSLA 4G3XB 1NU5A 4HVBA 2PMZC 3KBBA 3PLUA 3WK8A 3DBLB 4EFOA 3R8BA 5ALTA 2ZIUA 1U48A 4IM3A 3RGTA 1F0XA 1WGDA 2MJEA 5FXEA 4ECWA 3DBHB 4RPYA 4OVUA 3PSIA 2YVFA 2F8LA 3IHPC 4EMIA 1F44A 4GYPC 2BC1A 2DF4B 3RR1A 2FMSA 2RDXA 1WG8A 4I6NB 1L7MA 3O65B 2LGYA 3MKCA 3ZTCA 1IBXB 4BAXA 1K8RB 4O95A 5D2MB 4ZYNA 4W9CA 4G9BA 4UAWA 1MRAA 5IAAC 1BPZA 2KACA 4KLOA 3JZUA 3ZDMC 2JY6A 4YWSA 1K5OA 1X9MA 1I35A 3JYUA 1WJNA 2W8LA 3WAPA 1NELA 1A70A 1C4AA 2BHNA 4MFFA 1L3SA 1HA5A 1CUKA 2JYTA 4RNOA 1LXDA 1ZRMA 4IL6U 3HX0A 2AJQA 8ICZA 1SGHA 5EDSA 1TK0A 4IS7A 1ZQWA 3PT2B 5KG0A 1TT5B 1IYXA 2KFNA 4KX5A 4I27A 5EE0A 1EU4A 2QC8A 2JZPA 2I5QA 2XCPA 2GGIA 4BBNF 3NVZB 4MH8A 1F9JA 4GC6A 1V49A 1JRUA 5C0YA 3QC8B 2HTME 4HCDA 2QPMA 5BYQA 2B3AA 1MQ3A 4GYPA 3UGVA 3SD5A 2BVFA 4W9LA 1NI3A 3NY5A 1PGAA 2D11A 2FAZA 2HTHA 2DHZA 1UA1A 4E0DA 5AI5A 2N0SB 1R4MI 3V6HA 3P2BA 4MJSA 4BFRA 3T8QA 1SEBD 4BKSA 5KFCA 2YMLA 4BGDA 2HOFA 4UB4A 3ML9A 1AQ6A 1XDIA 3ZLHA 1Q10A 2FKPA 2HBJA 5CHGA 3H6NA 1FECA 2JZBA 1MUCA 2KWDA 1RM6B 3TANA 1J19A 4MEMA 4QZIA 4CGZA 4JHMA 2OHFA 4M8NA 4E4FA 1S7MA 3PV8A 1SJHD 1Y8RC 2EH9A 1SL1A 3LAEA 2VFTA 1I4PA 3MR5A 3TADC 4F5PA 8ICPA 2LUMA 2Y5BB 4EEYA 4FP1A 4AOFA 2ISPA 3WK9A 5AE3A 1X42A 2B76B 3DBRB 4DXKA 3B0XA
chains in the Genus database with same CATH topology
1FCLA 3TSHA 1MPEA 3ABVB 4MT5A 3AE5B 3AECB 1SIJA 4O1NA 3FC4A 2G9HD 5E6JA 2DBYA 1VJKA 3SEBA 1R7SA 1TS2A 3MHZA 2AX5A 3VRBB 1W1OA 1T6BX 1EWCA 5G5GA 1E9MA 4JPSA 1W1JA 2KAJA 3Q8FA 3NVVA 2ONQA 4PVKA 1RM6C 4RH6A 4YSZB 2WP9B 1ET9A 3OWEB 3TEYA 2E5AA 1TJEA 1FNVA 1VAOA 1TYGB 3NVYB 1ZP0B 4P6VF 1NYQA 2P13A 1QT9A 1YN5A 1WVEA 5HG2A 3IAM1 4JE3B 4RGOS 2ZW1A 1XLQA 2MJ3A 1KF6B 3BYTB 1DIIA 2WXNA 4US8A 5EE3A 5D7GA 3NRZB 4EC3A 5AE1A 3LYYA 3DEDA 4C56C 3EGRA 5FXDA 3D2JA 2J52A 5MPOA 4NAWB 4OZCA 1E8HA 1L5PA 2E3TA 1BMLC 4ZYSA 1E10A 1KLUD 2WQYB 3EUB3 3AEFB 3S1EA 1X2GA 3HSUA 1FIQB 3NVWA 4YSXB 2NTTA 2KN4A 1SB3C 1L0YB 1NYRA 1C78A 1OFFA 3FWAA 4RGTA 1JALA 1WGKA 3P4PB 4TQ0A 1WRIA 3AEGB 3A7UA 3KLSX 2VZKB 3AEDB 1HQRD 1XXGA 1QLBB 1E8GA 1J7CA 1Y56A 2JXTA 1UUPA 2EXRA 3W8XA 1ZE3D 4RFBA 3SR6A 1SSNA 3GP7A 4ARIA 3JS8A 4R3DA 5L6FA 1L0VB 2PLIA 3SFDB 1EWYC 1SE4A 3BK2A 3BWUD 3EA6A 4IDIA 4D2KA 3UI3A 1TY2A 1OQRA 1F2RC 2VAOA 2UUUA 1I4QA 3ZJVA 1AYFA 2MEKA 1DZNA 1FFVA 1UWXA 1VQZA 1SXTA 2GRIA 3W2DA 2AQ2B 1C4PA 1FIQA 3RJ8A 1AHUA 1WVFA 1QQRA 3PQBA 3V3XA 1UNSA 3FW9A 3FAHA 1I19A 2MBRA 2KMMA 2Y3RA 4KGRA 3NS1A 1VZ7A 2BB5A 1L6UA 4OZAA 2W3SA 1HXYD 1UGJA 1KLGD 2M0AA 1ZXHA 4L1BA 1KRHA 3NVZA 3TUOA 3W5UB 3HUIA 3MC0B 4HKZE 4B0MA 2BVGA 4PVJA 3I99A 2K3UA 3URYA 1E6EB 3NRZA 4YSYB 2UUVA 1ROEA 1W1SA 4YTNB 4WIPA 2MH7A 2DYMA 1JCKB 2PW9A 1EM7A 1QKZA 5BMIA 1DOXA 2VFSA 2SEBD 4NZLB 2IGGA 3AE3B 3C8YA 1W1KA 5L6GA 2W54A 3B9JA 3TSSA 3GSYA 5H92C 1HZ6A 3NUHB 3NVVB 1TKEA 2WS3B 2LMCA 1GB4A 1K52A 1M4VA 3U52E 1QF6A 1FFUC 5I4DA 2NQWA 4GDKB 2IDYA 1ZDVA 2WXOA 4L2YA 3KQ4A 2V3NA 1EU3A 4LTUA 2RK5A 2AQ1B 2QILA 2WDVB 3LLBA 2ICIA 3AB5A 1JWMD 4LLGM 5LNK1 1E0YA 5BYRA 3P63A 1B9RA 2WDWA 1V1PB 4MLAA 5I1VA 4XLOA 2L32A 2WXQA 1N62C 4PWBA 1L0XB 1QLUA 2R8DA 2YVSA 2N9LA 2GB1A 1SBBB 3D2HA 3C0PA 3ETRB 3V05A 2MJDA 4UDUC 5AUKA 2QMTA 1D5MC 5BMGA 4H2AA 1NENB 4GDLB 1FFUA 2BW2A 1T3QA 2WXRA 3IT4B 3HRDD 1L4DB 4PVHA 2FE8A 5FK9C 2Q85A 1WXQA 3R07C 1IBXA 1MHXA 1KH0A 1YQ4B 2PLPA 1SJED 2VFUA 2KDMA 4XDDA 3AE8B 2RPVA 4DXGA 3P4RB 3TSJA 3MFGA 4YWGG 2K22A 3B9JB 4PWCA 1ENFA 4C7YA 2I0KA 3KWVA 2WXJA 1QOGA 2EKIA 1SB3B 4N6EB 1SE3A 4JWSC 2I2YA 5EE1A 5FKAC 1HSKA 1QILA 5H8YE 2WLBA 5C2TB 1KFYB 1E7PB 2JU6X 4HKQA 2LHEA 2XN9C 1VDVA 1L6VA 5I1WA 1PDXA 2DLBA 1UXYA 1N62A 2WXMA 4XWTA 1L4ZB 1GOZA 1E0ZA 1XCTL 1XF5L 4PZFA 1FXAA 2IGHA 3PZ7A 4HROA 5JXVA 4AQ7A 2BYTA 4RF1A 3PO0A 2AXRA 4BCAA 2FUG1 1F77A 1YMHE 2J42A 3U2SC 1X2HA 2BS2B 2QEJC 1IGDA 3IT6B 1I4HA 5GXGB 4OZBA 3TEWA 1XCQL 5G5HB 3MP9A 3AE4B 1IGCA 3VR9B 4C7ZA 2QJLA 4NJCA 4YT0B 2G1EA 1WWTA 2R61A 1P7FA 3BYYB 3AE7B 4JB1A 3ZQ4A 5HHZA 4OW0A 4WURA 4XWWA 3U4EG 1JW9D 2WXIA 1E8FA 2P4PA 1K53A 4YXDB 4BBYA 2O3GA 2JSVX 2WDQB 2BB6A 3TX1A 5AE2A 3AE1B 1W1QA 1PFDA 4Q2JA 2WXFA 2Y3SA 3S1CA 2M19A 5EE9A 3HRDC 3ZGZA 2NMQA 2K5PA 1YN3A 2YEPB 4HRSA 1AHVA 4WWMA 4BC9A 1ZPSA 3IAS1 1C79A 4ZRQA 2VZKD 3ZJUA 4RGNA 1STEA 4CQNA 2BVHA 1HZ5A 2WNMA 3AEEB 3P4QB 2L52A 4JAYA 1MBTA 4YTMB 4KGSA 2R2ZA 4RCOA 1D5ZC 1SF0A 2ON8A 5BYSA 1TY0A 1BXTA 2BTEA 1T5XD 4KKJA 2PIAA 4TSSA 1YQ3B 4A90A 1DGJA 1N63C 3AE9B 1DOYA 2RMMA 4USAA 1LO5D 2LGIA 2W3RA 5AWVA 1XEEA 4HJGE 4WAFA 5TSSA 4PYTA 4US9A 1C76A 4J3OD 1N60C 1SE2A 1ZXIC 3PM9A 1RWSA 1DOIA 3FILA 1D5XC 1VZ6A 4KGTA 2V0GA 5G5GB 2PTLA 1N5WA 3AMZA 4A55A 4MM3B 1GAQB 1RYJA 2N9KA 3W8ZA 3J9CA 1PGBA 1FRDA 3HVDA 3L4PA 2BS3B 3RPFC 3W1SA 1PUTA 2CU3A 1JRPA 4JX1C 3ETRA 1FFVC 2GQTA 2IJ0A 1N63A 3AH7A 1YN4A 4GLSC 5ADZA 4XE0A 5FXFA 1TZOA 3CWIA 3E56A 2PMVA 3I9V1 3AE2B 2Q4WA 3NZ3A 1AW7A 4KX6B 2JWUA 1FO4A 3DWMA 3FW7A 1IUEA 2JYEA 1QOAA 2GQUA 4PVEA 3Q8AA 1PGXA 4XDCA 3AEAB 2Y4GA 2QKNA 4YTPB 3VTEA 1FNUA 1NVID 3P1MA 1YNTE 1XLOA 1XLPA 1ET6A 2RDGA 1DIQA 1N5XA 2M56B 2WU5B 5D79A 3VQIA 1GPXA 1YJIA 3NVWB 1JMLA 2W82A 4TVYA 4ZOHC 3ZJTA 1D4BA 2X38A 1C9FA 3BVZA 1CJEA 2QSDA 4ZHOA 4L23A 3RJAA 3FILB 1F0ZA 1V8CA 4DQOC 1TS5A 1OQQA 2BBCA 1JROA 5FR3A 2SAKA 2WXLA 1QLTA 3SFEB 1JWBD 2K0PA 4LK0M 3S1FA 3TEZA 1I4RA 3Q8BA 1UWMA 1JWSD 1N61A 2ZW0A 3KWLA 4REZA 1QOBA 3W5VB 3MJ5A 5T8IA 5HQXA 2PLSA 1FNWA 4TQ1A 2WXHA 1AHZA 2H88B 1V1PA 4M0WA 1JQ4A 5HMRA 1MVKA 2EELA 1ESFA 4IOIE 3AEBB 3LB8C 2DWQA 5FXPA 1HEZE 1CQVA 2JQRB 2PVOD 2TSSA 4FXCA 1NEKB 4HEA1 3BVMA 1CZPA 2J4XA 1AN8A 2QIEB 2N7JA 2Y3AA 1FD6A 2Y5CA 3N9YC 4UD8A 1ZDXA 2PVGC 2Z8LA 2BS4B 3ZYYX 2L1AA 1XO3A 4HG0A 4RF0A 2WDRB 1JWUD 1N61C 3LXFA 4TVWA 2Y08A 3AV8A 2LEKA 3E9SA 1N60A 4ITKA 1I7HA 5BMHA 3P42A 1ZUD2 3I57A 1AWDA 1C77A 2D5GA 1FEHA 2VFVA 4B0EA 3A7AA 4PT5A 3IXSA 3W9CB 1FXIA 4EE2A 1JWAD 3NVYA 3Q8CA 4OHJA 2E6XA 5K8EA 2PKOA 3U7ZA 1J7BA 4KKIA 2RDHA 4ML8A 3POPA 2WXGA 1RFKA 2INNE 3WCQA 3T3NA 2WXPA 1W1LA 2BT6A 3PZ8A 1FMAD 2H89B 1MI0A 2L83A 2LFIA 3T3OA 1YJJA 1I4GA 1B1ZA 1K50A 3Q69A 2Y5PA 1FM0D 3RFZB 2JX5A 5D3DA 3S1DA 2KQ4X 4IKGA 2I38A 3BK1A 2ACZB 4ZOHB 3BW7A 3R8BA 4WH4A 1J7AA 1TS4A 4TMAB 1F0XA 2MJEA 5FXEA 1VLBA 1ZR6A 2XNAC 1DYQA 2J53A 2YEPF 4P16A 1V97A 2W55A 3AM9A 4OVZA 1D6EC 2IPKD 2WU2B 1BUIC 1VRAB 1N5WC 3NS1B 2FBWB 3TEXA 1IBXB 2P3HA 3DWGC 4JWUC 2GI9A 3P4SB 1W1MA 4O95A 1ZXIA 5D3IB 2KACA 2WXKA 1I4XA 1MBBA 3A7RA 2OAIA 1C4CA 3FW8A 2Q5WD 1K51A 2AQ3B 1A70A 1GB1A 1C4AA 1HA5A 3R2TA 2JYTA 1KTKA 4DXFA 5C3JB 4MACA 2CJOA 3KJMA 1FCCC 1TKYA 3SR6B 4RNAA 5EE0A 1EU4A 3B2FA 2JZPA 3R2IA 1QOFA 5HHDG 3B2GA 2K9XA 4BC7A 3EUB2 3DQ0A 3BVGA 3HVZA 2V4IB 4MH8A 3NVZB 2INPE 3H8HA 4N58A 4ZRPA 3BZDB 1PYWD 3AN1A 1ZOYB 2OEDA 3CIRB 3BIID 2HTME 1XLNA 2QPMA 3AE6B 1VZ8A 5BYQA 2NTSA 2IGDA 4A9AA 2BVFA 1F2RI 1V1OA 1NI3A 5AUIA 1TKGA 4A8XC 5HFYA 1W1RA 1MHHE 1PGAA 5G5HA 4AS1A 1P7EA 1TS3A 2N0SB 4N59A 1SEBD 4RGMA 1ACCA 4A6QA 1WYGA 1Q10A 1CK1A 3O13A 1RM6B 4C80A 2KWDA 1FRRA 3GS2A 3D2DA 2VFRA 2V3PA 2HDEA 2OHFA 3VRAB 4OALA 1SJHD 3LAEA 4ARCA 2DYOA 2VFTA 3GB1A 1I4PA 2LJIA 2CJNA 1WSPA 5HI1A 4ZHPA 3Q8EA 3W8WA 1VR9A 2LUMA 1T3QC 2IPIA 4DNSA 2LHDA 4NAMA 5AE3A 2B76B 3VR8B 4WQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSH A;  3ABV B;  3AE5 B;  3AEC B;  1SIJ A;  3FC4 A;  2DBY A;  1VJK A;  1R7S A;  2AX5 A;  3VRB B;  1W1O A;  5G5G A;  1E9M A;  1W1J A;  2KAJ A;  3NVV A;  4PVK A;  1RM6 C;  4YSZ B;  2WP9 B;  2E5A A;  1TJE A;  1VAO A;  1TYG B;  3NVY B;  1ZP0 B;  4P6V F;  1NYQ A;  2P13 A;  1QT9 A;  1WVE A;  1XLQ A;  2MJ3 A;  1KF6 B;  1DII A;  5EE3 A;  4US8 A;  3NRZ B;  4EC3 A;  5AE1 A;  3DED A;  5FXD A;  3D2J A;  5MPO A;  1E8H A;  1L5P A;  2E3T A;  1E10 A;  2WQY B;  3EUB 3;  3S1E A;  3AEF B;  1X2G A;  1FIQ B;  3NVW A;  4YSX B;  1SB3 C;  1NYR A;  1OFF A;  3FWA A;  1JAL A;  1WGK A;  3P4P B;  3A7U A;  1WRI A;  3AEG B;  3AED B;  1QLB B;  1E8G A;  1J7C A;  2EXR A;  3W8X A;  3SR6 A;  3JS8 A;  1L0V B;  2PLI A;  3SFD B;  1EWY C;  4IDI A;  1OQR A;  2VAO A;  1AYF A;  1DZN A;  1FFV A;  1VQZ A;  1FIQ A;  1AHU A;  1WVF A;  3FW9 A;  3FAH A;  1I19 A;  2MBR A;  2KMM A;  3NS1 A;  1L6U A;  2W3S A;  1KRH A;  3NVZ A;  3W5U B;  3HUI A;  2BVG A;  4PVJ A;  3I99 A;  1E6E B;  3NRZ A;  4YSY B;  1ROE A;  1W1S A;  4YTN B;  2MH7 A;  1DOX A;  2VFS A;  3AE3 B;  1W1K A;  2W54 A;  3B9J A;  3GSY A;  5H92 C;  3NVV B;  1TKE A;  2WS3 B;  2NQW A;  1FFU C;  1QF6 A;  4LTU A;  2RK5 A;  3LLB A;  2WDV B;  3AB5 A;  1E0Y A;  3P63 A;  1B9R A;  4MLA A;  4XLO A;  1N62 C;  4PWB A;  1QLU A;  2R8D A;  2YVS A;  3D2H A;  3C0P A;  3ETR B;  2MJD A;  5AUK A;  1NEN B;  1FFU A;  1T3Q A;  3HRD D;  4PVH A;  2Q85 A;  1WXQ A;  3R07 C;  1YQ4 B;  2VFU A;  3AE8 B;  3P4R B;  3TSJ A;  2K22 A;  3B9J B;  4PWC A;  2I0K A;  4C7Y A;  1QOG A;  2EKI A;  1SB3 B;  4N6E B;  4JWS C;  5EE1 A;  1HSK A;  5H8Y E;  2WLB A;  5C2T B;  1KFY B;  1E7P B;  1VDV A;  1L6V A;  1PDX A;  1UXY A;  1N62 A;  1E0Z A;  4PZF A;  1FXA A;  4HRO A;  2AXR A;  3PO0 A;  4BCA A;  1X2H A;  2BS2 B;  5GXG B;  5G5H B;  3AE4 B;  3VR9 B;  4C7Z A;  2QJL A;  4YT0 B;  2G1E A;  1WWT A;  3AE7 B;  4JB1 A;  5HHZ A;  1JW9 D;  1E8F A;  2P4P A;  4YXD B;  4BBY A;  2O3G A;  2WDQ B;  3TX1 A;  5AE2 A;  3AE1 B;  1W1Q A;  1PFD A;  3S1C A;  2M19 A;  5EE9 A;  3HRD C;  2K5P A;  4HRS A;  1AHV A;  4WWM A;  4BC9 A;  2BVH A;  3AEE B;  3P4Q B;  2L52 A;  4JAY A;  1MBT A;  4YTM B;  2R2Z A;  1SF0 A;  2PIA A;  1YQ3 B;  1DGJ A;  1N63 C;  3AE9 B;  1DOY A;  4USA A;  2W3R A;  4PYT A;  4US9 A;  1N60 C;  1ZXI C;  3PM9 A;  1RWS A;  1DOI A;  5G5G B;  1N5W A;  3AMZ A;  1GAQ B;  1RYJ A;  3W8Z A;  1FRD A;  3L4P A;  2BS3 B;  3RPF C;  1PUT A;  2CU3 A;  1JRP A;  4JX1 C;  3ETR A;  1FFV C;  2GQT A;  1N63 A;  3AH7 A;  5ADZ A;  5FXF A;  3CWI A;  3AE2 B;  2Q4W A;  4KX6 B;  1FO4 A;  3DWM A;  3FW7 A;  1IUE A;  1QOA A;  2GQU A;  4PVE A;  3AEA B;  2QKN A;  4YTP B;  3VTE A;  1NVI D;  3P1M A;  1XLO A;  1XLP A;  1DIQ A;  1N5X A;  2M56 B;  2WU5 B;  5D79 A;  1GPX A;  3NVW B;  1YJI A;  4TVY A;  4ZOH C;  1CJE A;  4ZHO A;  1F0Z A;  1V8C A;  1OQQ A;  1JRO A;  1QLT A;  3SFE B;  1JWB D;  3S1F A;  1UWM A;  1N61 A;  3KWL A;  3W5V B;  1QOB A;  5HQX A;  2PLS A;  1AHZ A;  2H88 B;  1JQ4 A;  5HMR A;  3AEB B;  3LB8 C;  2DWQ A;  5FXP A;  2JQR B;  2PVO D;  4FXC A;  1NEK B;  1CZP A;  2QIE B;  2Y5C A;  4UD8 A;  2PVG C;  2BS4 B;  3ZYY X;  1XO3 A;  4HG0 A;  2WDR B;  1N61 C;  3LXF A;  4TVW A;  3AV8 A;  2LEK A;  1N60 A;  4ITK A;  1I7H A;  1ZUD 2;  1AWD A;  2VFV A;  3A7A A;  3W9C B;  1FXI A;  1JWA D;  3NVY A;  2PKO A;  1J7B A;  4ML8 A;  1RFK A;  3WCQ A;  1W1L A;  2BT6 A;  1FMA D;  2H89 B;  2L83 A;  1YJJ A;  1FM0 D;  2JX5 A;  3S1D A;  2ACZ B;  4ZOH B;  3BW7 A;  1J7A A;  1F0X A;  2MJE A;  5FXE A;  1VLB A;  1ZR6 A;  1V97 A;  2W55 A;  3AM9 A;  2WU2 B;  1N5W C;  3NS1 B;  2FBW B;  2P3H A;  3DWG C;  4JWU C;  1W1M A;  3P4S B;  4O95 A;  1ZXI A;  1MBB A;  3A7R A;  2OAI A;  3FW8 A;  2Q5W D;  1A70 A;  5C3J B;  3KJM A;  2CJO A;  1TKY A;  3SR6 B;  5EE0 A;  3B2F A;  1QOF A;  3B2G A;  2K9X A;  4BC7 A;  3EUB 2;  3DQ0 A;  3HVZ A;  3NVZ B;  4N58 A;  3AN1 A;  1ZOY B;  3CIR B;  3BII D;  2HTM E;  1XLN A;  2QPM A;  3AE6 B;  4A9A A;  2BVF A;  1W1R A;  5AUI A;  1NI3 A;  1TKG A;  5G5H A;  2N0S B;  4N59 A;  1WYG A;  1RM6 B;  4C80 A;  1FRR A;  3D2D A;  2VFR A;  2OHF A;  3VRA B;  4OAL A;  3LAE A;  2VFT A;  4ZHP A;  2CJN A;  3W8W A;  1T3Q C;  4DNS A;  5AE3 A;  2B76 B;  3VR8 B;  4WQM A; 
#chains in the Genus database with same CATH topology
 1D8L A;  7ICN A;  3TSH A;  1B4F A;  3ABV B;  3WK4 A;  4MT5 A;  2KC1 A;  3AE5 B;  1SIJ A;  1VD2 A;  1WFY A;  4KIK B;  4S17 A;  4B95 A;  2Q4T A;  2ZNV C;  3ED5 A;  3GFK B;  5DBC A;  4I2B A;  1PDY A;  3VRB B;  4FJY A;  1Z1B A;  1KBU A;  2KVZ A;  5DCN A;  4DL2 A;  2O6V D;  3DDH A;  5L1J A;  2P35 A;  1F0M A;  4ED1 A;  4ECY A;  4ANW A;  3Q8F A;  3URH A;  3C5F A;  2BCP A;  4PVK A;  1RM6 C;  4RH6 A;  2CPR A;  1NHR A;  3UJR A;  2WP9 B;  5DG9 A;  5HR7 A;  3VH3 B;  2NV3 A;  4UAU A;  4ECX A;  2DAJ A;  9ICW A;  1E8Y A;  5J2A A;  2FLP A;  1L6N A;  1UZX B;  2DAF A;  4UB3 A;  1FNV A;  1N6Z A;  3DK4 A;  2AH5 A;  2QAR B;  1Z1V A;  3CGD A;  1YOV B;  1MO9 A;  4F50 A;  1NDA A;  1NYQ A;  3NXL A;  3PHW B;  2IND C;  4J9P A;  1GUA B;  4FAD A;  1XWL A;  3AU2 A;  4M47 A;  2VH1 A;  1XAN A;  5E6O A;  1SV0 C;  5AKI A;  1NK9 A;  8ICO A;  2ZW1 A;  2DW6 A;  4NNJ B;  3BYT B;  4UQG A;  3OSN A;  5EE3 A;  3GIK A;  5J0P A;  5D7G A;  2OPJ A;  2LYA A;  1WJ6 A;  5DBA A;  2PFP A;  4C56 C;  3EGR A;  4NAW B;  5AIB A;  2NR2 A;  1BML C;  4MKS A;  3V5F A;  3H4B A;  3V7K A;  8ICL A;  2WQY B;  1GEU A;  2KJ5 A;  2ZUD A;  4ED2 A;  2AL2 A;  3SQS A;  1ZDL A;  4YSX B;  4B9M A;  2K8B B;  2FMP A;  1C78 A;  2O56 A;  5AK6 A;  3H4D A;  3A7U A;  1WGK A;  2WF7 A;  2P3Z A;  4H83 A;  5JH5 C;  3AED B;  5KFU A;  2TPR A;  1HQR D;  5ER0 A;  1XXG A;  3JSV B;  1J7C A;  2JXT A;  3EFC A;  1UUP A;  1ONE A;  1Q1R A;  1ZQP A;  4KLU A;  2BZF A;  5FJU A;  4ARI A;  1NK5 A;  3RH5 A;  3DG6 A;  4M2Y A;  2E8N A;  4NJ6 A;  4ZRI A;  3JS8 A;  2R8I A;  4J9M A;  3RRA A;  2PLI A;  4R8U A;  3IJQ A;  1LV5 A;  1P3Q U;  1GC6 A;  1MSW D;  3TQ1 A;  2GQW A;  3TW9 A;  5J18 A;  5J0R A;  4TUR A;  3EEZ A;  2ZZ0 A;  1DOQ A;  4GGH A;  4K8D A;  3J81 j;  4DHG A;  1F2R C;  8ICM A;  4DHZ B;  1GRT A;  1V81 A;  2KOX A;  3DHH C;  2NYV A;  1LGR A;  1FFV A;  2V9W A;  1VQZ A;  3W2D A;  2AQ2 B;  4BDP A;  2M4N A;  2BPS A;  4ANV A;  1WVF A;  4MMW A;  2LYH A;  3N3K B;  3ZD8 A;  2Y3R A;  3EZ5 A;  2KXJ A;  4LII A;  1L6U A;  1NZP A;  2M9N A;  2W3S A;  4B6J A;  1P7D A;  2AL6 A;  2C9W B;  3AI5 A;  4DL6 A;  2FI1 A;  1KRH A;  1Y88 A;  2EZX A;  4W9D A;  3TIX A;  1ZQY A;  3MC0 B;  4B0M A;  3V3W A;  2HW3 A;  3I99 A;  2ATL A;  1UT5 A;  2K3U A;  3URY A;  3MR2 A;  2X8H A;  1WE7 A;  4II3 B;  3BZC A;  1ZQE A;  1ROE A;  2ZZP B;  9ICN A;  4YTN B;  1ZW7 A;  4YMO A;  3MDA A;  2FPL A;  4DDG D;  3T5K A;  4M9H A;  1HUO A;  1KKX A;  1IP9 A;  2W03 A;  2NVK X;  4EEK A;  4UB6 U;  3ZNZ B;  2MBO A;  8ICX A;  1MN8 A;  8ICY A;  2EAO A;  1IV8 A;  3UCD A;  4DWD A;  2RHF A;  5IP4 D;  1GES A;  1TKE A;  1JPD X;  4W9E A;  3Q8L A;  9ICG A;  1H4R A;  2C7M B;  2HHW A;  1JX4 A;  4OZA A;  3ZNI D;  1GRF A;  5I4D A;  4GDK B;  1ZDV A;  2V3N A;  3V60 A;  2OOB B;  2XID A;  4K4G A;  1EU3 A;  1TYT A;  1X9S A;  2KX0 A;  4QZ9 A;  4RQ6 A;  2AU0 A;  2QIL A;  2WDV B;  4F4X A;  1JWM D;  4LLG M;  4X5V A;  5I1V A;  3P63 A;  1B9R A;  3W1S C;  1GNU A;  2C5L C;  4DHJ D;  3Q8Q B;  2EZY A;  5JCM A;  2WXQ A;  1XC9 A;  4F91 B;  1NHS A;  3T79 A;  3RJI A;  1NZB A;  1E8Z A;  1OQY A;  2YAU A;  2YVS A;  1XS2 A;  4QZ8 A;  3C19 A;  2M0X A;  3ETR B;  9ICO A;  2MJD A;  4UDU C;  3TJ4 A;  2PE6 B;  4EKU A;  1D3Z A;  3DVG X;  1T0Q C;  4UB8 U;  3EPG A;  3EYZ A;  4I29 A;  4HJK A;  4EBE A;  3K9P B;  3L10 B;  4J56 A;  4Z17 A;  2ASQ A;  1FFU A;  2JGA A;  1TV9 A;  3KUM A;  2WXR A;  5AIA A;  3IT4 B;  1L4D B;  2WB1 C;  2FE8 A;  3MTN B;  1N48 A;  1WR1 A;  1MHX A;  3ZLF A;  4YP3 A;  4DXG A;  5BOF A;  3P4R B;  2EMT A;  1WM3 A;  3TSJ A;  4IM2 A;  4YWG G;  2ONE A;  5EU9 A;  2PI5 A;  2KFJ A;  2A4Z A;  4P4M A;  2C2D A;  3JPR A;  4QWA A;  1S77 D;  3OJS A;  2G4D B;  3U7D A;  4W9G A;  4H4V A;  1SL0 A;  1UF0 A;  2WXJ A;  1R4M B;  4JQ9 A;  4H4W A;  5KFY A;  3ZXV A;  1SB3 B;  5KFP A;  3OZY A;  2ZJ5 A;  2LYB A;  2E5S A;  2A1J A;  4JMU A;  3PNC A;  5FKA C;  2I5H A;  4OJO A;  3KTQ A;  4CE6 A;  5H8Y E;  1L5U A;  5C2T B;  1E7P B;  4EBC A;  5ALV A;  4QWD A;  3CAW A;  4LJO B;  1L6V A;  4F92 B;  3RB0 A;  2DLB A;  2EAM A;  1UXY A;  2OVL A;  2AWT A;  4UB2 A;  3RJJ A;  3MC1 A;  1DXS A;  3OPX A;  3ZKJ C;  1RQN A;  4QZF A;  4R66 A;  2PP3 A;  1LKY B;  4ZA0 A;  2KOB A;  1E5W A;  4RF1 A;  1LVL A;  9ICL A;  3NOB A;  2ESE A;  3LAD A;  3RUL A;  1YMH E;  2KVS A;  2MAX A;  4BXO A;  3IT6 B;  4J9L A;  5GXG B;  4OZB A;  5G5H B;  1NK4 A;  2IO2 B;  3AE4 B;  2MBQ A;  2I9G A;  4C7Z A;  4NJC A;  1UGM A;  1WWT A;  2R61 A;  1COK A;  3UF8 A;  2ZPY A;  3CGE A;  4HWI B;  1Q8K A;  4WUR A;  3MC8 A;  2P4P A;  3IBE A;  5ALX A;  2FIF A;  3R9K A;  3RH4 A;  2JSV X;  2L0T A;  4NL9 C;  3W1Y A;  2O3G A;  3PO5 A;  3AE1 B;  2F5Z A;  4E4U A;  4CCH A;  2GO7 A;  4DL4 A;  3OZM A;  3CF6 E;  4H4U A;  3H7S A;  4KMO B;  1WH3 A;  3VC5 A;  2BCU A;  5DPS A;  3TI0 A;  2FPM A;  4MDK E;  2QDD A;  2K4I A;  1ZOL A;  4GIV A;  3APC A;  3IAS 1;  4B9L A;  2UWQ A;  3KLJ A;  4ZRQ A;  2WAQ C;  2VZK D;  2LZ6 A;  4PS8 A;  1RZT A;  1MOK A;  2Z0E B;  2POZ A;  2PPG A;  4CQN A;  5J2B A;  1HZ5 A;  1RG6 A;  3PW2 A;  3SV3 A;  1WGH A;  2IYD B;  2ASL A;  2PTW A;  5B66 U;  3ISD A;  2DZI A;  2JEJ A;  3PO4 A;  2R2Z A;  1TAU A;  1D5Z C;  1SF0 A;  2ON8 A;  5BYS A;  3EJB B;  3RJG A;  1WX8 A;  1T5X D;  4PYU A;  4KKJ A;  2PIA A;  4A90 A;  9ICQ A;  1YQ3 B;  4H4Q A;  2LXC A;  3AE9 B;  4KLG A;  2LAS A;  4TUS A;  3JSV A;  1PZN A;  4DX3 A;  3GDX A;  4MGY E;  2W3R A;  1B0X A;  3KH0 A;  4HJG E;  1Q46 A;  5TSS A;  1V2Y A;  4US9 A;  2ZG6 A;  1XO1 A;  1N60 C;  4UAZ A;  4YL8 A;  8ICH A;  1DOI A;  2D3C A;  4BVU C;  1KSP A;  3DBS A;  2V0G A;  4KLS A;  5CTR C;  1GRA A;  1ZQO A;  1NJW A;  1ZQQ A;  1S76 D;  2ZCC A;  3DFY A;  4ED7 A;  3I4K A;  2V4Q A;  4Y2T A;  4RT3 A;  1FRD A;  2NBV B;  3M3J A;  4JGH B;  3RPF C;  4A3P A;  1HEK A;  2CU3 A;  3UIN B;  1JRP A;  4IG7 B;  3I1Y A;  4GIR A;  2J7Q B;  1FFV C;  2GQT A;  4LDT D;  1N63 A;  3AH7 A;  2OQH A;  3T5H A;  3AU5 A;  4IRD A;  3N20 C;  5ADZ A;  3ENE A;  3T6C A;  5IA7 A;  4YFK A;  3JPQ A;  2PFQ A;  4PS3 A;  1L2N A;  3E56 A;  2NBU A;  1ZQK A;  4LNK A;  2MX2 A;  3TAR A;  2Q4W A;  3NZ3 A;  4Y2J A;  2K25 A;  3FV9 A;  3BDP A;  4PZO A;  4F93 B;  4UB1 A;  1QOA A;  2JYE A;  4I6L B;  2C2R A;  3DEQ A;  2YMP A;  4JV2 A;  2KNB A;  4AP4 C;  5ALL A;  2EDU A;  5U25 A;  3QKE A;  1OW5 A;  2E8P A;  1MJD A;  4QW9 A;  3QX7 A;  1T7P A;  4DSI A;  1BVS A;  3DDC B;  5BPC A;  3DJJ A;  2JEG A;  1QSL A;  3UXP A;  1ZQU A;  3OHB A;  4XC2 A;  1N5X A;  2ZJ8 A;  3H70 A;  2M56 B;  3R0K A;  4WWP A;  3CST A;  3NVW B;  3LWL A;  1YJI A;  3SQP A;  4ECV A;  4DL7 A;  5DDY A;  2XIC A;  4J1O A;  1HE8 A;  1D4B A;  2G09 A;  1UBI A;  3KKA C;  3RJA A;  1U47 A;  1F0Z A;  3SMV A;  4DQO C;  3H7P A;  5AKH A;  2YB1 A;  2CR5 A;  4HCL A;  3GV7 B;  3DVN U;  1JRO A;  2WXL A;  4EYH B;  3Q6J A;  4IQW A;  4JDR A;  3SFE B;  3PLV A;  5IIJ A;  1JWB D;  1ZD2 P;  4LK0 M;  2V3B A;  1UWM A;  4QWC A;  2BPC A;  1JWS D;  3PGE A;  2X8C A;  1N61 A;  1XD3 B;  2KV2 A;  4FZN A;  5T8I A;  3RNC C;  3AU6 A;  2KIV A;  4ECR A;  1R6W A;  3UJE A;  4RQ5 A;  4G0N B;  1ZJN A;  4XQ8 A;  2H88 B;  1AHZ A;  1GJZ A;  5DB7 A;  3N1Y C;  3RAQ A;  4KIT B;  5ALE A;  3LB8 C;  2DWQ A;  4WWO A;  3CW2 C;  3PSP A;  2LVO A;  5KVI A;  2PVO D;  1QCK A;  4PK1 A;  2KTR B;  4HEA 1;  3D2S A;  1B43 A;  4DEZ A;  2LWP A;  1AN8 A;  1WY8 A;  2V1Y A;  3VUX A;  2HHV A;  2QIE B;  2N7J A;  3ZO5 B;  2H3F A;  4NY8 A;  2K6D B;  1FD6 A;  4UD8 A;  1NHQ A;  2EAP A;  2BKE A;  1KFS A;  4NAW A;  1F5S A;  2Z8L A;  2XC9 A;  2L1A A;  3FG2 P;  2FE9 A;  1ZD4 A;  2WDR B;  1JWU D;  2JRI B;  3T5J A;  3LXF A;  4TVW A;  2WBA A;  3E9S A;  4XYC A;  4M02 A;  1V38 A;  2JT4 B;  2VIX A;  3TCS A;  3N97 B;  1KKR A;  2GH5 A;  2MA1 A;  3RNM A;  3M62 B;  2K8H A;  4BKG A;  4EZL A;  4LZD A;  5KT5 A;  2ZIV A;  2D5G A;  3DJG X;  1VCB A;  1KJT A;  3W9C B;  3GZF A;  4DYE A;  1TZ1 A;  2RDI A;  1M94 A;  3TAD A;  4RQM A;  2A1J B;  2Q0Z X;  4EX7 A;  1ZKH A;  3BOX A;  2PCE A;  4Q43 A;  5AKG A;  4K7W A;  2WP6 A;  3PR5 B;  3M63 B;  4P4O A;  2O2V A;  3IJL A;  1V6E A;  4MM3 A;  2AEH A;  3RNB C;  5E6P A;  2INN E;  3WCQ A;  2VAN A;  7ICT A;  1Z4N A;  1U49 A;  1W1L A;  5J04 A;  2H89 B;  4MF8 A;  2LFI A;  4O5E A;  1ZKQ A;  5DGA A;  4CNQ A;  5J2I A;  3T3O A;  1F52 A;  1TAM A;  5CHV C;  3II4 A;  1LVH A;  3RFZ B;  4IL0 A;  1XHC A;  4ECZ A;  2W0H A;  5D3D A;  1UHU A;  2KQ4 X;  1RDF A;  5AM4 A;  1EO6 A;  2I38 A;  3MFH A;  4Z6D A;  3WKC A;  4G11 A;  4G8T A;  4ZOH B;  3BW7 A;  2XH0 A;  3ZVH A;  3C21 A;  1TS4 A;  4TMA B;  4WH4 A;  5FMH A;  2KWC A;  2G45 B;  4X57 B;  4YXM A;  2K4E A;  2PE9 A;  1VLB A;  5TZV A;  5J0X A;  5JU5 A;  2XNA C;  2HXU A;  1DYQ A;  2G5I B;  2J53 A;  4P16 A;  1I42 A;  1X40 A;  2F1H A;  1Q3V A;  3IFW B;  4O3R A;  2D07 B;  3OGU A;  2MHJ A;  3AXC A;  4OVZ A;  1UEL A;  5IIK A;  2WU2 B;  4H2H A;  4KDI C;  3NS1 B;  2ZXI A;  2FBW B;  1TZZ A;  2RLT A;  1KTQ A;  1ZQS A;  4F4W A;  1U4A A;  3A1Q A;  3DWG C;  2V3A A;  2P3H A;  4ELV A;  4P0P A;  1ZXI A;  4ELT A;  3A7R A;  5KFM A;  2OAI A;  3FW8 A;  4KN4 A;  1YJ1 A;  3GZN I;  1K51 A;  2MSN A;  4KLL A;  3MY9 A;  5IOI A;  2QJM A;  3H1U A;  5DQI A;  3Q6B A;  3CGC A;  3R2T A;  4BUR A;  3NZS A;  4DXF A;  4WJN A;  3N6J A;  4MAC A;  2CJO A;  5JTI A;  3UGB B;  4J9R A;  1V9J A;  1BNO A;  2J0K A;  3PRZ A;  1XSL A;  2BYF A;  3SU8 X;  3BQ7 A;  2FLN A;  2REX A;  4RNA A;  1ZQZ A;  2NRT A;  1GG3 A;  2LJ5 A;  1L3U A;  3B2F A;  3KZX A;  3B2G A;  1JI7 A;  4J03 A;  3EUB 2;  3BVG A;  3F5A A;  2V4I B;  2INP E;  5AHX A;  4N58 A;  1PYW D;  3GD3 A;  4M0A A;  2P8C A;  3AN1 A;  3H7P B;  1ZOY B;  3CIR B;  3OJ4 B;  1J8C A;  2DUY A;  1WUE A;  1XLN A;  2BCV A;  1VZ8 A;  3HHM A;  4PZN A;  4GXJ A;  1CRX A;  1H38 A;  2A1A A;  5HFY A;  4A8X C;  1MHH E;  2PFO A;  9ICB A;  4AS1 A;  2RDJ A;  3QEB Z;  1TS3 A;  4ED8 A;  1R0M A;  3N6H A;  5ALY A;  3EHV A;  4RGM A;  2RR9 A;  4AYB F;  4A6Q A;  3IP4 B;  3U30 A;  2RP5 A;  2ZC8 A;  1CK1 A;  2XY6 A;  3H8M A;  2N9X A;  2WGS A;  2KIC A;  1ONF A;  2NPT A;  2HDE A;  3ZXR A;  2GR3 A;  2DPJ A;  3GD6 A;  1Z00 B;  4KLD A;  2D10 A;  1WZ0 A;  2Y0S C;  4ICA A;  2KKC A;  2MU2 A;  5J0S A;  1KOT A;  1WSP A;  5J8Y A;  4FO6 A;  1B22 A;  2IPI A;  5III A;  4NJ7 A;  2LHD A;  2WX0 A;  4NAM A;  2ZIU B;  4ECQ A;  1S5L U;  3VR8 B;  4DO9 A;  4WQM A;  1H6V A;  4RQ7 A;  2JK6 A;  1YEY A;  3Q4D A;  5HML A;  3AEC B;  3SEN A;  2IY0 B;  2NPT B;  3EEC A;  1PUZ A;  2DBY A;  1R7S A;  3IVF A;  2ODG A;  2P6U A;  2D3A A;  3K9O B;  1UA0 A;  1W1O A;  1D7Y A;  2HBK A;  1PDZ A;  3R0U A;  4EMJ A;  2DPI A;  2DKZ A;  4LDT B;  1W1J A;  2KAJ A;  4LNF A;  5ALK A;  3NVV A;  2K89 A;  3QWZ B;  4C8K A;  3BJS A;  3SN0 A;  3H7V A;  4P2H A;  2DQN B;  2C3D A;  3TEY A;  5J29 A;  2JPH A;  3V4B A;  4M04 A;  5KFE A;  4APN A;  1VAO A;  1S0M A;  5C23 A;  1MDL A;  3Q3N C;  2PA6 A;  2MLB A;  3V6E B;  2HBM A;  2P13 A;  5HG2 A;  4J9S A;  1C1Y B;  3IAM 1;  1EXN A;  3E58 A;  3EPI A;  1EF5 A;  2MJ3 A;  4HCN B;  1KF6 B;  4MSM B;  5D94 A;  4US8 A;  5KAF U;  3IDW A;  2GMI C;  3NRZ B;  4EC3 A;  2QAR A;  2OXO A;  3LYY A;  3Q3J A;  3NFU A;  2WHE A;  3F5E A;  3DED A;  2RDB C;  5FXD A;  2L0F A;  1NJZ A;  1E8H A;  2I1Q A;  4ZYS A;  1NHP A;  1E10 A;  4O3P A;  3EUB 3;  3S1E A;  3HKZ F;  5LXH A;  1ECQ A;  3KYC D;  1X2G A;  3HSU A;  1FIQ B;  1KLV A;  2W9B B;  1WGY A;  4KLI A;  3TJI A;  5AZF A;  1TGZ B;  2KN4 A;  1IIP A;  1SB3 C;  2NTT A;  1E9I A;  1SKS A;  4Q8E A;  2PTY A;  4RGT A;  4TQ0 A;  2KMC A;  2MRL A;  1NPX A;  4FBU A;  1QLB B;  2EXR A;  1QSS A;  4DLE A;  3I5J C;  5U1O A;  3SR6 A;  4DL5 A;  5L83 A;  1GRG A;  3GP7 A;  4UAR A;  4FLH A;  3OHA A;  2D6F C;  3IC9 A;  5F9L A;  4R3D A;  5KNI A;  1L0V B;  5ENL A;  4H1Z A;  2CHZ A;  1EWY C;  3BK2 A;  2I1K A;  2RD0 A;  2FCS A;  3MAB A;  4I2C A;  3EA6 A;  4IDI A;  4GR1 A;  3CP8 A;  1HJP A;  9ICF A;  5D46 A;  3N32 A;  2GOL A;  2OCE A;  4GU2 A;  4M8M A;  4P1B C;  2UUU A;  4XA5 A;  1I4Q A;  1BT0 A;  5AM3 A;  5JHB A;  3ONS A;  4Q8F A;  3ZJV A;  4EQR A;  4TKN A;  1UD7 A;  2N1V A;  1S0O A;  3Q8R B;  5KFD A;  1UWX A;  3ZDC A;  1SXT A;  1LKY A;  3JW0 X;  7ICK A;  1F8W A;  3SBF A;  1XSP A;  4QNL A;  3FW9 A;  5EWE A;  1UNS A;  2XH4 A;  2KKP A;  3D9X A;  3PQB A;  8ICN A;  2MBR A;  4KGR A;  3NS1 A;  4WAA A;  1VZ7 A;  5FS8 A;  2BB5 A;  4H4Z A;  3RB3 A;  4HN8 A;  5DGB A;  1ZXH A;  5JRB A;  2JXX A;  5KT4 A;  2HHS A;  3M1Y A;  2R18 A;  3DQV A;  3H0M B;  3LVV A;  3HUI A;  2PFN A;  3R25 A;  4W9F A;  5AEK B;  1LB2 B;  1S9F A;  4HKZ E;  5D4B A;  1WRD B;  2E1E A;  2XGQ A;  1NKB A;  1D8B A;  5AK3 A;  1E6E B;  2MP2 A;  2QCZ A;  4DN1 A;  1JPM A;  4YSY B;  3QFB A;  3RAX A;  5AM5 A;  5KT3 A;  4TQR A;  4WIP A;  1U45 A;  1EM7 A;  1QKZ A;  3L8K A;  5FS6 A;  1WUD A;  1NKC A;  8ICJ A;  2SEB D;  4BZA A;  3IJI A;  2DZJ A;  4TQS A;  3AE3 B;  9ICP A;  1DXL A;  3S47 A;  6ENL A;  3B9J A;  4I6P A;  5EBK A;  3TFS A;  1HZ6 A;  5FJO A;  2LMC A;  4ZRJ A;  5ALU A;  2IO1 B;  1M4V A;  3LB8 A;  3U52 E;  4KN7 A;  4L2Y A;  3CSF A;  4DOA A;  4BOZ B;  2H5X A;  2RK5 A;  1FEZ A;  3M7D A;  4HDQ A;  5G55 A;  1NOM A;  2YLM A;  3IRU A;  4IT1 A;  4DFK A;  3WKE A;  5BYR A;  2RSU A;  3MGI A;  3C1Y A;  4K1R B;  4PH5 A;  5DDM A;  3TBL D;  4ANX A;  4PWB A;  2XI9 A;  3QZ8 A;  4GMV A;  2YMQ A;  1LPF A;  4RQ0 A;  2BCS A;  2GB1 A;  2N9L A;  3T5L A;  4EZ9 A;  5CB1 A;  3RBE A;  2ZTE A;  4YMM A;  4II2 B;  3ZI4 A;  2QMT A;  4IL2 A;  2HHT A;  1D5M C;  3PHX B;  2LI6 A;  3SAH A;  2ZAD A;  3CB3 A;  1JUD A;  4OD0 A;  4O0I A;  2KZR A;  1ZET A;  4DQQ A;  2Q85 A;  1MQ2 A;  1ZJM A;  2PLP A;  1F9C A;  5HKH A;  2RPV A;  4K7Z A;  4NLN A;  5AM2 A;  3MFG A;  2KTF A;  3BQ1 A;  4IZG A;  7ICL A;  3B9J B;  3EJE B;  3VH4 B;  4PWC A;  2I0K A;  3DVG Y;  4IWO A;  2BCR A;  5J2G A;  4I2A A;  1QOG A;  3B0Y A;  3BS5 A;  9ICX A;  5KFR A;  2D3B A;  5EE1 A;  1HSK A;  1QIL A;  1ZK7 A;  1CEZ A;  3P93 A;  2WLB A;  7ICJ A;  3ZNG C;  2KFK A;  1MFW A;  4HKQ A;  4KMU A;  4DHZ E;  2HHQ A;  1PK3 A;  1VDV A;  4QZE A;  2W7O A;  4H4T A;  1PDX A;  3SZ2 A;  2IOF K;  2GWS A;  8ICB A;  4URK A;  3VCB A;  3QAQ A;  3VUY A;  5AKE A;  3SN1 A;  1GOZ A;  1E0Z A;  1J2N A;  2MWS B;  3QUQ A;  4ACO A;  4AQ7 A;  4JN8 A;  2E8M A;  2JR5 A;  2D8C A;  4UAV A;  4BCA A;  4F8C B;  2FUG 1;  1F77 A;  5C5J A;  2J42 A;  3U2S C;  4YMN A;  2FCQ A;  4DK5 A;  5GTI U;  1WR6 E;  4P1C C;  2W9C B;  3EAO A;  1I4H A;  4HPP A;  1XPY A;  3TEW A;  1XCQ L;  1ZQM A;  2YVG A;  4F5O A;  1IGC A;  3ZDA A;  3P0W A;  3NHE B;  1OEY J;  2KZM A;  2EQ8 A;  1OTR B;  1XSN A;  4YT0 B;  3UPQ A;  3BYY B;  3NUQ A;  4LA1 A;  3TOY A;  1QLN A;  5ALM A;  3AE7 B;  3ZQ4 A;  3DVN V;  4NLK A;  1JXE A;  2NCN A;  5HHZ A;  1JOA A;  4M6W A;  3U4E G;  3PW5 A;  3WA0 A;  1SE9 A;  1E8F A;  4RM9 A;  2QKQ A;  1OEY A;  3IG5 A;  1ZQH A;  2BB6 A;  4XX5 A;  2AQ0 A;  3IM1 A;  1FPY A;  3PV1 A;  2CKH B;  3PST A;  3AQE A;  2KDE B;  3S1C A;  5AKJ A;  5EE9 A;  3HRD C;  3KKA A;  4H4X A;  1KEJ A;  4I2J A;  2QJN A;  4PGY A;  3K75 D;  5ALW A;  1AHV A;  5DBB A;  4WWM A;  4BC9 A;  4DL3 A;  1ZPS A;  3R66 C;  5J0T A;  2J0J A;  1ZQL A;  3B1L X;  4KSK C;  3RIT A;  3K1Z A;  4RGN A;  1KFT A;  1T3N A;  2BVH A;  3ECI A;  1SXD A;  1ZQF A;  3P4Q B;  5IIN A;  1Q3U A;  4I2F A;  3TQP A;  5ALQ A;  1BXT A;  3MFI A;  2BTE A;  3N7R C;  2X99 A;  3UXL A;  4RU9 A;  4TSS A;  3V61 A;  1NJY A;  4CO7 A;  4C0Z A;  3ZUN A;  2YN4 A;  2BF8 B;  4IM0 A;  1KLN A;  1LO5 D;  2LGI A;  1SV4 A;  4IC7 B;  1XEE A;  4WAF A;  1UCV A;  2KTQ A;  4Y2P A;  2GBR A;  2J6T A;  3BQ0 A;  4IC9 A;  2HHX A;  1WXV A;  1SIF A;  4NPN A;  5DB9 A;  1SE2 A;  1OEP A;  1C7Y A;  5ALO A;  1D5X C;  1K1Q A;  4KGT A;  5BOL A;  4O9M A;  2R2O A;  7ICV A;  3DH9 A;  2PTL A;  2CFY A;  2HOQ A;  3H9D A;  2AQ4 A;  3C2M A;  2CHW A;  2N9K A;  5FP0 A;  3J9C A;  2Y0S F;  1BPD A;  1TKD A;  4GOC A;  3HVD A;  2NPX A;  4RQ4 A;  4LZG A;  3D46 A;  2BS3 B;  3C0R B;  3KHG A;  9ICM A;  4AJY B;  4Z1Y A;  4HCP B;  3K1R B;  3QU4 A;  2IJ0 A;  4CRX A;  4O3Q A;  4AYB C;  2IOH A;  2LRW A;  4N9F 4;  3A9K B;  1SJC A;  4GFJ A;  3CWI A;  3QJZ A;  3AE2 B;  3MR6 A;  5CHW A;  4KX6 B;  1RPL A;  4F5Q A;  3MQT A;  1FO4 A;  1A76 A;  3DWM A;  1S10 A;  2IBK A;  1IUE A;  4MH0 E;  1P48 A;  3O0H A;  3QFA A;  4XDC A;  3AEA B;  1C20 A;  2JZZ A;  1ZQB A;  4A6G A;  2ZIW B;  1JXL A;  5C1Z A;  2QKN A;  2KZZ A;  4FHK A;  2UVU A;  1FNU A;  2VJ4 A;  3DDM A;  3KVF B;  1NVI D;  2KJR A;  3G6V A;  1YNT E;  5IIO A;  1XLO A;  1XLP A;  1PK1 A;  1TK5 A;  1DIQ A;  2NQL A;  2UYZ B;  3SD7 A;  4I2E A;  3WU2 U;  2WU5 B;  1RYU A;  2GSH A;  3VQI A;  1GPX A;  2ES6 A;  7ICG A;  3ZJT A;  2K8B A;  3RRG A;  1C9F A;  4EM3 A;  1SL2 A;  4ZHO A;  5KFT A;  4MGK E;  1A6S A;  4LCD E;  1WYW B;  1WCL A;  4O3N A;  5D49 A;  4JIO U;  3SAF A;  4DS4 A;  3NZG A;  4QWB A;  2YB4 A;  5CA7 A;  3A9J B;  2SAK A;  3RD2 A;  3CT2 A;  4WJQ A;  5HR6 A;  3DEE A;  4JLC A;  2CRX A;  2CHR A;  2NRZ A;  2ZW0 A;  3KWL A;  4UB5 A;  3FVD A;  5JCK A;  2UVV A;  3MJ5 A;  5HQX A;  4AJW A;  3WK7 A;  5CRX A;  2JEF A;  5J2E A;  1FNW A;  5HNK A;  4ZRK A;  5HP4 A;  2XVT A;  3HKZ C;  2W11 A;  2C60 A;  2G3Q B;  3RT3 B;  3GRS A;  1MVK A;  3FCP A;  4GLX A;  4R63 A;  3PW7 A;  2MSE D;  3RBD A;  4EQW A;  3TAP A;  3DGB A;  3QE9 Y;  3LWM A;  1EBG A;  5GRT A;  1Z2M A;  3M6K A;  3APF A;  3AUO A;  2TSS A;  4FXC A;  5KG1 A;  4RNN A;  1WF9 A;  3MGV A;  4MJS B;  1SJB A;  1PK1 B;  4NEV A;  4E5T A;  2HNE A;  3N9Y C;  4Z6F A;  4EOY A;  3V62 A;  3P3B A;  2JWZ A;  3ZYY X;  3QU9 A;  1XO3 A;  4JV1 A;  4ICV A;  3QUT A;  1N61 C;  3AV8 A;  2DNF A;  1OJT A;  3T9L A;  5AI6 A;  4OJP A;  4LNI A;  3O0F A;  4KLJ A;  4EZK A;  4DHJ B;  4C4S A;  3GOE A;  4KZ0 A;  5BMH A;  1MA7 A;  1QQ6 A;  1UH6 A;  1ZUD 2;  1Z00 A;  3Q3M C;  8ICS A;  3I57 A;  1AWD A;  1EC8 A;  2KDF B;  4EZJ A;  1FEH A;  1UQV A;  4B0E A;  5AI8 A;  2RAB A;  3A7A A;  4F4R A;  3BS5 B;  8ICC A;  1JWA D;  4U7C A;  1ZGU B;  3TCA A;  2E6X A;  4EMW A;  4HPM B;  5KFQ A;  2M0N A;  3E0F A;  4ZCW A;  4ML8 A;  2KJ9 A;  4CF5 A;  2CU1 A;  2HBL A;  3RUI B;  2BT6 A;  4EEL A;  1FMA D;  4DFD A;  4FBJ B;  4C8O A;  2QB1 A;  1HTO A;  1YJJ A;  1B1Z A;  2ZZC A;  2N9P C;  2G5H B;  1E8X A;  2KWU B;  1ZD3 A;  3Q69 A;  1SKR A;  4M9L A;  2JX5 A;  2KIW A;  3PY8 A;  3RI7 C;  2Y1J A;  2O2V B;  5J0Q A;  3PVX A;  3UQ0 A;  4Y2S A;  3BK1 A;  3ZDB A;  3GIL A;  3GU3 A;  3PSF A;  2IY1 B;  1ZQG A;  3KUZ A;  9ICV A;  1MC8 A;  1J7A A;  2KN7 A;  2E8O A;  3HWT A;  2BVC A;  3DPD A;  4K7S A;  2W9A A;  2PKE A;  4F5N A;  1WE6 A;  2BCQ A;  3QK0 A;  3PZD A;  3STP A;  2YEP F;  3QX1 A;  5G2N A;  5FS9 A;  3ISB A;  1NK8 A;  1CI4 A;  2WB1 F;  1S97 A;  4NQL B;  3SHQ A;  2W55 A;  5KT6 A;  2KE7 A;  2FUH B;  1EBD A;  1VRA B;  4NL9 A;  4IQV A;  3MWC A;  3TEX A;  3HPO A;  4JWU C;  1YX6 B;  2GI9 A;  3P4S B;  1W1M A;  1K1S A;  4H50 A;  4BKT A;  1GO3 F;  2AYO B;  5IDZ A;  1DK3 A;  1WI0 A;  2AL1 A;  3ZD9 A;  4YXJ A;  1QQ5 A;  3EWA A;  4KDL B;  1GB1 A;  4E74 A;  9ICE A;  2ZIW A;  5BO4 B;  3N4M B;  1BGX T;  3LDA A;  4F4Y A;  4JV0 A;  2BQU A;  4IR1 A;  4O5K A;  1KTK A;  5C3J B;  1GSN A;  2P8B A;  3V7J A;  2PSN A;  2WOW A;  3K1G A;  2KDB A;  2KQS A;  5KFI A;  3ALR A;  1QH9 A;  4KTQ A;  4M0W B;  4DSE A;  5AI9 A;  2V3S A;  3T3F A;  2BDP A;  1QOF A;  4QJF B;  3R2I A;  4BC7 A;  3QLD A;  4Y2Q A;  2L76 A;  3VC6 A;  2K8A A;  3DQ0 A;  3RFA A;  2F1J A;  4ZRP A;  5FS7 A;  5J8Y C;  2FMQ A;  5DLF A;  8ICR A;  2OED A;  3A9K A;  3D32 A;  3BII D;  3DBH I;  2LVQ A;  2Z59 B;  2PP0 A;  9ICJ A;  4MEX A;  2NTS A;  2X8X X;  3SYZ A;  4F3O A;  1F2R I;  3CMM B;  1TKG A;  1W1R A;  4E8G A;  3V72 A;  1P7E A;  3RJE A;  4BXO B;  2WF8 A;  7ICS A;  1TAQ A;  5L1K A;  1WYG A;  2BPG A;  3CK5 A;  4GME A;  2EQ6 A;  4I2H A;  2KEY A;  3H4K A;  5CX3 A;  2OO6 A;  4GSW A;  1YX5 B;  4ECT A;  4NLC A;  2HVH A;  3H7I A;  2V3P A;  3GS2 A;  2W9M A;  3VRA B;  4OAL A;  5DLG A;  1S3S G;  2GBN A;  5DB8 A;  2JHD A;  4ARC A;  3GRT A;  3GB1 A;  4I2D A;  4ZDV A;  4ZHP A;  2CJN A;  2GGJ A;  3W8W A;  1VR9 A;  4FZL A;  3DK8 A;  4UBC A;  3M9N B;  1BKH A;  3OAW A;  3SV4 A;  1FCL A;  2WPC A;  4O1N A;  1X9X A;  2K6Q A;  5EWF A;  2N7D A;  5J0O A;  2ZIX A;  4HLE A;  2G0A A;  1VJK A;  2JRH A;  5KHQ A;  4LNO A;  3MHZ A;  4B9N A;  2AX5 A;  3MR3 A;  4F5R A;  2KMA A;  2BR0 A;  4J9O A;  1N62 C;  3PML A;  9ICA A;  5G5G A;  2GLE A;  4JPS A;  2LM4 A;  2OYY A;  5E6N A;  3OC4 A;  2L5Y A;  4PL1 A;  3VCC A;  5HMM A;  5T14 A;  2G08 A;  4DFP A;  3RN9 C;  4YWO A;  9ICR A;  4YSZ B;  3RTV A;  2A3V A;  2ZNV B;  2DKX A;  4KPL A;  3GD4 A;  3U9I A;  4S0R A;  3U26 A;  4HXD A;  5AI0 A;  1TYG B;  4WJP A;  2HHU A;  5J17 A;  1ZP0 B;  3JPT A;  3L16 A;  4P6V F;  5KFV A;  1T0Y A;  1D9F A;  1QT9 A;  4HDO A;  2WWZ A;  1WVE A;  3C23 A;  1V85 A;  4OJ6 A;  5KAI U;  2JH1 A;  1NDD A;  1XLQ A;  7ICE A;  1EC7 A;  2GBK A;  3ZW3 A;  2QDF A;  2OJR A;  2WXN A;  3VC8 A;  3QU7 A;  4MSQ B;  1DII A;  9ICT A;  2K4P A;  1U9L A;  5ALH A;  4F8R A;  1WM2 A;  2BPF A;  2XK5 A;  4NQK E;  4Q45 A;  1L7Y A;  3ZTD A;  4E71 A;  3AUL A;  1LFD A;  5MPO A;  3D2J A;  1L5P A;  3TMP B;  3G6X A;  3UJF A;  4J57 A;  1M6I A;  1M6Y A;  3AEF B;  1ZMD A;  3RJH A;  4PHP A;  3I6T A;  5AKK A;  5ALJ A;  3ZRF A;  4QZC A;  3JPO A;  1NYR A;  4K7U A;  1OFF A;  5JCL A;  1GER A;  4MGZ E;  3P4P B;  1X66 A;  5AK4 A;  3L5K A;  1E8G A;  3HM3 A;  3UXK A;  1STZ A;  4RFB A;  4YG2 A;  1SSN A;  2MA9 B;  4TUQ A;  3HW2 A;  4BWM A;  2PPH A;  1GET A;  1SJA A;  5L6F A;  4ED3 A;  2JZ3 B;  3DK9 A;  3RNA C;  2YMM A;  4GC7 A;  3H0L B;  4D2K A;  1A5R A;  1L8O A;  2F8K A;  1BZL A;  4IRC A;  1OQR A;  2DW7 A;  1BWC A;  4M6W B;  4FS2 A;  1DK2 A;  7ICF A;  3GIM A;  4KEM A;  1Q5W B;  2VAO A;  2BYV E;  2FDR A;  3AQF A;  4ICU A;  3RCY A;  1WX7 A;  3KOO A;  4QZA A;  3KHL A;  1RRB A;  3Q8M A;  4ROP A;  2KDI A;  3RJ8 A;  1C4P A;  2AL2 B;  1QQR A;  3ETL A;  3ML8 A;  3V3X A;  2V4L A;  3FAH A;  1P1A A;  1V80 A;  5TR5 A;  3TL5 A;  5LXI B;  3THU A;  3HM6 X;  1UGJ A;  1KLG D;  1TE6 A;  3N4E A;  2F77 X;  2KYW A;  3TUO A;  2MUT B;  4CDG A;  1WXS A;  3B08 A;  5B5E U;  3T9P A;  5D6J B;  3GY1 A;  3OLM D;  2YX8 A;  2PJH A;  2LPE A;  1Q1O A;  4NY0 A;  1ZQT A;  2E1F A;  5KHO A;  2MH7 A;  1JCK B;  1T94 A;  2PW9 A;  1DOX A;  5BMI A;  2VFS A;  3D2Q A;  4NZL B;  5ALS A;  2C3C A;  2Y9T A;  4H19 A;  3C8Y A;  3U8Z A;  5CP2 A;  3ZIM A;  2W54 A;  1TIF A;  3TSS A;  3GSY A;  4F71 A;  2OZ3 A;  4TUP A;  4Z6E A;  3H8A A;  4DNA A;  1F1H A;  3NUH B;  4BBN C;  4Y2Y A;  2WS3 B;  3QCA A;  1V86 A;  1GB4 A;  2KO3 A;  2OX4 A;  1K52 A;  1FFU C;  5KFJ A;  3AEV A;  4B9V A;  1QSY A;  2IDY A;  2WXO A;  3KQ4 A;  3A0H U;  4RPX A;  4K3C A;  4LTU A;  4PJ0 U;  2AQ1 B;  3LLB A;  3H40 A;  1T8E A;  4RUA A;  3H8J A;  4C4R A;  2O6V A;  5LNK 1;  2KSO B;  3S6J A;  2P6R A;  1E0Y A;  3BIN A;  4MLA A;  2WDW A;  3PW4 A;  2OQY A;  1KDH A;  4XLO A;  2L32 A;  2G06 A;  4FBT A;  2J6S A;  4O5C A;  4ED0 A;  2ZTC A;  2BDU A;  5IKC M;  1YIW A;  1L0X B;  2EMS A;  4Q44 A;  3VAW A;  2WAQ F;  5KVH A;  3SQI A;  1XO0 A;  1NK7 A;  1SBB B;  3VTV A;  3D2H A;  2PU0 A;  3V05 A;  1SXE A;  2GDQ A;  4K81 A;  4GRT A;  4QWE A;  5KG2 A;  4UW9 A;  4DF8 A;  5AUK A;  3R10 A;  4RZR A;  1NEN B;  4EYI B;  3A9J A;  5ALR A;  4C00 A;  4KSL C;  4IP4 A;  2BW2 A;  2KSO A;  4QZD A;  1WIA A;  4C4V B;  1QZE A;  5FK9 C;  2F44 A;  3T8M A;  1KD0 A;  4CF3 A;  1IXR A;  1TTN A;  3R07 C;  1IBX A;  3B0A A;  5DQH A;  1YQ4 B;  2LHT A;  5ALD A;  4JWN A;  4MF2 A;  2KDM A;  2VFU A;  2WOV A;  3AE8 B;  1V5O A;  3A1Q B;  5KFG A;  2HOI A;  1KN5 A;  2W7P A;  3C1Z A;  3L08 A;  3QN3 A;  2KZ3 A;  1ZQR A;  3LVW A;  2XK5 B;  3HJE A;  3KWV A;  5L1M A;  2OM6 A;  4BOS C;  2EKI A;  2XSX A;  5JUM A;  1JIH A;  4UAT A;  4JWS C;  4EUT A;  2I2Y A;  2EKE C;  5J2D A;  5TIS U;  2UVW A;  4NLZ A;  2FYM A;  2D3G A;  3KYD D;  3IK4 A;  2JU6 X;  4K8G A;  1C3T A;  4P4P A;  2LHE A;  4ADW A;  2A8X A;  2ZUC A;  3PR4 A;  2X8G A;  2L7R A;  5J2R A;  3HW8 A;  5KFS A;  5DPW A;  2WXM A;  3KUD B;  4XWT A;  3C2K A;  1Z4O A;  1L4Z B;  4P0Q A;  3TJP A;  4KLM A;  1KQQ A;  2XBB C;  1RQL A;  4DSK A;  4PYZ A;  3VFC A;  4DQR A;  5KFO A;  1JCT A;  1FXA A;  2IGH A;  2A5U A;  2K4H A;  1S0N A;  2KLC A;  3NJT A;  2IMW P;  3PZ7 A;  4HRO A;  4DXA B;  4E3C A;  2QJJ A;  4ENL A;  2EQ9 A;  1OUQ A;  3RZW C;  2LM1 A;  3OSP A;  2NRW A;  4DCC A;  2J0M A;  4F7Z A;  4M6U A;  5K4L A;  4ACF A;  3UJS A;  1X2H A;  1WX9 A;  3I76 A;  2QEJ C;  2OLA A;  3D47 A;  2KT7 A;  3M9M B;  3VR9 B;  2I6X A;  7ENL A;  3LDZ E;  2LGD A;  1ZD5 A;  2QJL A;  3ZLG A;  5AM0 A;  2G1E A;  2EQ7 A;  3UJ2 A;  3DER A;  5JZE B;  4HPL B;  3JVZ X;  1HIW A;  4XWW A;  5J2J A;  2IOF A;  4AWJ A;  2WXI A;  1ZQA A;  1AAR A;  2F76 X;  1BPY A;  1K53 A;  3L13 A;  4YXD B;  4BBY A;  1MG4 A;  3TX1 A;  5AE2 A;  2KMD A;  1PFD A;  1G6J A;  2OKT A;  1Z3E B;  3QUB A;  3OTQ A;  4Q2J A;  2QDE A;  2WXF A;  1KCZ A;  1WJ4 A;  3A0B U;  3WKD A;  3MSY A;  3N30 A;  5FJT A;  2KKV A;  3X0W A;  2CHX A;  3DGZ A;  2KC2 A;  2K5P A;  1YN3 A;  2YEP B;  3UQA A;  5KFH A;  2KD0 A;  2L8J A;  2BQ3 A;  3WK6 A;  4IHC A;  1C79 A;  4XGA B;  2HJ8 A;  4H4R A;  2KHQ A;  2ZXH A;  1E8W A;  3I28 A;  2LGS A;  5DG7 A;  2FCN A;  1STE A;  3PPA A;  4DF4 A;  3Q8K A;  2WNM A;  2MBE A;  1O03 A;  1FXT B;  3AEE B;  3BZK A;  1EUV B;  3DGH A;  2AHO B;  4JAY A;  3BJY A;  7ICR A;  5ALI A;  4YTM B;  2P88 A;  2M17 A;  1IM4 A;  5KFL A;  4ECU A;  1BPB A;  3OW1 A;  4K2S A;  5KFA A;  3QNM A;  5KFW A;  1RYR A;  1NK6 A;  1K4Q A;  3H12 A;  4BWJ A;  1ED1 A;  4I28 A;  2RMM A;  2HXT A;  1XQQ A;  4LNN A;  2K60 A;  3DOW A;  1N2X A;  3MDC A;  2Z7J A;  5AWV A;  3SDL C;  3TWB A;  3T4W A;  4PYT A;  4MEY A;  5E79 U;  1C76 A;  5HHI A;  1WUF A;  1DGS A;  3FIL A;  4O3O A;  1VZ6 A;  2KJ6 A;  3ZLZ A;  4YN4 A;  1KN0 A;  1E90 A;  1TFR A;  5J0Y A;  2ZJA A;  4KX3 A;  3AMZ A;  2DYB A;  4MM3 B;  4MFC A;  3VTU A;  1ZQV A;  4A55 A;  3W8Z A;  8ICA A;  2KG5 A;  2JEI A;  2DGZ A;  3UMC A;  3M8R A;  1PQS A;  2QAE A;  4K3B A;  3R1Z A;  3G6Y A;  1PUT A;  1WMH B;  2PGE A;  3DFH A;  1URJ A;  3RR8 A;  5GMV A;  2FLL A;  3VDZ A;  4I2G A;  1YN4 A;  4H4P A;  2ISO A;  2KX3 A;  2PMV A;  4EQX A;  4UAY A;  2C7N B;  1AW7 A;  4FUL A;  2JWU A;  4PVE A;  4DWF A;  2L3Z A;  3IV6 A;  1QTM A;  3FW7 A;  3BS7 A;  2NS5 A;  3Q8A A;  3QAR A;  5J0W A;  3Q2A C;  4KV2 A;  2OZ8 A;  3NGD A;  1YZ7 A;  4DQI A;  8ICG A;  4JQW C;  4YTP B;  3UCC A;  3GII A;  1J2M A;  4J9K A;  1SGG A;  5L1I A;  5CJ7 A;  3TAQ A;  1ET6 A;  1D9D A;  3THV A;  3C5G A;  2RDG A;  3X23 A;  4MEL A;  4NLB A;  2W9B A;  3WIM A;  1LM8 B;  2QVH A;  2P66 A;  4ZOH C;  4TVY A;  8ICI A;  4F1S A;  4QZH A;  3PX0 A;  2LMR A;  3ZDE A;  2VA3 A;  3BVZ A;  2W43 A;  2QSD A;  3PSE B;  2ZVO A;  1R4N B;  1IG6 A;  3N7P D;  3FIL B;  2PGW A;  8ICE A;  1V8C A;  2DFL A;  2OEH A;  2IA6 A;  2FJ6 A;  4C4V A;  1SV0 A;  2FPK A;  3DHI C;  4J9Q A;  1LQB A;  3KW5 B;  4NJ8 A;  4R8U B;  3HK0 A;  3WAL A;  2WTF A;  2G07 A;  3S1F A;  1I4R A;  3Q8B A;  4ZH4 A;  2Z0D B;  1QQ7 A;  4QW8 A;  3EC8 A;  2WPF A;  3DCG A;  4REZ A;  2JVC A;  2LI5 A;  2PLS A;  3PW0 A;  2W9N A;  2GR0 A;  1KFD A;  1Z5S B;  1D8Y A;  2WXH A;  1WWU A;  4M0W A;  3GE8 C;  3R7R A;  5HMR A;  1FEB A;  2MNR A;  2EEL A;  3PTF C;  3ZDT A;  3GQC A;  3L17 A;  4IOI E;  3AEB B;  5AZG A;  3DG7 A;  4KLT A;  4W9I A;  4AUQ C;  2PXI A;  1EF1 A;  3PVL A;  1CQV A;  4EQS A;  1RXW A;  3FYY A;  4W9K A;  1NEK B;  2ZIX B;  3CXO A;  3BVM A;  1CZP A;  2PMZ F;  3R3M A;  4HCH A;  2NO5 A;  2CXY A;  2Y3A A;  2F3N A;  1V9P A;  3MC9 A;  4FI4 A;  4G3I A;  2BS4 B;  2QHO A;  5CHF A;  4RF0 A;  3RNF C;  4HK2 A;  3UXO A;  5DG8 A;  3AU4 A;  5LLI A;  2Y08 A;  4GIB A;  2GLS A;  4MGG A;  4ELU A;  2LBO A;  1P98 A;  3VDG A;  2XH7 A;  4LJX A;  3Q8S B;  3GIJ A;  2EQY A;  4RQN A;  4IR9 A;  3K4G A;  1I7H A;  2MP2 B;  2BWF A;  4MGI E;  1J97 A;  2R8G A;  8ICF A;  2KWV B;  1C77 A;  3SAG A;  2YVC A;  3A4S C;  3VTW A;  2BQQ A;  2VFV A;  4GGQ A;  4PT5 A;  3IXS A;  1FXI A;  4EE2 A;  1GXF A;  2A19 A;  2VA8 A;  2KVC A;  3NVY A;  1PVP A;  2R8K A;  3KFU F;  1UBQ A;  3EJD B;  1UT8 A;  1KL9 A;  5KFX A;  2F1I A;  2OJW A;  4KKI A;  3GZN B;  2RDH A;  4F72 A;  4CYE A;  1EC9 A;  4R64 A;  3IG3 A;  3UIP B;  3EKG A;  4UAS A;  2H3V A;  3I6E A;  3PZ8 A;  1YQZ A;  4KZC A;  2ZZB A;  3FM9 A;  3QYP A;  5DB6 A;  4A3O A;  3M95 A;  1WWV A;  1K50 A;  2ZPN A;  1FM0 D;  3RRH A;  4FJV B;  3UM9 A;  2KJH B;  2JMG A;  1BPX A;  3CGB A;  4IQT A;  2ACZ B;  4P7I A;  2D3D A;  3NAS A;  5L1L A;  2OWO A;  3H0R B;  4WJO A;  3QA8 A;  3WAN A;  4A35 A;  2JXJ A;  4PPX A;  3L3F X;  2M8S A;  4TV3 A;  3Q45 A;  2LKY A;  3ENL A;  3RZF A;  1ZR6 A;  2DL0 A;  4JWM A;  2PS2 A;  4B9T A;  2ZTD A;  2K39 A;  5AKL A;  2IHN A;  4Y2V A;  4RQ3 A;  4QZB A;  2XGP A;  1V97 A;  3JVA A;  4HNC A;  1WMH A;  3AM9 A;  3NS8 A;  1D6E C;  2IPK D;  3QTP A;  1N5W C;  1BUI C;  3KHH A;  4EWJ A;  2F2A B;  4FZM A;  1T4G A;  3TWA A;  5JRT A;  2HE7 A;  3QHT A;  2GH1 A;  4PS7 A;  2QQ6 A;  5D3I B;  2WXK A;  3RNE C;  5ALG A;  5ALZ A;  1I4X A;  1MBB A;  3HPF A;  1C4C A;  2Q5W D;  3B97 A;  1OXJ A;  3S5S A;  2AQ3 B;  1GC7 A;  3ES8 A;  2N1W A;  1DTN A;  3SJN A;  2YQU A;  1ZQX A;  3HT3 A;  4A20 A;  3KJM A;  1FCC C;  1TKY A;  5J0U A;  1X6J A;  2KJ8 A;  5L95 C;  3UMG A;  3SR6 B;  1P0R A;  2BC0 A;  2ZVN A;  1SWW A;  4EM4 A;  5KT7 A;  1L7O A;  1ARO P;  4DOC A;  5HHD G;  3E2E A;  1UPH A;  2K9X A;  3DIP A;  3SN4 A;  3HVZ A;  3QU2 A;  5ALF A;  3H8H A;  2HZG A;  3BZD B;  4B9S A;  2HDO A;  3UXN A;  3WKB A;  4EBD A;  2GRT A;  1ZQI A;  2IBI B;  4DQP A;  4IW0 A;  3AE6 B;  4IWQ A;  1NBF C;  3LK9 A;  2IGD A;  4A9A A;  2N7E A;  4EEN A;  3GV5 B;  4TUU A;  1V1O A;  5AUI A;  4RT2 A;  4KLQ A;  3PRP B;  2IO0 B;  5G5H A;  2VA2 A;  3L5O A;  1X1M A;  2XEW A;  1JEH A;  4N59 A;  2QGY A;  4FFD A;  9ICK A;  2JF5 A;  1WXA A;  4DDI D;  1ACC A;  3M6Z A;  3BSM A;  5KFZ A;  5KG3 A;  3QQ8 B;  1KKO A;  1YZ6 A;  4AP9 A;  2K1F A;  3O13 A;  1ZY8 A;  2B21 A;  4C80 A;  7ICI A;  5CEH A;  1FRR A;  1ZQN A;  4NWI A;  4A8E A;  1S1Q B;  2VFR A;  3D2D A;  3V7L A;  4FX9 A;  4PHE A;  3QPE A;  3MUC A;  1L8L A;  2QB0 A;  2DYO A;  2HI0 A;  2KK0 A;  4PHA A;  4I2I A;  2LJI A;  1ZX9 A;  5HI1 A;  3R7Q A;  2AAQ A;  3Q8E A;  1T3Q C;  2Y9U A;  2FNJ B;  1NK0 A;  2MBB B;  4DNS A;  4XRH A;  2ZJD A;  1J0G A;  2MUT A;  3H8W A;  5CWR A;  4DOB A;  3C28 A;  1MPE A;  3FXG A;  2WOI A;  5GTH U;  2YVJ A;  3FC4 A;  2G9H D;  3ICX A;  3N28 A;  2AL3 A;  5E6J A;  4HYR A;  4MFA A;  8ICT A;  1TS2 A;  3SEB A;  5BOE A;  1T6B X;  1SKW A;  1EWC A;  1L3T A;  3N1X C;  4M9J A;  3CYJ A;  1E9M A;  2AGQ A;  2C7H A;  4J3Z A;  2D2Q A;  4HPN A;  3VFK A;  1TYP A;  3JPP A;  1FHV A;  4FE3 A;  1KW4 A;  2ONQ A;  4M01 A;  1GRH A;  3PK7 A;  3M8S A;  4Y2U A;  4M00 A;  2UVR A;  4DS5 A;  3UMB A;  4IRK A;  2XGZ A;  4P0Q B;  1ET9 A;  3OWE B;  3SSZ A;  2EZZ A;  2MBH A;  2B6G A;  1TJE A;  2E5A A;  1A0P A;  3ZRC A;  3ALB A;  3FDS A;  3NVY B;  3QXG A;  3QUC A;  2WFA A;  3D6J A;  3KZI U;  1R4N I;  1ZQD A;  5ALN A;  3ZVH B;  3C29 A;  1OGW A;  3WK5 A;  1YN5 A;  2H3I A;  1L8P A;  3HIZ A;  2KVR A;  4RGO S;  4JE3 B;  1ZQ1 C;  4Y2R A;  3I63 C;  2JRZ A;  7ICU A;  2X50 A;  2HJ1 A;  2WHI A;  4ANU A;  2POD A;  5AE1 A;  2WPE A;  2H3Q A;  5HHH A;  1MG8 A;  4FS1 A;  2J52 A;  4OZC A;  2E3T A;  5F3X B;  1L3V A;  7ICO A;  2NBW B;  1KLU D;  2BGF A;  2R2Q A;  5AZH A;  3HP6 A;  3V6K A;  3NVW A;  7ICM A;  2XH2 A;  2KAN A;  3APD A;  7ICQ A;  1L0Y B;  3JW7 A;  3NO1 A;  3FWA A;  1H2I A;  2DZK A;  1JAL A;  5DPT A;  1WRI A;  3AEG B;  4FA6 A;  2NRX A;  2VZK B;  3KLS X;  3LJ3 A;  5A0L A;  1Y56 A;  4KWS A;  4RQ8 A;  1ZE3 D;  3W8X A;  3RH6 A;  3VA8 A;  4QIW F;  4B9U A;  3OTR A;  7ICH A;  4OJ5 A;  1XT9 B;  2C2E A;  2ALZ A;  2LVP A;  3SFD B;  1SE4 A;  3BWU D;  2VKQ A;  2NVU I;  5KFK A;  4KT2 A;  2KFK B;  3UI3 A;  3EAN A;  4MHV A;  1TY2 A;  1WGG A;  4BX9 C;  3RR7 A;  1W6T A;  2NO4 A;  5KFB A;  1RVK A;  5EWG A;  2PU1 A;  5TR3 A;  1WXM A;  2BWE S;  2GGH A;  1NKE A;  4DSJ A;  9ICC A;  4XZ4 A;  1ZQJ A;  3TKA A;  1AYF A;  2MEK A;  2MQJ A;  1DZN A;  2JZB B;  2W04 A;  3C2L A;  1HUZ A;  3RO6 A;  3NRW A;  2ASD A;  2JV3 A;  2GRI A;  4X2P A;  1FIQ A;  1AHU A;  3AL0 B;  2AKM A;  2GGE A;  3ZNH B;  1U4B A;  3MJW A;  1I19 A;  5FJP A;  2KMM A;  4JL9 A;  2IO3 B;  1DNC A;  2ZUB A;  1JMS A;  5IIL A;  4FJZ A;  1HXY D;  4G7F A;  2M0A A;  1MNS A;  4YR3 A;  4RPZ A;  1S0V A;  4R65 A;  4L1B A;  2HQM A;  3NVZ A;  4WJ3 B;  3W5U B;  2WYQ A;  4A3R A;  2GR1 A;  3JPS A;  1RXV A;  2BVG A;  2UU7 A;  3H8S A;  4PVJ A;  3WAM A;  1ZRN A;  4KLH A;  4EEW A;  1RFA A;  9ICS A;  3NRZ A;  3OG5 A;  3IG8 A;  3MBY A;  1W1S A;  2UUV A;  4GFI A;  3ISC A;  2DYM A;  4CF4 A;  2G4S A;  5IO9 A;  1NJX A;  8ICV A;  2MW5 A;  4IQU A;  3DHG C;  4GDK A;  4KLE A;  3R11 A;  2IGG A;  9ICH A;  1W1K A;  1PVQ A;  7ICP A;  5L6G A;  5H92 C;  1RLF A;  4KLF A;  1GRB A;  2OG9 A;  3NVV B;  4GIS A;  1ISN A;  5AK5 A;  2LD9 A;  2KK8 A;  4ECS A;  4EZ6 A;  2NQW A;  2RQ5 A;  2AGO A;  1QF6 A;  3NZU A;  4BV6 A;  2AKZ A;  4YR0 A;  2RRD A;  1A77 A;  2WP5 A;  4KPR A;  4RUC A;  2N9E B;  4BUG A;  2ICI A;  3AB5 A;  4IP5 A;  3VCN A;  1V1P B;  1SJD A;  4F4K A;  2OH2 A;  3PX6 A;  2H3Z A;  2ZIV B;  3TTE A;  1QLU A;  2R8D A;  3RJF A;  3C0P A;  5IIM A;  2RGF A;  3UQB A;  5J2F A;  5H2F U;  2O6V B;  4JK1 A;  3QZ7 A;  1SZH A;  3F2D A;  4H2A A;  5BMG A;  2V6O A;  1ECW A;  3KHR A;  2N4F A;  3HIL A;  4GDL B;  4GXI A;  1Q0W B;  1T3Q A;  2KTR A;  3PS6 A;  3HRD D;  2WF9 A;  4PVH A;  3LXD A;  1WXQ A;  4RQ2 A;  2ZCB A;  3DES A;  1KH0 A;  1SJE D;  1PVR A;  2W9C A;  1CMX B;  4XDD A;  4P0P B;  3TFR A;  1IPG A;  2KLG A;  2BGW A;  3Q14 C;  1JDF A;  2KN5 A;  3RF9 A;  2MUC A;  1Q1W A;  2LRU A;  2BKF A;  2K22 A;  2GL5 A;  3FJ4 A;  3A4R A;  3V5C A;  4FHJ A;  3VXW A;  1ENF A;  3N1Z C;  4C7Y A;  2KP7 A;  2KD1 A;  2I1J A;  2L05 A;  3F2C A;  2CDU A;  3V6J A;  2K8C B;  3ORY A;  4PHD A;  4IUM B;  1SE3 A;  2VH2 A;  4N6E B;  4GXK A;  2LUE A;  3RCZ A;  4YCX A;  1SWV A;  4DFJ A;  4OCZ A;  2ASJ A;  1COO A;  1KFY B;  4H4S A;  5DPR A;  4DSF A;  1DRG A;  2XN9 C;  8ICK A;  2HVI A;  4WQO B;  5KG6 A;  1TKK A;  5I1W A;  1N62 A;  2WX1 A;  1P43 A;  2GBJ A;  3PMN A;  3RB6 A;  4M9G A;  3VUW A;  5KTQ A;  3BY4 B;  3RMK C;  3OPS A;  4C8M A;  2WF5 A;  1XCT L;  1XF5 L;  3L54 A;  1X2I A;  3MGH A;  4PZF A;  4U6P A;  3JPN A;  2BYT A;  2CS4 A;  5JXV A;  2AXR A;  4F2S A;  3PO0 A;  4C8L A;  3F53 A;  4FDC B;  4IWP A;  4GDL A;  3ZVV A;  1N56 A;  2BS2 B;  5L9X A;  1IGD A;  2R8H A;  1RAX A;  3DBL I;  3MP9 A;  4QAY A;  3BQT A;  3N7S C;  5KT2 A;  3LYS A;  1NNL A;  1AOG A;  1TE2 A;  5AKZ A;  1P7F A;  4O3S A;  1IYF A;  9ICI A;  4JB1 A;  5AIC A;  4Y2X A;  2PP1 A;  4OW0 A;  4NEW A;  5ALP A;  2YY6 A;  5KL1 B;  1JW9 D;  2GR2 A;  1BPE A;  3QIJ A;  2WDQ B;  2ZEQ A;  3EW9 A;  4J9N A;  1L7N A;  1W1Q A;  3WAO A;  2Y3S A;  5F9N A;  2IHM A;  3PRM B;  3DG3 A;  3SI8 A;  2M19 A;  4J6I A;  5JCN A;  4M52 A;  3ZGZ A;  2FID A;  3RYT A;  2NMQ A;  1HTQ A;  3N4F A;  4C8N A;  3WKA A;  4GB9 A;  2KHW B;  4HRS A;  2PTZ A;  1H8C A;  2LGX A;  5KFN A;  2AXT U;  2N1R A;  3KD3 A;  4JUZ A;  1T0S C;  3PZP A;  5KG4 A;  2O6K A;  1KM7 A;  3OJU A;  2MRP A;  1ZQC A;  4M9N A;  3TAC B;  4RNM A;  3ZJU A;  1GRE A;  2HCF A;  4YQW A;  3CNH A;  4UBB A;  2VJ5 A;  2L52 A;  2FCM A;  1BNP A;  1RYS A;  1MBT A;  4KGS A;  2BQR A;  4F2R A;  3QEA Z;  4RCO A;  4W9H A;  4B6W A;  1YD8 U;  1TY0 A;  5EOZ A;  2HSZ A;  1O08 A;  4HYK A;  4NXZ A;  3GE3 C;  2JUO A;  1DGJ A;  1N63 C;  4CHK A;  1DOY A;  5JCI A;  1KRP A;  4M0X A;  2BYE A;  4USA A;  4LVS A;  1ELS A;  4GGB A;  1Z19 A;  4C4T A;  4DWI A;  4BKS D;  4EX6 A;  3NG0 A;  3ZDD A;  2MCN B;  4DBG A;  3PX4 A;  4J3O D;  4H4Y A;  2RPQ A;  1ZXI C;  4F4Z A;  3PM9 A;  1RWS A;  3RNG C;  4NM2 A;  2DEN B;  2YQE A;  4KVG B;  5G5G B;  1FHU A;  4GXB A;  1N5W A;  8ICQ A;  2L00 B;  1GAQ B;  4ED6 A;  1RYJ A;  3ONN A;  5IN7 A;  1PGB A;  3OJ3 A;  2QLT A;  4JB3 A;  1F3P A;  4WWN A;  3DV9 A;  3L4P A;  5J2H A;  3W1S A;  4E6M A;  1NI2 A;  2GBM A;  3KUC B;  3ES7 A;  4JX1 C;  3ETR A;  3VVW B;  4YD1 A;  4GLS C;  4XE0 A;  5FXF A;  8ICU A;  4KIK A;  1TZO A;  5AKX A;  3DBR I;  3S2A A;  1V5T A;  3I9V 1;  5CR0 A;  3UIO B;  4B9K A;  3I3T B;  1X6I A;  5BOM A;  8ICW A;  3GC2 A;  5KG5 A;  3OP2 A;  3Q3O C;  1E7U A;  2C28 A;  2GQU A;  4OO1 J;  1PGX A;  4DLG A;  3IHQ B;  4RQ1 A;  2Y4G A;  3VTE A;  2YTU A;  5DKW A;  4PGQ A;  2DX5 B;  2JH7 A;  2W8K A;  2J6U A;  3P1M A;  1ZMC A;  3PWI A;  1E7V A;  2NRV A;  2KHV A;  3FKY A;  2QB0 B;  3PG6 A;  4GN1 A;  3GO2 A;  2V4R A;  5D79 A;  2AGP A;  4NLG A;  1FEA A;  4RM8 A;  1V59 A;  1JML A;  2W82 A;  4YD2 A;  5KL8 B;  9ICU A;  2GOW A;  2X38 A;  4PGX A;  2PEA A;  3SEI A;  1CJE A;  4PL2 A;  1YQB A;  1GV4 A;  4L23 A;  3CRX A;  4QIW C;  1TS5 A;  2KFZ A;  1OQQ A;  2V9H A;  1XU4 A;  4G50 A;  1WZ3 A;  4RMA A;  3V6C B;  2PTX A;  4Z6C A;  3RB4 A;  2PI4 A;  2BBC A;  3A33 B;  5FR3 A;  2OZT A;  1QLT A;  1ZYQ A;  4YR2 A;  3IN5 A;  2K0P A;  2PMQ A;  3TEZ A;  4FN2 A;  2J3N A;  1T0R C;  2LXA A;  1VJ5 A;  3W5V B;  1QOB A;  2XO7 A;  4BJQ A;  3EFU A;  1YT3 A;  4TQ1 A;  1BQG A;  5KFF A;  4OVV A;  4ASW C;  2R8J A;  4K4H A;  3UQ2 A;  2R9Z A;  3MZN A;  1V1P A;  3Q3F A;  1JQ4 A;  3MHS D;  3QU5 A;  1ESF A;  1P9D U;  2HD5 B;  3GV8 B;  4O3M A;  3U4F A;  5AKY A;  4HNL A;  5JHA A;  2XY5 A;  5FJR A;  5FXP A;  1HEZ E;  4W9J A;  1TVA A;  3M9O B;  4K4I A;  3F2B A;  2XY7 A;  3BQ2 A;  2Y1I A;  2DZM A;  2EAN A;  2JQR B;  4LJP B;  1MDR A;  2J4X A;  3CYM A;  1SZP A;  5J2K A;  4HAI A;  2BKR B;  2Y5C A;  3PFR A;  3FYH A;  5AM1 A;  1ZDX A;  5AI4 A;  4DQS A;  2PVG C;  5FR6 A;  1WCN A;  2B0C A;  4HG0 A;  3CXB A;  2LEK A;  2WDT B;  1XS9 D;  1N60 A;  4ITK A;  1X9W A;  2WF6 A;  3P42 A;  2KNJ A;  3L0W B;  3EF6 A;  1L7P A;  2XCA A;  1TBE A;  1S8O A;  2CN1 A;  2OFJ A;  2K8C A;  1EBH A;  3NTU A;  3Q8C A;  3PWG A;  2KQ7 A;  4OHJ A;  5K8E A;  2PKO A;  2GGG A;  3U7Z A;  1J7B A;  4YVZ A;  4OJL A;  2M1M A;  2HMX A;  3POP A;  2WXG A;  4XUS A;  4DFM A;  4QZG A;  1RFK A;  4K1W A;  3ZVI A;  2INC C;  3PRE A;  3T3N A;  2C22 A;  4NM1 A;  2WXP A;  2P0I A;  4NV0 A;  1MI0 A;  2L83 A;  3VHT C;  5KG7 A;  1JN3 A;  2VRR B;  1I4G A;  2IZV B;  2Y5P A;  1WJU A;  4JN7 A;  3Q8P B;  1TK8 A;  3RJK A;  3S1D A;  1WGR A;  4IKG A;  3D2N A;  5DQG A;  1XNS A;  5J2C A;  4DSL A;  4G3X B;  1NU5 A;  4HVB A;  2PMZ C;  3KBB A;  3PLU A;  3WK8 A;  3DBL B;  4EFO A;  3R8B A;  5ALT A;  2ZIU A;  1U48 A;  4IM3 A;  3RGT A;  1F0X A;  1WGD A;  2MJE A;  5FXE A;  4ECW A;  3DBH B;  4RPY A;  4OVU A;  3PSI A;  2YVF A;  2F8L A;  3IHP C;  4EMI A;  1F44 A;  4GYP C;  2BC1 A;  2DF4 B;  3RR1 A;  2FMS A;  2RDX A;  1WG8 A;  4I6N B;  1L7M A;  3O65 B;  2LGY A;  3MKC A;  3ZTC A;  1IBX B;  4BAX A;  1K8R B;  4O95 A;  5D2M B;  4ZYN A;  4W9C A;  4G9B A;  4UAW A;  1MRA A;  5IAA C;  1BPZ A;  2KAC A;  4KLO A;  3JZU A;  3ZDM C;  2JY6 A;  4YWS A;  1K5O A;  1X9M A;  1I35 A;  3JYU A;  1WJN A;  2W8L A;  3WAP A;  1NEL A;  1A70 A;  1C4A A;  2BHN A;  4MFF A;  1L3S A;  1HA5 A;  1CUK A;  2JYT A;  4RNO A;  1LXD A;  1ZRM A;  4IL6 U;  3HX0 A;  2AJQ A;  8ICZ A;  1SGH A;  5EDS A;  1TK0 A;  4IS7 A;  1ZQW A;  3PT2 B;  5KG0 A;  1TT5 B;  1IYX A;  2KFN A;  4KX5 A;  4I27 A;  5EE0 A;  1EU4 A;  2QC8 A;  2JZP A;  2I5Q A;  2XCP A;  2GGI A;  4BBN F;  3NVZ B;  4MH8 A;  1F9J A;  4GC6 A;  1V49 A;  1JRU A;  5C0Y A;  3QC8 B;  2HTM E;  4HCD A;  2QPM A;  5BYQ A;  2B3A A;  1MQ3 A;  4GYP A;  3UGV A;  3SD5 A;  2BVF A;  4W9L A;  1NI3 A;  3NY5 A;  1PGA A;  2D11 A;  2FAZ A;  2HTH A;  2DHZ A;  1UA1 A;  4E0D A;  5AI5 A;  2N0S B;  1R4M I;  3V6H A;  3P2B A;  4MJS A;  4BFR A;  3T8Q A;  1SEB D;  4BKS A;  5KFC A;  2YML A;  4BGD A;  2HOF A;  4UB4 A;  3ML9 A;  1AQ6 A;  1XDI A;  3ZLH A;  1Q10 A;  2FKP A;  2HBJ A;  5CHG A;  3H6N A;  1FEC A;  2JZB A;  1MUC A;  2KWD A;  1RM6 B;  3TAN A;  1J19 A;  4MEM A;  4QZI A;  4CGZ A;  4JHM A;  2OHF A;  4M8N A;  4E4F A;  1S7M A;  3PV8 A;  1SJH D;  1Y8R C;  2EH9 A;  1SL1 A;  3LAE A;  2VFT A;  1I4P A;  3MR5 A;  3TAD C;  4F5P A;  8ICP A;  2LUM A;  2Y5B B;  4EEY A;  4FP1 A;  4AOF A;  2ISP A;  3WK9 A;  5AE3 A;  1X42 A;  2B76 B;  3DBR B;  4DXK A;  3B0X A; 
#chains in the Genus database with same CATH homology
 1FCL A;  3TSH A;  1MPE A;  3ABV B;  4MT5 A;  3AE5 B;  3AEC B;  1SIJ A;  4O1N A;  3FC4 A;  2G9H D;  5E6J A;  2DBY A;  1VJK A;  3SEB A;  1R7S A;  1TS2 A;  3MHZ A;  2AX5 A;  3VRB B;  1W1O A;  1T6B X;  1EWC A;  5G5G A;  1E9M A;  4JPS A;  1W1J A;  2KAJ A;  3Q8F A;  3NVV A;  2ONQ A;  4PVK A;  1RM6 C;  4RH6 A;  4YSZ B;  2WP9 B;  1ET9 A;  3OWE B;  3TEY A;  2E5A A;  1TJE A;  1FNV A;  1VAO A;  1TYG B;  3NVY B;  1ZP0 B;  4P6V F;  1NYQ A;  2P13 A;  1QT9 A;  1YN5 A;  1WVE A;  5HG2 A;  3IAM 1;  4JE3 B;  4RGO S;  2ZW1 A;  1XLQ A;  2MJ3 A;  1KF6 B;  3BYT B;  1DII A;  2WXN A;  4US8 A;  5EE3 A;  5D7G A;  3NRZ B;  4EC3 A;  5AE1 A;  3LYY A;  3DED A;  4C56 C;  3EGR A;  5FXD A;  3D2J A;  2J52 A;  5MPO A;  4NAW B;  4OZC A;  1E8H A;  1L5P A;  2E3T A;  1BML C;  4ZYS A;  1E10 A;  1KLU D;  2WQY B;  3EUB 3;  3AEF B;  3S1E A;  1X2G A;  3HSU A;  1FIQ B;  3NVW A;  4YSX B;  2NTT A;  2KN4 A;  1SB3 C;  1L0Y B;  1NYR A;  1C78 A;  1OFF A;  3FWA A;  4RGT A;  1JAL A;  1WGK A;  3P4P B;  4TQ0 A;  1WRI A;  3AEG B;  3A7U A;  3KLS X;  2VZK B;  3AED B;  1HQR D;  1XXG A;  1QLB B;  1E8G A;  1J7C A;  1Y56 A;  2JXT A;  1UUP A;  2EXR A;  3W8X A;  1ZE3 D;  4RFB A;  3SR6 A;  1SSN A;  3GP7 A;  4ARI A;  3JS8 A;  4R3D A;  5L6F A;  1L0V B;  2PLI A;  3SFD B;  1EWY C;  1SE4 A;  3BK2 A;  3BWU D;  3EA6 A;  4IDI A;  4D2K A;  3UI3 A;  1TY2 A;  1OQR A;  1F2R C;  2VAO A;  2UUU A;  1I4Q A;  3ZJV A;  1AYF A;  2MEK A;  1DZN A;  1FFV A;  1UWX A;  1VQZ A;  1SXT A;  2GRI A;  3W2D A;  2AQ2 B;  1C4P A;  1FIQ A;  3RJ8 A;  1AHU A;  1WVF A;  1QQR A;  3PQB A;  3V3X A;  1UNS A;  3FW9 A;  3FAH A;  1I19 A;  2MBR A;  2KMM A;  2Y3R A;  4KGR A;  3NS1 A;  1VZ7 A;  2BB5 A;  1L6U A;  4OZA A;  2W3S A;  1HXY D;  1UGJ A;  1KLG D;  2M0A A;  1ZXH A;  4L1B A;  1KRH A;  3NVZ A;  3TUO A;  3W5U B;  3HUI A;  3MC0 B;  4HKZ E;  4B0M A;  2BVG A;  4PVJ A;  3I99 A;  2K3U A;  3URY A;  1E6E B;  3NRZ A;  4YSY B;  2UUV A;  1ROE A;  1W1S A;  4YTN B;  4WIP A;  2MH7 A;  2DYM A;  1JCK B;  2PW9 A;  1EM7 A;  1QKZ A;  5BMI A;  1DOX A;  2VFS A;  2SEB D;  4NZL B;  2IGG A;  3AE3 B;  3C8Y A;  1W1K A;  5L6G A;  2W54 A;  3B9J A;  3TSS A;  3GSY A;  5H92 C;  1HZ6 A;  3NUH B;  3NVV B;  1TKE A;  2WS3 B;  2LMC A;  1GB4 A;  1K52 A;  1M4V A;  3U52 E;  1QF6 A;  1FFU C;  5I4D A;  2NQW A;  4GDK B;  2IDY A;  1ZDV A;  2WXO A;  4L2Y A;  3KQ4 A;  2V3N A;  1EU3 A;  4LTU A;  2RK5 A;  2AQ1 B;  2QIL A;  2WDV B;  3LLB A;  2ICI A;  3AB5 A;  1JWM D;  4LLG M;  5LNK 1;  1E0Y A;  5BYR A;  3P63 A;  1B9R A;  2WDW A;  1V1P B;  4MLA A;  5I1V A;  4XLO A;  2L32 A;  2WXQ A;  1N62 C;  4PWB A;  1L0X B;  1QLU A;  2R8D A;  2YVS A;  2N9L A;  2GB1 A;  1SBB B;  3D2H A;  3C0P A;  3ETR B;  3V05 A;  2MJD A;  4UDU C;  5AUK A;  2QMT A;  1D5M C;  5BMG A;  4H2A A;  1NEN B;  4GDL B;  1FFU A;  2BW2 A;  1T3Q A;  2WXR A;  3IT4 B;  3HRD D;  1L4D B;  4PVH A;  2FE8 A;  5FK9 C;  2Q85 A;  1WXQ A;  3R07 C;  1IBX A;  1MHX A;  1KH0 A;  1YQ4 B;  2PLP A;  1SJE D;  2VFU A;  2KDM A;  4XDD A;  3AE8 B;  2RPV A;  4DXG A;  3P4R B;  3TSJ A;  3MFG A;  4YWG G;  2K22 A;  3B9J B;  4PWC A;  1ENF A;  4C7Y A;  2I0K A;  3KWV A;  2WXJ A;  1QOG A;  2EKI A;  1SB3 B;  4N6E B;  1SE3 A;  4JWS C;  2I2Y A;  5EE1 A;  5FKA C;  1HSK A;  1QIL A;  5H8Y E;  2WLB A;  5C2T B;  1KFY B;  1E7P B;  2JU6 X;  4HKQ A;  2LHE A;  2XN9 C;  1VDV A;  1L6V A;  5I1W A;  1PDX A;  2DLB A;  1UXY A;  1N62 A;  2WXM A;  4XWT A;  1L4Z B;  1GOZ A;  1E0Z A;  1XCT L;  1XF5 L;  4PZF A;  1FXA A;  2IGH A;  3PZ7 A;  4HRO A;  5JXV A;  4AQ7 A;  2BYT A;  4RF1 A;  3PO0 A;  2AXR A;  4BCA A;  2FUG 1;  1F77 A;  1YMH E;  2J42 A;  3U2S C;  1X2H A;  2BS2 B;  2QEJ C;  1IGD A;  3IT6 B;  1I4H A;  5GXG B;  4OZB A;  3TEW A;  1XCQ L;  5G5H B;  3MP9 A;  3AE4 B;  1IGC A;  3VR9 B;  4C7Z A;  2QJL A;  4NJC A;  4YT0 B;  2G1E A;  1WWT A;  2R61 A;  1P7F A;  3BYY B;  3AE7 B;  4JB1 A;  3ZQ4 A;  5HHZ A;  4OW0 A;  4WUR A;  4XWW A;  3U4E G;  1JW9 D;  2WXI A;  1E8F A;  2P4P A;  1K53 A;  4YXD B;  4BBY A;  2O3G A;  2JSV X;  2WDQ B;  2BB6 A;  3TX1 A;  5AE2 A;  3AE1 B;  1W1Q A;  1PFD A;  4Q2J A;  2WXF A;  2Y3S A;  3S1C A;  2M19 A;  5EE9 A;  3HRD C;  3ZGZ A;  2NMQ A;  2K5P A;  1YN3 A;  2YEP B;  4HRS A;  1AHV A;  4WWM A;  4BC9 A;  1ZPS A;  3IAS 1;  1C79 A;  4ZRQ A;  2VZK D;  3ZJU A;  4RGN A;  1STE A;  4CQN A;  2BVH A;  1HZ5 A;  2WNM A;  3AEE B;  3P4Q B;  2L52 A;  4JAY A;  1MBT A;  4YTM B;  4KGS A;  2R2Z A;  4RCO A;  1D5Z C;  1SF0 A;  2ON8 A;  5BYS A;  1TY0 A;  1BXT A;  2BTE A;  1T5X D;  4KKJ A;  2PIA A;  4TSS A;  1YQ3 B;  4A90 A;  1DGJ A;  1N63 C;  3AE9 B;  1DOY A;  2RMM A;  4USA A;  1LO5 D;  2LGI A;  2W3R A;  5AWV A;  1XEE A;  4HJG E;  4WAF A;  5TSS A;  4PYT A;  4US9 A;  1C76 A;  4J3O D;  1N60 C;  1SE2 A;  1ZXI C;  3PM9 A;  1RWS A;  1DOI A;  3FIL A;  1D5X C;  1VZ6 A;  4KGT A;  2V0G A;  5G5G B;  2PTL A;  1N5W A;  3AMZ A;  4A55 A;  4MM3 B;  1GAQ B;  1RYJ A;  2N9K A;  3W8Z A;  3J9C A;  1PGB A;  1FRD A;  3HVD A;  3L4P A;  2BS3 B;  3RPF C;  3W1S A;  1PUT A;  2CU3 A;  1JRP A;  4JX1 C;  3ETR A;  1FFV C;  2GQT A;  2IJ0 A;  1N63 A;  3AH7 A;  1YN4 A;  4GLS C;  5ADZ A;  4XE0 A;  5FXF A;  1TZO A;  3CWI A;  3E56 A;  2PMV A;  3I9V 1;  3AE2 B;  2Q4W A;  3NZ3 A;  1AW7 A;  4KX6 B;  2JWU A;  1FO4 A;  3DWM A;  3FW7 A;  1IUE A;  2JYE A;  1QOA A;  2GQU A;  4PVE A;  3Q8A A;  1PGX A;  4XDC A;  3AEA B;  2Y4G A;  2QKN A;  4YTP B;  3VTE A;  1FNU A;  1NVI D;  3P1M A;  1YNT E;  1XLO A;  1XLP A;  1ET6 A;  2RDG A;  1DIQ A;  1N5X A;  2M56 B;  2WU5 B;  5D79 A;  3VQI A;  1GPX A;  1YJI A;  3NVW B;  1JML A;  2W82 A;  4TVY A;  4ZOH C;  3ZJT A;  1D4B A;  2X38 A;  1C9F A;  3BVZ A;  1CJE A;  2QSD A;  4ZHO A;  4L23 A;  3RJA A;  3FIL B;  1F0Z A;  1V8C A;  4DQO C;  1TS5 A;  1OQQ A;  2BBC A;  1JRO A;  5FR3 A;  2SAK A;  2WXL A;  1QLT A;  3SFE B;  1JWB D;  2K0P A;  4LK0 M;  3S1F A;  3TEZ A;  1I4R A;  3Q8B A;  1UWM A;  1JWS D;  1N61 A;  2ZW0 A;  3KWL A;  4REZ A;  1QOB A;  3W5V B;  3MJ5 A;  5T8I A;  5HQX A;  2PLS A;  1FNW A;  4TQ1 A;  2WXH A;  1AHZ A;  2H88 B;  1V1P A;  4M0W A;  1JQ4 A;  5HMR A;  1MVK A;  2EEL A;  1ESF A;  4IOI E;  3AEB B;  3LB8 C;  2DWQ A;  5FXP A;  1HEZ E;  1CQV A;  2JQR B;  2PVO D;  2TSS A;  4FXC A;  1NEK B;  4HEA 1;  3BVM A;  1CZP A;  2J4X A;  1AN8 A;  2QIE B;  2N7J A;  2Y3A A;  1FD6 A;  2Y5C A;  3N9Y C;  4UD8 A;  1ZDX A;  2PVG C;  2Z8L A;  2BS4 B;  3ZYY X;  2L1A A;  1XO3 A;  4HG0 A;  4RF0 A;  2WDR B;  1JWU D;  1N61 C;  3LXF A;  4TVW A;  2Y08 A;  3AV8 A;  2LEK A;  3E9S A;  1N60 A;  4ITK A;  1I7H A;  5BMH A;  3P42 A;  1ZUD 2;  3I57 A;  1AWD A;  1C77 A;  2D5G A;  1FEH A;  2VFV A;  4B0E A;  3A7A A;  4PT5 A;  3IXS A;  3W9C B;  1FXI A;  4EE2 A;  1JWA D;  3NVY A;  3Q8C A;  4OHJ A;  2E6X A;  5K8E A;  2PKO A;  3U7Z A;  1J7B A;  4KKI A;  2RDH A;  4ML8 A;  3POP A;  2WXG A;  1RFK A;  2INN E;  3WCQ A;  3T3N A;  2WXP A;  1W1L A;  2BT6 A;  3PZ8 A;  1FMA D;  2H89 B;  1MI0 A;  2L83 A;  2LFI A;  3T3O A;  1YJJ A;  1I4G A;  1B1Z A;  1K50 A;  3Q69 A;  2Y5P A;  1FM0 D;  3RFZ B;  2JX5 A;  5D3D A;  3S1D A;  2KQ4 X;  4IKG A;  2I38 A;  3BK1 A;  2ACZ B;  4ZOH B;  3BW7 A;  3R8B A;  4WH4 A;  1J7A A;  1TS4 A;  4TMA B;  1F0X A;  2MJE A;  5FXE A;  1VLB A;  1ZR6 A;  2XNA C;  1DYQ A;  2J53 A;  2YEP F;  4P16 A;  1V97 A;  2W55 A;  3AM9 A;  4OVZ A;  1D6E C;  2IPK D;  2WU2 B;  1BUI C;  1VRA B;  1N5W C;  3NS1 B;  2FBW B;  3TEX A;  1IBX B;  2P3H A;  3DWG C;  4JWU C;  2GI9 A;  3P4S B;  1W1M A;  4O95 A;  1ZXI A;  5D3I B;  2KAC A;  2WXK A;  1I4X A;  1MBB A;  3A7R A;  2OAI A;  1C4C A;  3FW8 A;  2Q5W D;  1K51 A;  2AQ3 B;  1A70 A;  1GB1 A;  1C4A A;  1HA5 A;  3R2T A;  2JYT A;  1KTK A;  4DXF A;  5C3J B;  4MAC A;  2CJO A;  3KJM A;  1FCC C;  1TKY A;  3SR6 B;  4RNA A;  5EE0 A;  1EU4 A;  3B2F A;  2JZP A;  3R2I A;  1QOF A;  5HHD G;  3B2G A;  2K9X A;  4BC7 A;  3EUB 2;  3DQ0 A;  3BVG A;  3HVZ A;  2V4I B;  4MH8 A;  3NVZ B;  2INP E;  3H8H A;  4N58 A;  4ZRP A;  3BZD B;  1PYW D;  3AN1 A;  1ZOY B;  2OED A;  3CIR B;  3BII D;  2HTM E;  1XLN A;  2QPM A;  3AE6 B;  1VZ8 A;  5BYQ A;  2NTS A;  2IGD A;  4A9A A;  2BVF A;  1F2R I;  1V1O A;  1NI3 A;  5AUI A;  1TKG A;  4A8X C;  5HFY A;  1W1R A;  1MHH E;  1PGA A;  5G5H A;  4AS1 A;  1P7E A;  1TS3 A;  2N0S B;  4N59 A;  1SEB D;  4RGM A;  1ACC A;  4A6Q A;  1WYG A;  1Q10 A;  1CK1 A;  3O13 A;  1RM6 B;  4C80 A;  2KWD A;  1FRR A;  3GS2 A;  3D2D A;  2VFR A;  2V3P A;  2HDE A;  2OHF A;  3VRA B;  4OAL A;  1SJH D;  3LAE A;  4ARC A;  2DYO A;  2VFT A;  3GB1 A;  1I4P A;  2LJI A;  2CJN A;  1WSP A;  5HI1 A;  4ZHP A;  3Q8E A;  3W8W A;  1VR9 A;  2LUM A;  1T3Q C;  2IPI A;  4DNS A;  2LHD A;  4NAM A;  5AE3 A;  2B76 B;  3VR8 B;  4WQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...