2W3SA

Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
462
structure length
450
Chain Sequence
MEIAFLLNGETRRVRIEDPTQSLLEWLRAEGLTGTKEGCNEGDCGACTVMIRDAAGSRAVNACLMMLPQIAGKALRTIEGIAAPDGRLHPVQQAMIDHHGSQCGFCTPGFIVSMAAAHDRDRKDYDDLLAGNLCRCTGYAPILRAAEAAAGEPPADWLQADAAFTLPAFLPETSDALADWYLAHPEATLIAGGTDVSLWVTKALRDLPEVAFLSHCKDLAQIRETPDGYGIGAGVTIAALRAFAEGPHPALAGLLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPLEDFFLEYRKQDRRPGEFVESVTLPKSAPGLRCYKLSKRFDQDISAVCGCLNLTLKGSKIETARIAFGGMAGVPKRAAAFEAALIGQDFREDTIAAALPLLAQDFTPLSDMRASAAYRMNAAQAMALRYVRELSGEAVAVLEVMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords XANTHINE DEHYDROGENASE
publication title Mechanism of Substrate and Inhibitor Binding of Rhodobacter Capsulatus Xanthine Dehydrogenase.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 125
structure length 450
sequence length 462
chains with identical sequence C, E, G
ec nomenclature ec 1.1.1.204: Transferred entry: 1.17.1.4.
pdb deposition date 2008-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
A PF01799 Fer2_2 [2Fe-2S] binding domain
A PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 2w3sA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2w3sA01
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 2w3sA03
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 2w3sA05
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2w3sA04
4IDIA 2PLIA 1QOFA 5AE3A 1AWDA 1X2GA 3B9JA 1W1LA 3DEDA 3HUIA 4US9A 2Q5WD 1QOAA 1QLTA 3A7RA 1W1JA 4US8A 3A7AA 5AE2A 3W5VB 2N0SB 3L4PA 2WDRB 3AEGB 3I99A 3R07C 4BCAA 2QKNA 2VFUA 3AEDB 3NVYB 1KFYB 1N63A 2DWQA 1J7CA 1ZXIA 3W8WA 5H92C 1L6VA 3AE6B 2VAOA 2WS3B 1AHVA 4N6EB 3P4RB 3VRAB 1WGKA 2MBRA 4BBYA 3SFDB 2L83A 2EXRA 5G5GA 2MJEA 3FWAA 1FXAA 4JX1C 1W1RA 5HHZA 4ZOHC 2PLSA 4HG0A 4WWMA 2MJ3A 1RFKA 2Y5CA 1E8HA 4PVJA 1QOGA 5FXDA 3FC4A 4TVWA 2K9XA 1TKGA 1XLQA 3AE4B 3A7UA 1ZR6A 3P1MA 1UXYA 2OHFA 3NVVB 3B9JB 2DBYA 5EE1A 1N62A 5HMRA 1GAQB 4O95A 2LEKA 2GQUA 2BVGA 4UD8A 3FW7A 3P4QB 1WWTA 1XLNA 4PVHA 2QJLA 1N60A 2K22A 3JS8A 3C0PA 4PWBA 3SFEB 1W1KA 3TSHA 1DOYA 1WVEA 3FW9A 3P4SB 1WVFA 4JAYA 1N61A 2BS3B 1T3QC 5FXEA 1DGJA 3BW7A 1SB3B 1V8CA 3D2DA 3ABVB 5FXFA 1JROA 1QOBA 4JB1A 5G5GB 1QLBB 5HQXA 1MBTA 5FXPA 2WDQB 1W1SA 1NENB 2G1EA 1FFVA 1DOIA 1YJJA 4YSYB 1ZP0B 2K5PA 3D2JA 4N58A 3FW8A 3VR8B 3NVVA 1FRRA 2P3HA 5D79A 3AEEB 3WCQA 4DNSA 4XLOA 2ACZB 4P6VF 4PZFA 1ROEA 5ADZA 4PYTA 1TKEA 1NEKB 5G5HB 1NVID 3LAEA 3NVWB 2QPMA 3FAHA 1XO3A 2VFSA 1DIIA 1AHUA 3AECB 4ZHOA 1RM6B 3S1DA 2JQRB 3NRZA 1HSKA 3PO0A 3AEBB 1JWBD 1KF6B 1SF0A 5EE0A 2W3RA 3ETRB 1TYGB 2PVOD 4YSZB 4PVEA 1MBBA 1RWSA 2W3SA 2L52A 3CIRB 1ZXIC 3NVZA 1PDXA 4ML8A 2VFTA 1JW9D 4ZHPA 1E10A 3VRBB 5C3JB 1L5PA 1AHZA 1JALA 4YSXB 2BS2B 3VTEA 1FRDA 1WYGA 2AX5A 1PUTA 1VLBA 1TKYA 3BIID 3CWIA 1JRPA 3LB8C 1R7SA 1E0ZA 1RYJA 4C7YA 1KRHA 1E8FA 1F0ZA 5G5HA 3NVWA 4EC3A 1OFFA 2CJNA 5H8YE 1DZNA 3DWGC 3SR6B 4BC7A 2CU3A 1L6UA 1GPXA 3HRDC 4KX6B 4HRSA 4WQMA 3NRZB 3ETRA 3AE8B 1T3QA 1A70A 3S1FA 1VQZA 2WLBA 2P4PA 1ZUD2 2Q85A 2BS4B 4YT0B 2PKOA 1NYRA 2W55A 1V97A 4C80A 3NVZB 3P4PB 4YXDB 1FIQA 1N5XA 3NS1A 4OALA 1FFUA 3DQ0A 1IUEA 1E8GA 2NQWA 4ZOHB 3W8ZA 3DWMA 5MPOA 2WU2B 1W1MA 1PFDA 3AEFB 5AE1A 1YQ4B 1WXQA 3PM9A 1E0YA 1N5WC 2WDVB 2RK5A 4YTPB 3B2GA 2HTME 2VFRA 4USAA 1XLOA 3AE9B 1DOXA 2CJOA 1E7PB 2PIAA 3AE2B 1AYFA 4YTMB 3SR6A 1FXIA 4FXCA 1L0VB 3EUB2 1OQQA 1B9RA 1J7BA 2BT6A 2W54A 3KWLA 1UWMA 1ZOYB 2OAIA 3AE1B 1FM0D 1JQ4A 3B2FA 3AV8A 4JWUC 3KJMA 2P13A 3GSYA 4N59A 1F0XA 1TJEA 3AE3B 2E5AA 2KMMA 5AUIA 3VR9B 3HRDD 3AE5B 1N63C 3LXFA 2H89B 1CJEA 5EE9A 1JWAD 1WRIA 3EUB3 1XLPA 1SB3C 3TX1A 1E9MA 5GXGB 1I19A 1FIQB 2BVFA 3NS1B 1W1OA 1OQRA 3AB5A 4C7ZA 3D2HA 2Q4WA 3S1CA 2M56B 1QF6A 2WQYB 2O3GA 4TVYA 2E3TA 1FO4A 2PVGC 2MH7A 1NYQA 3AMZA 2H88B 1X2HA 4YTNB 3ZYYX 3LLBA 1YJIA 4A9AA 2VFVA 4PWCA 3W9CB 2AXRA 2EKIA 5AUKA 2I0KA 2YVSA 2JX5A 1N62C 3AH7A 1VDVA 2QIEB 2WU5B 3HVZA 2R8DA 1J7AA 3AE7B 1DIQA 1W1QA 1N60C 4ITKA 4HROA 4JWSC 5EE3A 2GQTA 3NVYA 4PVKA 1E6EB 2FBWB 1RM6C 4BC9A 2BVHA 1N61C 4LTUA 3S1EA 1EWYC 3TSJA 1SIJA 3AM9A 1VAOA 2KAJA 5C2TB 1VJKA 1I7HA 1NI3A 2R2ZA 3AN1A 2MJDA 3RPFC 2WP9B 3W5UB 2M19A 3P63A 3AEAB 3W8XA 1FFUC 4MLAA 1FFVC 1CZPA 1N5WA 1FMAD 1QT9A 1YQ3B 1QLUA 2B76B
chains in the Genus database with same CATH superfamily
3AU4A 3AQEA 2HQMA 1F2RC 2REXA 4TURA 1KKXA 3KWVA 4P1BC 5AE3A 1RQNA 1AWDA 4M2YA 2LZ6A 4K3CA 5DQIA 3F5EA 3IP4B 3JYUA 3C28A 1P3QU 7ICJA 2AL1A 3EJEB 1SIFA 4US9A 4FP1A 3ZXVA 2Q5WD 3JPTA 2HW3A 5DQHA 3KHGA 2PFNA 4IRKA 3THVA 1IGCA 3UIPB 2AYOB 2LHDA 3A7AA 4DHZE 1KSPA 5AE2A 5ALNA 2ASDA 3MC9A 2G08A 2ZJAA 5AKLA 3DBHI 3TEZA 3FYHA 1S0MA 5ALIA 2GBJA 1I42A 3R07C 3PZPA 3RNGC 2RDXA 1Z00A 2VFUA 3ZLFA 5J0UA 4GOCA 5HR7A 2IJ0A 3O13A 1XT9B 2J52A 1GXFA 4DHJB 3EHVA 5AI4A 3ISDA 5ALSA 2RR9A 3SAHA 2DYMA 3GZNI 1J7CA 3OZYA 1XU4A 1ZXIA 4GLXA 1UD7A 3FKYA 3IG3A 2JV3A 4NAMA 2NBWB 3VFCA 3DH9A 4EBCA 1COOA 4ANUA 2ZJ8A 3TUOA 4RQ8A 4QZIA 3ECIA 1WM3A 1SE2A 2HVIA 3IG8A 3P4RB 3EEZA 3VRAB 3Q14C 1STEA 3H4KA 4OJPA 2O6KA 4WAAA 4BBYA 3KLSX 2F44A 3V7LA 3CYMA 2L83A 4TUQA 4AOFA 5FJUA 2MJEA 2WHIA 4II2B 3OHBA 1Z1BA 3SDLC 3VC6A 3FWAA 4B95A 1UUPA 3STPA 4ED0A 1FXAA 4JX1C 4XDDA 5HHZA 2KFJA 1B1ZA 3BVZA 2UUVA 4ZOHC 1B22A 2KN7A 2LUEA 5AKEA 2I5HA 1T0YA 2BWES 3KVFB 3L10B 4KLQA 4PYUA 4HG0A 1D7YA 4FBUA 1RFKA 4F4YA 4I2FA 4RQMA 3ZKJC 2RDBC 3A4SC 2NRZA 1R4NI 2I2YA 4EENA 3K4GA 3TFRA 1RXWA 1MOKA 3D47A 4BKSD 2W03A 7ICQA 1MUCA 3IDWA 2RABA 3BVGA 3TL5A 5B66U 3AE4B 4TUSA 3IFWB 3A7UA 1WJ6A 1ZR6A 3Q45A 3DHGC 3NVVB 2Q4TA 3CAWA 3PX6A 5EWEA 5HMRA 4HEA1 3UQ0A 3A0HU 5AI8A 4WQOB 4QZ8A 3V62A 4AJWA 1H4RA 1QSSA 3PZDA 2LYHA 4CF3A 1WGDA 2AKMA 3FDSA 3F2BA 4O3MA 2CHXA 5KFCA 3GILA 2GQUA 1WUEA 2MBBB 3T9PA 4PGQA 2BVGA 1IXRA 1XLNA 1L3VA 4RQ6A 3QA8A 3H0MB 5DBAA 2ASJA 1SL1A 4MGYE 4P4OA 3V5FA 2NVKX 2MUTB 2QJLA 5J2KA 8ICHA 3M9OB 2UVRA 9ICUA 1OEYA 1UBIA 2KJ8A 3B1LX 3JS8A 1Z5SB 3C0PA 2PMQA 4DQSA 4MF8A 1DYQA 4EWJA 3PMLA 1RG6A 5DDYA 1DOYA 2GH5A 4UASA 2WOIA 3UXKA 5GTHU 2IGGA 1WVFA 1TK5A 4ASWC 4MDKE 1X6JA 2K25A 4KITB 1SKWA 4P4PA 9ICWA 1S3SG 1DGJA 5KFFA 3M95A 2PMZC 3BW7A 2ZIWA 2HHTA 4HN8A 2K3UA 2Y0SF 5KT3A 3OW1A 4J9LA 1LO5D 1E8YA 4H4YA 1SBBB 3TKAA 3Q3OC 4GDKA 2B6GA 5C5JA 2WXIA 2LFIA 5G5GB 1WIAA 2PMZF 2DNFA 2GLEA 4EFOA 5CA7A 1MBTA 4JV0A 5F9LA 5DDMA 5BMIA 2FLNA 3C2KA 3B08A 2AQ1B 4GXBA 2WDQB 1W1SA 2E5SA 5F9NA 2G1EA 3DBRB 2V4RA 1FFVA 1DOIA 1UA0A 4YSYB 2H3ZA 3RH4A 4ED8A 2CPRA 1TZOA 3K1ZA 5HI1A 3EC8A 3T5LA 1QCKA 5L95C 2KJ6A 2HMXA 2QB1A 2XH7A 3Q8QB 4IQUA 2N7EA 4Q2JA 3NVVA 1MJDA 2BDUA 2CHZA 3H8MA 4MKSA 3VA8A 3KHLA 1HUZA 1VZ8A 1DK3A 3IAS1 2F1IA 2E1FA 4XLOA 4RNMA 4RGNA 1X9WA 1TV9A 4OCZA 4RM8A 1D8LA 3GD3A 2VRRB 1FEHA 2BCSA 7ICKA 8ICQA 2BB6A 1HUOA 2L0TA 3CGCA 4OHJA 3T8MA 2JZZA 5G5HB 5K8EA 2QB0A 5L1LA 1YN4A 2HBJA 2OXOA 3NVWB 1DXLA 3FAHA 1XO3A 4HJKA 4L2YA 4OJ5A 3DOWA 3GB1A 2PJHA 3SN0A 4JN7A 2HHUA 5BYRA 2KHWB 1ZQEA 3MDCA 2HJ8A 4RZRA 2K0PA 1R4MI 2ZIXB 1E8ZA 1WJNA 4ZHOA 2JZPA 3S1DA 4EM3A 3NRZA 5DG8A 4KLEA 4IR1A 2L7RA 3PO0A 4DSJA 3AEBB 2WXLA 3E56A 3L17A 3RH6A 4ECZA 1KF6B 3FYYA 1SF0A 1OEPA 3PW4A 2BC0A 2LGSA 1O03A 3UMBA 3RITA 1GG3A 1MDRA 3QYPA 2NTTA 2PVOD 4ECRA 3A9KB 5AKIA 4DSEA 4RGOS 1GRTA 3VDGA 2BQ3A 3QEBZ 1MQ3A 4I27A 4PL2A 2HXUA 1PDXA 2JWZA 3U7DA 4GRTA 2LHTA 4RQ2A 2BPFA 2LMRA 2IOHA 1MO9A 1XS2A 4EUTA 3Q8RB 4AUQC 3KHRA 4F5NA 4NV0A 3TFSA 1MG4A 1L7PA 1ONEA 3QIJA 5JCLA 1SJAA 2GGJA 4K2SA 1ZQDA 3BQTA 2D3AA 3OZMA 1KBUA 1WYWB 1L5PA 4TQ0A 1SKSA 5C3JB 4R8UB 1NJZA 4UW9A 4Y2QA 3ZNID 4DHGA 1JALA 1UBQA 5IIJA 4F4ZA 4ED2A 1K51A 2G9HD 4H4PA 2CN1A 4X57B 2F8KA 3EANA 1ZQSA 4OZAA 4UAVA 3F5AA 1WYGA 1HEZE 2NYVA 2EQ6A 2UU7A 1ZQPA 4TUUA 1Z4OA 3B0YA 4WAFA 1ZD3A 1KCZA 3Q2AC 1JRPA 4IT1A 5FJOA 1YX6B 4LNIA 3DJJA 2ZIUB 1E0ZA 3FXGA 2BPSA 2FE9A 2GO7A 4G11A 2KSOB 2G09A 4C7YA 5KFPA 4YMMA 1MPEA 3A0BU 1RYJA 3EECA 4GSWA 2Y5BB 3VXWA 3SQSA 5G5HA 1XCQL 4FZLA 4XRHA 4EKUA 1V5OA 3NVWA 4LK0M 3N1YC 3KZIU 1HJPA 2GB1A 2TPRA 4UARA 1YD8U 2CJNA 4KZCA 4AJYB 4E8GA 2ZIVB 3GY1A 3ALRA 4BC7A 1KTQA 1JPMA 4JHMA 4HDOA 2CU3A 4RUAA 3HRDC 2P88A 4CQNA 2MA9B 2C2EA 5ALRA 2HCFA 7ICIA 1MN8A 7ICEA 3QAQA 5AKYA 2WTFA 3PR5B 3CYJA 3AQFA 1ZRMA 1KRPA 3AEVA 3BZKA 1TE6A 5F3XB 1A70A 9ICSA 1ET6A 2JYTA 2KQ4X 2WLBA 4FJVB 1NU5A 5FS6A 2PMVA 1X40A 2P4PA 1XNSA 5FS7A 4ECXA 2R8GA 3VHTC 4UAYA 4F1SA 5AEKB 1TKDA 4FHKA 2E6XA 2WYQA 4EZKA 5BPCA 1MG8A 1MQ2A 4NLNA 2PPGA 4FI4A 1NJWA 3ZUNA 2JK6A 2CS4A 1D5XC 2W55A 4K3BA 2PS2A 3QQ8B 4GGHA 2HHWA 4RQ0A 2WXGA 3G6VA 1Q10A 5CP2A 2GMIC 5AM2A 1V97A 3NS8A 5JCKA 3MC0B 4E5TA 1SE9A 2K39A 1OW5A 3NS1A 2LVOA 1Q8KA 1E8GA 3S2AA 2QJMA 4KLSA 1Q1WA 4R8UA 4ZOHB 3V4BA 4DS4A 4DDID 1K50A 3DWMA 3HJEA 4KZ0A 1L7OA 3MTNB 2KANA 1GV4A 3GU3A 2M0NA 1PFDA 2NVUI 1NK6A 3AEFB 4A8EA 4Z6FA 1WXQA 1ECQA 2KZMA 1SL2A 4R3DA 1UZXB 4UATA 4NJ7A 1E0YA 4GC7A 1N5WC 3IHPC 5JCIA 5AM1A 2ZIUA 4JPSA 3ZJTA 2X99A 1P7DA 3H7SA 1MI0A 2KSOA 2MU2A 1SWVA 2YB1A 3M3JA 3PT2B 4OZBA 4YL8A 5HHDG 5AZGA 1GESA 3QZ7A 4J1OA 1JWMD 3ML8A 3ALBA 5TR3A 1S9FA 2QARA 4I6LB 1S8OA 9ICIA 4IP5A 2DHZA 1PGBA 2ZIVA 4FZMA 1FCCC 2JRHA 4W9GA 4OZCA 1F3PA 1BNPA 2CHWA 2KX3A 3N4FA 2MRPA 2LASA 4CRXA 1L0VB 4CF4A 1TK8A 5FKAC 1J7BA 4FZNA 3V6EB 3ZRCA 2W54A 1ZRNA 1WR1A 1ZOYB 4JQWC 5LXIB 2FKPA 4DFDA 3MJWA 5E6JA 1GJZA 5FJRA 5J2RA 1PK3A 2KDMA 1EU4A 2RPQA 4JWUC 3B97A 3DG6A 3MC1A 1ISNA 3JPPA 5AK5A 3QFAA 2EQYA 2K8HA 1F0XA 1TJEA 2XY6A 2PGWA 7ENLA 1GC7A 2KN4A 2POZA 3GO2A 2KK8A 5CR0A 4JLCA 2ZXIA 5EE9A 3BVMA 2X8HA 3UMCA 1X9MA 1BZLA 2D07B 4UAUA 5IA7A 1UT8A 1UWXA 1E9MA 1T3NA 2KX0A 4IKGA 5GXGB 4H4SA 4LLGM 4IWQA 2X8XX 1DGSA 4DHJD 3IJIA 4XWTA 4P4MA 1FIQB 4F5OA 3ZIMA 2BVFA 2N1RA 2FMQA 1J0GA 1W1OA 3OPSA 2VH2A 4I29A 4E4UA 4OJLA 4QJFB 1V1OA 2ODGA 4ACFA 1YQZA 4RQ3A 4FADA 3L3FX 2W04A 4ANVA 4GISA 2MSED 1CRXA 1KW4A 3OJ4B 2XIDA 2ISOA 3ZW3A 1QF6A 1ZQOA 3N3KB 4MEXA 4M00A 2H3QA 5L6FA 5DB9A 1SV0A 5E79U 4LNKA 2GRTA 4GU2A 4EQSA 2PVGC 1RVKA 2R8HA 3V72A 1WZ3A 1MDLA 3AMZA 2H88B 1X2HA 4NZLB 3ZYYX 2BC1A 1RDFA 2YY6A 4A9AA 3BQ7A 3KLJA 1EM7A 2YVSA 1UELA 5AWVA 2K6DB 1FXTB 4A6GA 1EC8A 3FJ4A 2WF5A 5JU5A 1IPGA 2HHSA 1XCTL 2QIEB 1K52A 5JRTA 4RT3A 2JXXA 3H7VA 2WU5B 2XC9A 2DF4B 4NPNA 3V6KA 3KH0A 3HSUA 1J7AA 2W9NA 3RNFC 2KICA 5TSSA 2XK5B 4BBNF 1EU3A 4EBDA 3QU7A 4ZRQA 2A4ZA 2X50A 2JGAA 3NUHB 1L3SA 2GRIA 4A3OA 3NVYA 2LJ5A 4HKQA 1PYWD 1E6EB 1IP9A 2M0XA 4FFDA 2ICIA 4NEWA 2OCEA 2BVHA 3PQBA 5J2AA 1YIWA 5AI9A 1MC8A 4XQ8A 4KPLA 4P1CC 5E6NA 4HPLB 3M6ZA 4X2PA 1ZXHA 5BOMA 2F1JA 4ZH4A 3L8KA 3C23A 1QSLA 4Y2VA 5ALTA 1SIJA 3AM9A 4TQSA 1VAOA 2WBAA 3I6TA 1CI4A 4LNNA 4PGYA 4F2SA 1SGGA 5C2TB 2QDDA 1PGXA 2A1JA 2ONEA 5FS9A 4KLUA 3ZD8A 4HCDA 3C1YA 3DFHA 4BKGA 3RPFC 4Y2SA 3W5UB 2LXCA 3OP2A 2C3DA 1WWVA 2F8LA 2VJ4A 5KFMA 2KWUB 3NZGA 2VH1A 5C23A 3IJQA 4F4XA 1FFUC 2F76X 8ICAA 1WX9A 3GE8C 4MLAA 1ZQXA 2FPLA 5H2FU 1NKCA 2KVRA 1FFVC 2UYZB 3C0RB 1YMHE 3TSSA 1YQ3B 2OO6A 4KKIA 4RPYA 1IIPA 3N1ZC 2J6UA 3E2EA 4IDIA 4S0RA 1ZQWA 3MC8A 1RAXA 2O6VB 3NG0A 4Q44A 4G50A 2IY1B 1HZ6A 3JW7A 2D8CA 4IHCA 4ENLA 1QOFA 3HT3A 1E5WA 1ZQCA 2WXJA 3VCNA 5CHVC 3U2SC 3ZTDA 3RI7C 3DEDA 3VVWB 1RYUA 1ESFA 2LVQA 2WWZA 3ZRFA 3TMPB 2KWCA 4C8KA 3UIOB 2JZBA 1QOAA 2I1JA 3W1YA 1JDFA 4EX6A 3PNCA 1W1JA 3OTQA 1MHHE 1TTNA 8ICVA 2XK5A 4EMWA 3NUQA 1C3TA 3W5VB 2ZUCA 2MX2A 2WX1A 3GQCA 5L1IA 4BDPA 5AZHA 2P35A 5KL1B 4NAWB 3RYTA 1SJCA 3S6JA 2N0SB 3E58A 5AKJA 3PW0A 5ALOA 2YVJA 2L0FA 1LXDA 3UM9A 2D2QA 5EOZA 1QTMA 4RQ7A 2NMQA 4F4RA 1I4QA 3RNCC 1OJTA 3NOBA 3WKCA 3PVLA 5E6OA 1WXMA 1V59A 4M04A 4EZ6A 4HYRA 3RNMA 2G3QB 3DBLI 2R2QA 2MSNA 4DL7A 3N97B 1Q1OA 2I9GA 3AE6B 5KHQA 2VAOA 2RQ5A 1ZPSA 2EQ9A 2JEGA 3DDCB 3LXDA 3K1GA 1WGKA 2GBKA 1BQGA 4JWMA 1WG8A 1KLNA 2FLLA 1S7MA 2EXRA 4HPMB 3G6XA 4B0MA 1YN5A 3KHHA 3QUQA 3GS2A 2BGWA 1W1RA 4DF8A 1LVLA 1VZ6A 1SXDA 3JSVA 4MJSA 1EBGA 4WWMA 1L4ZB 2MJ3A 1UA1A 3R7RA 5G2NA 3W2DA 5DG9A 3H6NA 2K4HA 4HCLA 2KACA 2Y5CA 2GOWA 4PVJA 4O3NA 2O6VA 5J18A 2LHEA 3M63B 3HKZF 1Z4NA 4DSIA 3B0XA 2YVCA 3LK9A 1GETA 4KX5A 2KTQA 4C4SA 2WF8A 3RCZA 3VTUA 2GH1A 2PA6A 4RGMA 5IOIA 1L8OA 2EH9A 2H3FA 2NTSA 2WP6A 3P1MA 3TACB 4JQ9A 4GFIA 4C8OA 3KYCD 1U4AA 1V85A 1EC7A 4KKJA 2YVGA 2JXJA 5KFRA 1GAQB 4YFKA 1P1AA 1A76A 4O95A 2W9BB 3Q8BA 4UD8A 7ICSA 1DOQA 2KZZA 3TAQA 1K8RB 1WR6E 2KHVA 2XBBC 3P4QB 1K5OA 3R25A 4O0IA 2LPEA 1L0XB 1WY8A 4GMVA 3VUWA 3ED5A 3TQ1A 1N60A 2IO2B 2K22A 2LBOA 3HWTA 1Z00B 4Z6EA 2ZZCA 3LDAA 3ENEA 2PI4A 4F4KA 5CEHA 1BXTA 1T7PA 1LFDA 3SFEB 6ENLA 4DF4A 1L5UA 2PTXA 3ZGZA 5HFYA 4CYEA 4DFKA 5CB1A 5J29A 4JAYA 1S10A 7ICMA 2BS3B 1V80A 3RNAC 3PG6A 3RN9C 8ICRA 2BKRB 2KYWA 2L8JA 2IBIB 5AI6A 3D2DA 2KD0A 2IO0B 2R8JA 9ICMA 3RJ8A 2BPGA 1V38A 4QWEA 1R4MB 2EZXA 2K8CA 1BKHA 8ICFA 1QOBA 4JB1A 8ICJA 3ENLA 3GZFA 2OZ8A 3M9MB 3H9DA 4NY8A 4MM3B 1WCLA 5FXPA 1JI7A 2HBKA 2QLTA 8ICWA 2FCSA 4RF1A 1ZQ1C 1ZOLA 3EF6A 3QE9Y 5DG7A 3GIKA 4RQ5A 9ICNA 2XI9A 4QZBA 2KFNA 1V6EA 3D2JA 2QCZA 1E9IA 2R8IA 3E9SA 3VR8B 1RLFA 4GDLA 5KT6A 5I1VA 1P9DU 3GIJA 2VIXA 5HHHA 5G55A 1QQRA 2WPEA 5ALDA 5D79A 4G3XB 4FE3A 3WCQA 4BKTA 4DNSA 2ZJ5A 2RRDA 5EWFA 2W9BA 2ACZB 2D3CA 2L32A 4QNLA 2MQJA 1GRHA 2CDUA 4XWWA 3T6CA 1TIFA 3DBSA 4GIBA 4YR2A 3R3MA 4XC2A 1H2IA 3JPOA 2MEKA 4REZA 2F5ZA 1EO6A 2HOQA 3WKDA 4PYTA 4GMEA 5KFGA 4KLHA 3HVDA 4FA6A 4IWPA 1SE3A 4KLIA 1TKEA 4DXAB 2GGGA 4ADWA 3LYSA 3KOOA 1E7VA 2BCQA 1JCTA 2KLGA 2ZPNA 2LJIA 2QEJC 2EZZA 3UXPA 2C5LC 4YG2A 4IR9A 4BOSC 2XSXA 3QPEA 2A8XA 2EQ7A 3KUMA 4KX3A 3AECB 3NZ3A 4Q8FA 4J9SA 4RCOA 5IAAC 5KL8B 2AQ3B 3QX1A 1OTRB 3K1RB 1WM2A 2ZPYA 4TKNA 4BURA 4IQVA 2MAXA 9ICVA 5HR6A 3VTVA 3DESA 1ZQRA 4QW8A 8ICKA 4Z6DA 2YQEA 5EE0A 1EXNA 2YMQA 2LYBA 3KBBA 2OEHA 3OG5A 2ZIWB 4F4WA 2HDOA 4TMAB 2L3ZA 2PI5A 5U25A 3N7SC 1WI0A 1IBXA 4GDKB 4MGGA 1KLUD 3CIRB 2NO4A 4MM3A 2IGHA 4DQIA 2F2AB 4F5QA 4K7SA 2KNBA 4OJOA 4ZYNA 5ALMA 3R1ZA 4PZNA 3RJAA 4M8MA 1N48A 4YCXA 2GR3A 4DFPA 8ICBA 3N20C 2QJNA 1Y88A 3MR3A 1F52A 4GR1A 1XWLA 2YAUA 3HK0A 3RAQA 4LJOB 2WGSA 3VRBB 5BOEA 4DFJA 5KFLA 4GIVA 1S77D 4RMAA 1AHZA 5J0QA 4JWNA 3H8JA 3P3BA 4DS5A 2WOVA 3VUYA 1Q3UA 2KXJA 2YMPA 3RCYA 2MA1A 1TS4A 3BWUD 4KLMA 4MH0E 1SV0C 2DZJA 2N9LA 2H3IA 4DLEA 2B0CA 4DL3A 5EWGA 4MELA 1ZY8A 5AKGA 3SMVA 3M8RA 2V3AA 4IZGA 2KNJA 3QU4A 2ASLA 4ICUA 2INNE 4WURA 2BR0A 1KRHA 4XDCA 1E8FA 4UB5A 3D2NA 4YWGG 1P48A 4PHDA 4W9JA 1FECA 4B9NA 4JL9A 2UUUA 2KJ5A 3UQ2A 3RJGA 4RM9A 1WF9A 4JK1A 2QC8A 3MGVA 1OFFA 4EM4A 1WE6A 2JT4B 4AS1A 2QB0B 1ZQLA 4B9TA 3DWGC 3I63C 4LIIA 2BDPA 4DWIA 3ZLZA 1GPXA 4M6WB 3BYYB 5KFYA 3CGDA 2MHJA 2Y0SC 4B9VA 4HRSA 4DSFA 4KVGB 1GRAA 2BGFA 3U4EG 5L1JA 3NRZB 3QNMA 3ZQ4A 4CNQA 4K4IA 1BGXT 3HX0A 3T3FA 3N30A 2UVWA 1LB2B 3BS5B 4UB3A 3RGTA 2Y5PA 4UB6U 2Y3AA 4YT0B 5KG2A 1Q5WB 1JCKB 2KG5A 4I2AA 1AW7A 2UVVA 2SEBD 4BUGA 3TTEA 1PVRA 3GP7A 4TSSA 3BJSA 3NXLA 3FCPA 2HZGA 3UGVA 3BYTB 2L00B 3P4PB 4YXDB 4NM1A 2LMCA 1FFUA 2GI9A 3PLUA 1U9LA 4GXKA 4I6PA 2QDFA 4WWPA 4FS2A 1GRGA 3G6YA 5BMHA 2KKVA 1ZD5A 5KVIA 3GV8B 4HDQA 2WU2B 4ANXA 1GRBA 4O3QA 3TEYA 5U1OA 3DVNV 5AE1A 3N32A 2A19A 3AI5A 5KFHA 3EZ5A 4F2RA 4EZLA 4NNJB 1ZQMA 2J0MA 3PFRA 3C19A 5KFQA 4PHEA 2D3GA 4F72A 4KSLC 2WDVB 4QZAA 5KT4A 4OJ6A 4H2HA 4M02A 5KFIA 1ZQKA 1F77A 2DYBA 2VFRA 3OGUA 4ECVA 1X1MA 2FIDA 1DOXA 5JUMA 1S0VA 3GIMA 1SV4A 2J42A 3MP9A 2BBCA 3IC9A 2AXTU 3RJFA 3H7IA 3RRGA 1ZMDA 4E3CA 4YTMB 8ICCA 2GWSA 4O9MA 1FXIA 1KFSA 3SYZA 2BCRA 2BB5A 3GOEA 4M6WA 4EBEA 3V60A 3UJRA 5KAFU 1L7YA 2MWSB 4FHJA 2BHNA 3PY8A 1JXLA 2DZIA 2FIFA 4YR3A 2KT7A 2WXHA 2J53A 3KWLA 3RT3B 9ICKA 4R64A 3PSEB 3Q8KA 2FLPA 3TEWA 4BWMA 4P2HA 4C4VB 2OLAA 2HBMA 4NL9A 3RFAA 1FM0D 1VCBA 3DEEA 4I28A 4EELA 3APDA 4Y2XA 3AV8A 3BS5A 3Q8CA 1SZPA 3ONSA 4KWSA 2LGDA 4IM3A 4NEVA 2FE8A 4ZRJA 4K7WA 2WP5A 1F5SA 2NPTA 5KFVA 4J3OD 2E5AA 3VR9B 3HRDD 2P8CA 3NY5A 2PP0A 1Z1VA 4PGXA 2KP7A 3IBEA 1JWAD 4M8NA 2LM1A 4I2BA 3EUB3 3TX1A 3CXBA 2DKXA 2KN5A 1GEUA 1OEYJ 1F9JA 3SBFA 1WGRA 5HHIA 3TW9A 5DLGA 1BNOA 3QU5A 2WXRA 1YNTE 1Q0WB 5CTRC 3NS1B 1NELA 9ICPA 3SEBA 3IK4A 2EAMA 2N9KA 4E4FA 5AHXA 2JEIA 4PZOA 4LA1A 4DHZB 2NR2A 4O3OA 1UNSA 1MHXA 1T0RC 2OOBB 2NRWA 2PFQA 4MGKE 2KTRA 3PGEA 1GERA 2IMWP 4H83A 1YT3A 2HHXA 5KFWA 2Z59B 1ECWA 2IDYA 2K1FA 3MZNA 3D2HA 1KFTA 2Y3RA 2IOFK 3QJZA 5EDSA 2Q4WA 3NFUA 3R66C 2DL0A 3RB4A 1N56A 2W9AA 3PO4A 1TY0A 3H8SA 3PTFC 2AL6A 5JHAA 4F7ZA 2K4PA 3DEQA 3Q4DA 3PREA 4TVYA 4GB9A 2E3TA 3EYZA 1ZQIA 1T5XD 4TUPA 2D11A 3FV9A 3U4FA 3SEIA 1IV8A 2MP2A 1V1PB 4AYBF 3PZ7A 5ALJA 1NDDA 1H6VA 3MR5A 2BCUA 4Y2JA 2DLBA 2VFVA 4J9OA 3W9CB 1B43A 3QZ8A 1I4GA 1XF5L 2BQQA 3AU5A 3L08A 4DSKA 5AUKA 2QARB 1YX5B 2JX5A 3P2BA 4W9IA 3AH7A 3ES8A 3Q8AA 4NLCA 4F92B 3DDHA 2RPVA 2RGFA 3M8SA 4FX9A 3RJKA 1RQLA 1VDVA 1SJED 1JN3A 2G07A 2JEJA 5TR5A 2LVPA 4M0AA 4C4VA 2G4DB 1HTQA 1ZQUA 1SXEA 4XUSA 3DG3A 2R8DA 3AU2A 2V9WA 2DGZA 3OAWA 3QKEA 2RDGA 4ED3A 3AE7B 2ZC8A 5HMMA 4H1ZA 3UQBA 1N60C 4UBBA 3PX0A 1F44A 5KHOA 2EKEC 2X8CA 3KUDB 1P0RA 2V4QA 3VC5A 1CEZA 2KQSA 2Z8LA 3MBYA 1WJUA 2WXFA 2L1AA 2XH2A 3SAGA 4FS1A 2O56A 1RM6C 4BC9A 1NI2A 3TOYA 4JMUA 1YQBA 5AI5A 2FJ6A 1ED1A 4KLOA 5KFOA 3PRZA 2W7OA 1L7MA 2ESEA 2V3SA 1DRGA 4QZFA 4I2HA 2OVLA 4Q43A 4DO9A 3S1EA 3SV4A 3F2DA 5HP4A 5J2HA 1KFDA 4NM2A 3TSJA 2KV2A 2KWVB 2OQHA 2ATLA 2PP3A 2YEPF 2BYEA 2KAJA 2XCAA 2PSNA 7ICNA 9ICBA 3THUA 1I4HA 2ZTDA 2PPHA 1WWUA 3MDAA 4JGHB 5D94A 1I7HA 3MUCA 4M9LA 3AN1A 4HLEA 4ICVA 1PK1A 4EEYA 3WAMA 3R9KA 2X8GA 4QAYA 1R6WA 3ISBA 5KG4A 1PQSA 3HW2A 3C21A 5ENLA 4KN4A 1NJYA 2L76A 5J0SA 2HOIA 3DCGA 1KTKA 4UBCA 3HW8A 2K89A 2LM4A 3H8HA 3PV1A 3V3WA 1JMLA 3UXOA 2ZJDA 5GRTA 1V1PA 1QT9A 3VH4B 5ALHA 2GGEA 1QLUA 1A77A 2OH2A 8ICPA 1SE4A 2R9ZA 2QDEA 4RUCA 2GBRA 1HA5A 2PLIA 4WJPA 1VRAB 4GGQA 5KFSA 3ZJVA 2JY6A 1UPHA 2OYYA 3D2SA 1EBHA 3SZ2A 4YN4A 1BT0A 2FCMA 3B9JA 3Q8PB 4MACA 4C56C 2EMTA 4O5EA 2NQLA 5IINA 3IVFA 5KFDA 1JWUD 3L13A 4PS8A 1C9FA 3PK7A 1NNLA 3I6EA 3ZVIA 5HNKA 3U7ZA 3QUTA 2AHOB 1SSNA 4A6QA 2PFOA 2ALZA 1D6EC 4US8A 5L1KA 5A0LA 2KK0A 3CT2A 1QILA 2IPIA 4W9LA 1S97A 4EMIA 1OUQA 4S17A 2XGZA 4JN8A 4EEKA 2Z0DB 2LI6A 2WDRB 3CNHA 3L4PA 4GC6A 3AU6A 1EF1A 2KJRA 2F1HA 2KMCA 5DPSA 2QVHA 3DVNU 4Z6CA 3RRAA 4KLLA 3PO5A 3ETLA 1ZQNA 3NVYB 1EWCA 4OW0A 4II3B 4DN1A 3BSMA 3FVDA 1CMXB 5EU9A 2V1YA 1KFYB 1L3TA 2W9MA 4IWOA 3TQPA 1N63A 1TYPA 2VA2A 2W43A 3OWEB 5KFEA 5J0OA 2L5YA 1XO0A 4RF0A 1FCLA 3DHHC 3P42A 1JEHA 1PVPA 1EBDA 3SN4A 4OD0A 5KTQA 1V81A 3W8WA 3V6JA 5IIMA 2BCPA 2PTZA 2KOBA 5BYSA 2ZZ0A 1HTOA 4GYPC 4IP4A 1SXTA 2WS3B 4N6EB 4PYZA 3T8QA 5GMVA 2F3NA 2C22A 4KEMA 4DOBA 1HEKA 1V5TA 3II4A 2A1JB 1JRUA 4MSQB 1SGHA 3ZXRA 2CR5A 5HKHA 4K8GA 3BQ2A 3DBRI 3ZD9A 3H40A 4LNFA 2ZZBA 3MGHA 3JVZX 5D49A 3A33B 2DW6A 2PLSA 4RPZA 4YWSA 1J19A 2G45B 1ZJNA 2ZG6A 1PUZA 4DCCA 2VJ5A 1E8HA 3KTQA 4HPNA 1WX8A 2KDIA 5B5EU 1XHCA 1QOGA 2KIWA 5FXDA 3FC4A 1SKRA 1RXVA 2MBQA 3X0WA 2WAQF 1XLQA 2PU1A 3LDZE 4Q8EA 4C4RA 4I2GA 2OZ3A 4K8DA 3SENA 1ET9A 1TAMA 3RNEC 3ORYA 1KDHA 2OJWA 4BBNC 1UXYA 3AL0B 4RPXA 5DBCA 2DBYA 8ICIA 2LGYA 1S1QB 1MRAA 4ELTA 4MH8A 5D46A 2RMMA 7ICGA 4IL0A 1UGMA 1SJHD 4HKZE 4MFFA 2CKHB 2ZCBA 4M9JA 1DXSA 2JZBB 3NTUA 1JMSA 3PV8A 2LEKA 2C9WB 4FJYA 1G6JA 3FW7A 4EE2A 1WWTA 1SZHA 2WDTB 3QFBA 1WUFA 7ICFA 8ICTA 5DB6A 3IT4B 4Z1YA 1EF5A 2Y3SA 2JYEA 2FUHB 3UJEA 2BZFA 3SI8A 1NBFC 3I1YA 2PE6B 9ICRA 2JZ3B 1U48A 1AROP 1NZPA 2VA8A 5KFAA 3T5KA 2WX0A 3DBHB 2ZUDA 3ZDMC 4BWJA 2NRXA 9ICJA 5D2MB 4P7IA 4PWBA 3D2QA 4CF5A 4KLFA 3PHWB 3W1SA 4DL5A 4GXJA 2V3BA 3I4KA 4QZGA 3WANA 5K4LA 1WVEA 1VZ7A 3P4SB 4KIKB 4W9CA 1NK7A 1N61A 2YQUA 3QX7A 3OTRA 4AP4C 2DQNB 2RHFA 4NLZA 4X5VA 4HNLA 4ZA0A 5FXEA 4OVZA 2RDHA 2W9CA 2LYAA 1XSPA 1V8CA 4I2JA 2KJ9A 4O5CA 3GZNB 4M52A 3EGRA 3ABVB 1X9SA 4M9HA 2R8KA 4E6MA 3N4MB 3P0WA 3MGIA 4P0QB 5HQXA 2VZKB 2KKPA 3VCBA 2BF8B 3ZLGA 4BKSA 1TBEA 2AL3A 2MLBA 2VANA 1FPYA 3ES7A 2QKQA 4OO1J 3DK8A 3ZVHA 3CSFA 3RB0A 3JSVB 3UXLA 1H38A 4F91B 1NENB 4MJSB 4RQNA 3BY4B 2O2VB 2LGIA 1YJJA 4KDIC 1C4PA 4J6IA 3RFZB 4HXDA 3SJNA 2ZZPB 2OM6A 2K5PA 1F2RI 2BQRA 1WH3A 3DHIC 5AM5A 3FW8A 3V7JA 1WGHA 1RRBA 3DERA 3RB6A 4C00A 2DX5B 1R4NB 1GSNA 1C4AA 3MY9A 3A9JA 2JSVX 3QXGA 1GNUA 2ZW0A 4LCDE 2KMAA 1STZA 3NZSA 1WGGA 4R65A 4RNNA 2D10A 3CGBA 1KOTA 5C1ZA 5ALXA 4J9PA 1Q1RA 2WXMA 1ONFA 3QLDA 4PZFA 1ROEA 5CJ7A 1HIWA 3J9CA 3NJTA 4KN7A 2KEYA 3QU9A 4ANWA 4YP3A 3TWAA 2OPJA 4HVBA 2DPIA 4JUZA 4F71A 1L8LA 4R63A 3WIMA 4PL1A 2V9HA 4DQOC 3UCCA 1NEKB 2HJ1A 1ZE3D 2BYFA 4MEMA 1NVID 4ZCWA 3TJIA 3LAEA 4I2IA 5ALYA 2P6UA 1ZQHA 3KUZA 3BINA 2VFSA 2R61A 4WIPA 4QIWF 2K8BA 1MSWD 4DLGA 2VA3A 1DIIA 4UB2A 2GBNA 4KIKA 3RJJA 4NL9C 1AHUA 2H3VA 5DB7A 2KZ3A 4QWDA 4BX9C 1L7NA 1RM6B 2JQRB 3RZWC 1HSKA 5KT2A 3BOXA 8ICSA 4F93B 2HE7A 2AL2B 4GGBA 2W3RA 4KMUA 9ICXA 1P43A 8ICGA 5KFXA 4YVZA 3A4RA 3U30A 4M9GA 2AWTA 1EUVB 4YSZB 1MBBA 2BTEA 3R10A 4P0QA 2W3SA 3I28A 2K8CB 4AP9A 1BPDA 4G8TA 3QCAA 2ZVOA 3SHQA 5IKCM 3NVZA 3HKZC 3KQ4A 1U45A 2AGOA 4PK1A 3PSTA 1NK5A 1S0NA 4HCHA 3I57A 4IW0A 5JXVA 2FDRA 2NPXA 2O2VA 3JPQA 2UWQA 1JW9D 3JPSA 2QILA 1NK8A 4DWDA 7ICTA 5GTIU 1KH0A 1C77A 2FAZA 1S76D 4ZHPA 4NJ6A 2FPKA 1FNUA 1K4QA 5T14A 2IYDB 4EMJA 4NLBA 2BPCA 2ON8A 3OHAA 4DYEA 2V4LA 5KG5A 5J0YA 4YXMA 3P93A 1XXGA 4ECTA 2UVUA 4WJQA 1B4FA 1C76A 4YSXB 4KT2A 3WAOA 4GDLB 3D9XA 1V2YA 3LWMA 4K4GA 3U52E 2YX8A 5IN7A 4G9BA 2XH0A 3VTEA 1IGDA 2I1KA 1L2NA 3L5OA 2WF7A 2OWOA 5KG0A 1MNSA 2AX5A 5J2BA 1VLBA 4LJXA 3BQ1A 3CWIA 2LXAA 1WSPA 2ES6A 1R7SA 5HMLA 1RPLA 2INCC 2FI1A 4D2KA 4G7FA 4J57A 2KDBA 2RLTA 1QH9A 1ZQYA 1F0ZA 3DGHA 1E8XA 3BDPA 1FHVA 3BQ0A 1M94A 1PDZA 1PZNA 4YD2A 1GREA 1XQQA 1QKZA 3V61A 2D3BA 2KQ7A 2W0HA 1BPZA 2B21A 5H8YE 1ZKQA 1DZNA 2PODA 2DW7A 3SR6B 4DOCA 3OC4A 4H4XA 1X2IA 1L6UA 3L54A 2JU6X 3M1YA 1TKKA 3OJSA 2IHNA 1QQ6A 3NASA 3WK8A 5JRBA 3UPQA 2XH4A 4WQMA 5DPTA 2XY7A 4IG7B 1ENFA 3UINB 2AL2A 2M8SA 4DX3A 5D3IB 1NPXA 2MBEA 4F3OA 1T3QA 3Q8MA 3WK6A 1AN8A 3WU2U 2KJHB 3TCAA 3Q3NC 3S1FA 3FILB 1XD3B 2IY0B 3Q3JA 2YMLA 2JR5A 4J9KA 1Y8RC 5DGAA 3RRHA 5CWRA 4RQ1A 3ZDBA 2KD1A 3HM6X 2PKOA 2Z7JA 1NYRA 5I4DA 2PTWA 4ELUA 3QHTA 2CFYA 5KFKA 1IBXB 2EQ8A 3DPDA 2JRZA 4KMOB 2KC2A 4C80A 4E74A 1L8PA 4JV2A 3DGBA 5J0WA 1Q46A 1N5XA 4YQWA 3WAPA 5FR3A 3IG5A 3MFIA 1P98A 3DVGX 3V05A 1ACCA 1IUEA 4NJCA 2ZTCA 4PPXA 1P7FA 3W8ZA 2IOFA 4KGSA 3ZI4A 3TAPA 9ICCA 1SEBD 1WX7A 3LJ3A 2KVCA 1WRDB 3GRTA 4KDLB 1AOGA 3T79A 1T8EA 1A6SA 3HPOA 1LPFA 4M0XA 2DKZA 4H4RA 3U9IA 3MWCA 2K4EA 3Q8EA 1RZTA 5DB8A 2LWPA 3PM9A 2PTYA 4PJ0U 1KQQA 3IJLA 2KZRA 1F1HA 2LRWA 4P0PA 2J4XA 1J2NA 2QQ6A 4YTPB 2OZTA 4QWCA 3B2GA 4EQWA 4USAA 3AE9B 1E8WA 1F9CA 2CJOA 3EJDB 3SAFA 4QZEA 5IIOA 3MKCA 1B0XA 4YD1A 3CRXA 4G3IA 2JUOA 5ALQA 2KFKA 5BOFA 4NXZA 1TT5B 2K6QA 3ZDEA 3PRPB 4H4WA 5KNIA 4FBTA 2LD9A 3DG7A 2AEHA 2BYVE 2GBMA 3HM3A 3SR6A 3V7KA 4DOAA 3Q6BA 5HG2A 1GO3F 3TADA 4YMNA 2AQ4A 1L4DB 1GC6A 1V49A 3UI3A 8ICOA 1H8CA 3EUB2 1OQQA 1B9RA 1XANA 2BT6A 1ZD4A 5TISU 1GUAB 4ED7A 2XN9C 2KVZA 8ICYA 2ZTEA 2A3VA 5AIBA 1C1YB 1RFAA 2HI0A 2OAIA 5FJTA 4M9NA 5D7GA 2JH7A 1URJA 4PH5A 7ICRA 3SU8X 9ICGA 1JQ4A 3H70A 2EELA 3FILA 3MR6A 4DDGD 3UXNA 2L05A 3T9LA 4F50A 4DQRA 4N59A 2ASQA 2KFZA 5ER0A 3NGDA 5J2GA 3APFA 5AUIA 5L83A 4GYPA 1N63C 3LXFA 1X42A 2EAPA 1CJEA 2H89B 2C7MB 2KLCA 2F77X 3N7PD 3I76A 3SQPA 5BYQA 4KPRA 1XLPA 1SB3C 2FMPA 3R2IA 1I19A 4M6UA 3TCSA 3NRWA 2YLMA 4W9KA 3BS7A 2NBUA 1L6NA 5KFJA 3N6HA 2OQYA 4QW9A 4MEYA 2Y1JA 3QU2A 4HPPA 1OQRA 3AB5A 3DK9A 3SQIA 2GR0A 2W82A 3N6JA 1U47A 5IILA 4HAIA 1QQ7A 5KFBA 2FPMA 4ECUA 1IYFA 5AKZA 2E8NA 4WWOA 1R0MA 2D3DA 4CCHA 3C29A 3DJGX 4PHPA 4IM0A 4Q45A 4K7UA 1NK4A 4IM2A 4CE6A 4RU9A 1ZQTA 1K1SA 5DPWA 4MGIE 3S1CA 3J81j 1ELSA 4M47A 1FNWA 3U26A 1TS3A 2R2OA 4B6JA 1IG6A 2PGEA 1FO4A 4B9MA 4WJOA 5J2EA 3H4BA 5J2CA 5J8YA 3C1ZA 2G06A 2MH7A 2BKFA 4TQRA 4ZDVA 4IS7A 2P8BA 4HCPB 4O1NA 3LB8A 4B9KA 2M4NA 1YJIA 4PWCA 1FHUA 2EKIA 3VQIA 2WNMA 4IQWA 2LRUA 4O3RA 2OJRA 5ALLA 3NO1A 2WOWA 3R2TA 1ZD2P 4BXOB 1T0SC 4XYCA 5ALEA 5L1MA 1XS9D 1BUIC 4FN2A 4FULA 1WGYA 2J0KA 3ZTCA 5DGBA 5IP4D 2GQWA 4RT2A 2AGPA 3CSTA 3D6JA 4A55A 3GV7B 4BZAA 1U49A 1C20A 2OEDA 2BYTA 1FNVA 2ZVNA 3X23A 1N6ZA 2VKQA 2AH5A 1C79A 3VUXA 1E90A 1DNCA 2WPFA 4JWSC 3V6CB 2GQTA 3ZNHB 3PPAA 1C7YA 3M7DA 4W9DA 2XICA 3WK7A 3ZVVA 3W1SC 3BK1A 1ZJMA 3CP8A 3KW5B 2NPTB 1HQRD 4GLSC 5E6PA 2EAOA 7ICOA 1RYRA 2KC1A 3B0AA 1N61C 2AKZA 4A8XC 1NHPA 4UDUC 9ICOA 2V6OA 2JXTA 4ICAA 3H8AA 3CB3A 3UCDA 5JCMA 4LTUA 2E8OA 3PW2A 3VFKA 2OKTA 3EPIA 2GR2A 5J0TA 3ZDDA 2I5QA 4ELVA 1MFWA 2EANA 5KAIU 2C2RA 1XSNA 1WUDA 2WPCA 2J6TA 1D8YA 5FR6A 2C2DA 2GL5A 1VJKA 2GSHA 2R2ZA 1IM4A 9ICFA 3SD5A 3R0UA 2MJDA 1X66A 2KDEB 2HOFA 4O5KA 1WXAA 2KTRB 3DVGY 5LXHA 1DK2A 4F5PA 4J56A 1KKOA 3N28A 2FCNA 2H5XA 4WJ3B 2BQUA 1YOVB 4FBJB 1Z3EB 3H4DA 1D9DA 1FEBA 3MHZA 3URHA 1ZQZA 1XO1A 4LVSA 4A20A 1KN0A 1GOZA 4N9F4 3RR1A 2VZKD 3Q8LA 1LM8B 3RTVA 2HD5B 3JW0X 3HP6A 1JWSD 3QARA 4KGRA 1GRFA 1JPDX 3N1XC 2P6RA 5ALZA 2MP2B 3ZNGC 3L5KA 1LKYB 1OXJA 4I2EA 3ISCA 5J0PA 4HYKA 3LWLA 1S0OA 1X2GA 1X9XA 3H7PB 2PCEA 4BXOA 3O65B 1W1LA 1T94A 5KT7A 1P7EA 2O6VD 4P16A 2WXKA 3QK0A 3HUIA 5ALGA 4Y2UA 5CX3A 1XPYA 2YVFA 2V4IB 3MABA 1UQVA 3TI0A 1QLTA 3A7RA 3V5CA 2IA6A 2NCNA 2CXYA 1UCVA 2WFAA 1D9FA 3LVVA 1SJDA 1ZETA 3IXSA 4APNA 1TGZB 4Y2PA 3I9V1 2DZMA 2MUTA 3AEGB 3RD2A 3I99A 4BCAA 3WA0A 4EZ9A 4UAZA 4KV2A 2DPJA 4JE3B 1KEJA 2QKNA 2KKCA 1AARA 4QWBA 3TEXA 5L6GA 4DSLA 4LJPB 4I2CA 1LGRA 2XO7A 3AEDB 1PVQA 2HHQA 4KGTA 2OX4A 1SWWA 4O3PA 3T5HA 5BO4B 2JRIB 3RR7A 2DWQA 2V3PA 2R18A 3VTWA 3OSPA 3KKAA 3ML9A 2K60A 2MUCA 1C78A 2M17A 1NZBA 2PW9A 3KYDD 5H92C 2G0AA 2WF6A 3DV9A 3PVXA 3QTPA 1L6VA 7ICLA 5D3DA 3K9OB 2XVTA 3BK2A 1QSYA 4A3PA 1AHVA 1Q3VA 2AQ2B 2QSDA 2WXNA 3GE3C 2PXIA 2C60A 2MBRA 4IC7B 1NHSA 4IRCA 3IV6A 2DAJA 3SFDB 3POPA 4W9FA 3WK5A 5G5GA 4KTQA 4UQGA 4YMOA 2W8LA 3MR2A 1D8BA 4B6WA 3MJ5A 5J2DA 4BVUC 1PK1B 2IHMA 2XNAC 2CRXA 1UH6A 3MHSD 4AYBC 2KDFB 9ICTA 3CF6E 3SV3A 4YWOA 3UJSA 4J9QA 5KG1A 3WKBA 9ICEA 1PGAA 4ED6A 2MW5A 4DXKA 3IHQB 3OLMD 4ACOA 2PFPA 3RBEA 1L3UA 2N1WA 5FP0A 3Q3MC 1LKYA 4J3ZA 2JWUA 4LDTB 2V0GA 5J2JA 1MVKA 4TVWA 2K9XA 1SJBA 3H7PA 1TKGA 4EQRA 3HPFA 1BWCA 3LADA 2YN4A 2QAEA 4IL6U 4DEZA 1BPBA 3M6KA 9ICQA 1FEZA 2OHFA 3EKGA 4DK5A 3B9JB 5CHFA 3IT6B 1ZDXA 5EE1A 1M6YA 1N62A 4C4TA 1ZQJA 3I5JC 1ZQBA 4H4TA 5BMGA 3IRUA 1XC9A 4KLGA 2ZNVC 2CHRA 3CW2C 3W8XA 1I4XA 1NKEA 2A5UA 1OQYA 4TV3A 3FM9A 5AK4A 5ALWA 5LLIA 3Q6JA 4CDGA 2E8PA 3DIPA 3L0WB 2W7PA 2QMTA 3NHEB 3C5FA 4BGDA 2V3NA 3DQVA 3QWZB 4PVHA 4MF2A 3KD3A 1C4CA 2AQ0A 4U6PA 3DK4A 1UT5A 4R66A 3FG2P 4EEWA 4DFMA 5ALFA 4DXGA 2ONQA 4H19A 4DXFA 1ZQGA 4EZJA 1W1KA 3H0LB 4ECYA 3TSHA 2ZIXA 5JZEB 4H4VA 1KM7A 3FW9A 4UB8U 4ECQA 1WXSA 2D6FC 1NOMA 1T3QC 8ICXA 5AIAA 2EZYA 2N4FA 3KZXA 3QC8B 4ZRIA 4ARIA 4Z17A 1SB3B 4K81A 2ZXHA 8ICLA 1COKA 4Y2TA 4RFBA 3A9KA 3R7QA 1WFYA 3HILA 1WMHB 1ZYQA 1ZKHA 4RNOA 2FCQA 3PHXB 3PLVA 5FXFA 1JROA 3DBLB 1CQVA 2JH1A 5JCNA 3RBDA 4J9MA 3CGEA 5AK6A 5AI0A 3PSFA 4MFCA 4EOYA 1TAQA 1QLBB 3EWAA 4YR0A 3PRMB 2LKYA 1WZ0A 2PP1A 4LNOA 5DQGA 1HXYD 2DYOA 2LGXA 1IYXA 3T3OA 5AICA 5KFNA 9ICAA 3VAWA 3GV5B 2GGHA 5J04A 1F0MA 4QZDA 2KWDA 1Z2MA 2KTFA 4YXJA 4H4QA 4MMWA 1T0QC 1UGJA 3VCCA 4M0WB 2EMSA 1ZP0B 1BMLC 2KVSA 1JUDA 1TK0A 4B9LA 1NHRA 4N58A 7ICVA 3LYYA 2XGPA 1QQ5A 2FUG1 2N1VA 3CK5A 4KLTA 5C0YA 4EQXA 3RH5A 1MA7A 1J97A 1FRRA 1OGWA 3H1UA 2RDIA 4J9RA 3ZJUA 2ZCCA 2KE7A 2WF9A 2A1AA 2P3HA 3WALA 9ICHA 5AM3A 3QUBA 3AEEB 7ICHA 2INPE 4P6VF 4EYIB 5AZFA 5DKWA 1V9JA 4DQPA 4ZRPA 1YZ7A 2Q85A 2KHQA 3UJ2A 4H50A 4QWAA 5ADZA 1TZ1A 4WH4A 3EJBB 2C3CA 1FD6A 5JH5C 4FLHA 2WXPA 4HNCA 1WE7A 2YTUA 3TADC 5CRXA 3PSPA 3R8BA 2JPHA 3GD6A 2TSSA 2DENB 2QPMA 1HZ5A 2Y9TA 2AU0A 4NWIA 1LQBA 3M62B 2G5IB 1M6IA 3K9PB 4GN1A 1PDYA 3F2CA 1KN5A 4UAWA 3GDXA 2W11A 1WJ4A 2G4SA 2MBOA 4GXIA 1BPXA 4WJNA 2E1EA 4CHKA 3GFKB 3OJ3A 4GFJA 5IIKA 1TVAA 1YEYA 2P0IA 1JWBD 1WMHA 1GB4A 1F8WA 2OFJA 3ETRB 3WK4A 2W9CB 3PR4A 1TYGB 2C28A 2INDC 4MSMB 3PSIA 2BWFA 4PVEA 4NJ8A 2DFLA 8ICMA 5AK3A 2NO5A 1RWSA 3VDZA 4MT5A 2L52A 1ZXIC 1E7UA 4DL6A 1ZK7A 5ALUA 3UQAA 1WXVA 3O0HA 2MCNB 3TBLD 4CO7A 1I35A 5I1WA 1LV5A 2Y08A 5KG7A 3OJUA 3T5JA 4ML8A 2WAQC 2VFTA 5FJPA 4B9SA 2KMDA 3TJ4A 2XCPA 3ZVHB 5J2FA 4BJQA 4M0WA 5FS8A 4IUMB 4NQKE 1E10A 1N2XA 2M1MA 3BZCA 4K1WA 4PHAA 3RJEA 1D4BA 4DL4A 5AKKA 1FEAA 4URKA 2KIVA 1JOAA 4NY0A 1BVSA 5D6JB 1VJ5A 4Y2RA 1TE2A 4C8NA 2RD0A 4Y2YA 2LI5A 4AWJA 2NBVB 1ZGUB 1ZQQA 2BS2B 4I6NB 1FRDA 1ZDVA 1TY2A 1A0PA 1JXEA 3A9JB 3URYA 1DTNA 1UF0A 5J8YC 1XDIA 1PUTA 1TKYA 3BIID 3RZFA 5JHBA 5KFUA 4G0NB 3LB8C 3Q69A 3PW7A 2JEFA 4A3RA 4JV1A 1K53A 2WDWA 4DL2A 4H4UA 4QZ9A 1ZQAA 4TQ1A 2Z0EB 4FO6A 4C8MA 2FMSA 1VR9A 2J7QB 1SL0A 4RNAA 3JVAA 4MGZE 2MBHA 4MHVA 4EC3A 3VH3B 2JVCA 3KUCB 3N9YC 5ALKA 2IPKD 5KVHA 4NQLB 4A90A 4MFAA 3IN5A 3I3TB 4E71A 5AM4A 2N7JA 3Q8SB 4ED1A 1KJTA 3HIZA 3APCA 4JDRA 2K8BB 2NRTA 1AQ6A 4RQ4A 4HCNB 4KX6B 2I6XA 4W9EA 5ALVA 2BKEA 1KLVA 3PZ8A 2C7HA 5IIIA 2N9EB 2P66A 1KLGD 3S47A 1CK1A 3ETRA 1QLNA 2XGQA 5J2IA 3AE8B 1TYTA 4CGZA 2C7NB 3H12A 3L16A 4ECSA 3DFYA 1VQZA 4OVUA 1NDAA 3JPRA 3UMGA 5J0RA 2GDQA 2AJQA 4IC9A 1ZUD2 3MQTA 1QZEA 2J3NA 2BS4B 3R11A 3TWBA 3EFCA 2BVCA 2YB4A 5LNK1 4XZ4A 2OG9A 4NLKA 5CHWA 4DNAA 3NVZB 1K1QA 3N7RC 1FIQA 4OALA 1J2MA 2MRLA 3DQ0A 2Y4GA 4PT5A 1D3ZA 2NQWA 3F53A 3WKEA 5IDZA 8ICZA 4PS3A 3C5GA 4EX7A 7ICPA 4QZCA 4I2DA 3ZDTA 3AUOA 5MPOA 2PU0A 9ICLA 1Y56A 1W1MA 1A5RA 1NHQA 3PX4A 4IL2A 3OSNA 3RB3A 2IBKA 2B3AA 1YQ4B 3VC8A 5DPRA 1ZQFA 5L9XA 2K8AA 3H8WA 1NJXA 4KLDA 4J9NA 2N9PC 1NKBA 3GC2A 1ZMCA 3H0RB 5KG6A 2RK5A 3SSZA 3ICXA 4DBGA 2RDJA 3QN3A 2HTME 4K1RB 4B9UA 1XLOA 2J0JA 4BOZB 2I1QA 3UGBB 1X6IA 4L1BA 4LZDA 1E7PB 2PLPA 2PEAA 4QIWC 4E0DA 3A1QB 5FMHA 5JTIA 2PIAA 2ZNVB 3AE2B 2Y9UA 2HVHA 4DQQA 5AM0A 3EFUA 2GOLA 1Z19A 3K75D 3CMMB 4ARCA 1AYFA 3GD4A 4OVVA 2FNJB 2P3ZA 2HBLA 4FXCA 3JZUA 2M0AA 3QEAZ 1HE8A 4UB1A 3EAOA 1TS5A 1KL9A 1O08A 2HDEA 4J03A 3ZLHA 2WHEA 3WKAA 3NZUA 4UB4A 2EDUA 1YZ6A 7ICUA 3GIIA 1UWMA 1VD2A 5J17A 4ECWA 4AQ7A 3MFGA 3RF9A 3AULA 5TZVA 3TANA 2WXOA 3C2MA 3AE1B 2Y1IA 1ZDLA 2MNRA 1TAUA 2CU1A 1WCNA 2YEPB 3B2FA 3KJMA 1V86A 2P13A 2KO3A 1T4GA 3GSYA 1ZQVA 2QHOA 2QJJA 2PTLA 3AE3B 2ZADA 2KMMA 3EPGA 5D4BA 3AE5B 3TIXA 3T3NA 3MFHA 4F5RA 3RR8A 3ZDAA 3EA6A 4HWIB 4K4HA 1D5ZC 4L23A 1WRIA 2RP5A 3IM1A 5KT5A 3KKAC 4ROPA 2GLSA 3V3XA 3TJPA 4U7CA 3C2LA 2DZKA 2BCVA 3BZDB 2XEWA 2X38A 3RO6A 3QUCA 3PW5A 3KFUF 4HK2A 2GR1A 4C7ZA 4FDCB 5CHGA 5DBBA 3S5SA 3GRSA 3Q8FA 2ISPA 2N7DA 2PE9A 4ZYSA 2M9NA 3Q3FA 5EBKA 4IOIE 4XX5A 5ALPA 3C8YA 3SN1A 1BPEA 3UF8A 4XGAB 3R0KA 1TS2A 2JMGA 2IO1B 4ZRKA 4H4ZA 2M56B 3V6HA 2YMMA 4IQTA 4A35A 2WQYB 2G5HB 2NV3A 2N9XA 2GGIA 4GIRA 2J6SA 4LZGA 3IAM1 3RULA 2O3GA 4P0PB 3D32A 1J8CA 4M01A 3U8ZA 3A1QA 4DWFA 8ICNA 3D46A 4EYHB 1CUKA 5KG3A 3TARA 1NYQA 1YN3A 1EC9A 3HHMA 4WWNA 4YTNB 3LVWA 1NK0A 3DGZA 3M9NB 1KD0A 2KFKB 2AGQA 1TZZA 3LLBA 2AXRA 3ONNA 3SD7A 3T4WA 2I0KA 3PS6A 4HJGE 3O0FA 5BOLA 4LDTD 1N62C 3PWGA 3OPXA 4K7ZA 4JIOU 2WXQA 2BW2A 3ZO5B 4BV6A 2WB1C 2LUMA 4FJZA 1BPYA 3HVZA 2HHVA 2W8KA 4B0EA 2SAKA 1JIHA 4NLGA 4NAWA 3ZNZB 2HNEA 4RH6A 3JPNA 1DIQA 1S5LU 4C8LA 8ICUA 1L0YB 4KLJA 1YJ1A 1W1QA 2WB1F 4ITKA 2ZEQA 4HROA 2PKEA 5EE3A 2KOXA 3RJIA 4PVKA 3N4EA 3PWIA 2IO3B 2D5GA 2AAQA 2DUYA 2HSZA 5FK9C 1LVHA 3CXOA 2NRVA 2FBWB 4XA5A 1I4RA 2E8MA 5KFTA 1TFRA 1I4PA 5DLFA 5DCNA 1KKRA 3EW9A 1RYSA 4W9HA 3RJHA 2Q0ZX 2ZW1A 1T6BX 3RNBC 1NK9A 1XSLA 4H2AA 1JX4A 2JF5A 2I38A 8ICEA 5KFZA 3BJYA 1EWYC 4RGTA 3WK9A 4PS7A 1UHUA 4KSKC 3PMNA 2XY5A 2IGDA 5T8IA 2QGYA 3UJFA 4QZHA 1GB1A 1ZW7A 1V9PA 4F8CB 4XE0A 5J0XA 3ZDCA 1NI3A 2JHDA 2RSUA 3DDMA 2HXTA 4F8RA 2WP9B 5IO9A 2M19A 2FYMA 3RMKC 1W6TA 3AXCA 2IZVB 3P63A 3AEAB 4BFRA 2DAFA 4JB3A 2NS5A 1D5MC 4C0ZA 1U4BA 4O3SA 1M4VA 1CZPA 3RAXA 4IRDA 1N5WA 2K4IA 3RUIB 1ZX9A 3E0FA 2ZUBA 1FMAD 4BAXA 5AKXA 5AKHA 2B76B 1XEEA 2HTHA 3MSYA
chains in the Genus database with same CATH topology
4IDIA 2PLIA 1HA5A 1F2RC 1HZ6A 1VRAB 3KWVA 1QOFA 3ZJVA 5AE3A 1AWDA 2WXJA 1X2GA 3U2SC 4MACA 3B9JA 1W1LA 4C56C 3DEDA 1P7EA 4P16A 2WXKA 1ESFA 3HUIA 4US9A 1JWUD 2V4IB 1C9FA 2Q5WD 3U7ZA 1QOAA 1SSNA 1QLTA 1IGCA 1W1JA 3A7RA 1MHHE 4A6QA 1D6EC 2IPIA 4US8A 2LHDA 3A7AA 1QILA 5AE2A 3W5VB 3TEZA 3IXSA 4NAWB 3I9V1 2N0SB 3L4PA 2WDRB 3AEGB 3I99A 3R07C 4BCAA 4JE3B 2QKNA 2VFUA 3TEXA 5L6GA 3AEDB 3NVYB 1EWCA 4OW0A 2NMQA 2IJ0A 3O13A 4KGTA 2J52A 1I4QA 1KFYB 1N63A 2V3PA 2DWQA 3OWEB 2DYMA 4RF0A 1J7CA 1FCLA 1ZXIA 3P42A 4NAMA 3W8WA 1C78A 2PW9A 5H92C 3TUOA 1L6VA 5BYSA 5D3DA 1SE2A 3AE6B 2VAOA 1SXTA 2WS3B 1ZPSA 3BK2A 4N6EB 3P4RB 1AHVA 2AQ2B 2QSDA 3VRAB 1STEA 2WXNA 1WGKA 2MBRA 4BBYA 3KLSX 3SFDB 2L83A 2EXRA 5G5GA 2MJEA 4B0MA 3MJ5A 3FWAA 1YN5A 1UUPA 2XNAC 1FXAA 3GS2A 4JX1C 1W1RA 4XDDA 5HHZA 1VZ6A 1B1ZA 3BVZA 2UUVA 4ZOHC 2PLSA 1PGAA 4HG0A 4WWMA 1L4ZB 2MJ3A 3W2DA 1RFKA 2KACA 2Y5CA 1E8HA 2I2YA 4PVJA 2LHEA 2JWUA 2V0GA 1QOGA 5FXDA 3FC4A 1MVKA 2K9XA 4TVWA 1TKGA 3BVGA 1XLQA 3AE4B 4RGMA 3A7UA 1ZR6A 2NTSA 3P1MA 1ET9A 1UXYA 2OHFA 3NVVB 3B9JB 2DBYA 1ZDXA 3IT6B 1N62A 4HEA1 5EE1A 5HMRA 4MH8A 2RMMA 4KKJA 5BMGA 1SJHD 4HKZE 1GAQB 4O95A 2LEKA 1I4XA 2GQUA 3Q8BA 2BVGA 4UD8A 3FW7A 4EE2A 3P4QB 1WWTA 1XLNA 3IT4B 2Y3SA 2QMTA 2JYEA 1L0XB 2V3NA 4PVHA 1C4CA 2QJLA 1N60A 2K22A 3JS8A 3C0PA 4PWBA 1BXTA 2ONQA 4DXGA 1DYQA 3SFEB 3W1SA 4DXFA 1W1KA 3TSHA 3ZGZA 5HFYA 1DOYA 1WVEA 1VZ7A 3FW9A 2IGGA 3P4SB 1WVFA 4JAYA 1N61A 2BS3B 1T3QC 4ARIA 5FXEA 4OVZA 2RDHA 1DGJA 3BW7A 1SB3B 1V8CA 3D2DA 4RFBA 2K3UA 3RJ8A 3EGRA 1LO5D 3ABVB 5FXFA 1SBBB 1JROA 1CQVA 1QOBA 4JB1A 2WXIA 2LFIA 5G5GB 1QLBB 5HQXA 2VZKB 1MBTA 4MM3B 5FXPA 1HXYD 2DYOA 5BMIA 3T3OA 2AQ1B 2WDQB 1W1SA 4RF1A 1NENB 2G1EA 2KWDA 2LGIA 1FFVA 1DOIA 1C4PA 1UGJA 1YJJA 4YSYB 3RFZB 1ZP0B 1BMLC 2K5PA 1F2RI 1TZOA 5HI1A 3D2JA 4N58A 3FW8A 3E9SA 3LYYA 3VR8B 4Q2JA 2FUG1 5I1VA 3NVVA 1C4AA 1FRRA 3ZJUA 2JSVX 2ZW0A 1QQRA 2P3HA 1VZ8A 5D79A 3IAS1 3AEEB 3WCQA 4DNSA 4XLOA 2ACZB 4RGNA 2L32A 2INPE 4P6VF 4XWWA 2WXMA 4PZFA 1ROEA 4ZRPA 3J9CA 2MEKA 4REZA 5ADZA 1FEHA 4WH4A 4PYTA 1FD6A 2BB6A 2WXPA 4OHJA 3HVDA 1SE3A 1TKEA 1NEKB 4DQOC 1ZE3D 5G5HB 5K8EA 1NVID 3R8BA 3LAEA 1YN4A 2TSSA 2LJIA 3NVWB 2QPMA 3FAHA 1XO3A 2QEJC 2VFSA 1HZ5A 2R61A 4WIPA 4L2YA 1DIIA 3GB1A 1AHUA 5BYRA 3AECB 3NZ3A 4RCOA 2AQ3B 2K0PA 4ZHOA 2JZPA 3S1DA 2JQRB 1RM6B 3NRZA 1HSKA 3PO0A 3AEBB 2WXLA 3E56A 1JWBD 1KF6B 1SF0A 5EE0A 1GB4A 2W3RA 3ETRB 1TYGB 2NTTA 2PVOD 4YSZB 4TMAB 4PVEA 4RGOS 1MBBA 2BTEA 1RWSA 2W3SA 1IBXA 4GDKB 4MT5A 2L52A 1KLUD 3CIRB 1ZXIC 2IGHA 3NVZA 1PDXA 3KQ4A 3RJAA 5I1WA 2Y08A 3I57A 5JXVA 4ML8A 2VFTA 1JW9D 2QILA 4M0WA 1KH0A 4ZHPA 1C77A 1E10A 1FNUA 3VRBB 1D4BA 2ON8A 1L5PA 4TQ0A 5C3JB 1XXGA 1AHZA 1JALA 1C76A 1K51A 4YSXB 2G9HD 4GDLB 1TS4A 3BWUD 4OZAA 2BS2B 3U52E 3VTEA 1FRDA 1ZDVA 1TY2A 1WYGA 1HEZE 3URYA 1IGDA 2N9LA 2AX5A 1PUTA 1VLBA 1TKYA 3BIID 3CWIA 4WAFA 1JRPA 3LB8C 1WSPA 1R7SA 1E0ZA 3Q69A 4D2KA 4WURA 2INNE 1K53A 1RYJA 4C7YA 2WDWA 1KRHA 1MPEA 4XDCA 1E8FA 4TQ1A 4YWGG 1F0ZA 5G5HA 1VR9A 1XCQL 4RNAA 2UUUA 3NVWA 4EC3A 4LK0M 3N9YC 1QKZA 2GB1A 1OFFA 2IPKD 2CJNA 5H8YE 4A90A 4AS1A 1DZNA 3DWGC 3SR6B 4BC7A 2N7JA 2CU3A 1L6UA 1GPXA 2JU6X 3BYYB 3HRDC 4KX6B 4HRSA 4CQNA 4WQMA 3PZ8A 1ENFA 3U4EG 1KLGD 5D3IB 4KGRA 1CK1A 3ETRA 3AE8B 3NRZB 1T3QA 1AN8A 1A70A 3S1FA 1VQZA 1ET6A 2JYTA 2KQ4X 2WLBA 3FILB 2PMVA 1ZUD2 2P4PA 2Q85A 3POPA 2Y5PA 2BS4B 2E6XA 2Y3AA 4YT0B 2PKOA 1JCKB 1AW7A 1NYRA 5I4DA 1D5XC 2W55A 2SEBD 5LNK1 2WXGA 1IBXB 3GP7A 1Q10A 4TSSA 1V97A 4C80A 3MC0B 3NVZB 3BYTB 3P4PB 4YXDB 1FIQA 1N5XA 5FR3A 3NS1A 2LMCA 1FFUA 2GI9A 3DQ0A 3V05A 4OALA 2Y4GA 4PT5A 1ACCA 1IUEA 4NJCA 1E8GA 2NQWA 4ZOHB 5BMHA 1P7FA 3W8ZA 1K50A 3DWMA 4KGSA 5MPOA 1SEBD 2WU2B 1Y56A 1W1MA 3TEYA 1PFDA 3AEFB 5AE1A 1YQ4B 1WXQA 4R3DA 3Q8EA 3PM9A 1E0YA 1N5WC 2WDVB 2J4XA 2RK5A 4YTPB 4JPSA 3ZJTA 1F77A 3B2GA 2HTME 1MI0A 4OZBA 4USAA 1XLOA 5HHDG 3AE9B 2VFRA 1DOXA 2CJOA 4L1BA 1E7PB 2PLPA 1JWMD 2J42A 2PIAA 3AE2B 2BBCA 3MP9A 4ARCA 1PGBA 1AYFA 1FCCC 4YTMB 3SR6A 1FXIA 4OZCA 5HG2A 1L4DB 2BB5A 4FXCA 3UI3A 2M0AA 1L0VB 1TS5A 3EUB2 1OQQA 2HDEA 5FKAC 1B9RA 1J7BA 2BT6A 2W54A 2WXHA 3KWLA 1UWMA 2J53A 1ZOYB 2XN9C 4AQ7A 2OAIA 3TEWA 3MFGA 5E6JA 5D7GA 2WXOA 3AE1B 1FM0D 1JQ4A 2YEPB 2EELA 2KDMA 1EU4A 3AV8A 3B2FA 3FILA 4JWUC 3Q8CA 3KJMA 2P13A 3GSYA 2FE8A 4N59A 1F0XA 1TJEA 2PTLA 3AE3B 2E5AA 2KN4A 2KMMA 4J3OD 5AUIA 3VR9B 3HRDD 3AE5B 3T3NA 1N63C 3LXFA 2H89B 1CJEA 3EA6A 3BVMA 5EE9A 1D5ZC 4L23A 1JWAD 1WRIA 3EUB3 5BYQA 3V3XA 1XLPA 1SB3C 1UWXA 4IKGA 1E9MA 3TX1A 3R2IA 5GXGB 1I19A 4LLGM 3BZDB 2X38A 4XWTA 2WXRA 1FIQB 1YNTE 2BVFA 3NS1B 1W1OA 1OQRA 3AB5A 4C7ZA 3SEBA 2N9KA 2W82A 3Q8FA 1UNSA 1MHXA 1V1OA 4ZYSA 4IOIE 3C8YA 2IDYA 2Y3RA 3D2HA 2Q4WA 1TS2A 3S1CA 2M56B 1QF6A 1FNWA 1TY0A 1TS3A 2WQYB 2O3GA 5L6FA 4TVYA 3IAM1 2E3TA 1FO4A 1T5XD 2PVGC 2MH7A 1NYQA 1YN3A 3AMZA 1V1PB 2H88B 4O1NA 1X2HA 3PZ7A 4YTNB 4NZLB 3ZYYX 2DLBA 3LLBA 1YJIA 4A9AA 2VFVA 4PWCA 3W9CB 2AXRA 2EKIA 3VQIA 1I4GA 1XF5L 1EM7A 2WNMA 4HJGE 5AUKA 3ZQ4A 2I0KA 2JX5A 2YVSA 1N62C 3AH7A 5AWVA 3Q8AA 2RPVA 3R2TA 2WXQA 2BW2A 1VDVA 1SJED 1XCTL 1BUIC 2QIEB 1K52A 2LUMA 2WU5B 3HVZA 4A55A 4B0EA 3HSUA 2SAKA 1J7AA 2R8DA 5TSSA 4RH6A 2OEDA 2RDGA 1EU3A 3AE7B 2BYTA 1FNVA 1DIQA 1W1QA 4ZRQA 1L0YB 1N60C 1C79A 3NUHB 4ITKA 2GRIA 4HROA 4JWSC 5EE3A 2GQTA 3NVYA 4PVKA 4HKQA 1PYWD 1E6EB 2D5GA 2Z8LA 5FK9C 2WXFA 2L1AA 3BK1A 2FBWB 2ICIA 1RM6C 1I4RA 1I4PA 2BVHA 4BC9A 3PQBA 1HQRD 4GLSC 1N61C 4A8XC 2ZW1A 4UDUC 2JXTA 1T6BX 1ZXHA 4H2AA 4LTUA 3S1EA 2I38A 1EWYC 4RGTA 3TSJA 1SIJA 3AM9A 1VAOA 2YEPF 2KAJA 2IGDA 5T8IA 5C2TB 1GB1A 1PGXA 1I4HA 1VJKA 4XE0A 1I7HA 1NI3A 2R2ZA 3AN1A 2MJDA 3RPFC 2WP9B 3W5UB 2M19A 3P63A 3AEAB 3W8XA 1FFUC 3H8HA 4MLAA 1D5MC 1KTKA 1M4VA 1FFVC 1CZPA 1JMLA 3MHZA 1N5WA 1V1PA 1GOZA 1FMAD 1QT9A 1YMHE 1YQ3B 2VZKD 4KKIA 3TSSA 1QLUA 2B76B 1JWSD 1XEEA 1SE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDI A;  2PLI A;  1QOF A;  5AE3 A;  1AWD A;  1X2G A;  3B9J A;  1W1L A;  3DED A;  3HUI A;  4US9 A;  2Q5W D;  1QOA A;  1QLT A;  3A7R A;  1W1J A;  4US8 A;  3A7A A;  5AE2 A;  3W5V B;  2N0S B;  3L4P A;  2WDR B;  3AEG B;  3I99 A;  3R07 C;  4BCA A;  2QKN A;  2VFU A;  3AED B;  3NVY B;  1KFY B;  1N63 A;  2DWQ A;  1J7C A;  1ZXI A;  3W8W A;  5H92 C;  1L6V A;  3AE6 B;  2VAO A;  2WS3 B;  1AHV A;  4N6E B;  3P4R B;  3VRA B;  1WGK A;  2MBR A;  4BBY A;  3SFD B;  2L83 A;  2EXR A;  5G5G A;  2MJE A;  3FWA A;  1FXA A;  4JX1 C;  1W1R A;  5HHZ A;  4ZOH C;  2PLS A;  4HG0 A;  4WWM A;  2MJ3 A;  1RFK A;  2Y5C A;  1E8H A;  4PVJ A;  1QOG A;  5FXD A;  3FC4 A;  4TVW A;  2K9X A;  1TKG A;  1XLQ A;  3AE4 B;  3A7U A;  1ZR6 A;  3P1M A;  1UXY A;  2OHF A;  3NVV B;  3B9J B;  2DBY A;  5EE1 A;  1N62 A;  5HMR A;  1GAQ B;  4O95 A;  2LEK A;  2GQU A;  2BVG A;  4UD8 A;  3FW7 A;  3P4Q B;  1WWT A;  1XLN A;  4PVH A;  2QJL A;  1N60 A;  2K22 A;  3JS8 A;  3C0P A;  4PWB A;  3SFE B;  1W1K A;  3TSH A;  1DOY A;  1WVE A;  3FW9 A;  3P4S B;  1WVF A;  4JAY A;  1N61 A;  2BS3 B;  1T3Q C;  5FXE A;  1DGJ A;  3BW7 A;  1SB3 B;  1V8C A;  3D2D A;  3ABV B;  5FXF A;  1JRO A;  1QOB A;  4JB1 A;  5G5G B;  1QLB B;  5HQX A;  1MBT A;  5FXP A;  2WDQ B;  1W1S A;  1NEN B;  2G1E A;  1FFV A;  1DOI A;  1YJJ A;  4YSY B;  1ZP0 B;  2K5P A;  3D2J A;  4N58 A;  3FW8 A;  3VR8 B;  3NVV A;  1FRR A;  2P3H A;  5D79 A;  3AEE B;  3WCQ A;  4DNS A;  4XLO A;  2ACZ B;  4P6V F;  4PZF A;  1ROE A;  5ADZ A;  4PYT A;  1TKE A;  1NEK B;  5G5H B;  1NVI D;  3LAE A;  3NVW B;  2QPM A;  3FAH A;  1XO3 A;  2VFS A;  1DII A;  1AHU A;  3AEC B;  4ZHO A;  1RM6 B;  3S1D A;  2JQR B;  3NRZ A;  1HSK A;  3PO0 A;  3AEB B;  1JWB D;  1KF6 B;  1SF0 A;  5EE0 A;  2W3R A;  3ETR B;  1TYG B;  2PVO D;  4YSZ B;  4PVE A;  1MBB A;  1RWS A;  2W3S A;  2L52 A;  3CIR B;  1ZXI C;  3NVZ A;  1PDX A;  4ML8 A;  2VFT A;  1JW9 D;  4ZHP A;  1E10 A;  3VRB B;  5C3J B;  1L5P A;  1AHZ A;  1JAL A;  4YSX B;  2BS2 B;  3VTE A;  1FRD A;  1WYG A;  2AX5 A;  1PUT A;  1VLB A;  1TKY A;  3BII D;  3CWI A;  1JRP A;  3LB8 C;  1R7S A;  1E0Z A;  1RYJ A;  4C7Y A;  1KRH A;  1E8F A;  1F0Z A;  5G5H A;  3NVW A;  4EC3 A;  1OFF A;  2CJN A;  5H8Y E;  1DZN A;  3DWG C;  3SR6 B;  4BC7 A;  2CU3 A;  1L6U A;  1GPX A;  3HRD C;  4KX6 B;  4HRS A;  4WQM A;  3NRZ B;  3ETR A;  3AE8 B;  1T3Q A;  1A70 A;  3S1F A;  1VQZ A;  2WLB A;  2P4P A;  1ZUD 2;  2Q85 A;  2BS4 B;  4YT0 B;  2PKO A;  1NYR A;  2W55 A;  1V97 A;  4C80 A;  3NVZ B;  3P4P B;  4YXD B;  1FIQ A;  1N5X A;  3NS1 A;  4OAL A;  1FFU A;  3DQ0 A;  1IUE A;  1E8G A;  2NQW A;  4ZOH B;  3W8Z A;  3DWM A;  5MPO A;  2WU2 B;  1W1M A;  1PFD A;  3AEF B;  5AE1 A;  1YQ4 B;  1WXQ A;  3PM9 A;  1E0Y A;  1N5W C;  2WDV B;  2RK5 A;  4YTP B;  3B2G A;  2HTM E;  2VFR A;  4USA A;  1XLO A;  3AE9 B;  1DOX A;  2CJO A;  1E7P B;  2PIA A;  3AE2 B;  1AYF A;  4YTM B;  3SR6 A;  1FXI A;  4FXC A;  1L0V B;  3EUB 2;  1OQQ A;  1B9R A;  1J7B A;  2BT6 A;  2W54 A;  3KWL A;  1UWM A;  1ZOY B;  2OAI A;  3AE1 B;  1FM0 D;  1JQ4 A;  3B2F A;  3AV8 A;  4JWU C;  3KJM A;  2P13 A;  3GSY A;  4N59 A;  1F0X A;  1TJE A;  3AE3 B;  2E5A A;  2KMM A;  5AUI A;  3VR9 B;  3HRD D;  3AE5 B;  1N63 C;  3LXF A;  2H89 B;  1CJE A;  5EE9 A;  1JWA D;  1WRI A;  3EUB 3;  1XLP A;  1SB3 C;  3TX1 A;  1E9M A;  5GXG B;  1I19 A;  1FIQ B;  2BVF A;  3NS1 B;  1W1O A;  1OQR A;  3AB5 A;  4C7Z A;  3D2H A;  2Q4W A;  3S1C A;  2M56 B;  1QF6 A;  2WQY B;  2O3G A;  4TVY A;  2E3T A;  1FO4 A;  2PVG C;  2MH7 A;  1NYQ A;  3AMZ A;  2H88 B;  1X2H A;  4YTN B;  3ZYY X;  3LLB A;  1YJI A;  4A9A A;  2VFV A;  4PWC A;  3W9C B;  2AXR A;  2EKI A;  5AUK A;  2I0K A;  2YVS A;  2JX5 A;  1N62 C;  3AH7 A;  1VDV A;  2QIE B;  2WU5 B;  3HVZ A;  2R8D A;  1J7A A;  3AE7 B;  1DIQ A;  1W1Q A;  1N60 C;  4ITK A;  4HRO A;  4JWS C;  5EE3 A;  2GQT A;  3NVY A;  4PVK A;  1E6E B;  2FBW B;  1RM6 C;  4BC9 A;  2BVH A;  1N61 C;  4LTU A;  3S1E A;  1EWY C;  3TSJ A;  1SIJ A;  3AM9 A;  1VAO A;  2KAJ A;  5C2T B;  1VJK A;  1I7H A;  1NI3 A;  2R2Z A;  3AN1 A;  2MJD A;  3RPF C;  2WP9 B;  3W5U B;  2M19 A;  3P63 A;  3AEA B;  3W8X A;  1FFU C;  4MLA A;  1FFV C;  1CZP A;  1N5W A;  1FMA D;  1QT9 A;  1YQ3 B;  1QLU A;  2B76 B; 
#chains in the Genus database with same CATH topology
 3AU4 A;  3AQE A;  2HQM A;  1F2R C;  2REX A;  4TUR A;  1KKX A;  3KWV A;  4P1B C;  5AE3 A;  1RQN A;  1AWD A;  4M2Y A;  2LZ6 A;  4K3C A;  5DQI A;  3F5E A;  3IP4 B;  3JYU A;  3C28 A;  1P3Q U;  7ICJ A;  2AL1 A;  3EJE B;  1SIF A;  4US9 A;  4FP1 A;  3ZXV A;  2Q5W D;  3JPT A;  2HW3 A;  5DQH A;  3KHG A;  2PFN A;  4IRK A;  3THV A;  1IGC A;  3UIP B;  2AYO B;  2LHD A;  3A7A A;  4DHZ E;  1KSP A;  5AE2 A;  5ALN A;  2ASD A;  3MC9 A;  2G08 A;  2ZJA A;  5AKL A;  3DBH I;  3TEZ A;  3FYH A;  1S0M A;  5ALI A;  2GBJ A;  1I42 A;  3R07 C;  3PZP A;  3RNG C;  2RDX A;  1Z00 A;  2VFU A;  3ZLF A;  5J0U A;  4GOC A;  5HR7 A;  2IJ0 A;  3O13 A;  1XT9 B;  2J52 A;  1GXF A;  4DHJ B;  3EHV A;  5AI4 A;  3ISD A;  5ALS A;  2RR9 A;  3SAH A;  2DYM A;  3GZN I;  1J7C A;  3OZY A;  1XU4 A;  1ZXI A;  4GLX A;  1UD7 A;  3FKY A;  3IG3 A;  2JV3 A;  4NAM A;  2NBW B;  3VFC A;  3DH9 A;  4EBC A;  1COO A;  4ANU A;  2ZJ8 A;  3TUO A;  4RQ8 A;  4QZI A;  3ECI A;  1WM3 A;  1SE2 A;  2HVI A;  3IG8 A;  3P4R B;  3EEZ A;  3VRA B;  3Q14 C;  1STE A;  3H4K A;  4OJP A;  2O6K A;  4WAA A;  4BBY A;  3KLS X;  2F44 A;  3V7L A;  3CYM A;  2L83 A;  4TUQ A;  4AOF A;  5FJU A;  2MJE A;  2WHI A;  4II2 B;  3OHB A;  1Z1B A;  3SDL C;  3VC6 A;  3FWA A;  4B95 A;  1UUP A;  3STP A;  4ED0 A;  1FXA A;  4JX1 C;  4XDD A;  5HHZ A;  2KFJ A;  1B1Z A;  3BVZ A;  2UUV A;  4ZOH C;  1B22 A;  2KN7 A;  2LUE A;  5AKE A;  2I5H A;  1T0Y A;  2BWE S;  3KVF B;  3L10 B;  4KLQ A;  4PYU A;  4HG0 A;  1D7Y A;  4FBU A;  1RFK A;  4F4Y A;  4I2F A;  4RQM A;  3ZKJ C;  2RDB C;  3A4S C;  2NRZ A;  1R4N I;  2I2Y A;  4EEN A;  3K4G A;  3TFR A;  1RXW A;  1MOK A;  3D47 A;  4BKS D;  2W03 A;  7ICQ A;  1MUC A;  3IDW A;  2RAB A;  3BVG A;  3TL5 A;  5B66 U;  3AE4 B;  4TUS A;  3IFW B;  3A7U A;  1WJ6 A;  1ZR6 A;  3Q45 A;  3DHG C;  3NVV B;  2Q4T A;  3CAW A;  3PX6 A;  5EWE A;  5HMR A;  4HEA 1;  3UQ0 A;  3A0H U;  5AI8 A;  4WQO B;  4QZ8 A;  3V62 A;  4AJW A;  1H4R A;  1QSS A;  3PZD A;  2LYH A;  4CF3 A;  1WGD A;  2AKM A;  3FDS A;  3F2B A;  4O3M A;  2CHX A;  5KFC A;  3GIL A;  2GQU A;  1WUE A;  2MBB B;  3T9P A;  4PGQ A;  2BVG A;  1IXR A;  1XLN A;  1L3V A;  4RQ6 A;  3QA8 A;  3H0M B;  5DBA A;  2ASJ A;  1SL1 A;  4MGY E;  4P4O A;  3V5F A;  2NVK X;  2MUT B;  2QJL A;  5J2K A;  8ICH A;  3M9O B;  2UVR A;  9ICU A;  1OEY A;  1UBI A;  2KJ8 A;  3B1L X;  3JS8 A;  1Z5S B;  3C0P A;  2PMQ A;  4DQS A;  4MF8 A;  1DYQ A;  4EWJ A;  3PML A;  1RG6 A;  5DDY A;  1DOY A;  2GH5 A;  4UAS A;  2WOI A;  3UXK A;  5GTH U;  2IGG A;  1WVF A;  1TK5 A;  4ASW C;  4MDK E;  1X6J A;  2K25 A;  4KIT B;  1SKW A;  4P4P A;  9ICW A;  1S3S G;  1DGJ A;  5KFF A;  3M95 A;  2PMZ C;  3BW7 A;  2ZIW A;  2HHT A;  4HN8 A;  2K3U A;  2Y0S F;  5KT3 A;  3OW1 A;  4J9L A;  1LO5 D;  1E8Y A;  4H4Y A;  1SBB B;  3TKA A;  3Q3O C;  4GDK A;  2B6G A;  5C5J A;  2WXI A;  2LFI A;  5G5G B;  1WIA A;  2PMZ F;  2DNF A;  2GLE A;  4EFO A;  5CA7 A;  1MBT A;  4JV0 A;  5F9L A;  5DDM A;  5BMI A;  2FLN A;  3C2K A;  3B08 A;  2AQ1 B;  4GXB A;  2WDQ B;  1W1S A;  2E5S A;  5F9N A;  2G1E A;  3DBR B;  2V4R A;  1FFV A;  1DOI A;  1UA0 A;  4YSY B;  2H3Z A;  3RH4 A;  4ED8 A;  2CPR A;  1TZO A;  3K1Z A;  5HI1 A;  3EC8 A;  3T5L A;  1QCK A;  5L95 C;  2KJ6 A;  2HMX A;  2QB1 A;  2XH7 A;  3Q8Q B;  4IQU A;  2N7E A;  4Q2J A;  3NVV A;  1MJD A;  2BDU A;  2CHZ A;  3H8M A;  4MKS A;  3VA8 A;  3KHL A;  1HUZ A;  1VZ8 A;  1DK3 A;  3IAS 1;  2F1I A;  2E1F A;  4XLO A;  4RNM A;  4RGN A;  1X9W A;  1TV9 A;  4OCZ A;  4RM8 A;  1D8L A;  3GD3 A;  2VRR B;  1FEH A;  2BCS A;  7ICK A;  8ICQ A;  2BB6 A;  1HUO A;  2L0T A;  3CGC A;  4OHJ A;  3T8M A;  2JZZ A;  5G5H B;  5K8E A;  2QB0 A;  5L1L A;  1YN4 A;  2HBJ A;  2OXO A;  3NVW B;  1DXL A;  3FAH A;  1XO3 A;  4HJK A;  4L2Y A;  4OJ5 A;  3DOW A;  3GB1 A;  2PJH A;  3SN0 A;  4JN7 A;  2HHU A;  5BYR A;  2KHW B;  1ZQE A;  3MDC A;  2HJ8 A;  4RZR A;  2K0P A;  1R4M I;  2ZIX B;  1E8Z A;  1WJN A;  4ZHO A;  2JZP A;  3S1D A;  4EM3 A;  3NRZ A;  5DG8 A;  4KLE A;  4IR1 A;  2L7R A;  3PO0 A;  4DSJ A;  3AEB B;  2WXL A;  3E56 A;  3L17 A;  3RH6 A;  4ECZ A;  1KF6 B;  3FYY A;  1SF0 A;  1OEP A;  3PW4 A;  2BC0 A;  2LGS A;  1O03 A;  3UMB A;  3RIT A;  1GG3 A;  1MDR A;  3QYP A;  2NTT A;  2PVO D;  4ECR A;  3A9K B;  5AKI A;  4DSE A;  4RGO S;  1GRT A;  3VDG A;  2BQ3 A;  3QEB Z;  1MQ3 A;  4I27 A;  4PL2 A;  2HXU A;  1PDX A;  2JWZ A;  3U7D A;  4GRT A;  2LHT A;  4RQ2 A;  2BPF A;  2LMR A;  2IOH A;  1MO9 A;  1XS2 A;  4EUT A;  3Q8R B;  4AUQ C;  3KHR A;  4F5N A;  4NV0 A;  3TFS A;  1MG4 A;  1L7P A;  1ONE A;  3QIJ A;  5JCL A;  1SJA A;  2GGJ A;  4K2S A;  1ZQD A;  3BQT A;  2D3A A;  3OZM A;  1KBU A;  1WYW B;  1L5P A;  4TQ0 A;  1SKS A;  5C3J B;  4R8U B;  1NJZ A;  4UW9 A;  4Y2Q A;  3ZNI D;  4DHG A;  1JAL A;  1UBQ A;  5IIJ A;  4F4Z A;  4ED2 A;  1K51 A;  2G9H D;  4H4P A;  2CN1 A;  4X57 B;  2F8K A;  3EAN A;  1ZQS A;  4OZA A;  4UAV A;  3F5A A;  1WYG A;  1HEZ E;  2NYV A;  2EQ6 A;  2UU7 A;  1ZQP A;  4TUU A;  1Z4O A;  3B0Y A;  4WAF A;  1ZD3 A;  1KCZ A;  3Q2A C;  1JRP A;  4IT1 A;  5FJO A;  1YX6 B;  4LNI A;  3DJJ A;  2ZIU B;  1E0Z A;  3FXG A;  2BPS A;  2FE9 A;  2GO7 A;  4G11 A;  2KSO B;  2G09 A;  4C7Y A;  5KFP A;  4YMM A;  1MPE A;  3A0B U;  1RYJ A;  3EEC A;  4GSW A;  2Y5B B;  3VXW A;  3SQS A;  5G5H A;  1XCQ L;  4FZL A;  4XRH A;  4EKU A;  1V5O A;  3NVW A;  4LK0 M;  3N1Y C;  3KZI U;  1HJP A;  2GB1 A;  2TPR A;  4UAR A;  1YD8 U;  2CJN A;  4KZC A;  4AJY B;  4E8G A;  2ZIV B;  3GY1 A;  3ALR A;  4BC7 A;  1KTQ A;  1JPM A;  4JHM A;  4HDO A;  2CU3 A;  4RUA A;  3HRD C;  2P88 A;  4CQN A;  2MA9 B;  2C2E A;  5ALR A;  2HCF A;  7ICI A;  1MN8 A;  7ICE A;  3QAQ A;  5AKY A;  2WTF A;  3PR5 B;  3CYJ A;  3AQF A;  1ZRM A;  1KRP A;  3AEV A;  3BZK A;  1TE6 A;  5F3X B;  1A70 A;  9ICS A;  1ET6 A;  2JYT A;  2KQ4 X;  2WLB A;  4FJV B;  1NU5 A;  5FS6 A;  2PMV A;  1X40 A;  2P4P A;  1XNS A;  5FS7 A;  4ECX A;  2R8G A;  3VHT C;  4UAY A;  4F1S A;  5AEK B;  1TKD A;  4FHK A;  2E6X A;  2WYQ A;  4EZK A;  5BPC A;  1MG8 A;  1MQ2 A;  4NLN A;  2PPG A;  4FI4 A;  1NJW A;  3ZUN A;  2JK6 A;  2CS4 A;  1D5X C;  2W55 A;  4K3B A;  2PS2 A;  3QQ8 B;  4GGH A;  2HHW A;  4RQ0 A;  2WXG A;  3G6V A;  1Q10 A;  5CP2 A;  2GMI C;  5AM2 A;  1V97 A;  3NS8 A;  5JCK A;  3MC0 B;  4E5T A;  1SE9 A;  2K39 A;  1OW5 A;  3NS1 A;  2LVO A;  1Q8K A;  1E8G A;  3S2A A;  2QJM A;  4KLS A;  1Q1W A;  4R8U A;  4ZOH B;  3V4B A;  4DS4 A;  4DDI D;  1K50 A;  3DWM A;  3HJE A;  4KZ0 A;  1L7O A;  3MTN B;  2KAN A;  1GV4 A;  3GU3 A;  2M0N A;  1PFD A;  2NVU I;  1NK6 A;  3AEF B;  4A8E A;  4Z6F A;  1WXQ A;  1ECQ A;  2KZM A;  1SL2 A;  4R3D A;  1UZX B;  4UAT A;  4NJ7 A;  1E0Y A;  4GC7 A;  1N5W C;  3IHP C;  5JCI A;  5AM1 A;  2ZIU A;  4JPS A;  3ZJT A;  2X99 A;  1P7D A;  3H7S A;  1MI0 A;  2KSO A;  2MU2 A;  1SWV A;  2YB1 A;  3M3J A;  3PT2 B;  4OZB A;  4YL8 A;  5HHD G;  5AZG A;  1GES A;  3QZ7 A;  4J1O A;  1JWM D;  3ML8 A;  3ALB A;  5TR3 A;  1S9F A;  2QAR A;  4I6L B;  1S8O A;  9ICI A;  4IP5 A;  2DHZ A;  1PGB A;  2ZIV A;  4FZM A;  1FCC C;  2JRH A;  4W9G A;  4OZC A;  1F3P A;  1BNP A;  2CHW A;  2KX3 A;  3N4F A;  2MRP A;  2LAS A;  4CRX A;  1L0V B;  4CF4 A;  1TK8 A;  5FKA C;  1J7B A;  4FZN A;  3V6E B;  3ZRC A;  2W54 A;  1ZRN A;  1WR1 A;  1ZOY B;  4JQW C;  5LXI B;  2FKP A;  4DFD A;  3MJW A;  5E6J A;  1GJZ A;  5FJR A;  5J2R A;  1PK3 A;  2KDM A;  1EU4 A;  2RPQ A;  4JWU C;  3B97 A;  3DG6 A;  3MC1 A;  1ISN A;  3JPP A;  5AK5 A;  3QFA A;  2EQY A;  2K8H A;  1F0X A;  1TJE A;  2XY6 A;  2PGW A;  7ENL A;  1GC7 A;  2KN4 A;  2POZ A;  3GO2 A;  2KK8 A;  5CR0 A;  4JLC A;  2ZXI A;  5EE9 A;  3BVM A;  2X8H A;  3UMC A;  1X9M A;  1BZL A;  2D07 B;  4UAU A;  5IA7 A;  1UT8 A;  1UWX A;  1E9M A;  1T3N A;  2KX0 A;  4IKG A;  5GXG B;  4H4S A;  4LLG M;  4IWQ A;  2X8X X;  1DGS A;  4DHJ D;  3IJI A;  4XWT A;  4P4M A;  1FIQ B;  4F5O A;  3ZIM A;  2BVF A;  2N1R A;  2FMQ A;  1J0G A;  1W1O A;  3OPS A;  2VH2 A;  4I29 A;  4E4U A;  4OJL A;  4QJF B;  1V1O A;  2ODG A;  4ACF A;  1YQZ A;  4RQ3 A;  4FAD A;  3L3F X;  2W04 A;  4ANV A;  4GIS A;  2MSE D;  1CRX A;  1KW4 A;  3OJ4 B;  2XID A;  2ISO A;  3ZW3 A;  1QF6 A;  1ZQO A;  3N3K B;  4MEX A;  4M00 A;  2H3Q A;  5L6F A;  5DB9 A;  1SV0 A;  5E79 U;  4LNK A;  2GRT A;  4GU2 A;  4EQS A;  2PVG C;  1RVK A;  2R8H A;  3V72 A;  1WZ3 A;  1MDL A;  3AMZ A;  2H88 B;  1X2H A;  4NZL B;  3ZYY X;  2BC1 A;  1RDF A;  2YY6 A;  4A9A A;  3BQ7 A;  3KLJ A;  1EM7 A;  2YVS A;  1UEL A;  5AWV A;  2K6D B;  1FXT B;  4A6G A;  1EC8 A;  3FJ4 A;  2WF5 A;  5JU5 A;  1IPG A;  2HHS A;  1XCT L;  2QIE B;  1K52 A;  5JRT A;  4RT3 A;  2JXX A;  3H7V A;  2WU5 B;  2XC9 A;  2DF4 B;  4NPN A;  3V6K A;  3KH0 A;  3HSU A;  1J7A A;  2W9N A;  3RNF C;  2KIC A;  5TSS A;  2XK5 B;  4BBN F;  1EU3 A;  4EBD A;  3QU7 A;  4ZRQ A;  2A4Z A;  2X50 A;  2JGA A;  3NUH B;  1L3S A;  2GRI A;  4A3O A;  3NVY A;  2LJ5 A;  4HKQ A;  1PYW D;  1E6E B;  1IP9 A;  2M0X A;  4FFD A;  2ICI A;  4NEW A;  2OCE A;  2BVH A;  3PQB A;  5J2A A;  1YIW A;  5AI9 A;  1MC8 A;  4XQ8 A;  4KPL A;  4P1C C;  5E6N A;  4HPL B;  3M6Z A;  4X2P A;  1ZXH A;  5BOM A;  2F1J A;  4ZH4 A;  3L8K A;  3C23 A;  1QSL A;  4Y2V A;  5ALT A;  1SIJ A;  3AM9 A;  4TQS A;  1VAO A;  2WBA A;  3I6T A;  1CI4 A;  4LNN A;  4PGY A;  4F2S A;  1SGG A;  5C2T B;  2QDD A;  1PGX A;  2A1J A;  2ONE A;  5FS9 A;  4KLU A;  3ZD8 A;  4HCD A;  3C1Y A;  3DFH A;  4BKG A;  3RPF C;  4Y2S A;  3W5U B;  2LXC A;  3OP2 A;  2C3D A;  1WWV A;  2F8L A;  2VJ4 A;  5KFM A;  2KWU B;  3NZG A;  2VH1 A;  5C23 A;  3IJQ A;  4F4X A;  1FFU C;  2F76 X;  8ICA A;  1WX9 A;  3GE8 C;  4MLA A;  1ZQX A;  2FPL A;  5H2F U;  1NKC A;  2KVR A;  1FFV C;  2UYZ B;  3C0R B;  1YMH E;  3TSS A;  1YQ3 B;  2OO6 A;  4KKI A;  4RPY A;  1IIP A;  3N1Z C;  2J6U A;  3E2E A;  4IDI A;  4S0R A;  1ZQW A;  3MC8 A;  1RAX A;  2O6V B;  3NG0 A;  4Q44 A;  4G50 A;  2IY1 B;  1HZ6 A;  3JW7 A;  2D8C A;  4IHC A;  4ENL A;  1QOF A;  3HT3 A;  1E5W A;  1ZQC A;  2WXJ A;  3VCN A;  5CHV C;  3U2S C;  3ZTD A;  3RI7 C;  3DED A;  3VVW B;  1RYU A;  1ESF A;  2LVQ A;  2WWZ A;  3ZRF A;  3TMP B;  2KWC A;  4C8K A;  3UIO B;  2JZB A;  1QOA A;  2I1J A;  3W1Y A;  1JDF A;  4EX6 A;  3PNC A;  1W1J A;  3OTQ A;  1MHH E;  1TTN A;  8ICV A;  2XK5 A;  4EMW A;  3NUQ A;  1C3T A;  3W5V B;  2ZUC A;  2MX2 A;  2WX1 A;  3GQC A;  5L1I A;  4BDP A;  5AZH A;  2P35 A;  5KL1 B;  4NAW B;  3RYT A;  1SJC A;  3S6J A;  2N0S B;  3E58 A;  5AKJ A;  3PW0 A;  5ALO A;  2YVJ A;  2L0F A;  1LXD A;  3UM9 A;  2D2Q A;  5EOZ A;  1QTM A;  4RQ7 A;  2NMQ A;  4F4R A;  1I4Q A;  3RNC C;  1OJT A;  3NOB A;  3WKC A;  3PVL A;  5E6O A;  1WXM A;  1V59 A;  4M04 A;  4EZ6 A;  4HYR A;  3RNM A;  2G3Q B;  3DBL I;  2R2Q A;  2MSN A;  4DL7 A;  3N97 B;  1Q1O A;  2I9G A;  3AE6 B;  5KHQ A;  2VAO A;  2RQ5 A;  1ZPS A;  2EQ9 A;  2JEG A;  3DDC B;  3LXD A;  3K1G A;  1WGK A;  2GBK A;  1BQG A;  4JWM A;  1WG8 A;  1KLN A;  2FLL A;  1S7M A;  2EXR A;  4HPM B;  3G6X A;  4B0M A;  1YN5 A;  3KHH A;  3QUQ A;  3GS2 A;  2BGW A;  1W1R A;  4DF8 A;  1LVL A;  1VZ6 A;  1SXD A;  3JSV A;  4MJS A;  1EBG A;  4WWM A;  1L4Z B;  2MJ3 A;  1UA1 A;  3R7R A;  5G2N A;  3W2D A;  5DG9 A;  3H6N A;  2K4H A;  4HCL A;  2KAC A;  2Y5C A;  2GOW A;  4PVJ A;  4O3N A;  2O6V A;  5J18 A;  2LHE A;  3M63 B;  3HKZ F;  1Z4N A;  4DSI A;  3B0X A;  2YVC A;  3LK9 A;  1GET A;  4KX5 A;  2KTQ A;  4C4S A;  2WF8 A;  3RCZ A;  3VTU A;  2GH1 A;  2PA6 A;  4RGM A;  5IOI A;  1L8O A;  2EH9 A;  2H3F A;  2NTS A;  2WP6 A;  3P1M A;  3TAC B;  4JQ9 A;  4GFI A;  4C8O A;  3KYC D;  1U4A A;  1V85 A;  1EC7 A;  4KKJ A;  2YVG A;  2JXJ A;  5KFR A;  1GAQ B;  4YFK A;  1P1A A;  1A76 A;  4O95 A;  2W9B B;  3Q8B A;  4UD8 A;  7ICS A;  1DOQ A;  2KZZ A;  3TAQ A;  1K8R B;  1WR6 E;  2KHV A;  2XBB C;  3P4Q B;  1K5O A;  3R25 A;  4O0I A;  2LPE A;  1L0X B;  1WY8 A;  4GMV A;  3VUW A;  3ED5 A;  3TQ1 A;  1N60 A;  2IO2 B;  2K22 A;  2LBO A;  3HWT A;  1Z00 B;  4Z6E A;  2ZZC A;  3LDA A;  3ENE A;  2PI4 A;  4F4K A;  5CEH A;  1BXT A;  1T7P A;  1LFD A;  3SFE B;  6ENL A;  4DF4 A;  1L5U A;  2PTX A;  3ZGZ A;  5HFY A;  4CYE A;  4DFK A;  5CB1 A;  5J29 A;  4JAY A;  1S10 A;  7ICM A;  2BS3 B;  1V80 A;  3RNA C;  3PG6 A;  3RN9 C;  8ICR A;  2BKR B;  2KYW A;  2L8J A;  2IBI B;  5AI6 A;  3D2D A;  2KD0 A;  2IO0 B;  2R8J A;  9ICM A;  3RJ8 A;  2BPG A;  1V38 A;  4QWE A;  1R4M B;  2EZX A;  2K8C A;  1BKH A;  8ICF A;  1QOB A;  4JB1 A;  8ICJ A;  3ENL A;  3GZF A;  2OZ8 A;  3M9M B;  3H9D A;  4NY8 A;  4MM3 B;  1WCL A;  5FXP A;  1JI7 A;  2HBK A;  2QLT A;  8ICW A;  2FCS A;  4RF1 A;  1ZQ1 C;  1ZOL A;  3EF6 A;  3QE9 Y;  5DG7 A;  3GIK A;  4RQ5 A;  9ICN A;  2XI9 A;  4QZB A;  2KFN A;  1V6E A;  3D2J A;  2QCZ A;  1E9I A;  2R8I A;  3E9S A;  3VR8 B;  1RLF A;  4GDL A;  5KT6 A;  5I1V A;  1P9D U;  3GIJ A;  2VIX A;  5HHH A;  5G55 A;  1QQR A;  2WPE A;  5ALD A;  5D79 A;  4G3X B;  4FE3 A;  3WCQ A;  4BKT A;  4DNS A;  2ZJ5 A;  2RRD A;  5EWF A;  2W9B A;  2ACZ B;  2D3C A;  2L32 A;  4QNL A;  2MQJ A;  1GRH A;  2CDU A;  4XWW A;  3T6C A;  1TIF A;  3DBS A;  4GIB A;  4YR2 A;  3R3M A;  4XC2 A;  1H2I A;  3JPO A;  2MEK A;  4REZ A;  2F5Z A;  1EO6 A;  2HOQ A;  3WKD A;  4PYT A;  4GME A;  5KFG A;  4KLH A;  3HVD A;  4FA6 A;  4IWP A;  1SE3 A;  4KLI A;  1TKE A;  4DXA B;  2GGG A;  4ADW A;  3LYS A;  3KOO A;  1E7V A;  2BCQ A;  1JCT A;  2KLG A;  2ZPN A;  2LJI A;  2QEJ C;  2EZZ A;  3UXP A;  2C5L C;  4YG2 A;  4IR9 A;  4BOS C;  2XSX A;  3QPE A;  2A8X A;  2EQ7 A;  3KUM A;  4KX3 A;  3AEC B;  3NZ3 A;  4Q8F A;  4J9S A;  4RCO A;  5IAA C;  5KL8 B;  2AQ3 B;  3QX1 A;  1OTR B;  3K1R B;  1WM2 A;  2ZPY A;  4TKN A;  4BUR A;  4IQV A;  2MAX A;  9ICV A;  5HR6 A;  3VTV A;  3DES A;  1ZQR A;  4QW8 A;  8ICK A;  4Z6D A;  2YQE A;  5EE0 A;  1EXN A;  2YMQ A;  2LYB A;  3KBB A;  2OEH A;  3OG5 A;  2ZIW B;  4F4W A;  2HDO A;  4TMA B;  2L3Z A;  2PI5 A;  5U25 A;  3N7S C;  1WI0 A;  1IBX A;  4GDK B;  4MGG A;  1KLU D;  3CIR B;  2NO4 A;  4MM3 A;  2IGH A;  4DQI A;  2F2A B;  4F5Q A;  4K7S A;  2KNB A;  4OJO A;  4ZYN A;  5ALM A;  3R1Z A;  4PZN A;  3RJA A;  4M8M A;  1N48 A;  4YCX A;  2GR3 A;  4DFP A;  8ICB A;  3N20 C;  2QJN A;  1Y88 A;  3MR3 A;  1F52 A;  4GR1 A;  1XWL A;  2YAU A;  3HK0 A;  3RAQ A;  4LJO B;  2WGS A;  3VRB B;  5BOE A;  4DFJ A;  5KFL A;  4GIV A;  1S77 D;  4RMA A;  1AHZ A;  5J0Q A;  4JWN A;  3H8J A;  3P3B A;  4DS5 A;  2WOV A;  3VUY A;  1Q3U A;  2KXJ A;  2YMP A;  3RCY A;  2MA1 A;  1TS4 A;  3BWU D;  4KLM A;  4MH0 E;  1SV0 C;  2DZJ A;  2N9L A;  2H3I A;  4DLE A;  2B0C A;  4DL3 A;  5EWG A;  4MEL A;  1ZY8 A;  5AKG A;  3SMV A;  3M8R A;  2V3A A;  4IZG A;  2KNJ A;  3QU4 A;  2ASL A;  4ICU A;  2INN E;  4WUR A;  2BR0 A;  1KRH A;  4XDC A;  1E8F A;  4UB5 A;  3D2N A;  4YWG G;  1P48 A;  4PHD A;  4W9J A;  1FEC A;  4B9N A;  4JL9 A;  2UUU A;  2KJ5 A;  3UQ2 A;  3RJG A;  4RM9 A;  1WF9 A;  4JK1 A;  2QC8 A;  3MGV A;  1OFF A;  4EM4 A;  1WE6 A;  2JT4 B;  4AS1 A;  2QB0 B;  1ZQL A;  4B9T A;  3DWG C;  3I63 C;  4LII A;  2BDP A;  4DWI A;  3ZLZ A;  1GPX A;  4M6W B;  3BYY B;  5KFY A;  3CGD A;  2MHJ A;  2Y0S C;  4B9V A;  4HRS A;  4DSF A;  4KVG B;  1GRA A;  2BGF A;  3U4E G;  5L1J A;  3NRZ B;  3QNM A;  3ZQ4 A;  4CNQ A;  4K4I A;  1BGX T;  3HX0 A;  3T3F A;  3N30 A;  2UVW A;  1LB2 B;  3BS5 B;  4UB3 A;  3RGT A;  2Y5P A;  4UB6 U;  2Y3A A;  4YT0 B;  5KG2 A;  1Q5W B;  1JCK B;  2KG5 A;  4I2A A;  1AW7 A;  2UVV A;  2SEB D;  4BUG A;  3TTE A;  1PVR A;  3GP7 A;  4TSS A;  3BJS A;  3NXL A;  3FCP A;  2HZG A;  3UGV A;  3BYT B;  2L00 B;  3P4P B;  4YXD B;  4NM1 A;  2LMC A;  1FFU A;  2GI9 A;  3PLU A;  1U9L A;  4GXK A;  4I6P A;  2QDF A;  4WWP A;  4FS2 A;  1GRG A;  3G6Y A;  5BMH A;  2KKV A;  1ZD5 A;  5KVI A;  3GV8 B;  4HDQ A;  2WU2 B;  4ANX A;  1GRB A;  4O3Q A;  3TEY A;  5U1O A;  3DVN V;  5AE1 A;  3N32 A;  2A19 A;  3AI5 A;  5KFH A;  3EZ5 A;  4F2R A;  4EZL A;  4NNJ B;  1ZQM A;  2J0M A;  3PFR A;  3C19 A;  5KFQ A;  4PHE A;  2D3G A;  4F72 A;  4KSL C;  2WDV B;  4QZA A;  5KT4 A;  4OJ6 A;  4H2H A;  4M02 A;  5KFI A;  1ZQK A;  1F77 A;  2DYB A;  2VFR A;  3OGU A;  4ECV A;  1X1M A;  2FID A;  1DOX A;  5JUM A;  1S0V A;  3GIM A;  1SV4 A;  2J42 A;  3MP9 A;  2BBC A;  3IC9 A;  2AXT U;  3RJF A;  3H7I A;  3RRG A;  1ZMD A;  4E3C A;  4YTM B;  8ICC A;  2GWS A;  4O9M A;  1FXI A;  1KFS A;  3SYZ A;  2BCR A;  2BB5 A;  3GOE A;  4M6W A;  4EBE A;  3V60 A;  3UJR A;  5KAF U;  1L7Y A;  2MWS B;  4FHJ A;  2BHN A;  3PY8 A;  1JXL A;  2DZI A;  2FIF A;  4YR3 A;  2KT7 A;  2WXH A;  2J53 A;  3KWL A;  3RT3 B;  9ICK A;  4R64 A;  3PSE B;  3Q8K A;  2FLP A;  3TEW A;  4BWM A;  4P2H A;  4C4V B;  2OLA A;  2HBM A;  4NL9 A;  3RFA A;  1FM0 D;  1VCB A;  3DEE A;  4I28 A;  4EEL A;  3APD A;  4Y2X A;  3AV8 A;  3BS5 A;  3Q8C A;  1SZP A;  3ONS A;  4KWS A;  2LGD A;  4IM3 A;  4NEV A;  2FE8 A;  4ZRJ A;  4K7W A;  2WP5 A;  1F5S A;  2NPT A;  5KFV A;  4J3O D;  2E5A A;  3VR9 B;  3HRD D;  2P8C A;  3NY5 A;  2PP0 A;  1Z1V A;  4PGX A;  2KP7 A;  3IBE A;  1JWA D;  4M8N A;  2LM1 A;  4I2B A;  3EUB 3;  3TX1 A;  3CXB A;  2DKX A;  2KN5 A;  1GEU A;  1OEY J;  1F9J A;  3SBF A;  1WGR A;  5HHI A;  3TW9 A;  5DLG A;  1BNO A;  3QU5 A;  2WXR A;  1YNT E;  1Q0W B;  5CTR C;  3NS1 B;  1NEL A;  9ICP A;  3SEB A;  3IK4 A;  2EAM A;  2N9K A;  4E4F A;  5AHX A;  2JEI A;  4PZO A;  4LA1 A;  4DHZ B;  2NR2 A;  4O3O A;  1UNS A;  1MHX A;  1T0R C;  2OOB B;  2NRW A;  2PFQ A;  4MGK E;  2KTR A;  3PGE A;  1GER A;  2IMW P;  4H83 A;  1YT3 A;  2HHX A;  5KFW A;  2Z59 B;  1ECW A;  2IDY A;  2K1F A;  3MZN A;  3D2H A;  1KFT A;  2Y3R A;  2IOF K;  3QJZ A;  5EDS A;  2Q4W A;  3NFU A;  3R66 C;  2DL0 A;  3RB4 A;  1N56 A;  2W9A A;  3PO4 A;  1TY0 A;  3H8S A;  3PTF C;  2AL6 A;  5JHA A;  4F7Z A;  2K4P A;  3DEQ A;  3Q4D A;  3PRE A;  4TVY A;  4GB9 A;  2E3T A;  3EYZ A;  1ZQI A;  1T5X D;  4TUP A;  2D11 A;  3FV9 A;  3U4F A;  3SEI A;  1IV8 A;  2MP2 A;  1V1P B;  4AYB F;  3PZ7 A;  5ALJ A;  1NDD A;  1H6V A;  3MR5 A;  2BCU A;  4Y2J A;  2DLB A;  2VFV A;  4J9O A;  3W9C B;  1B43 A;  3QZ8 A;  1I4G A;  1XF5 L;  2BQQ A;  3AU5 A;  3L08 A;  4DSK A;  5AUK A;  2QAR B;  1YX5 B;  2JX5 A;  3P2B A;  4W9I A;  3AH7 A;  3ES8 A;  3Q8A A;  4NLC A;  4F92 B;  3DDH A;  2RPV A;  2RGF A;  3M8S A;  4FX9 A;  3RJK A;  1RQL A;  1VDV A;  1SJE D;  1JN3 A;  2G07 A;  2JEJ A;  5TR5 A;  2LVP A;  4M0A A;  4C4V A;  2G4D B;  1HTQ A;  1ZQU A;  1SXE A;  4XUS A;  3DG3 A;  2R8D A;  3AU2 A;  2V9W A;  2DGZ A;  3OAW A;  3QKE A;  2RDG A;  4ED3 A;  3AE7 B;  2ZC8 A;  5HMM A;  4H1Z A;  3UQB A;  1N60 C;  4UBB A;  3PX0 A;  1F44 A;  5KHO A;  2EKE C;  2X8C A;  3KUD B;  1P0R A;  2V4Q A;  3VC5 A;  1CEZ A;  2KQS A;  2Z8L A;  3MBY A;  1WJU A;  2WXF A;  2L1A A;  2XH2 A;  3SAG A;  4FS1 A;  2O56 A;  1RM6 C;  4BC9 A;  1NI2 A;  3TOY A;  4JMU A;  1YQB A;  5AI5 A;  2FJ6 A;  1ED1 A;  4KLO A;  5KFO A;  3PRZ A;  2W7O A;  1L7M A;  2ESE A;  2V3S A;  1DRG A;  4QZF A;  4I2H A;  2OVL A;  4Q43 A;  4DO9 A;  3S1E A;  3SV4 A;  3F2D A;  5HP4 A;  5J2H A;  1KFD A;  4NM2 A;  3TSJ A;  2KV2 A;  2KWV B;  2OQH A;  2ATL A;  2PP3 A;  2YEP F;  2BYE A;  2KAJ A;  2XCA A;  2PSN A;  7ICN A;  9ICB A;  3THU A;  1I4H A;  2ZTD A;  2PPH A;  1WWU A;  3MDA A;  4JGH B;  5D94 A;  1I7H A;  3MUC A;  4M9L A;  3AN1 A;  4HLE A;  4ICV A;  1PK1 A;  4EEY A;  3WAM A;  3R9K A;  2X8G A;  4QAY A;  1R6W A;  3ISB A;  5KG4 A;  1PQS A;  3HW2 A;  3C21 A;  5ENL A;  4KN4 A;  1NJY A;  2L76 A;  5J0S A;  2HOI A;  3DCG A;  1KTK A;  4UBC A;  3HW8 A;  2K89 A;  2LM4 A;  3H8H A;  3PV1 A;  3V3W A;  1JML A;  3UXO A;  2ZJD A;  5GRT A;  1V1P A;  1QT9 A;  3VH4 B;  5ALH A;  2GGE A;  1QLU A;  1A77 A;  2OH2 A;  8ICP A;  1SE4 A;  2R9Z A;  2QDE A;  4RUC A;  2GBR A;  1HA5 A;  2PLI A;  4WJP A;  1VRA B;  4GGQ A;  5KFS A;  3ZJV A;  2JY6 A;  1UPH A;  2OYY A;  3D2S A;  1EBH A;  3SZ2 A;  4YN4 A;  1BT0 A;  2FCM A;  3B9J A;  3Q8P B;  4MAC A;  4C56 C;  2EMT A;  4O5E A;  2NQL A;  5IIN A;  3IVF A;  5KFD A;  1JWU D;  3L13 A;  4PS8 A;  1C9F A;  3PK7 A;  1NNL A;  3I6E A;  3ZVI A;  5HNK A;  3U7Z A;  3QUT A;  2AHO B;  1SSN A;  4A6Q A;  2PFO A;  2ALZ A;  1D6E C;  4US8 A;  5L1K A;  5A0L A;  2KK0 A;  3CT2 A;  1QIL A;  2IPI A;  4W9L A;  1S97 A;  4EMI A;  1OUQ A;  4S17 A;  2XGZ A;  4JN8 A;  4EEK A;  2Z0D B;  2LI6 A;  2WDR B;  3CNH A;  3L4P A;  4GC6 A;  3AU6 A;  1EF1 A;  2KJR A;  2F1H A;  2KMC A;  5DPS A;  2QVH A;  3DVN U;  4Z6C A;  3RRA A;  4KLL A;  3PO5 A;  3ETL A;  1ZQN A;  3NVY B;  1EWC A;  4OW0 A;  4II3 B;  4DN1 A;  3BSM A;  3FVD A;  1CMX B;  5EU9 A;  2V1Y A;  1KFY B;  1L3T A;  2W9M A;  4IWO A;  3TQP A;  1N63 A;  1TYP A;  2VA2 A;  2W43 A;  3OWE B;  5KFE A;  5J0O A;  2L5Y A;  1XO0 A;  4RF0 A;  1FCL A;  3DHH C;  3P42 A;  1JEH A;  1PVP A;  1EBD A;  3SN4 A;  4OD0 A;  5KTQ A;  1V81 A;  3W8W A;  3V6J A;  5IIM A;  2BCP A;  2PTZ A;  2KOB A;  5BYS A;  2ZZ0 A;  1HTO A;  4GYP C;  4IP4 A;  1SXT A;  2WS3 B;  4N6E B;  4PYZ A;  3T8Q A;  5GMV A;  2F3N A;  2C22 A;  4KEM A;  4DOB A;  1HEK A;  1V5T A;  3II4 A;  2A1J B;  1JRU A;  4MSQ B;  1SGH A;  3ZXR A;  2CR5 A;  5HKH A;  4K8G A;  3BQ2 A;  3DBR I;  3ZD9 A;  3H40 A;  4LNF A;  2ZZB A;  3MGH A;  3JVZ X;  5D49 A;  3A33 B;  2DW6 A;  2PLS A;  4RPZ A;  4YWS A;  1J19 A;  2G45 B;  1ZJN A;  2ZG6 A;  1PUZ A;  4DCC A;  2VJ5 A;  1E8H A;  3KTQ A;  4HPN A;  1WX8 A;  2KDI A;  5B5E U;  1XHC A;  1QOG A;  2KIW A;  5FXD A;  3FC4 A;  1SKR A;  1RXV A;  2MBQ A;  3X0W A;  2WAQ F;  1XLQ A;  2PU1 A;  3LDZ E;  4Q8E A;  4C4R A;  4I2G A;  2OZ3 A;  4K8D A;  3SEN A;  1ET9 A;  1TAM A;  3RNE C;  3ORY A;  1KDH A;  2OJW A;  4BBN C;  1UXY A;  3AL0 B;  4RPX A;  5DBC A;  2DBY A;  8ICI A;  2LGY A;  1S1Q B;  1MRA A;  4ELT A;  4MH8 A;  5D46 A;  2RMM A;  7ICG A;  4IL0 A;  1UGM A;  1SJH D;  4HKZ E;  4MFF A;  2CKH B;  2ZCB A;  4M9J A;  1DXS A;  2JZB B;  3NTU A;  1JMS A;  3PV8 A;  2LEK A;  2C9W B;  4FJY A;  1G6J A;  3FW7 A;  4EE2 A;  1WWT A;  1SZH A;  2WDT B;  3QFB A;  1WUF A;  7ICF A;  8ICT A;  5DB6 A;  3IT4 B;  4Z1Y A;  1EF5 A;  2Y3S A;  2JYE A;  2FUH B;  3UJE A;  2BZF A;  3SI8 A;  1NBF C;  3I1Y A;  2PE6 B;  9ICR A;  2JZ3 B;  1U48 A;  1ARO P;  1NZP A;  2VA8 A;  5KFA A;  3T5K A;  2WX0 A;  3DBH B;  2ZUD A;  3ZDM C;  4BWJ A;  2NRX A;  9ICJ A;  5D2M B;  4P7I A;  4PWB A;  3D2Q A;  4CF5 A;  4KLF A;  3PHW B;  3W1S A;  4DL5 A;  4GXJ A;  2V3B A;  3I4K A;  4QZG A;  3WAN A;  5K4L A;  1WVE A;  1VZ7 A;  3P4S B;  4KIK B;  4W9C A;  1NK7 A;  1N61 A;  2YQU A;  3QX7 A;  3OTR A;  4AP4 C;  2DQN B;  2RHF A;  4NLZ A;  4X5V A;  4HNL A;  4ZA0 A;  5FXE A;  4OVZ A;  2RDH A;  2W9C A;  2LYA A;  1XSP A;  1V8C A;  4I2J A;  2KJ9 A;  4O5C A;  3GZN B;  4M52 A;  3EGR A;  3ABV B;  1X9S A;  4M9H A;  2R8K A;  4E6M A;  3N4M B;  3P0W A;  3MGI A;  4P0Q B;  5HQX A;  2VZK B;  2KKP A;  3VCB A;  2BF8 B;  3ZLG A;  4BKS A;  1TBE A;  2AL3 A;  2MLB A;  2VAN A;  1FPY A;  3ES7 A;  2QKQ A;  4OO1 J;  3DK8 A;  3ZVH A;  3CSF A;  3RB0 A;  3JSV B;  3UXL A;  1H38 A;  4F91 B;  1NEN B;  4MJS B;  4RQN A;  3BY4 B;  2O2V B;  2LGI A;  1YJJ A;  4KDI C;  1C4P A;  4J6I A;  3RFZ B;  4HXD A;  3SJN A;  2ZZP B;  2OM6 A;  2K5P A;  1F2R I;  2BQR A;  1WH3 A;  3DHI C;  5AM5 A;  3FW8 A;  3V7J A;  1WGH A;  1RRB A;  3DER A;  3RB6 A;  4C00 A;  2DX5 B;  1R4N B;  1GSN A;  1C4A A;  3MY9 A;  3A9J A;  2JSV X;  3QXG A;  1GNU A;  2ZW0 A;  4LCD E;  2KMA A;  1STZ A;  3NZS A;  1WGG A;  4R65 A;  4RNN A;  2D10 A;  3CGB A;  1KOT A;  5C1Z A;  5ALX A;  4J9P A;  1Q1R A;  2WXM A;  1ONF A;  3QLD A;  4PZF A;  1ROE A;  5CJ7 A;  1HIW A;  3J9C A;  3NJT A;  4KN7 A;  2KEY A;  3QU9 A;  4ANW A;  4YP3 A;  3TWA A;  2OPJ A;  4HVB A;  2DPI A;  4JUZ A;  4F71 A;  1L8L A;  4R63 A;  3WIM A;  4PL1 A;  2V9H A;  4DQO C;  3UCC A;  1NEK B;  2HJ1 A;  1ZE3 D;  2BYF A;  4MEM A;  1NVI D;  4ZCW A;  3TJI A;  3LAE A;  4I2I A;  5ALY A;  2P6U A;  1ZQH A;  3KUZ A;  3BIN A;  2VFS A;  2R61 A;  4WIP A;  4QIW F;  2K8B A;  1MSW D;  4DLG A;  2VA3 A;  1DII A;  4UB2 A;  2GBN A;  4KIK A;  3RJJ A;  4NL9 C;  1AHU A;  2H3V A;  5DB7 A;  2KZ3 A;  4QWD A;  4BX9 C;  1L7N A;  1RM6 B;  2JQR B;  3RZW C;  1HSK A;  5KT2 A;  3BOX A;  8ICS A;  4F93 B;  2HE7 A;  2AL2 B;  4GGB A;  2W3R A;  4KMU A;  9ICX A;  1P43 A;  8ICG A;  5KFX A;  4YVZ A;  3A4R A;  3U30 A;  4M9G A;  2AWT A;  1EUV B;  4YSZ B;  1MBB A;  2BTE A;  3R10 A;  4P0Q A;  2W3S A;  3I28 A;  2K8C B;  4AP9 A;  1BPD A;  4G8T A;  3QCA A;  2ZVO A;  3SHQ A;  5IKC M;  3NVZ A;  3HKZ C;  3KQ4 A;  1U45 A;  2AGO A;  4PK1 A;  3PST A;  1NK5 A;  1S0N A;  4HCH A;  3I57 A;  4IW0 A;  5JXV A;  2FDR A;  2NPX A;  2O2V A;  3JPQ A;  2UWQ A;  1JW9 D;  3JPS A;  2QIL A;  1NK8 A;  4DWD A;  7ICT A;  5GTI U;  1KH0 A;  1C77 A;  2FAZ A;  1S76 D;  4ZHP A;  4NJ6 A;  2FPK A;  1FNU A;  1K4Q A;  5T14 A;  2IYD B;  4EMJ A;  4NLB A;  2BPC A;  2ON8 A;  3OHA A;  4DYE A;  2V4L A;  5KG5 A;  5J0Y A;  4YXM A;  3P93 A;  1XXG A;  4ECT A;  2UVU A;  4WJQ A;  1B4F A;  1C76 A;  4YSX B;  4KT2 A;  3WAO A;  4GDL B;  3D9X A;  1V2Y A;  3LWM A;  4K4G A;  3U52 E;  2YX8 A;  5IN7 A;  4G9B A;  2XH0 A;  3VTE A;  1IGD A;  2I1K A;  1L2N A;  3L5O A;  2WF7 A;  2OWO A;  5KG0 A;  1MNS A;  2AX5 A;  5J2B A;  1VLB A;  4LJX A;  3BQ1 A;  3CWI A;  2LXA A;  1WSP A;  2ES6 A;  1R7S A;  5HML A;  1RPL A;  2INC C;  2FI1 A;  4D2K A;  4G7F A;  4J57 A;  2KDB A;  2RLT A;  1QH9 A;  1ZQY A;  1F0Z A;  3DGH A;  1E8X A;  3BDP A;  1FHV A;  3BQ0 A;  1M94 A;  1PDZ A;  1PZN A;  4YD2 A;  1GRE A;  1XQQ A;  1QKZ A;  3V61 A;  2D3B A;  2KQ7 A;  2W0H A;  1BPZ A;  2B21 A;  5H8Y E;  1ZKQ A;  1DZN A;  2POD A;  2DW7 A;  3SR6 B;  4DOC A;  3OC4 A;  4H4X A;  1X2I A;  1L6U A;  3L54 A;  2JU6 X;  3M1Y A;  1TKK A;  3OJS A;  2IHN A;  1QQ6 A;  3NAS A;  3WK8 A;  5JRB A;  3UPQ A;  2XH4 A;  4WQM A;  5DPT A;  2XY7 A;  4IG7 B;  1ENF A;  3UIN B;  2AL2 A;  2M8S A;  4DX3 A;  5D3I B;  1NPX A;  2MBE A;  4F3O A;  1T3Q A;  3Q8M A;  3WK6 A;  1AN8 A;  3WU2 U;  2KJH B;  3TCA A;  3Q3N C;  3S1F A;  3FIL B;  1XD3 B;  2IY0 B;  3Q3J A;  2YML A;  2JR5 A;  4J9K A;  1Y8R C;  5DGA A;  3RRH A;  5CWR A;  4RQ1 A;  3ZDB A;  2KD1 A;  3HM6 X;  2PKO A;  2Z7J A;  1NYR A;  5I4D A;  2PTW A;  4ELU A;  3QHT A;  2CFY A;  5KFK A;  1IBX B;  2EQ8 A;  3DPD A;  2JRZ A;  4KMO B;  2KC2 A;  4C80 A;  4E74 A;  1L8P A;  4JV2 A;  3DGB A;  5J0W A;  1Q46 A;  1N5X A;  4YQW A;  3WAP A;  5FR3 A;  3IG5 A;  3MFI A;  1P98 A;  3DVG X;  3V05 A;  1ACC A;  1IUE A;  4NJC A;  2ZTC A;  4PPX A;  1P7F A;  3W8Z A;  2IOF A;  4KGS A;  3ZI4 A;  3TAP A;  9ICC A;  1SEB D;  1WX7 A;  3LJ3 A;  2KVC A;  1WRD B;  3GRT A;  4KDL B;  1AOG A;  3T79 A;  1T8E A;  1A6S A;  3HPO A;  1LPF A;  4M0X A;  2DKZ A;  4H4R A;  3U9I A;  3MWC A;  2K4E A;  3Q8E A;  1RZT A;  5DB8 A;  2LWP A;  3PM9 A;  2PTY A;  4PJ0 U;  1KQQ A;  3IJL A;  2KZR A;  1F1H A;  2LRW A;  4P0P A;  2J4X A;  1J2N A;  2QQ6 A;  4YTP B;  2OZT A;  4QWC A;  3B2G A;  4EQW A;  4USA A;  3AE9 B;  1E8W A;  1F9C A;  2CJO A;  3EJD B;  3SAF A;  4QZE A;  5IIO A;  3MKC A;  1B0X A;  4YD1 A;  3CRX A;  4G3I A;  2JUO A;  5ALQ A;  2KFK A;  5BOF A;  4NXZ A;  1TT5 B;  2K6Q A;  3ZDE A;  3PRP B;  4H4W A;  5KNI A;  4FBT A;  2LD9 A;  3DG7 A;  2AEH A;  2BYV E;  2GBM A;  3HM3 A;  3SR6 A;  3V7K A;  4DOA A;  3Q6B A;  5HG2 A;  1GO3 F;  3TAD A;  4YMN A;  2AQ4 A;  1L4D B;  1GC6 A;  1V49 A;  3UI3 A;  8ICO A;  1H8C A;  3EUB 2;  1OQQ A;  1B9R A;  1XAN A;  2BT6 A;  1ZD4 A;  5TIS U;  1GUA B;  4ED7 A;  2XN9 C;  2KVZ A;  8ICY A;  2ZTE A;  2A3V A;  5AIB A;  1C1Y B;  1RFA A;  2HI0 A;  2OAI A;  5FJT A;  4M9N A;  5D7G A;  2JH7 A;  1URJ A;  4PH5 A;  7ICR A;  3SU8 X;  9ICG A;  1JQ4 A;  3H70 A;  2EEL A;  3FIL A;  3MR6 A;  4DDG D;  3UXN A;  2L05 A;  3T9L A;  4F50 A;  4DQR A;  4N59 A;  2ASQ A;  2KFZ A;  5ER0 A;  3NGD A;  5J2G A;  3APF A;  5AUI A;  5L83 A;  4GYP A;  1N63 C;  3LXF A;  1X42 A;  2EAP A;  1CJE A;  2H89 B;  2C7M B;  2KLC A;  2F77 X;  3N7P D;  3I76 A;  3SQP A;  5BYQ A;  4KPR A;  1XLP A;  1SB3 C;  2FMP A;  3R2I A;  1I19 A;  4M6U A;  3TCS A;  3NRW A;  2YLM A;  4W9K A;  3BS7 A;  2NBU A;  1L6N A;  5KFJ A;  3N6H A;  2OQY A;  4QW9 A;  4MEY A;  2Y1J A;  3QU2 A;  4HPP A;  1OQR A;  3AB5 A;  3DK9 A;  3SQI A;  2GR0 A;  2W82 A;  3N6J A;  1U47 A;  5IIL A;  4HAI A;  1QQ7 A;  5KFB A;  2FPM A;  4ECU A;  1IYF A;  5AKZ A;  2E8N A;  4WWO A;  1R0M A;  2D3D A;  4CCH A;  3C29 A;  3DJG X;  4PHP A;  4IM0 A;  4Q45 A;  4K7U A;  1NK4 A;  4IM2 A;  4CE6 A;  4RU9 A;  1ZQT A;  1K1S A;  5DPW A;  4MGI E;  3S1C A;  3J81 j;  1ELS A;  4M47 A;  1FNW A;  3U26 A;  1TS3 A;  2R2O A;  4B6J A;  1IG6 A;  2PGE A;  1FO4 A;  4B9M A;  4WJO A;  5J2E A;  3H4B A;  5J2C A;  5J8Y A;  3C1Z A;  2G06 A;  2MH7 A;  2BKF A;  4TQR A;  4ZDV A;  4IS7 A;  2P8B A;  4HCP B;  4O1N A;  3LB8 A;  4B9K A;  2M4N A;  1YJI A;  4PWC A;  1FHU A;  2EKI A;  3VQI A;  2WNM A;  4IQW A;  2LRU A;  4O3R A;  2OJR A;  5ALL A;  3NO1 A;  2WOW A;  3R2T A;  1ZD2 P;  4BXO B;  1T0S C;  4XYC A;  5ALE A;  5L1M A;  1XS9 D;  1BUI C;  4FN2 A;  4FUL A;  1WGY A;  2J0K A;  3ZTC A;  5DGB A;  5IP4 D;  2GQW A;  4RT2 A;  2AGP A;  3CST A;  3D6J A;  4A55 A;  3GV7 B;  4BZA A;  1U49 A;  1C20 A;  2OED A;  2BYT A;  1FNV A;  2ZVN A;  3X23 A;  1N6Z A;  2VKQ A;  2AH5 A;  1C79 A;  3VUX A;  1E90 A;  1DNC A;  2WPF A;  4JWS C;  3V6C B;  2GQT A;  3ZNH B;  3PPA A;  1C7Y A;  3M7D A;  4W9D A;  2XIC A;  3WK7 A;  3ZVV A;  3W1S C;  3BK1 A;  1ZJM A;  3CP8 A;  3KW5 B;  2NPT B;  1HQR D;  4GLS C;  5E6P A;  2EAO A;  7ICO A;  1RYR A;  2KC1 A;  3B0A A;  1N61 C;  2AKZ A;  4A8X C;  1NHP A;  4UDU C;  9ICO A;  2V6O A;  2JXT A;  4ICA A;  3H8A A;  3CB3 A;  3UCD A;  5JCM A;  4LTU A;  2E8O A;  3PW2 A;  3VFK A;  2OKT A;  3EPI A;  2GR2 A;  5J0T A;  3ZDD A;  2I5Q A;  4ELV A;  1MFW A;  2EAN A;  5KAI U;  2C2R A;  1XSN A;  1WUD A;  2WPC A;  2J6T A;  1D8Y A;  5FR6 A;  2C2D A;  2GL5 A;  1VJK A;  2GSH A;  2R2Z A;  1IM4 A;  9ICF A;  3SD5 A;  3R0U A;  2MJD A;  1X66 A;  2KDE B;  2HOF A;  4O5K A;  1WXA A;  2KTR B;  3DVG Y;  5LXH A;  1DK2 A;  4F5P A;  4J56 A;  1KKO A;  3N28 A;  2FCN A;  2H5X A;  4WJ3 B;  2BQU A;  1YOV B;  4FBJ B;  1Z3E B;  3H4D A;  1D9D A;  1FEB A;  3MHZ A;  3URH A;  1ZQZ A;  1XO1 A;  4LVS A;  4A20 A;  1KN0 A;  1GOZ A;  4N9F 4;  3RR1 A;  2VZK D;  3Q8L A;  1LM8 B;  3RTV A;  2HD5 B;  3JW0 X;  3HP6 A;  1JWS D;  3QAR A;  4KGR A;  1GRF A;  1JPD X;  3N1X C;  2P6R A;  5ALZ A;  2MP2 B;  3ZNG C;  3L5K A;  1LKY B;  1OXJ A;  4I2E A;  3ISC A;  5J0P A;  4HYK A;  3LWL A;  1S0O A;  1X2G A;  1X9X A;  3H7P B;  2PCE A;  4BXO A;  3O65 B;  1W1L A;  1T94 A;  5KT7 A;  1P7E A;  2O6V D;  4P16 A;  2WXK A;  3QK0 A;  3HUI A;  5ALG A;  4Y2U A;  5CX3 A;  1XPY A;  2YVF A;  2V4I B;  3MAB A;  1UQV A;  3TI0 A;  1QLT A;  3A7R A;  3V5C A;  2IA6 A;  2NCN A;  2CXY A;  1UCV A;  2WFA A;  1D9F A;  3LVV A;  1SJD A;  1ZET A;  3IXS A;  4APN A;  1TGZ B;  4Y2P A;  3I9V 1;  2DZM A;  2MUT A;  3AEG B;  3RD2 A;  3I99 A;  4BCA A;  3WA0 A;  4EZ9 A;  4UAZ A;  4KV2 A;  2DPJ A;  4JE3 B;  1KEJ A;  2QKN A;  2KKC A;  1AAR A;  4QWB A;  3TEX A;  5L6G A;  4DSL A;  4LJP B;  4I2C A;  1LGR A;  2XO7 A;  3AED B;  1PVQ A;  2HHQ A;  4KGT A;  2OX4 A;  1SWW A;  4O3P A;  3T5H A;  5BO4 B;  2JRI B;  3RR7 A;  2DWQ A;  2V3P A;  2R18 A;  3VTW A;  3OSP A;  3KKA A;  3ML9 A;  2K60 A;  2MUC A;  1C78 A;  2M17 A;  1NZB A;  2PW9 A;  3KYD D;  5H92 C;  2G0A A;  2WF6 A;  3DV9 A;  3PVX A;  3QTP A;  1L6V A;  7ICL A;  5D3D A;  3K9O B;  2XVT A;  3BK2 A;  1QSY A;  4A3P A;  1AHV A;  1Q3V A;  2AQ2 B;  2QSD A;  2WXN A;  3GE3 C;  2PXI A;  2C60 A;  2MBR A;  4IC7 B;  1NHS A;  4IRC A;  3IV6 A;  2DAJ A;  3SFD B;  3POP A;  4W9F A;  3WK5 A;  5G5G A;  4KTQ A;  4UQG A;  4YMO A;  2W8L A;  3MR2 A;  1D8B A;  4B6W A;  3MJ5 A;  5J2D A;  4BVU C;  1PK1 B;  2IHM A;  2XNA C;  2CRX A;  1UH6 A;  3MHS D;  4AYB C;  2KDF B;  9ICT A;  3CF6 E;  3SV3 A;  4YWO A;  3UJS A;  4J9Q A;  5KG1 A;  3WKB A;  9ICE A;  1PGA A;  4ED6 A;  2MW5 A;  4DXK A;  3IHQ B;  3OLM D;  4ACO A;  2PFP A;  3RBE A;  1L3U A;  2N1W A;  5FP0 A;  3Q3M C;  1LKY A;  4J3Z A;  2JWU A;  4LDT B;  2V0G A;  5J2J A;  1MVK A;  4TVW A;  2K9X A;  1SJB A;  3H7P A;  1TKG A;  4EQR A;  3HPF A;  1BWC A;  3LAD A;  2YN4 A;  2QAE A;  4IL6 U;  4DEZ A;  1BPB A;  3M6K A;  9ICQ A;  1FEZ A;  2OHF A;  3EKG A;  4DK5 A;  3B9J B;  5CHF A;  3IT6 B;  1ZDX A;  5EE1 A;  1M6Y A;  1N62 A;  4C4T A;  1ZQJ A;  3I5J C;  1ZQB A;  4H4T A;  5BMG A;  3IRU A;  1XC9 A;  4KLG A;  2ZNV C;  2CHR A;  3CW2 C;  3W8X A;  1I4X A;  1NKE A;  2A5U A;  1OQY A;  4TV3 A;  3FM9 A;  5AK4 A;  5ALW A;  5LLI A;  3Q6J A;  4CDG A;  2E8P A;  3DIP A;  3L0W B;  2W7P A;  2QMT A;  3NHE B;  3C5F A;  4BGD A;  2V3N A;  3DQV A;  3QWZ B;  4PVH A;  4MF2 A;  3KD3 A;  1C4C A;  2AQ0 A;  4U6P A;  3DK4 A;  1UT5 A;  4R66 A;  3FG2 P;  4EEW A;  4DFM A;  5ALF A;  4DXG A;  2ONQ A;  4H19 A;  4DXF A;  1ZQG A;  4EZJ A;  1W1K A;  3H0L B;  4ECY A;  3TSH A;  2ZIX A;  5JZE B;  4H4V A;  1KM7 A;  3FW9 A;  4UB8 U;  4ECQ A;  1WXS A;  2D6F C;  1NOM A;  1T3Q C;  8ICX A;  5AIA A;  2EZY A;  2N4F A;  3KZX A;  3QC8 B;  4ZRI A;  4ARI A;  4Z17 A;  1SB3 B;  4K81 A;  2ZXH A;  8ICL A;  1COK A;  4Y2T A;  4RFB A;  3A9K A;  3R7Q A;  1WFY A;  3HIL A;  1WMH B;  1ZYQ A;  1ZKH A;  4RNO A;  2FCQ A;  3PHX B;  3PLV A;  5FXF A;  1JRO A;  3DBL B;  1CQV A;  2JH1 A;  5JCN A;  3RBD A;  4J9M A;  3CGE A;  5AK6 A;  5AI0 A;  3PSF A;  4MFC A;  4EOY A;  1TAQ A;  1QLB B;  3EWA A;  4YR0 A;  3PRM B;  2LKY A;  1WZ0 A;  2PP1 A;  4LNO A;  5DQG A;  1HXY D;  2DYO A;  2LGX A;  1IYX A;  3T3O A;  5AIC A;  5KFN A;  9ICA A;  3VAW A;  3GV5 B;  2GGH A;  5J04 A;  1F0M A;  4QZD A;  2KWD A;  1Z2M A;  2KTF A;  4YXJ A;  4H4Q A;  4MMW A;  1T0Q C;  1UGJ A;  3VCC A;  4M0W B;  2EMS A;  1ZP0 B;  1BML C;  2KVS A;  1JUD A;  1TK0 A;  4B9L A;  1NHR A;  4N58 A;  7ICV A;  3LYY A;  2XGP A;  1QQ5 A;  2FUG 1;  2N1V A;  3CK5 A;  4KLT A;  5C0Y A;  4EQX A;  3RH5 A;  1MA7 A;  1J97 A;  1FRR A;  1OGW A;  3H1U A;  2RDI A;  4J9R A;  3ZJU A;  2ZCC A;  2KE7 A;  2WF9 A;  2A1A A;  2P3H A;  3WAL A;  9ICH A;  5AM3 A;  3QUB A;  3AEE B;  7ICH A;  2INP E;  4P6V F;  4EYI B;  5AZF A;  5DKW A;  1V9J A;  4DQP A;  4ZRP A;  1YZ7 A;  2Q85 A;  2KHQ A;  3UJ2 A;  4H50 A;  4QWA A;  5ADZ A;  1TZ1 A;  4WH4 A;  3EJB B;  2C3C A;  1FD6 A;  5JH5 C;  4FLH A;  2WXP A;  4HNC A;  1WE7 A;  2YTU A;  3TAD C;  5CRX A;  3PSP A;  3R8B A;  2JPH A;  3GD6 A;  2TSS A;  2DEN B;  2QPM A;  1HZ5 A;  2Y9T A;  2AU0 A;  4NWI A;  1LQB A;  3M62 B;  2G5I B;  1M6I A;  3K9P B;  4GN1 A;  1PDY A;  3F2C A;  1KN5 A;  4UAW A;  3GDX A;  2W11 A;  1WJ4 A;  2G4S A;  2MBO A;  4GXI A;  1BPX A;  4WJN A;  2E1E A;  4CHK A;  3GFK B;  3OJ3 A;  4GFJ A;  5IIK A;  1TVA A;  1YEY A;  2P0I A;  1JWB D;  1WMH A;  1GB4 A;  1F8W A;  2OFJ A;  3ETR B;  3WK4 A;  2W9C B;  3PR4 A;  1TYG B;  2C28 A;  2IND C;  4MSM B;  3PSI A;  2BWF A;  4PVE A;  4NJ8 A;  2DFL A;  8ICM A;  5AK3 A;  2NO5 A;  1RWS A;  3VDZ A;  4MT5 A;  2L52 A;  1ZXI C;  1E7U A;  4DL6 A;  1ZK7 A;  5ALU A;  3UQA A;  1WXV A;  3O0H A;  2MCN B;  3TBL D;  4CO7 A;  1I35 A;  5I1W A;  1LV5 A;  2Y08 A;  5KG7 A;  3OJU A;  3T5J A;  4ML8 A;  2WAQ C;  2VFT A;  5FJP A;  4B9S A;  2KMD A;  3TJ4 A;  2XCP A;  3ZVH B;  5J2F A;  4BJQ A;  4M0W A;  5FS8 A;  4IUM B;  4NQK E;  1E10 A;  1N2X A;  2M1M A;  3BZC A;  4K1W A;  4PHA A;  3RJE A;  1D4B A;  4DL4 A;  5AKK A;  1FEA A;  4URK A;  2KIV A;  1JOA A;  4NY0 A;  1BVS A;  5D6J B;  1VJ5 A;  4Y2R A;  1TE2 A;  4C8N A;  2RD0 A;  4Y2Y A;  2LI5 A;  4AWJ A;  2NBV B;  1ZGU B;  1ZQQ A;  2BS2 B;  4I6N B;  1FRD A;  1ZDV A;  1TY2 A;  1A0P A;  1JXE A;  3A9J B;  3URY A;  1DTN A;  1UF0 A;  5J8Y C;  1XDI A;  1PUT A;  1TKY A;  3BII D;  3RZF A;  5JHB A;  5KFU A;  4G0N B;  3LB8 C;  3Q69 A;  3PW7 A;  2JEF A;  4A3R A;  4JV1 A;  1K53 A;  2WDW A;  4DL2 A;  4H4U A;  4QZ9 A;  1ZQA A;  4TQ1 A;  2Z0E B;  4FO6 A;  4C8M A;  2FMS A;  1VR9 A;  2J7Q B;  1SL0 A;  4RNA A;  3JVA A;  4MGZ E;  2MBH A;  4MHV A;  4EC3 A;  3VH3 B;  2JVC A;  3KUC B;  3N9Y C;  5ALK A;  2IPK D;  5KVH A;  4NQL B;  4A90 A;  4MFA A;  3IN5 A;  3I3T B;  4E71 A;  5AM4 A;  2N7J A;  3Q8S B;  4ED1 A;  1KJT A;  3HIZ A;  3APC A;  4JDR A;  2K8B B;  2NRT A;  1AQ6 A;  4RQ4 A;  4HCN B;  4KX6 B;  2I6X A;  4W9E A;  5ALV A;  2BKE A;  1KLV A;  3PZ8 A;  2C7H A;  5III A;  2N9E B;  2P66 A;  1KLG D;  3S47 A;  1CK1 A;  3ETR A;  1QLN A;  2XGQ A;  5J2I A;  3AE8 B;  1TYT A;  4CGZ A;  2C7N B;  3H12 A;  3L16 A;  4ECS A;  3DFY A;  1VQZ A;  4OVU A;  1NDA A;  3JPR A;  3UMG A;  5J0R A;  2GDQ A;  2AJQ A;  4IC9 A;  1ZUD 2;  3MQT A;  1QZE A;  2J3N A;  2BS4 B;  3R11 A;  3TWB A;  3EFC A;  2BVC A;  2YB4 A;  5LNK 1;  4XZ4 A;  2OG9 A;  4NLK A;  5CHW A;  4DNA A;  3NVZ B;  1K1Q A;  3N7R C;  1FIQ A;  4OAL A;  1J2M A;  2MRL A;  3DQ0 A;  2Y4G A;  4PT5 A;  1D3Z A;  2NQW A;  3F53 A;  3WKE A;  5IDZ A;  8ICZ A;  4PS3 A;  3C5G A;  4EX7 A;  7ICP A;  4QZC A;  4I2D A;  3ZDT A;  3AUO A;  5MPO A;  2PU0 A;  9ICL A;  1Y56 A;  1W1M A;  1A5R A;  1NHQ A;  3PX4 A;  4IL2 A;  3OSN A;  3RB3 A;  2IBK A;  2B3A A;  1YQ4 B;  3VC8 A;  5DPR A;  1ZQF A;  5L9X A;  2K8A A;  3H8W A;  1NJX A;  4KLD A;  4J9N A;  2N9P C;  1NKB A;  3GC2 A;  1ZMC A;  3H0R B;  5KG6 A;  2RK5 A;  3SSZ A;  3ICX A;  4DBG A;  2RDJ A;  3QN3 A;  2HTM E;  4K1R B;  4B9U A;  1XLO A;  2J0J A;  4BOZ B;  2I1Q A;  3UGB B;  1X6I A;  4L1B A;  4LZD A;  1E7P B;  2PLP A;  2PEA A;  4QIW C;  4E0D A;  3A1Q B;  5FMH A;  5JTI A;  2PIA A;  2ZNV B;  3AE2 B;  2Y9U A;  2HVH A;  4DQQ A;  5AM0 A;  3EFU A;  2GOL A;  1Z19 A;  3K75 D;  3CMM B;  4ARC A;  1AYF A;  3GD4 A;  4OVV A;  2FNJ B;  2P3Z A;  2HBL A;  4FXC A;  3JZU A;  2M0A A;  3QEA Z;  1HE8 A;  4UB1 A;  3EAO A;  1TS5 A;  1KL9 A;  1O08 A;  2HDE A;  4J03 A;  3ZLH A;  2WHE A;  3WKA A;  3NZU A;  4UB4 A;  2EDU A;  1YZ6 A;  7ICU A;  3GII A;  1UWM A;  1VD2 A;  5J17 A;  4ECW A;  4AQ7 A;  3MFG A;  3RF9 A;  3AUL A;  5TZV A;  3TAN A;  2WXO A;  3C2M A;  3AE1 B;  2Y1I A;  1ZDL A;  2MNR A;  1TAU A;  2CU1 A;  1WCN A;  2YEP B;  3B2F A;  3KJM A;  1V86 A;  2P13 A;  2KO3 A;  1T4G A;  3GSY A;  1ZQV A;  2QHO A;  2QJJ A;  2PTL A;  3AE3 B;  2ZAD A;  2KMM A;  3EPG A;  5D4B A;  3AE5 B;  3TIX A;  3T3N A;  3MFH A;  4F5R A;  3RR8 A;  3ZDA A;  3EA6 A;  4HWI B;  4K4H A;  1D5Z C;  4L23 A;  1WRI A;  2RP5 A;  3IM1 A;  5KT5 A;  3KKA C;  4ROP A;  2GLS A;  3V3X A;  3TJP A;  4U7C A;  3C2L A;  2DZK A;  2BCV A;  3BZD B;  2XEW A;  2X38 A;  3RO6 A;  3QUC A;  3PW5 A;  3KFU F;  4HK2 A;  2GR1 A;  4C7Z A;  4FDC B;  5CHG A;  5DBB A;  3S5S A;  3GRS A;  3Q8F A;  2ISP A;  2N7D A;  2PE9 A;  4ZYS A;  2M9N A;  3Q3F A;  5EBK A;  4IOI E;  4XX5 A;  5ALP A;  3C8Y A;  3SN1 A;  1BPE A;  3UF8 A;  4XGA B;  3R0K A;  1TS2 A;  2JMG A;  2IO1 B;  4ZRK A;  4H4Z A;  2M56 B;  3V6H A;  2YMM A;  4IQT A;  4A35 A;  2WQY B;  2G5H B;  2NV3 A;  2N9X A;  2GGI A;  4GIR A;  2J6S A;  4LZG A;  3IAM 1;  3RUL A;  2O3G A;  4P0P B;  3D32 A;  1J8C A;  4M01 A;  3U8Z A;  3A1Q A;  4DWF A;  8ICN A;  3D46 A;  4EYH B;  1CUK A;  5KG3 A;  3TAR A;  1NYQ A;  1YN3 A;  1EC9 A;  3HHM A;  4WWN A;  4YTN B;  3LVW A;  1NK0 A;  3DGZ A;  3M9N B;  1KD0 A;  2KFK B;  2AGQ A;  1TZZ A;  3LLB A;  2AXR A;  3ONN A;  3SD7 A;  3T4W A;  2I0K A;  3PS6 A;  4HJG E;  3O0F A;  5BOL A;  4LDT D;  1N62 C;  3PWG A;  3OPX A;  4K7Z A;  4JIO U;  2WXQ A;  2BW2 A;  3ZO5 B;  4BV6 A;  2WB1 C;  2LUM A;  4FJZ A;  1BPY A;  3HVZ A;  2HHV A;  2W8K A;  4B0E A;  2SAK A;  1JIH A;  4NLG A;  4NAW A;  3ZNZ B;  2HNE A;  4RH6 A;  3JPN A;  1DIQ A;  1S5L U;  4C8L A;  8ICU A;  1L0Y B;  4KLJ A;  1YJ1 A;  1W1Q A;  2WB1 F;  4ITK A;  2ZEQ A;  4HRO A;  2PKE A;  5EE3 A;  2KOX A;  3RJI A;  4PVK A;  3N4E A;  3PWI A;  2IO3 B;  2D5G A;  2AAQ A;  2DUY A;  2HSZ A;  5FK9 C;  1LVH A;  3CXO A;  2NRV A;  2FBW B;  4XA5 A;  1I4R A;  2E8M A;  5KFT A;  1TFR A;  1I4P A;  5DLF A;  5DCN A;  1KKR A;  3EW9 A;  1RYS A;  4W9H A;  3RJH A;  2Q0Z X;  2ZW1 A;  1T6B X;  3RNB C;  1NK9 A;  1XSL A;  4H2A A;  1JX4 A;  2JF5 A;  2I38 A;  8ICE A;  5KFZ A;  3BJY A;  1EWY C;  4RGT A;  3WK9 A;  4PS7 A;  1UHU A;  4KSK C;  3PMN A;  2XY5 A;  2IGD A;  5T8I A;  2QGY A;  3UJF A;  4QZH A;  1GB1 A;  1ZW7 A;  1V9P A;  4F8C B;  4XE0 A;  5J0X A;  3ZDC A;  1NI3 A;  2JHD A;  2RSU A;  3DDM A;  2HXT A;  4F8R A;  2WP9 B;  5IO9 A;  2M19 A;  2FYM A;  3RMK C;  1W6T A;  3AXC A;  2IZV B;  3P63 A;  3AEA B;  4BFR A;  2DAF A;  4JB3 A;  2NS5 A;  1D5M C;  4C0Z A;  1U4B A;  4O3S A;  1M4V A;  1CZP A;  3RAX A;  4IRD A;  1N5W A;  2K4I A;  3RUI B;  1ZX9 A;  3E0F A;  2ZUB A;  1FMA D;  4BAX A;  5AKX A;  5AKH A;  2B76 B;  1XEE A;  2HTH A;  3MSY A; 
#chains in the Genus database with same CATH homology
 4IDI A;  2PLI A;  1HA5 A;  1F2R C;  1HZ6 A;  1VRA B;  3KWV A;  1QOF A;  3ZJV A;  5AE3 A;  1AWD A;  2WXJ A;  1X2G A;  3U2S C;  4MAC A;  3B9J A;  1W1L A;  4C56 C;  3DED A;  1P7E A;  4P16 A;  2WXK A;  1ESF A;  3HUI A;  4US9 A;  1JWU D;  2V4I B;  1C9F A;  2Q5W D;  3U7Z A;  1QOA A;  1SSN A;  1QLT A;  1IGC A;  1W1J A;  3A7R A;  1MHH E;  4A6Q A;  1D6E C;  2IPI A;  4US8 A;  2LHD A;  3A7A A;  1QIL A;  5AE2 A;  3W5V B;  3TEZ A;  3IXS A;  4NAW B;  3I9V 1;  2N0S B;  3L4P A;  2WDR B;  3AEG B;  3I99 A;  3R07 C;  4BCA A;  4JE3 B;  2QKN A;  2VFU A;  3TEX A;  5L6G A;  3AED B;  3NVY B;  1EWC A;  4OW0 A;  2NMQ A;  2IJ0 A;  3O13 A;  4KGT A;  2J52 A;  1I4Q A;  1KFY B;  1N63 A;  2V3P A;  2DWQ A;  3OWE B;  2DYM A;  4RF0 A;  1J7C A;  1FCL A;  1ZXI A;  3P42 A;  4NAM A;  3W8W A;  1C78 A;  2PW9 A;  5H92 C;  3TUO A;  1L6V A;  5BYS A;  5D3D A;  1SE2 A;  3AE6 B;  2VAO A;  1SXT A;  2WS3 B;  1ZPS A;  3BK2 A;  4N6E B;  3P4R B;  1AHV A;  2AQ2 B;  2QSD A;  3VRA B;  1STE A;  2WXN A;  1WGK A;  2MBR A;  4BBY A;  3KLS X;  3SFD B;  2L83 A;  2EXR A;  5G5G A;  2MJE A;  4B0M A;  3MJ5 A;  3FWA A;  1YN5 A;  1UUP A;  2XNA C;  1FXA A;  3GS2 A;  4JX1 C;  1W1R A;  4XDD A;  5HHZ A;  1VZ6 A;  1B1Z A;  3BVZ A;  2UUV A;  4ZOH C;  2PLS A;  1PGA A;  4HG0 A;  4WWM A;  1L4Z B;  2MJ3 A;  3W2D A;  1RFK A;  2KAC A;  2Y5C A;  1E8H A;  2I2Y A;  4PVJ A;  2LHE A;  2JWU A;  2V0G A;  1QOG A;  5FXD A;  3FC4 A;  1MVK A;  2K9X A;  4TVW A;  1TKG A;  3BVG A;  1XLQ A;  3AE4 B;  4RGM A;  3A7U A;  1ZR6 A;  2NTS A;  3P1M A;  1ET9 A;  1UXY A;  2OHF A;  3NVV B;  3B9J B;  2DBY A;  1ZDX A;  3IT6 B;  1N62 A;  4HEA 1;  5EE1 A;  5HMR A;  4MH8 A;  2RMM A;  4KKJ A;  5BMG A;  1SJH D;  4HKZ E;  1GAQ B;  4O95 A;  2LEK A;  1I4X A;  2GQU A;  3Q8B A;  2BVG A;  4UD8 A;  3FW7 A;  4EE2 A;  3P4Q B;  1WWT A;  1XLN A;  3IT4 B;  2Y3S A;  2QMT A;  2JYE A;  1L0X B;  2V3N A;  4PVH A;  1C4C A;  2QJL A;  1N60 A;  2K22 A;  3JS8 A;  3C0P A;  4PWB A;  1BXT A;  2ONQ A;  4DXG A;  1DYQ A;  3SFE B;  3W1S A;  4DXF A;  1W1K A;  3TSH A;  3ZGZ A;  5HFY A;  1DOY A;  1WVE A;  1VZ7 A;  3FW9 A;  2IGG A;  3P4S B;  1WVF A;  4JAY A;  1N61 A;  2BS3 B;  1T3Q C;  4ARI A;  5FXE A;  4OVZ A;  2RDH A;  1DGJ A;  3BW7 A;  1SB3 B;  1V8C A;  3D2D A;  4RFB A;  2K3U A;  3RJ8 A;  3EGR A;  1LO5 D;  3ABV B;  5FXF A;  1SBB B;  1JRO A;  1CQV A;  1QOB A;  4JB1 A;  2WXI A;  2LFI A;  5G5G B;  1QLB B;  5HQX A;  2VZK B;  1MBT A;  4MM3 B;  5FXP A;  1HXY D;  2DYO A;  5BMI A;  3T3O A;  2AQ1 B;  2WDQ B;  1W1S A;  4RF1 A;  1NEN B;  2G1E A;  2KWD A;  2LGI A;  1FFV A;  1DOI A;  1C4P A;  1UGJ A;  1YJJ A;  4YSY B;  3RFZ B;  1ZP0 B;  1BML C;  2K5P A;  1F2R I;  1TZO A;  5HI1 A;  3D2J A;  4N58 A;  3FW8 A;  3E9S A;  3LYY A;  3VR8 B;  4Q2J A;  2FUG 1;  5I1V A;  3NVV A;  1C4A A;  1FRR A;  3ZJU A;  2JSV X;  2ZW0 A;  1QQR A;  2P3H A;  1VZ8 A;  5D79 A;  3IAS 1;  3AEE B;  3WCQ A;  4DNS A;  4XLO A;  2ACZ B;  4RGN A;  2L32 A;  2INP E;  4P6V F;  4XWW A;  2WXM A;  4PZF A;  1ROE A;  4ZRP A;  3J9C A;  2MEK A;  4REZ A;  5ADZ A;  1FEH A;  4WH4 A;  4PYT A;  1FD6 A;  2BB6 A;  2WXP A;  4OHJ A;  3HVD A;  1SE3 A;  1TKE A;  1NEK B;  4DQO C;  1ZE3 D;  5G5H B;  5K8E A;  1NVI D;  3R8B A;  3LAE A;  1YN4 A;  2TSS A;  2LJI A;  3NVW B;  2QPM A;  3FAH A;  1XO3 A;  2QEJ C;  2VFS A;  1HZ5 A;  2R61 A;  4WIP A;  4L2Y A;  1DII A;  3GB1 A;  1AHU A;  5BYR A;  3AEC B;  3NZ3 A;  4RCO A;  2AQ3 B;  2K0P A;  4ZHO A;  2JZP A;  3S1D A;  2JQR B;  1RM6 B;  3NRZ A;  1HSK A;  3PO0 A;  3AEB B;  2WXL A;  3E56 A;  1JWB D;  1KF6 B;  1SF0 A;  5EE0 A;  1GB4 A;  2W3R A;  3ETR B;  1TYG B;  2NTT A;  2PVO D;  4YSZ B;  4TMA B;  4PVE A;  4RGO S;  1MBB A;  2BTE A;  1RWS A;  2W3S A;  1IBX A;  4GDK B;  4MT5 A;  2L52 A;  1KLU D;  3CIR B;  1ZXI C;  2IGH A;  3NVZ A;  1PDX A;  3KQ4 A;  3RJA A;  5I1W A;  2Y08 A;  3I57 A;  5JXV A;  4ML8 A;  2VFT A;  1JW9 D;  2QIL A;  4M0W A;  1KH0 A;  4ZHP A;  1C77 A;  1E10 A;  1FNU A;  3VRB B;  1D4B A;  2ON8 A;  1L5P A;  4TQ0 A;  5C3J B;  1XXG A;  1AHZ A;  1JAL A;  1C76 A;  1K51 A;  4YSX B;  2G9H D;  4GDL B;  1TS4 A;  3BWU D;  4OZA A;  2BS2 B;  3U52 E;  3VTE A;  1FRD A;  1ZDV A;  1TY2 A;  1WYG A;  1HEZ E;  3URY A;  1IGD A;  2N9L A;  2AX5 A;  1PUT A;  1VLB A;  1TKY A;  3BII D;  3CWI A;  4WAF A;  1JRP A;  3LB8 C;  1WSP A;  1R7S A;  1E0Z A;  3Q69 A;  4D2K A;  4WUR A;  2INN E;  1K53 A;  1RYJ A;  4C7Y A;  2WDW A;  1KRH A;  1MPE A;  4XDC A;  1E8F A;  4TQ1 A;  4YWG G;  1F0Z A;  5G5H A;  1VR9 A;  1XCQ L;  4RNA A;  2UUU A;  3NVW A;  4EC3 A;  4LK0 M;  3N9Y C;  1QKZ A;  2GB1 A;  1OFF A;  2IPK D;  2CJN A;  5H8Y E;  4A90 A;  4AS1 A;  1DZN A;  3DWG C;  3SR6 B;  4BC7 A;  2N7J A;  2CU3 A;  1L6U A;  1GPX A;  2JU6 X;  3BYY B;  3HRD C;  4KX6 B;  4HRS A;  4CQN A;  4WQM A;  3PZ8 A;  1ENF A;  3U4E G;  1KLG D;  5D3I B;  4KGR A;  1CK1 A;  3ETR A;  3AE8 B;  3NRZ B;  1T3Q A;  1AN8 A;  1A70 A;  3S1F A;  1VQZ A;  1ET6 A;  2JYT A;  2KQ4 X;  2WLB A;  3FIL B;  2PMV A;  1ZUD 2;  2P4P A;  2Q85 A;  3POP A;  2Y5P A;  2BS4 B;  2E6X A;  2Y3A A;  4YT0 B;  2PKO A;  1JCK B;  1AW7 A;  1NYR A;  5I4D A;  1D5X C;  2W55 A;  2SEB D;  5LNK 1;  2WXG A;  1IBX B;  3GP7 A;  1Q10 A;  4TSS A;  1V97 A;  4C80 A;  3MC0 B;  3NVZ B;  3BYT B;  3P4P B;  4YXD B;  1FIQ A;  1N5X A;  5FR3 A;  3NS1 A;  2LMC A;  1FFU A;  2GI9 A;  3DQ0 A;  3V05 A;  4OAL A;  2Y4G A;  4PT5 A;  1ACC A;  1IUE A;  4NJC A;  1E8G A;  2NQW A;  4ZOH B;  5BMH A;  1P7F A;  3W8Z A;  1K50 A;  3DWM A;  4KGS A;  5MPO A;  1SEB D;  2WU2 B;  1Y56 A;  1W1M A;  3TEY A;  1PFD A;  3AEF B;  5AE1 A;  1YQ4 B;  1WXQ A;  4R3D A;  3Q8E A;  3PM9 A;  1E0Y A;  1N5W C;  2WDV B;  2J4X A;  2RK5 A;  4YTP B;  4JPS A;  3ZJT A;  1F77 A;  3B2G A;  2HTM E;  1MI0 A;  4OZB A;  4USA A;  1XLO A;  5HHD G;  3AE9 B;  2VFR A;  1DOX A;  2CJO A;  4L1B A;  1E7P B;  2PLP A;  1JWM D;  2J42 A;  2PIA A;  3AE2 B;  2BBC A;  3MP9 A;  4ARC A;  1PGB A;  1AYF A;  1FCC C;  4YTM B;  3SR6 A;  1FXI A;  4OZC A;  5HG2 A;  1L4D B;  2BB5 A;  4FXC A;  3UI3 A;  2M0A A;  1L0V B;  1TS5 A;  3EUB 2;  1OQQ A;  2HDE A;  5FKA C;  1B9R A;  1J7B A;  2BT6 A;  2W54 A;  2WXH A;  3KWL A;  1UWM A;  2J53 A;  1ZOY B;  2XN9 C;  4AQ7 A;  2OAI A;  3TEW A;  3MFG A;  5E6J A;  5D7G A;  2WXO A;  3AE1 B;  1FM0 D;  1JQ4 A;  2YEP B;  2EEL A;  2KDM A;  1EU4 A;  3AV8 A;  3B2F A;  3FIL A;  4JWU C;  3Q8C A;  3KJM A;  2P13 A;  3GSY A;  2FE8 A;  4N59 A;  1F0X A;  1TJE A;  2PTL A;  3AE3 B;  2E5A A;  2KN4 A;  2KMM A;  4J3O D;  5AUI A;  3VR9 B;  3HRD D;  3AE5 B;  3T3N A;  1N63 C;  3LXF A;  2H89 B;  1CJE A;  3EA6 A;  3BVM A;  5EE9 A;  1D5Z C;  4L23 A;  1JWA D;  1WRI A;  3EUB 3;  5BYQ A;  3V3X A;  1XLP A;  1SB3 C;  1UWX A;  4IKG A;  1E9M A;  3TX1 A;  3R2I A;  5GXG B;  1I19 A;  4LLG M;  3BZD B;  2X38 A;  4XWT A;  2WXR A;  1FIQ B;  1YNT E;  2BVF A;  3NS1 B;  1W1O A;  1OQR A;  3AB5 A;  4C7Z A;  3SEB A;  2N9K A;  2W82 A;  3Q8F A;  1UNS A;  1MHX A;  1V1O A;  4ZYS A;  4IOI E;  3C8Y A;  2IDY A;  2Y3R A;  3D2H A;  2Q4W A;  1TS2 A;  3S1C A;  2M56 B;  1QF6 A;  1FNW A;  1TY0 A;  1TS3 A;  2WQY B;  2O3G A;  5L6F A;  4TVY A;  3IAM 1;  2E3T A;  1FO4 A;  1T5X D;  2PVG C;  2MH7 A;  1NYQ A;  1YN3 A;  3AMZ A;  1V1P B;  2H88 B;  4O1N A;  1X2H A;  3PZ7 A;  4YTN B;  4NZL B;  3ZYY X;  2DLB A;  3LLB A;  1YJI A;  4A9A A;  2VFV A;  4PWC A;  3W9C B;  2AXR A;  2EKI A;  3VQI A;  1I4G A;  1XF5 L;  1EM7 A;  2WNM A;  4HJG E;  5AUK A;  3ZQ4 A;  2I0K A;  2JX5 A;  2YVS A;  1N62 C;  3AH7 A;  5AWV A;  3Q8A A;  2RPV A;  3R2T A;  2WXQ A;  2BW2 A;  1VDV A;  1SJE D;  1XCT L;  1BUI C;  2QIE B;  1K52 A;  2LUM A;  2WU5 B;  3HVZ A;  4A55 A;  4B0E A;  3HSU A;  2SAK A;  1J7A A;  2R8D A;  5TSS A;  4RH6 A;  2OED A;  2RDG A;  1EU3 A;  3AE7 B;  2BYT A;  1FNV A;  1DIQ A;  1W1Q A;  4ZRQ A;  1L0Y B;  1N60 C;  1C79 A;  3NUH B;  4ITK A;  2GRI A;  4HRO A;  4JWS C;  5EE3 A;  2GQT A;  3NVY A;  4PVK A;  4HKQ A;  1PYW D;  1E6E B;  2D5G A;  2Z8L A;  5FK9 C;  2WXF A;  2L1A A;  3BK1 A;  2FBW B;  2ICI A;  1RM6 C;  1I4R A;  1I4P A;  2BVH A;  4BC9 A;  3PQB A;  1HQR D;  4GLS C;  1N61 C;  4A8X C;  2ZW1 A;  4UDU C;  2JXT A;  1T6B X;  1ZXH A;  4H2A A;  4LTU A;  3S1E A;  2I38 A;  1EWY C;  4RGT A;  3TSJ A;  1SIJ A;  3AM9 A;  1VAO A;  2YEP F;  2KAJ A;  2IGD A;  5T8I A;  5C2T B;  1GB1 A;  1PGX A;  1I4H A;  1VJK A;  4XE0 A;  1I7H A;  1NI3 A;  2R2Z A;  3AN1 A;  2MJD A;  3RPF C;  2WP9 B;  3W5U B;  2M19 A;  3P63 A;  3AEA B;  3W8X A;  1FFU C;  3H8H A;  4MLA A;  1D5M C;  1KTK A;  1M4V A;  1FFV C;  1CZP A;  1JML A;  3MHZ A;  1N5W A;  1V1P A;  1GOZ A;  1FMA D;  1QT9 A;  1YMH E;  1YQ3 B;  2VZK D;  4KKI A;  3TSS A;  1QLU A;  2B76 B;  1JWS D;  1XEE A;  1SE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...