1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
1E0YA 1DIQA 2VFTA 2VFRA 4MLAA 3TSJA 5FXDA 3PM9A 2VFUA 1AHZA 1W1LA 1WVFA 1FIQB 3B9JB 5ADZA 3S1CA 2P4PA 1ZR6A 1W1OA 2VAOA 3TSHA 2PLIA 2W3RA 3HRDC 3S1FA 1FFUC 1T3QC 1W1QA 3SR6B 1N5XA 4BBYA 3D2JA 2W54A 3NVVB 1F0XA 1QLUA 1N63C 2OAIA 2P13A 2QPMA 4OALA 4DNSA 1FO4A 2PLSA 4JAYA 2AXRA 2VFVA 3EUB3 5HHZA 2BVFA 2BVHA 3D2DA 1N5WC 3FW9A 3LAEA 1FFVC 2EXRA 2W55A 4PWCA 2YVSA 2GQUA 3NRZB 1N61C 3W8XA 3AMZA 4UD8A 2R2ZA 1AHUA 3FWAA 2Q85A 1QLTA 2QKNA 2E3TA 1JROA 1I19A 3W8WA 3GSYA 4TVYA 2R8DA 1W1RA 1DZNA 1E8GA 1WVEA 4BC7A 3LLBA 3A7AA 3NVWB 3W8ZA 3FW7A 4TVWA 3A7RA 5G5HB 4ZOHB 3BW7A 4PZFA 1X2HA 2GQTA 1E8FA 5HMRA 1DIIA 3ETRB 4PVHA 5FXFA 2BVGA 3S1DA 5FXEA 2NQWA 2RK5A 3NVYB 3DQ0A 1X2GA 3TX1A 3AN1A 5G5GB 4HG0A 4ML8A 2VFSA 2I0KA 1W1MA 4O95A 4PVJA 5D79A 1W1JA 1UXYA 4JB1A 1HSKA 1WYGA 3A7UA 1V97A 3KJMA 1N60C 2P3HA 1MBBA 2MBRA 1W1SA 2E5AA 1RM6B 1VDVA 4BC9A 3VTEA 4PVEA 3C0PA 1VQZA 3D2HA 3R07C 2W3SA 5HQXA 3NS1B 3NVZB 1W1KA 3S1EA 4XLOA 1VAOA 1E8HA 1AHVA 2Q4WA 1N62C 4EC3A 5AE2A 3AM9A 3JS8A 4PVKA 5AE3A 4BCAA 3DEDA 4PWBA 1JRPA 5AE1A 5FXPA 4PYTA 3I99A 1ZXIC 3FW8A 2O3GA 1SB3B 1MBTA
chains in the Genus database with same CATH superfamily
5L6FA 1NELA 3KUMA 1GSNA 1XHCA 1NU5A 4J1OA 1SJDA 2JK6A 3B9JB 2PTYA 2ZC8A 2HZGA 2YVFA 4IP4A 4EQWA 2W3RA 3FV9A 4H4TA 4HNCA 3SQPA 4ENLA 2FYMA 2Y3RA 3D47A 2P8BA 3TCSA 4J57A 1FECA 3KLJA 5JCLA 2Y08A 2W54A 2OG9A 3BSMA 1QLUA 1N63C 3UCDA 1E9IA 4J3ZA 5FJRA 2GGGA 1V59A 2XH4A 3OP2A 2AXRA 3GD4A 1H2IA 2HNEA 2BVFA 2PTXA 2QJNA 3D2DA 2O56A 5JCIA 3ES7A 2WPFA 2XGZA 3H7VA 3V3WA 5IDZA 2OZ3A 1BQGA 2EXRA 2YVSA 3NRZB 3DK9A 3U4FA 2WPEA 3S47A 1EBDA 1WUEA 2GR1A 2Q85A 4LA1A 1NHPA 2OVLA 3GRSA 2WP6A 2QAEA 1I19A 2QJJA 4DHGA 2OZ8A 2PTZA 4H4SA 2P8CA 2R8DA 4KPRA 4Z17A 3CT2A 3DERA 4BC7A 3W8ZA 2X99A 3FW7A 4HN8A 3Q45A 3QKEA 1KKRA 3R1ZA 3DK4A 3LADA 4DYEA 2AKMA 3RCYA 1KN0A 2NPXA 2PS2A 5HMRA 4FX9A 1TKKA 5FXFA 3R0UA 4H4YA 4EQRA 1RVKA 2AAQA 1EC8A 3TOYA 1SJAA 3DQ0A 1X2GA 4JN8A 4M6UA 1ZK7A 1GRBA 1MNSA 2HXTA 3AN1A 2TPRA 3H8AA 3QFBA 2VFSA 3BJSA 1JPMA 2PTWA 3ZVIA 2C3DA 1UXYA 4JB1A 3GD6A 1JOAA 3ZLHA 3I6TA 4G7FA 2GRTA 4FI4A 4IL0A 4BC9A 1SJBA 2BCPA 3C0PA 2X8GA 3D2HA 3PG6A 2W3SA 3RGTA 5HQXA 2QGYA 5I1WA 3CYJA 3UCCA 3DG6A 4ADWA 3IJIA 3EJEB 1W1KA 3OZYA 4NEVA 4ZCWA 2QDDA 4EC3A 1GREA 3MSYA 2V3BA 1GERA 1NHQA 3OZMA 2IPIA 2OLAA 1Q1RA 4E5TA 1D7YA 4FP1A 4H4WA 3DEDA 3DH9A 3ENLA 2HQMA 4H83A 3UJFA 1ZMDA 3IK4A 3FW8A 3CB3A 2O3GA 3OPSA 5FJUA 4MLAA 2AL2A 3QN3A 3TSJA 3PM9A 2OKTA 4IT1A 2VFUA 1W1LA 1WVFA 1FIQB 1SJCA 3ZVHB 5ADZA 2GGHA 2GGJA 1ZR6A 3R11A 2CHRA 2HXUA 3MY9A 3DJGX 4IL2A 2GR2A 1T3QC 1R6WA 3FXGA 2EQ8A 3D2JA 1DNCA 1YEYA 2R9ZA 1F0XA 1XS2A 2P13A 2QPMA 4GRTA 3SJNA 2AL2B 1KKOA 1ZDLA 3HW2A 3POPA 2CFYA 2BVHA 2YVJA 4HNLA 3GY1A 1MDRA 2OPJA 3EEZA 1EBGA 4YWSA 3SQSA 3R10A 3LAEA 1FFVC 2W55A 2OQYA 4HYRA 1LPFA 4M0XA 4UD8A 1F9CA 3FWAA 3V5CA 5JCKA 1R0MA 3TTEA 3DFHA 1GETA 3D46A 1BKHA 2A8XA 3W8WA 1F8WA 4TVYA 5JCNA 2NVKX 2X8HA 1DZNA 5FJPA 3A7AA 3MKCA 3IJQA 1NPXA 3VC5A 3N4EA 2F5ZA 3EJDB 1DTNA 3A7RA 4M52A 4H2HA 4DWDA 2OX4A 1X2HA 2P88A 3PWIA 2YAUA 4GR1A 3FYYA 3U9IA 2PGWA 3N6JA 3OW1A 4H4ZA 1DIIA 3ETRB 4PVHA 3RNMA 5KVHA 1P43A 3I4KA 3VCCA 1JEHA 2RK5A 3QTPA 1NHSA 4EWJA 1DXLA 4H4VA 2XH0A 3CGBA 4HG0A 4ML8A 5D79A 4EMIA 3UJRA 4MMWA 5FJTA 1HSKA 1ZX9A 3UXLA 4K7ZA 3TQPA 3P93A 3NZGA 2MBRA 3TWBA 3JW7A 1VQZA 2PMQA 4EQXA 2XSXA 4EMWA 2GH5A 3DG7A 4K1WA 3D9XA 4XLOA 2WBAA 2ZZBA 3DG3A 3H4KA 3SBFA 4EM3A 1GRAA 3EF6A 2GDQA 2PP3A 5AWVA 1NHRA 5FS7A 5ER0A 1MUCA 1P48A 3JVAA 3THUA 3VA8A 2QDEA 4BCAA 3CAWA 1GRFA 3TWAA 1ONFA 4IHCA 5U1OA 3T8QA 2YQUA 1ZXIC 1KD0A 4JN7A 3TJ4A 3QFAA 5EBKA 1SB3B 2WP5A 2J3NA 2PCEA 1E0YA 1DIQA 2VFTA 2GGEA 4HCDA 2GSHA 3BOXA 5FXDA 3PFRA 2XH7A 3DIPA 2PA6A 4BV6A 3T4WA 3L8KA 3DGHA 5ENLA 4K2SA 1JPDX 3OC4A 3VDGA 2VAOA 4EMJA 2PU0A 3TSHA 1MRAA 3HRDC 3V5FA 3S1FA 1OJTA 3O0HA 1FFUC 2OZTA 3MWCA 3SR6B 2CDUA 4DNAA 4HPNA 1FEAA 2OAIA 3DESA 3SN0A 2Y4GA 5J04A 1JDFA 4H19A 4OALA 7ENLA 1FO4A 3UJSA 4H4UA 4DXKA 2PLSA 4GFIA 2C3CA 4GGHA 4EM4A 2VFVA 4JQ9A 4X2PA 3EUB3 5HHZA 2GR0A 3PQBA 4G8TA 3CXOA 3I6EA 3CGEA 1H6VA 2I5QA 1N5WC 2OQHA 4H1ZA 2POZA 3MZNA 2PPGA 3SN1A 3URHA 3FJ4A 3H12A 1N61C 3FVDA 3HPFA 3AMZA 2R2ZA 2PGEA 2WDWA 4E4UA 1K4QA 3RO6A 3L5OA 3QPEA 3EJBB 1GRGA 2E3TA 2QQ6A 1JROA 1M6IA 1XDIA 2RDXA 3GSYA 4MGGA 3NO1A 1W1RA 1PDZA 1ONEA 1EC7A 3NVWB 3S5SA 1W6TA 5TR3A 2PP1A 4TVWA 3PK7A 4BURA 4HCHA 4ZOHB 3BW7A 2BC0A 4PZFA 3DK8A 3NXLA 3Q6JA 3ZVHA 5U25A 3JZUA 4E8GA 3CK5A 2GQTA 3EANA 1E8FA 6ENLA 3Q4DA 2OFJA 3TJIA 3S1DA 3NVYB 3DFYA 5BOFA 2P3ZA 3TX1A 3GC2A 4JDRA 3UJEA 2I0KA 4O95A 1PDYA 3SN4A 4A6GA 1V97A 5L6GA 3EKGA 1KCZA 2P3HA 3CGDA 1W1SA 4GYPA 5FJOA 1VDVA 4Z1YA 2DW7A 4PVEA 2ZZ0A 4KPLA 3DEQA 3GD3A 3II4A 5JRBA 1GRHA 3IC9A 2PODA 3S1EA 1AHVA 1OEPA 1TE6A 3RJAA 2V6OA 4EQSA 1ZKQA 3RRAA 1LVLA 4IP5A 1ECQA 4KWSA 4PVKA 5AE3A 3STPA 4APNA 1JRPA 5AE1A 4PYTA 4ZA0A 3N4FA 1GEUA 3DDMA 3R25A 1ELSA 1GESA 5EU9A 1MBTA 3RITA 1AOGA 2RABA 4YWOA 2VFRA 3HSUA 4H4XA 1GV4A 3SSZA 1XANA 1AHZA 1GRTA 5FS6A 1XPYA 3S1CA 5BOEA 2P4PA 1W1OA 4E4FA 2PLIA 2GQWA 4F4RA 3CXBA 4MKSA 4GIRA 2MNRA 4A35A 4HCLA 1W1QA 2XH2A 3RJ8A 1N5XA 4BBYA 1IYXA 3RR1A 3NVVB 2ZZCA 1F3PA 2EQ6A 2ONEA 1MDLA 5FS9A 2YVGA 2WOVA 4K8DA 3N6HA 4DNSA 3UGVA 4JAYA 2FKPA 2BC1A 1FHVA 2X8CA 4JHMA 4E6MA 1EBHA 4DX3A 2EQ7A 3H70A 2NQLA 3FW9A 2AL1A 3FG2P 1ZMCA 2MUCA 1JCTA 4GISA 4PWCA 2GQUA 5FMHA 3T9PA 3W8XA 1Q1WA 3TW9A 1AHUA 1TYTA 4K8GA 1QLTA 2QKNA 2DW6A 1NDAA 2UUUA 3K1GA 2PU1A 4ROPA 1FEBA 3ZLFA 2QJMA 3PWGA 3DJJA 3VC6A 3LB8A 3VFCA 2AKZA 3GRTA 1YQZA 1E8GA 3P0WA 1WVEA 4GGBA 3ZLGA 3LLBA 4H4QA 3B97A 3P3BA 5GRTA 3ES8A 4KEMA 5G5HB 4NEWA 2P0IA 5K8EA 1FHUA 4H4PA 1WUFA 3GO2A 3QLDA 2EQ9A 3MQTA 2GGIA 3UJ2A 2BVGA 3EAOA 3MUCA 5FXEA 4FDCB 2PSNA 2NQWA 3R0KA 1S7MA 1TZZA 4IZGA 3VCNA 3V4BA 1GXFA 5G5GB 2V3AA 2WOIA 3CGCA 4KT2A 1W1MA 4PVJA 2ZADA 3OTRA 3NFUA 1W1JA 4DN1A 2Y3SA 4J56A 2W0HA 2PP0A 1WYGA 1MO9A 3A7UA 3KJMA 1N60C 1EC9A 1MBBA 3DGBA 2E5AA 1RM6B 1STZA 1ZY8A 3VTEA 3R07C 5JCMA 2UUVA 3NS1B 4LIIA 3DGZA 3NVZB 4H50A 5I1VA 4H4RA 4GYPC 1VAOA 1E8HA 1MOKA 2Q4WA 1N62C 5AE2A 1BZLA 3FCPA 1BWCA 1L8PA 3IJLA 3UXKA 2GL5A 3T6CA 3AM9A 3JS8A 2X50A 4PWBA 4A3RA 5FXPA 2GR3A 3I99A 1TYPA 2WOWA 3LXDA 4GMEA 5KVIA 2OO6A 2QVHA 2WPCA 5FS8A
chains in the Genus database with same CATH topology
1E0YA 5L6FA 1DIQA 2VFTA 2VFRA 4MLAA 3HSUA 3TSJA 5FXDA 3PM9A 2VFUA 1AHZA 1W1LA 1WVFA 1FIQB 3B9JB 5ADZA 3S1CA 2P4PA 1ZR6A 1W1OA 2VAOA 3TSHA 2PLIA 2W3RA 3HRDC 3S1FA 2Y3RA 1FFUC 1T3QC 1W1QA 3SR6B 3RJ8A 1N5XA 4BBYA 3D2JA 2W54A 2Y08A 3NVVB 1F0XA 1QLUA 1N63C 2OAIA 2P13A 2Y4GA 2QPMA 4OALA 4DNSA 1FO4A 2PLSA 4JAYA 2AXRA 2VFVA 3EUB3 5HHZA 3PQBA 2BVFA 3POPA 2BVHA 3D2DA 1N5WC 3FW9A 3LAEA 1FFVC 2EXRA 2W55A 4PWCA 2YVSA 2GQUA 3NRZB 1N61C 3W8XA 3AMZA 4UD8A 2R2ZA 1AHUA 3FWAA 2WDWA 2Q85A 1QLTA 2QKNA 2UUUA 2E3TA 1JROA 1I19A 3W8WA 3GSYA 4TVYA 2R8DA 1W1RA 1DZNA 1E8GA 1WVEA 4BC7A 3LLBA 3A7AA 3NVWB 3W8ZA 3FW7A 4TVWA 3A7RA 5G5HB 4ZOHB 3BW7A 4PZFA 5K8EA 1X2HA 2GQTA 1E8FA 5HMRA 1DIIA 3ETRB 4PVHA 5FXFA 2BVGA 3S1DA 5FXEA 2NQWA 2RK5A 3NVYB 3DQ0A 1X2GA 3TX1A 3AN1A 5G5GB 4HG0A 4ML8A 2VFSA 2I0KA 1W1MA 4O95A 4PVJA 5D79A 2Y3SA 1W1JA 1UXYA 4JB1A 1HSKA 1WYGA 3A7UA 1V97A 5L6GA 3KJMA 1N60C 2P3HA 1MBBA 2MBRA 1W1SA 2E5AA 1RM6B 1VDVA 4BC9A 3VTEA 4PVEA 3C0PA 1VQZA 3D2HA 3R07C 2W3SA 5HQXA 2UUVA 5I1WA 3NS1B 5I1VA 3NVZB 1W1KA 3S1EA 4XLOA 1VAOA 1E8HA 1AHVA 2Q4WA 1N62C 4EC3A 5AE2A 5AWVA 3RJAA 2IPIA 3AM9A 3JS8A 4PVKA 5AE3A 4BCAA 3DEDA 4PWBA 1JRPA 5AE1A 5FXPA 4PYTA 3I99A 1ZXIC 3FW8A 2O3GA 1SB3B 1MBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E0Y A;  1DIQ A;  2VFT A;  2VFR A;  4MLA A;  3TSJ A;  5FXD A;  3PM9 A;  2VFU A;  1AHZ A;  1W1L A;  1WVF A;  1FIQ B;  3B9J B;  5ADZ A;  3S1C A;  2P4P A;  1ZR6 A;  1W1O A;  2VAO A;  3TSH A;  2PLI A;  2W3R A;  3HRD C;  3S1F A;  1FFU C;  1T3Q C;  1W1Q A;  3SR6 B;  1N5X A;  4BBY A;  3D2J A;  2W54 A;  3NVV B;  1F0X A;  1QLU A;  1N63 C;  2OAI A;  2P13 A;  2QPM A;  4OAL A;  4DNS A;  1FO4 A;  2PLS A;  4JAY A;  2AXR A;  2VFV A;  3EUB 3;  5HHZ A;  2BVF A;  2BVH A;  3D2D A;  1N5W C;  3FW9 A;  3LAE A;  1FFV C;  2EXR A;  2W55 A;  4PWC A;  2YVS A;  2GQU A;  3NRZ B;  1N61 C;  3W8X A;  3AMZ A;  4UD8 A;  2R2Z A;  1AHU A;  3FWA A;  2Q85 A;  1QLT A;  2QKN A;  2E3T A;  1JRO A;  1I19 A;  3W8W A;  3GSY A;  4TVY A;  2R8D A;  1W1R A;  1DZN A;  1E8G A;  1WVE A;  4BC7 A;  3LLB A;  3A7A A;  3NVW B;  3W8Z A;  3FW7 A;  4TVW A;  3A7R A;  5G5H B;  4ZOH B;  3BW7 A;  4PZF A;  1X2H A;  2GQT A;  1E8F A;  5HMR A;  1DII A;  3ETR B;  4PVH A;  5FXF A;  2BVG A;  3S1D A;  5FXE A;  2NQW A;  2RK5 A;  3NVY B;  3DQ0 A;  1X2G A;  3TX1 A;  3AN1 A;  5G5G B;  4HG0 A;  4ML8 A;  2VFS A;  2I0K A;  1W1M A;  4O95 A;  4PVJ A;  5D79 A;  1W1J A;  1UXY A;  4JB1 A;  1HSK A;  1WYG A;  3A7U A;  1V97 A;  3KJM A;  1N60 C;  2P3H A;  1MBB A;  2MBR A;  1W1S A;  2E5A A;  1RM6 B;  1VDV A;  4BC9 A;  3VTE A;  4PVE A;  3C0P A;  1VQZ A;  3D2H A;  3R07 C;  2W3S A;  5HQX A;  3NS1 B;  3NVZ B;  1W1K A;  3S1E A;  4XLO A;  1VAO A;  1E8H A;  1AHV A;  2Q4W A;  1N62 C;  4EC3 A;  5AE2 A;  3AM9 A;  3JS8 A;  4PVK A;  5AE3 A;  4BCA A;  3DED A;  4PWB A;  1JRP A;  5AE1 A;  5FXP A;  4PYT A;  3I99 A;  1ZXI C;  3FW8 A;  2O3G A;  1SB3 B;  1MBT A; 
#chains in the Genus database with same CATH topology
 5L6F A;  1NEL A;  3KUM A;  1GSN A;  1XHC A;  1NU5 A;  4J1O A;  1SJD A;  2JK6 A;  3B9J B;  2PTY A;  2ZC8 A;  2HZG A;  2YVF A;  4IP4 A;  4EQW A;  2W3R A;  3FV9 A;  4H4T A;  4HNC A;  3SQP A;  4ENL A;  2FYM A;  2Y3R A;  3D47 A;  2P8B A;  3TCS A;  4J57 A;  1FEC A;  3KLJ A;  5JCL A;  2Y08 A;  2W54 A;  2OG9 A;  3BSM A;  1QLU A;  1N63 C;  3UCD A;  1E9I A;  4J3Z A;  5FJR A;  2GGG A;  1V59 A;  2XH4 A;  3OP2 A;  2AXR A;  3GD4 A;  1H2I A;  2HNE A;  2BVF A;  2PTX A;  2QJN A;  3D2D A;  2O56 A;  5JCI A;  3ES7 A;  2WPF A;  2XGZ A;  3H7V A;  3V3W A;  5IDZ A;  2OZ3 A;  1BQG A;  2EXR A;  2YVS A;  3NRZ B;  3DK9 A;  3U4F A;  2WPE A;  3S47 A;  1EBD A;  1WUE A;  2GR1 A;  2Q85 A;  4LA1 A;  1NHP A;  2OVL A;  3GRS A;  2WP6 A;  2QAE A;  1I19 A;  2QJJ A;  4DHG A;  2OZ8 A;  2PTZ A;  4H4S A;  2P8C A;  2R8D A;  4KPR A;  4Z17 A;  3CT2 A;  3DER A;  4BC7 A;  3W8Z A;  2X99 A;  3FW7 A;  4HN8 A;  3Q45 A;  3QKE A;  1KKR A;  3R1Z A;  3DK4 A;  3LAD A;  4DYE A;  2AKM A;  3RCY A;  1KN0 A;  2NPX A;  2PS2 A;  5HMR A;  4FX9 A;  1TKK A;  5FXF A;  3R0U A;  4H4Y A;  4EQR A;  1RVK A;  2AAQ A;  1EC8 A;  3TOY A;  1SJA A;  3DQ0 A;  1X2G A;  4JN8 A;  4M6U A;  1ZK7 A;  1GRB A;  1MNS A;  2HXT A;  3AN1 A;  2TPR A;  3H8A A;  3QFB A;  2VFS A;  3BJS A;  1JPM A;  2PTW A;  3ZVI A;  2C3D A;  1UXY A;  4JB1 A;  3GD6 A;  1JOA A;  3ZLH A;  3I6T A;  4G7F A;  2GRT A;  4FI4 A;  4IL0 A;  4BC9 A;  1SJB A;  2BCP A;  3C0P A;  2X8G A;  3D2H A;  3PG6 A;  2W3S A;  3RGT A;  5HQX A;  2QGY A;  5I1W A;  3CYJ A;  3UCC A;  3DG6 A;  4ADW A;  3IJI A;  3EJE B;  1W1K A;  3OZY A;  4NEV A;  4ZCW A;  2QDD A;  4EC3 A;  1GRE A;  3MSY A;  2V3B A;  1GER A;  1NHQ A;  3OZM A;  2IPI A;  2OLA A;  1Q1R A;  4E5T A;  1D7Y A;  4FP1 A;  4H4W A;  3DED A;  3DH9 A;  3ENL A;  2HQM A;  4H83 A;  3UJF A;  1ZMD A;  3IK4 A;  3FW8 A;  3CB3 A;  2O3G A;  3OPS A;  5FJU A;  4MLA A;  2AL2 A;  3QN3 A;  3TSJ A;  3PM9 A;  2OKT A;  4IT1 A;  2VFU A;  1W1L A;  1WVF A;  1FIQ B;  1SJC A;  3ZVH B;  5ADZ A;  2GGH A;  2GGJ A;  1ZR6 A;  3R11 A;  2CHR A;  2HXU A;  3MY9 A;  3DJG X;  4IL2 A;  2GR2 A;  1T3Q C;  1R6W A;  3FXG A;  2EQ8 A;  3D2J A;  1DNC A;  1YEY A;  2R9Z A;  1F0X A;  1XS2 A;  2P13 A;  2QPM A;  4GRT A;  3SJN A;  2AL2 B;  1KKO A;  1ZDL A;  3HW2 A;  3POP A;  2CFY A;  2BVH A;  2YVJ A;  4HNL A;  3GY1 A;  1MDR A;  2OPJ A;  3EEZ A;  1EBG A;  4YWS A;  3SQS A;  3R10 A;  3LAE A;  1FFV C;  2W55 A;  2OQY A;  4HYR A;  1LPF A;  4M0X A;  4UD8 A;  1F9C A;  3FWA A;  3V5C A;  5JCK A;  1R0M A;  3TTE A;  3DFH A;  1GET A;  3D46 A;  1BKH A;  2A8X A;  3W8W A;  1F8W A;  4TVY A;  5JCN A;  2NVK X;  2X8H A;  1DZN A;  5FJP A;  3A7A A;  3MKC A;  3IJQ A;  1NPX A;  3VC5 A;  3N4E A;  2F5Z A;  3EJD B;  1DTN A;  3A7R A;  4M52 A;  4H2H A;  4DWD A;  2OX4 A;  1X2H A;  2P88 A;  3PWI A;  2YAU A;  4GR1 A;  3FYY A;  3U9I A;  2PGW A;  3N6J A;  3OW1 A;  4H4Z A;  1DII A;  3ETR B;  4PVH A;  3RNM A;  5KVH A;  1P43 A;  3I4K A;  3VCC A;  1JEH A;  2RK5 A;  3QTP A;  1NHS A;  4EWJ A;  1DXL A;  4H4V A;  2XH0 A;  3CGB A;  4HG0 A;  4ML8 A;  5D79 A;  4EMI A;  3UJR A;  4MMW A;  5FJT A;  1HSK A;  1ZX9 A;  3UXL A;  4K7Z A;  3TQP A;  3P93 A;  3NZG A;  2MBR A;  3TWB A;  3JW7 A;  1VQZ A;  2PMQ A;  4EQX A;  2XSX A;  4EMW A;  2GH5 A;  3DG7 A;  4K1W A;  3D9X A;  4XLO A;  2WBA A;  2ZZB A;  3DG3 A;  3H4K A;  3SBF A;  4EM3 A;  1GRA A;  3EF6 A;  2GDQ A;  2PP3 A;  5AWV A;  1NHR A;  5FS7 A;  5ER0 A;  1MUC A;  1P48 A;  3JVA A;  3THU A;  3VA8 A;  2QDE A;  4BCA A;  3CAW A;  1GRF A;  3TWA A;  1ONF A;  4IHC A;  5U1O A;  3T8Q A;  2YQU A;  1ZXI C;  1KD0 A;  4JN7 A;  3TJ4 A;  3QFA A;  5EBK A;  1SB3 B;  2WP5 A;  2J3N A;  2PCE A;  1E0Y A;  1DIQ A;  2VFT A;  2GGE A;  4HCD A;  2GSH A;  3BOX A;  5FXD A;  3PFR A;  2XH7 A;  3DIP A;  2PA6 A;  4BV6 A;  3T4W A;  3L8K A;  3DGH A;  5ENL A;  4K2S A;  1JPD X;  3OC4 A;  3VDG A;  2VAO A;  4EMJ A;  2PU0 A;  3TSH A;  1MRA A;  3HRD C;  3V5F A;  3S1F A;  1OJT A;  3O0H A;  1FFU C;  2OZT A;  3MWC A;  3SR6 B;  2CDU A;  4DNA A;  4HPN A;  1FEA A;  2OAI A;  3DES A;  3SN0 A;  2Y4G A;  5J04 A;  1JDF A;  4H19 A;  4OAL A;  7ENL A;  1FO4 A;  3UJS A;  4H4U A;  4DXK A;  2PLS A;  4GFI A;  2C3C A;  4GGH A;  4EM4 A;  2VFV A;  4JQ9 A;  4X2P A;  3EUB 3;  5HHZ A;  2GR0 A;  3PQB A;  4G8T A;  3CXO A;  3I6E A;  3CGE A;  1H6V A;  2I5Q A;  1N5W C;  2OQH A;  4H1Z A;  2POZ A;  3MZN A;  2PPG A;  3SN1 A;  3URH A;  3FJ4 A;  3H12 A;  1N61 C;  3FVD A;  3HPF A;  3AMZ A;  2R2Z A;  2PGE A;  2WDW A;  4E4U A;  1K4Q A;  3RO6 A;  3L5O A;  3QPE A;  3EJB B;  1GRG A;  2E3T A;  2QQ6 A;  1JRO A;  1M6I A;  1XDI A;  2RDX A;  3GSY A;  4MGG A;  3NO1 A;  1W1R A;  1PDZ A;  1ONE A;  1EC7 A;  3NVW B;  3S5S A;  1W6T A;  5TR3 A;  2PP1 A;  4TVW A;  3PK7 A;  4BUR A;  4HCH A;  4ZOH B;  3BW7 A;  2BC0 A;  4PZF A;  3DK8 A;  3NXL A;  3Q6J A;  3ZVH A;  5U25 A;  3JZU A;  4E8G A;  3CK5 A;  2GQT A;  3EAN A;  1E8F A;  6ENL A;  3Q4D A;  2OFJ A;  3TJI A;  3S1D A;  3NVY B;  3DFY A;  5BOF A;  2P3Z A;  3TX1 A;  3GC2 A;  4JDR A;  3UJE A;  2I0K A;  4O95 A;  1PDY A;  3SN4 A;  4A6G A;  1V97 A;  5L6G A;  3EKG A;  1KCZ A;  2P3H A;  3CGD A;  1W1S A;  4GYP A;  5FJO A;  1VDV A;  4Z1Y A;  2DW7 A;  4PVE A;  2ZZ0 A;  4KPL A;  3DEQ A;  3GD3 A;  3II4 A;  5JRB A;  1GRH A;  3IC9 A;  2POD A;  3S1E A;  1AHV A;  1OEP A;  1TE6 A;  3RJA A;  2V6O A;  4EQS A;  1ZKQ A;  3RRA A;  1LVL A;  4IP5 A;  1ECQ A;  4KWS A;  4PVK A;  5AE3 A;  3STP A;  4APN A;  1JRP A;  5AE1 A;  4PYT A;  4ZA0 A;  3N4F A;  1GEU A;  3DDM A;  3R25 A;  1ELS A;  1GES A;  5EU9 A;  1MBT A;  3RIT A;  1AOG A;  2RAB A;  4YWO A;  2VFR A;  3HSU A;  4H4X A;  1GV4 A;  3SSZ A;  1XAN A;  1AHZ A;  1GRT A;  5FS6 A;  1XPY A;  3S1C A;  5BOE A;  2P4P A;  1W1O A;  4E4F A;  2PLI A;  2GQW A;  4F4R A;  3CXB A;  4MKS A;  4GIR A;  2MNR A;  4A35 A;  4HCL A;  1W1Q A;  2XH2 A;  3RJ8 A;  1N5X A;  4BBY A;  1IYX A;  3RR1 A;  3NVV B;  2ZZC A;  1F3P A;  2EQ6 A;  2ONE A;  1MDL A;  5FS9 A;  2YVG A;  2WOV A;  4K8D A;  3N6H A;  4DNS A;  3UGV A;  4JAY A;  2FKP A;  2BC1 A;  1FHV A;  2X8C A;  4JHM A;  4E6M A;  1EBH A;  4DX3 A;  2EQ7 A;  3H70 A;  2NQL A;  3FW9 A;  2AL1 A;  3FG2 P;  1ZMC A;  2MUC A;  1JCT A;  4GIS A;  4PWC A;  2GQU A;  5FMH A;  3T9P A;  3W8X A;  1Q1W A;  3TW9 A;  1AHU A;  1TYT A;  4K8G A;  1QLT A;  2QKN A;  2DW6 A;  1NDA A;  2UUU A;  3K1G A;  2PU1 A;  4ROP A;  1FEB A;  3ZLF A;  2QJM A;  3PWG A;  3DJJ A;  3VC6 A;  3LB8 A;  3VFC A;  2AKZ A;  3GRT A;  1YQZ A;  1E8G A;  3P0W A;  1WVE A;  4GGB A;  3ZLG A;  3LLB A;  4H4Q A;  3B97 A;  3P3B A;  5GRT A;  3ES8 A;  4KEM A;  5G5H B;  4NEW A;  2P0I A;  5K8E A;  1FHU A;  4H4P A;  1WUF A;  3GO2 A;  3QLD A;  2EQ9 A;  3MQT A;  2GGI A;  3UJ2 A;  2BVG A;  3EAO A;  3MUC A;  5FXE A;  4FDC B;  2PSN A;  2NQW A;  3R0K A;  1S7M A;  1TZZ A;  4IZG A;  3VCN A;  3V4B A;  1GXF A;  5G5G B;  2V3A A;  2WOI A;  3CGC A;  4KT2 A;  1W1M A;  4PVJ A;  2ZAD A;  3OTR A;  3NFU A;  1W1J A;  4DN1 A;  2Y3S A;  4J56 A;  2W0H A;  2PP0 A;  1WYG A;  1MO9 A;  3A7U A;  3KJM A;  1N60 C;  1EC9 A;  1MBB A;  3DGB A;  2E5A A;  1RM6 B;  1STZ A;  1ZY8 A;  3VTE A;  3R07 C;  5JCM A;  2UUV A;  3NS1 B;  4LII A;  3DGZ A;  3NVZ B;  4H50 A;  5I1V A;  4H4R A;  4GYP C;  1VAO A;  1E8H A;  1MOK A;  2Q4W A;  1N62 C;  5AE2 A;  1BZL A;  3FCP A;  1BWC A;  1L8P A;  3IJL A;  3UXK A;  2GL5 A;  3T6C A;  3AM9 A;  3JS8 A;  2X50 A;  4PWB A;  4A3R A;  5FXP A;  2GR3 A;  3I99 A;  1TYP A;  2WOW A;  3LXD A;  4GME A;  5KVI A;  2OO6 A;  2QVH A;  2WPC A;  5FS8 A; 
#chains in the Genus database with same CATH homology
 1E0Y A;  5L6F A;  1DIQ A;  2VFT A;  2VFR A;  4MLA A;  3HSU A;  3TSJ A;  5FXD A;  3PM9 A;  2VFU A;  1AHZ A;  1W1L A;  1WVF A;  1FIQ B;  3B9J B;  5ADZ A;  3S1C A;  2P4P A;  1ZR6 A;  1W1O A;  2VAO A;  3TSH A;  2PLI A;  2W3R A;  3HRD C;  3S1F A;  2Y3R A;  1FFU C;  1T3Q C;  1W1Q A;  3SR6 B;  3RJ8 A;  1N5X A;  4BBY A;  3D2J A;  2W54 A;  2Y08 A;  3NVV B;  1F0X A;  1QLU A;  1N63 C;  2OAI A;  2P13 A;  2Y4G A;  2QPM A;  4OAL A;  4DNS A;  1FO4 A;  2PLS A;  4JAY A;  2AXR A;  2VFV A;  3EUB 3;  5HHZ A;  3PQB A;  2BVF A;  3POP A;  2BVH A;  3D2D A;  1N5W C;  3FW9 A;  3LAE A;  1FFV C;  2EXR A;  2W55 A;  4PWC A;  2YVS A;  2GQU A;  3NRZ B;  1N61 C;  3W8X A;  3AMZ A;  4UD8 A;  2R2Z A;  1AHU A;  3FWA A;  2WDW A;  2Q85 A;  1QLT A;  2QKN A;  2UUU A;  2E3T A;  1JRO A;  1I19 A;  3W8W A;  3GSY A;  4TVY A;  2R8D A;  1W1R A;  1DZN A;  1E8G A;  1WVE A;  4BC7 A;  3LLB A;  3A7A A;  3NVW B;  3W8Z A;  3FW7 A;  4TVW A;  3A7R A;  5G5H B;  4ZOH B;  3BW7 A;  4PZF A;  5K8E A;  1X2H A;  2GQT A;  1E8F A;  5HMR A;  1DII A;  3ETR B;  4PVH A;  5FXF A;  2BVG A;  3S1D A;  5FXE A;  2NQW A;  2RK5 A;  3NVY B;  3DQ0 A;  1X2G A;  3TX1 A;  3AN1 A;  5G5G B;  4HG0 A;  4ML8 A;  2VFS A;  2I0K A;  1W1M A;  4O95 A;  4PVJ A;  5D79 A;  2Y3S A;  1W1J A;  1UXY A;  4JB1 A;  1HSK A;  1WYG A;  3A7U A;  1V97 A;  5L6G A;  3KJM A;  1N60 C;  2P3H A;  1MBB A;  2MBR A;  1W1S A;  2E5A A;  1RM6 B;  1VDV A;  4BC9 A;  3VTE A;  4PVE A;  3C0P A;  1VQZ A;  3D2H A;  3R07 C;  2W3S A;  5HQX A;  2UUV A;  5I1W A;  3NS1 B;  5I1V A;  3NVZ B;  1W1K A;  3S1E A;  4XLO A;  1VAO A;  1E8H A;  1AHV A;  2Q4W A;  1N62 C;  4EC3 A;  5AE2 A;  5AWV A;  3RJA A;  2IPI A;  3AM9 A;  3JS8 A;  4PVK A;  5AE3 A;  4BCA A;  3DED A;  4PWB A;  1JRP A;  5AE1 A;  5FXP A;  4PYT A;  3I99 A;  1ZXI C;  3FW8 A;  2O3G A;  1SB3 B;  1MBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...