1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
2GQTA 1X2HA 2VFUA 1F0XA 2W55A 3BW7A 3TSJA 1W1LA 1N61C 1MBBA 2RK5A 1E8GA 3S1EA 1N62C 1ZXIC 3DQ0A 4TVYA 2BVFA 4JB1A 4PVKA 3KJMA 5ADZA 2PLIA 1V97A 3D2DA 1E0YA 4BCAA 3SR6B 5HHZA 3NVWB 1E8HA 3AN1A 1VDVA 3ETRB 1JROA 3EUB3 4PZFA 4HG0A 1W1JA 4EC3A 3FWAA 1RM6B 1WVEA 2E5AA 1E8FA 5FXFA 3S1DA 5HMRA 2O3GA 2VFVA 1N5XA 1ZR6A 2QPMA 3NVYB 2E3TA 3I99A 3LLBA 3S1CA 1VQZA 4PWBA 3GSYA 3A7AA 1UXYA 1QLUA 3D2JA 2PLSA 3B9JB 5AE1A 1FIQB 4UD8A 1AHZA 2VFSA 3FW7A 2Q85A 3NS1B 2VAOA 1DIIA 1MBTA 3S1FA 1HSKA 3C0PA 3LAEA 1DIQA 3A7UA 3HRDC 4PVJA 1FFUC 2EXRA 3R07C 3DEDA 4OALA 4PYTA 2OAIA 2W54A 2P4PA 1N60C 5D79A 2MBRA 4PWCA 2BVHA 4MLAA 4BBYA 2R8DA 4JAYA 3TSHA 1N5WC 1AHVA 4BC9A 1WYGA 4ZOHB 1QLTA 2P13A 3VTEA 1W1OA 2P3HA 4TVWA 1W1QA 1SB3B 2VFTA 1FFVC 1VAOA 1W1MA 1FO4A 2BVGA 3JS8A 4ML8A 2VFRA 1I19A 1W1KA 5G5GB 3AMZA 4BC7A 3NVZB 3FW9A 1AHUA 2NQWA 3PM9A 2AXRA 5AE2A 1T3QC 1JRPA 4O95A 4PVHA 3TX1A 2GQUA 1W1SA 3FW8A 1DZNA 2W3RA 3D2HA 5G5HB 3AM9A 4XLOA 5FXEA 3W8ZA 5FXDA 4PVEA 3W8WA 3NRZB 5AE3A 1N63C 2I0KA 5HQXA 2R2ZA 1X2GA 2W3SA 2Q4WA 4DNSA 5FXPA 3NVVB 1WVFA 2YVSA 1W1RA 3W8XA 2QKNA 3A7RA
chains in the Genus database with same CATH superfamily
1X2HA 1JDFA 4H4RA 1F0XA 2J3NA 3L8KA 2PGWA 2RK5A 1E8GA 1MDLA 3ZLHA 3UJFA 4HYRA 4GGHA 2OX4A 1ZXIC 4LA1A 1GRTA 1TKKA 4H50A 5FJOA 1NELA 3SR6B 3CYJA 5JRBA 1KD0A 4J3ZA 5HHZA 4YWSA 2EQ9A 2GDQA 5K8EA 3QFAA 3OZMA 2E5AA 1Q1RA 3UJEA 3JVAA 2OFJA 3S1CA 5J04A 4PWBA 1P48A 2PP3A 3A7AA 4H4WA 2WP5A 2HXUA 4JHMA 3D2JA 2PLSA 3URHA 4GYPC 5AE1A 5JCIA 1BZLA 4DX3A 4EQWA 4ZCWA 1NHQA 3DK9A 3I6TA 3C0PA 1V59A 2GH5A 4FX9A 3MWCA 3SQSA 2AKZA 1ONFA 2X99A 4M6UA 4YWOA 1PDZA 3TTEA 4H4UA 3U4FA 4G8TA 2MUCA 2PPGA 3QN3A 2RDXA 2WOVA 1GRAA 3R07C 1MDRA 3R11A 2PP1A 2OAIA 3DH9A 3GD6A 2YQUA 3V3WA 5D79A 1PDYA 3Q4DA 1MRAA 4J56A 1GXFA 1AHVA 2BC0A 1TYPA 3VCCA 2X8HA 3T8QA 4HNLA 2PSNA 1SJDA 5JCNA 1W1OA 2ZZBA 2OG9A 5FJRA 3II4A 1W1MA 1FO4A 4GYPA 2BVGA 3DG3A 3RJAA 1DXLA 2VFRA 1I19A 2FYMA 4Z1YA 3PWGA 3FW9A 3PWIA 1AHUA 3I4KA 3GRTA 2NPXA 4ROPA 3DERA 3GO2A 4O95A 3H12A 4H4SA 3DK8A 5FS6A 5JCKA 2W3RA 3D2HA 2YVFA 3PK7A 3UJSA 5U25A 3AM9A 4XLOA 1ECQA 2MNRA 4E8GA 5FXDA 2HZGA 3H8AA 2GGGA 4H4YA 3ZVHB 4BV6A 5KVHA 3I6EA 2PA6A 2R2ZA 3OTRA 3QTPA 4GISA 1JEHA 3PG6A 4GMEA 1X2GA 4GIRA 2Q4WA 3D47A 4DNSA 5FXPA 3LB8A 3OPSA 1R0MA 1KKOA 2V3AA 1JPMA 3CXBA 3TSJA 4IT1A 3CB3A 1N61C 1MBBA 2GGHA 4EM4A 1NHSA 3V4BA 2XH2A 3DQ0A 1YEYA 4TVYA 3NO1A 5ADZA 1V97A 3OC4A 1E0YA 2XH4A 1GSNA 4DNAA 5JCLA 3SN1A 4EQXA 3R10A 2PS2A 2ZZ0A 3AN1A 1GRBA 3ETRB 2EQ8A 3KLJA 1JROA 4HN8A 4PZFA 4A3RA 3FWAA 2YVJA 4FI4A 3LADA 2AL2B 3IC9A 3ZLGA 5FXFA 3RGTA 3EJBB 3FVDA 5AWVA 2ZC8A 1XS2A 2Y4GA 1MO9A 2OQYA 3DFHA 1K4QA 1VQZA 3H70A 2OPJA 3GSYA 4GR1A 1UXYA 2GR0A 2XH7A 5JCMA 3SBFA 3P93A 4H4QA 1YQZA 1JOAA 2C3CA 3TJIA 4E5TA 2OLAA 1AOGA 3VC6A 1AHZA 3FW7A 4A35A 2Q85A 3NS1B 2P3ZA 4DXKA 3N4EA 4FDCB 4EMJA 3S1FA 3ES7A 1HSKA 3OZYA 1ZDLA 3P3BA 4HNCA 3VCNA 2PU1A 2R9ZA 3A7UA 3SN0A 4EM3A 3DIPA 5BOEA 5EBKA 2WOIA 2PTZA 2UUVA 3EF6A 4PVJA 2EXRA 2QJJA 3ENLA 4OALA 4PYTA 4ENLA 2W54A 2P4PA 2WP6A 4E6MA 3PFRA 4KEMA 1DNCA 1FHUA 1S7MA 4PWCA 2GR3A 4HPNA 3TOYA 4MLAA 4BBYA 1ZMCA 1FEAA 1GERA 1N5WC 3T9PA 1FECA 1F3PA 4EQRA 4ZOHB 2GGEA 1QLTA 3RO6A 1R6WA 2WBAA 3DGZA 3DDMA 2ONEA 1WUEA 1FFVC 3MKCA 3DG6A 1MOKA 3Q45A 5EU9A 3ZVHA 3AMZA 4NEVA 2GL5A 2AKMA 3IK4A 2NQWA 1T3QC 3IJLA 3TCSA 2I5QA 1JRPA 5I1VA 3UGVA 3UJ2A 2X8GA 3FCPA 4MMWA 2OZ8A 3T4WA 4E4FA 2OZTA 1ZX9A 1KN0A 2PMQA 1IYXA 5G5HB 3DK4A 5FS8A 5FXEA 5FJPA 2ZZCA 3QKEA 3QFBA 5AE3A 2PU0A 1GRHA 1OEPA 3QPEA 1OJTA 3ZLFA 2PP0A 1Q1WA 1F9CA 2GQWA 2W3SA 1XDIA 3GD3A 3P0WA 3POPA 4K1WA 3SN4A 2OKTA 2X8CA 3W8XA 1GETA 3TWAA 3IJIA 1TE6A 1D7YA 2GQTA 3R1ZA 2VFUA 3HSUA 2W55A 3BW7A 3MUCA 1W1LA 3JW7A 4EMWA 3HW2A 1BKHA 3S1EA 5TR3A 1N62C 5L6GA 4FP1A 2BVFA 4PVKA 2BC1A 1EC9A 3D2DA 4EWJA 2PLIA 2P8CA 3O0HA 3DG7A 2CDUA 3DESA 4IP5A 5IDZA 1ZKQA 2WPFA 2C3DA 1VDVA 2XH0A 3TW9A 2Y3SA 4HG0A 3FG2P 2WDWA 2CFYA 1L8PA 3VFCA 4EQSA 1RM6B 1W6TA 4JDRA 1WVEA 3QLDA 3S1DA 2O3GA 3GY1A 1N5XA 1ZR6A 3TQPA 4ZA0A 2E3TA 4IHCA 4BURA 2PCEA 3CGDA 3DGHA 4JN7A 1DTNA 3VA8A 1LVLA 1QLUA 2OO6A 3B9JB 2QQ6A 1GREA 3RR1A 1FIQB 3FYYA 3CAWA 5ER0A 2VFSA 4HCHA 4IL0A 3FV9A 2VAOA 4H2HA 4NEWA 1FHVA 3K1GA 2P8BA 4M0XA 2V3BA 3UXLA 3DFYA 3U9IA 2AAQA 2O56A 4H4ZA 4J1OA 2AL1A 4ADWA 3PQBA 1DIQA 3UCDA 2WPCA 3RJ8A 4LIIA 3DEDA 1EBGA 5BOFA 3R0KA 2UUUA 4IZGA 2V6OA 3SQPA 2PTWA 2HQMA 2MBRA 5KVIA 3V5CA 4DHGA 2IPIA 2BVHA 3R0UA 2PTXA 4KT2A 3TSHA 4BC9A 1EBHA 1WYGA 4DYEA 3TJ4A 3GD4A 3HPFA 1NU5A 3NXLA 3RITA 3VTEA 2RABA 2P3HA 2VFTA 3DGBA 4HCLA 1BWCA 3BSMA 4KWSA 2QJMA 3BJSA 5FJUA 4MGGA 2FKPA 3LXDA 2PTYA 1BQGA 1GV4A 4BC7A 3NVZB 3D9XA 3MY9A 1H2IA 2AXRA 3CGEA 5AE2A 3FXGA 3UCCA 4H4TA 1ONEA 1ZY8A 3RRAA 3DJJA 4H4PA 1SJCA 2PODA 2QVHA 1GRGA 3ZVIA 5L6FA 4G7FA 3FW8A 1W1SA 3RNMA 1GRFA 1MUCA 3NZGA 5GRTA 3EEZA 1FEBA 2QDDA 3ES8A 3W8ZA 2CHRA 3W8WA 3GC2A 3NRZB 1N63C 3TWBA 5FS7A 3DJGX 3T6CA 4KPLA 3DEQA 3VDGA 2GGIA 4K8DA 1XHCA 2XGZA 1H6VA 1EC7A 1WVFA 1W1RA 2QKNA 3BOXA 4KPRA 2YVGA 2GGJA 4JQ9A 5I1WA 2EQ6A 2NVKX 1F8WA 2HXTA 3MSYA 3VC5A 1MNSA 3NFUA 4DN1A 1KCZA 4EMIA 2DW7A 2GSHA 4JB1A 3KJMA 4H1ZA 1NHPA 2OVLA 7ENLA 4BCAA 3NVWB 1SJBA 1E8HA 2PGEA 3EJEB 3EUB3 3JZUA 1W1JA 4EC3A 4IL2A 3UXKA 1KKRA 2DW6A 2NQLA 2JK6A 1E8FA 5HMRA 5FJTA 2VFVA 5ENLA 3CGBA 3RCYA 2QPMA 3NVYB 3I99A 3LLBA 1ELSA 1SJAA 2X50A 4M52A 1XPYA 3B97A 3D46A 4GFIA 3GRSA 4UD8A 4E4UA 2P88A 1DIIA 1MBTA 4A6GA 2AL2A 2QGYA 1EC8A 3LAEA 1NPXA 2EQ7A 2GR1A 4GGBA 3HRDC 2GR2A 2OZ3A 3EANA 2BCPA 3EAOA 4MKSA 1FFUC 3R25A 3OP2A 1JPDX 2F5ZA 2QJNA 1N60C 3THUA 1TZZA 4F4RA 2P0IA 3SSZA 1EBDA 2OQHA 1NHRA 4H83A 1ZK7A 3UJRA 1P43A 2R8DA 4JAYA 2GRTA 3OW1A 5FMHA 5U1OA 3V5FA 1M6IA 3SJNA 2WPEA 3EKGA 4IP4A 3EJDB 1ZMDA 4APNA 2P13A 2TPRA 3H7VA 1LPFA 1NDAA 1W1QA 1SB3B 2POZA 4K2SA 4H4XA 4TVWA 2XSXA 1VAOA 1STZA 2YAUA 3CT2A 4DWDA 3JS8A 4ML8A 4K7ZA 4Z17A 1W1KA 5G5GB 2HNEA 3CXOA 3PM9A 4GRTA 4X2PA 3KUMA 3MZNA 3S5SA 2QDEA 2Y3RA 4PVHA 4HCDA 2Y08A 3TX1A 2GQUA 2W0HA 1GEUA 3H4KA 1DZNA 1JCTA 3FJ4A 3MQTA 1XANA 3N4FA 3Q6JA 3CK5A 2ZADA 3CGCA 3STPA 4PVEA 2A8XA 4H4VA 2QAEA 3S47A 3N6JA 4J57A 2I0KA 5HQXA 1RVKA 3IJQA 4K8GA 3N6HA 3L5OA 6ENLA 4JN8A 1TYTA 2WOWA 4H19A 3NVVB 1WUFA 2YVSA 1E9IA 1GESA 5FS9A 3A7RA
chains in the Genus database with same CATH topology
2GQTA 1X2HA 2VFUA 1F0XA 3HSUA 2W55A 3BW7A 5I1WA 3TSJA 1W1LA 1N61C 1MBBA 2RK5A 1E8GA 3S1EA 1N62C 5L6GA 1ZXIC 3DQ0A 4TVYA 2BVFA 4JB1A 4PVKA 3KJMA 5ADZA 2PLIA 1V97A 3D2DA 1E0YA 4BCAA 3SR6B 5HHZA 3NVWB 1E8HA 3AN1A 1VDVA 3ETRB 2Y3SA 1JROA 3EUB3 4PZFA 4HG0A 5K8EA 2WDWA 1W1JA 4EC3A 3FWAA 1RM6B 1WVEA 2E5AA 1E8FA 5FXFA 3S1DA 5HMRA 2O3GA 2VFVA 5AWVA 1N5XA 1ZR6A 2Y4GA 2QPMA 3NVYB 2E3TA 3I99A 3LLBA 3S1CA 1VQZA 4PWBA 3GSYA 3A7AA 1UXYA 1QLUA 3D2JA 2PLSA 3B9JB 5AE1A 1FIQB 4UD8A 1AHZA 2VFSA 3FW7A 2Q85A 3NS1B 2VAOA 1DIIA 1MBTA 3S1FA 1HSKA 3C0PA 3LAEA 3PQBA 1DIQA 3A7UA 3HRDC 2UUVA 4PVJA 1FFUC 2EXRA 3R07C 3DEDA 3RJ8A 2UUUA 4OALA 4PYTA 2OAIA 2W54A 2P4PA 1N60C 5D79A 2MBRA 2IPIA 4PWCA 2BVHA 4MLAA 4BBYA 2R8DA 4JAYA 3TSHA 1N5WC 1AHVA 4BC9A 1WYGA 4ZOHB 1QLTA 2P13A 3VTEA 1W1OA 2P3HA 4TVWA 1W1QA 1SB3B 2VFTA 1FFVC 1VAOA 1W1MA 1FO4A 2BVGA 3RJAA 3JS8A 4ML8A 2VFRA 1I19A 1W1KA 5G5GB 3AMZA 4BC7A 3NVZB 3FW9A 1AHUA 2NQWA 3PM9A 2AXRA 5AE2A 1T3QC 2Y3RA 1JRPA 5I1VA 4O95A 4PVHA 2Y08A 3TX1A 5L6FA 2GQUA 1W1SA 3FW8A 1DZNA 2W3RA 3D2HA 5G5HB 3AM9A 4XLOA 5FXEA 3W8ZA 5FXDA 4PVEA 3W8WA 3NRZB 5AE3A 1N63C 2I0KA 5HQXA 2R2ZA 1X2GA 2W3SA 2Q4WA 4DNSA 5FXPA 3POPA 3NVVB 1WVFA 2YVSA 1W1RA 3W8XA 2QKNA 3A7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQT A;  1X2H A;  2VFU A;  1F0X A;  2W55 A;  3BW7 A;  3TSJ A;  1W1L A;  1N61 C;  1MBB A;  2RK5 A;  1E8G A;  3S1E A;  1N62 C;  1ZXI C;  3DQ0 A;  4TVY A;  2BVF A;  4JB1 A;  4PVK A;  3KJM A;  5ADZ A;  2PLI A;  1V97 A;  3D2D A;  1E0Y A;  4BCA A;  3SR6 B;  5HHZ A;  3NVW B;  1E8H A;  3AN1 A;  1VDV A;  3ETR B;  1JRO A;  3EUB 3;  4PZF A;  4HG0 A;  1W1J A;  4EC3 A;  3FWA A;  1RM6 B;  1WVE A;  2E5A A;  1E8F A;  5FXF A;  3S1D A;  5HMR A;  2O3G A;  2VFV A;  1N5X A;  1ZR6 A;  2QPM A;  3NVY B;  2E3T A;  3I99 A;  3LLB A;  3S1C A;  1VQZ A;  4PWB A;  3GSY A;  3A7A A;  1UXY A;  1QLU A;  3D2J A;  2PLS A;  3B9J B;  5AE1 A;  1FIQ B;  4UD8 A;  1AHZ A;  2VFS A;  3FW7 A;  2Q85 A;  3NS1 B;  2VAO A;  1DII A;  1MBT A;  3S1F A;  1HSK A;  3C0P A;  3LAE A;  1DIQ A;  3A7U A;  3HRD C;  4PVJ A;  1FFU C;  2EXR A;  3R07 C;  3DED A;  4OAL A;  4PYT A;  2OAI A;  2W54 A;  2P4P A;  1N60 C;  5D79 A;  2MBR A;  4PWC A;  2BVH A;  4MLA A;  4BBY A;  2R8D A;  4JAY A;  3TSH A;  1N5W C;  1AHV A;  4BC9 A;  1WYG A;  4ZOH B;  1QLT A;  2P13 A;  3VTE A;  1W1O A;  2P3H A;  4TVW A;  1W1Q A;  1SB3 B;  2VFT A;  1FFV C;  1VAO A;  1W1M A;  1FO4 A;  2BVG A;  3JS8 A;  4ML8 A;  2VFR A;  1I19 A;  1W1K A;  5G5G B;  3AMZ A;  4BC7 A;  3NVZ B;  3FW9 A;  1AHU A;  2NQW A;  3PM9 A;  2AXR A;  5AE2 A;  1T3Q C;  1JRP A;  4O95 A;  4PVH A;  3TX1 A;  2GQU A;  1W1S A;  3FW8 A;  1DZN A;  2W3R A;  3D2H A;  5G5H B;  3AM9 A;  4XLO A;  5FXE A;  3W8Z A;  5FXD A;  4PVE A;  3W8W A;  3NRZ B;  5AE3 A;  1N63 C;  2I0K A;  5HQX A;  2R2Z A;  1X2G A;  2W3S A;  2Q4W A;  4DNS A;  5FXP A;  3NVV B;  1WVF A;  2YVS A;  1W1R A;  3W8X A;  2QKN A;  3A7R A; 
#chains in the Genus database with same CATH topology
 1X2H A;  1JDF A;  4H4R A;  1F0X A;  2J3N A;  3L8K A;  2PGW A;  2RK5 A;  1E8G A;  1MDL A;  3ZLH A;  3UJF A;  4HYR A;  4GGH A;  2OX4 A;  1ZXI C;  4LA1 A;  1GRT A;  1TKK A;  4H50 A;  5FJO A;  1NEL A;  3SR6 B;  3CYJ A;  5JRB A;  1KD0 A;  4J3Z A;  5HHZ A;  4YWS A;  2EQ9 A;  2GDQ A;  5K8E A;  3QFA A;  3OZM A;  2E5A A;  1Q1R A;  3UJE A;  3JVA A;  2OFJ A;  3S1C A;  5J04 A;  4PWB A;  1P48 A;  2PP3 A;  3A7A A;  4H4W A;  2WP5 A;  2HXU A;  4JHM A;  3D2J A;  2PLS A;  3URH A;  4GYP C;  5AE1 A;  5JCI A;  1BZL A;  4DX3 A;  4EQW A;  4ZCW A;  1NHQ A;  3DK9 A;  3I6T A;  3C0P A;  1V59 A;  2GH5 A;  4FX9 A;  3MWC A;  3SQS A;  2AKZ A;  1ONF A;  2X99 A;  4M6U A;  4YWO A;  1PDZ A;  3TTE A;  4H4U A;  3U4F A;  4G8T A;  2MUC A;  2PPG A;  3QN3 A;  2RDX A;  2WOV A;  1GRA A;  3R07 C;  1MDR A;  3R11 A;  2PP1 A;  2OAI A;  3DH9 A;  3GD6 A;  2YQU A;  3V3W A;  5D79 A;  1PDY A;  3Q4D A;  1MRA A;  4J56 A;  1GXF A;  1AHV A;  2BC0 A;  1TYP A;  3VCC A;  2X8H A;  3T8Q A;  4HNL A;  2PSN A;  1SJD A;  5JCN A;  1W1O A;  2ZZB A;  2OG9 A;  5FJR A;  3II4 A;  1W1M A;  1FO4 A;  4GYP A;  2BVG A;  3DG3 A;  3RJA A;  1DXL A;  2VFR A;  1I19 A;  2FYM A;  4Z1Y A;  3PWG A;  3FW9 A;  3PWI A;  1AHU A;  3I4K A;  3GRT A;  2NPX A;  4ROP A;  3DER A;  3GO2 A;  4O95 A;  3H12 A;  4H4S A;  3DK8 A;  5FS6 A;  5JCK A;  2W3R A;  3D2H A;  2YVF A;  3PK7 A;  3UJS A;  5U25 A;  3AM9 A;  4XLO A;  1ECQ A;  2MNR A;  4E8G A;  5FXD A;  2HZG A;  3H8A A;  2GGG A;  4H4Y A;  3ZVH B;  4BV6 A;  5KVH A;  3I6E A;  2PA6 A;  2R2Z A;  3OTR A;  3QTP A;  4GIS A;  1JEH A;  3PG6 A;  4GME A;  1X2G A;  4GIR A;  2Q4W A;  3D47 A;  4DNS A;  5FXP A;  3LB8 A;  3OPS A;  1R0M A;  1KKO A;  2V3A A;  1JPM A;  3CXB A;  3TSJ A;  4IT1 A;  3CB3 A;  1N61 C;  1MBB A;  2GGH A;  4EM4 A;  1NHS A;  3V4B A;  2XH2 A;  3DQ0 A;  1YEY A;  4TVY A;  3NO1 A;  5ADZ A;  1V97 A;  3OC4 A;  1E0Y A;  2XH4 A;  1GSN A;  4DNA A;  5JCL A;  3SN1 A;  4EQX A;  3R10 A;  2PS2 A;  2ZZ0 A;  3AN1 A;  1GRB A;  3ETR B;  2EQ8 A;  3KLJ A;  1JRO A;  4HN8 A;  4PZF A;  4A3R A;  3FWA A;  2YVJ A;  4FI4 A;  3LAD A;  2AL2 B;  3IC9 A;  3ZLG A;  5FXF A;  3RGT A;  3EJB B;  3FVD A;  5AWV A;  2ZC8 A;  1XS2 A;  2Y4G A;  1MO9 A;  2OQY A;  3DFH A;  1K4Q A;  1VQZ A;  3H70 A;  2OPJ A;  3GSY A;  4GR1 A;  1UXY A;  2GR0 A;  2XH7 A;  5JCM A;  3SBF A;  3P93 A;  4H4Q A;  1YQZ A;  1JOA A;  2C3C A;  3TJI A;  4E5T A;  2OLA A;  1AOG A;  3VC6 A;  1AHZ A;  3FW7 A;  4A35 A;  2Q85 A;  3NS1 B;  2P3Z A;  4DXK A;  3N4E A;  4FDC B;  4EMJ A;  3S1F A;  3ES7 A;  1HSK A;  3OZY A;  1ZDL A;  3P3B A;  4HNC A;  3VCN A;  2PU1 A;  2R9Z A;  3A7U A;  3SN0 A;  4EM3 A;  3DIP A;  5BOE A;  5EBK A;  2WOI A;  2PTZ A;  2UUV A;  3EF6 A;  4PVJ A;  2EXR A;  2QJJ A;  3ENL A;  4OAL A;  4PYT A;  4ENL A;  2W54 A;  2P4P A;  2WP6 A;  4E6M A;  3PFR A;  4KEM A;  1DNC A;  1FHU A;  1S7M A;  4PWC A;  2GR3 A;  4HPN A;  3TOY A;  4MLA A;  4BBY A;  1ZMC A;  1FEA A;  1GER A;  1N5W C;  3T9P A;  1FEC A;  1F3P A;  4EQR A;  4ZOH B;  2GGE A;  1QLT A;  3RO6 A;  1R6W A;  2WBA A;  3DGZ A;  3DDM A;  2ONE A;  1WUE A;  1FFV C;  3MKC A;  3DG6 A;  1MOK A;  3Q45 A;  5EU9 A;  3ZVH A;  3AMZ A;  4NEV A;  2GL5 A;  2AKM A;  3IK4 A;  2NQW A;  1T3Q C;  3IJL A;  3TCS A;  2I5Q A;  1JRP A;  5I1V A;  3UGV A;  3UJ2 A;  2X8G A;  3FCP A;  4MMW A;  2OZ8 A;  3T4W A;  4E4F A;  2OZT A;  1ZX9 A;  1KN0 A;  2PMQ A;  1IYX A;  5G5H B;  3DK4 A;  5FS8 A;  5FXE A;  5FJP A;  2ZZC A;  3QKE A;  3QFB A;  5AE3 A;  2PU0 A;  1GRH A;  1OEP A;  3QPE A;  1OJT A;  3ZLF A;  2PP0 A;  1Q1W A;  1F9C A;  2GQW A;  2W3S A;  1XDI A;  3GD3 A;  3P0W A;  3POP A;  4K1W A;  3SN4 A;  2OKT A;  2X8C A;  3W8X A;  1GET A;  3TWA A;  3IJI A;  1TE6 A;  1D7Y A;  2GQT A;  3R1Z A;  2VFU A;  3HSU A;  2W55 A;  3BW7 A;  3MUC A;  1W1L A;  3JW7 A;  4EMW A;  3HW2 A;  1BKH A;  3S1E A;  5TR3 A;  1N62 C;  5L6G A;  4FP1 A;  2BVF A;  4PVK A;  2BC1 A;  1EC9 A;  3D2D A;  4EWJ A;  2PLI A;  2P8C A;  3O0H A;  3DG7 A;  2CDU A;  3DES A;  4IP5 A;  5IDZ A;  1ZKQ A;  2WPF A;  2C3D A;  1VDV A;  2XH0 A;  3TW9 A;  2Y3S A;  4HG0 A;  3FG2 P;  2WDW A;  2CFY A;  1L8P A;  3VFC A;  4EQS A;  1RM6 B;  1W6T A;  4JDR A;  1WVE A;  3QLD A;  3S1D A;  2O3G A;  3GY1 A;  1N5X A;  1ZR6 A;  3TQP A;  4ZA0 A;  2E3T A;  4IHC A;  4BUR A;  2PCE A;  3CGD A;  3DGH A;  4JN7 A;  1DTN A;  3VA8 A;  1LVL A;  1QLU A;  2OO6 A;  3B9J B;  2QQ6 A;  1GRE A;  3RR1 A;  1FIQ B;  3FYY A;  3CAW A;  5ER0 A;  2VFS A;  4HCH A;  4IL0 A;  3FV9 A;  2VAO A;  4H2H A;  4NEW A;  1FHV A;  3K1G A;  2P8B A;  4M0X A;  2V3B A;  3UXL A;  3DFY A;  3U9I A;  2AAQ A;  2O56 A;  4H4Z A;  4J1O A;  2AL1 A;  4ADW A;  3PQB A;  1DIQ A;  3UCD A;  2WPC A;  3RJ8 A;  4LII A;  3DED A;  1EBG A;  5BOF A;  3R0K A;  2UUU A;  4IZG A;  2V6O A;  3SQP A;  2PTW A;  2HQM A;  2MBR A;  5KVI A;  3V5C A;  4DHG A;  2IPI A;  2BVH A;  3R0U A;  2PTX A;  4KT2 A;  3TSH A;  4BC9 A;  1EBH A;  1WYG A;  4DYE A;  3TJ4 A;  3GD4 A;  3HPF A;  1NU5 A;  3NXL A;  3RIT A;  3VTE A;  2RAB A;  2P3H A;  2VFT A;  3DGB A;  4HCL A;  1BWC A;  3BSM A;  4KWS A;  2QJM A;  3BJS A;  5FJU A;  4MGG A;  2FKP A;  3LXD A;  2PTY A;  1BQG A;  1GV4 A;  4BC7 A;  3NVZ B;  3D9X A;  3MY9 A;  1H2I A;  2AXR A;  3CGE A;  5AE2 A;  3FXG A;  3UCC A;  4H4T A;  1ONE A;  1ZY8 A;  3RRA A;  3DJJ A;  4H4P A;  1SJC A;  2POD A;  2QVH A;  1GRG A;  3ZVI A;  5L6F A;  4G7F A;  3FW8 A;  1W1S A;  3RNM A;  1GRF A;  1MUC A;  3NZG A;  5GRT A;  3EEZ A;  1FEB A;  2QDD A;  3ES8 A;  3W8Z A;  2CHR A;  3W8W A;  3GC2 A;  3NRZ B;  1N63 C;  3TWB A;  5FS7 A;  3DJG X;  3T6C A;  4KPL A;  3DEQ A;  3VDG A;  2GGI A;  4K8D A;  1XHC A;  2XGZ A;  1H6V A;  1EC7 A;  1WVF A;  1W1R A;  2QKN A;  3BOX A;  4KPR A;  2YVG A;  2GGJ A;  4JQ9 A;  5I1W A;  2EQ6 A;  2NVK X;  1F8W A;  2HXT A;  3MSY A;  3VC5 A;  1MNS A;  3NFU A;  4DN1 A;  1KCZ A;  4EMI A;  2DW7 A;  2GSH A;  4JB1 A;  3KJM A;  4H1Z A;  1NHP A;  2OVL A;  7ENL A;  4BCA A;  3NVW B;  1SJB A;  1E8H A;  2PGE A;  3EJE B;  3EUB 3;  3JZU A;  1W1J A;  4EC3 A;  4IL2 A;  3UXK A;  1KKR A;  2DW6 A;  2NQL A;  2JK6 A;  1E8F A;  5HMR A;  5FJT A;  2VFV A;  5ENL A;  3CGB A;  3RCY A;  2QPM A;  3NVY B;  3I99 A;  3LLB A;  1ELS A;  1SJA A;  2X50 A;  4M52 A;  1XPY A;  3B97 A;  3D46 A;  4GFI A;  3GRS A;  4UD8 A;  4E4U A;  2P88 A;  1DII A;  1MBT A;  4A6G A;  2AL2 A;  2QGY A;  1EC8 A;  3LAE A;  1NPX A;  2EQ7 A;  2GR1 A;  4GGB A;  3HRD C;  2GR2 A;  2OZ3 A;  3EAN A;  2BCP A;  3EAO A;  4MKS A;  1FFU C;  3R25 A;  3OP2 A;  1JPD X;  2F5Z A;  2QJN A;  1N60 C;  3THU A;  1TZZ A;  4F4R A;  2P0I A;  3SSZ A;  1EBD A;  2OQH A;  1NHR A;  4H83 A;  1ZK7 A;  3UJR A;  1P43 A;  2R8D A;  4JAY A;  2GRT A;  3OW1 A;  5FMH A;  5U1O A;  3V5F A;  1M6I A;  3SJN A;  2WPE A;  3EKG A;  4IP4 A;  3EJD B;  1ZMD A;  4APN A;  2P13 A;  2TPR A;  3H7V A;  1LPF A;  1NDA A;  1W1Q A;  1SB3 B;  2POZ A;  4K2S A;  4H4X A;  4TVW A;  2XSX A;  1VAO A;  1STZ A;  2YAU A;  3CT2 A;  4DWD A;  3JS8 A;  4ML8 A;  4K7Z A;  4Z17 A;  1W1K A;  5G5G B;  2HNE A;  3CXO A;  3PM9 A;  4GRT A;  4X2P A;  3KUM A;  3MZN A;  3S5S A;  2QDE A;  2Y3R A;  4PVH A;  4HCD A;  2Y08 A;  3TX1 A;  2GQU A;  2W0H A;  1GEU A;  3H4K A;  1DZN A;  1JCT A;  3FJ4 A;  3MQT A;  1XAN A;  3N4F A;  3Q6J A;  3CK5 A;  2ZAD A;  3CGC A;  3STP A;  4PVE A;  2A8X A;  4H4V A;  2QAE A;  3S47 A;  3N6J A;  4J57 A;  2I0K A;  5HQX A;  1RVK A;  3IJQ A;  4K8G A;  3N6H A;  3L5O A;  6ENL A;  4JN8 A;  1TYT A;  2WOW A;  4H19 A;  3NVV B;  1WUF A;  2YVS A;  1E9I A;  1GES A;  5FS9 A;  3A7R A; 
#chains in the Genus database with same CATH homology
 2GQT A;  1X2H A;  2VFU A;  1F0X A;  3HSU A;  2W55 A;  3BW7 A;  5I1W A;  3TSJ A;  1W1L A;  1N61 C;  1MBB A;  2RK5 A;  1E8G A;  3S1E A;  1N62 C;  5L6G A;  1ZXI C;  3DQ0 A;  4TVY A;  2BVF A;  4JB1 A;  4PVK A;  3KJM A;  5ADZ A;  2PLI A;  1V97 A;  3D2D A;  1E0Y A;  4BCA A;  3SR6 B;  5HHZ A;  3NVW B;  1E8H A;  3AN1 A;  1VDV A;  3ETR B;  2Y3S A;  1JRO A;  3EUB 3;  4PZF A;  4HG0 A;  5K8E A;  2WDW A;  1W1J A;  4EC3 A;  3FWA A;  1RM6 B;  1WVE A;  2E5A A;  1E8F A;  5FXF A;  3S1D A;  5HMR A;  2O3G A;  2VFV A;  5AWV A;  1N5X A;  1ZR6 A;  2Y4G A;  2QPM A;  3NVY B;  2E3T A;  3I99 A;  3LLB A;  3S1C A;  1VQZ A;  4PWB A;  3GSY A;  3A7A A;  1UXY A;  1QLU A;  3D2J A;  2PLS A;  3B9J B;  5AE1 A;  1FIQ B;  4UD8 A;  1AHZ A;  2VFS A;  3FW7 A;  2Q85 A;  3NS1 B;  2VAO A;  1DII A;  1MBT A;  3S1F A;  1HSK A;  3C0P A;  3LAE A;  3PQB A;  1DIQ A;  3A7U A;  3HRD C;  2UUV A;  4PVJ A;  1FFU C;  2EXR A;  3R07 C;  3DED A;  3RJ8 A;  2UUU A;  4OAL A;  4PYT A;  2OAI A;  2W54 A;  2P4P A;  1N60 C;  5D79 A;  2MBR A;  2IPI A;  4PWC A;  2BVH A;  4MLA A;  4BBY A;  2R8D A;  4JAY A;  3TSH A;  1N5W C;  1AHV A;  4BC9 A;  1WYG A;  4ZOH B;  1QLT A;  2P13 A;  3VTE A;  1W1O A;  2P3H A;  4TVW A;  1W1Q A;  1SB3 B;  2VFT A;  1FFV C;  1VAO A;  1W1M A;  1FO4 A;  2BVG A;  3RJA A;  3JS8 A;  4ML8 A;  2VFR A;  1I19 A;  1W1K A;  5G5G B;  3AMZ A;  4BC7 A;  3NVZ B;  3FW9 A;  1AHU A;  2NQW A;  3PM9 A;  2AXR A;  5AE2 A;  1T3Q C;  2Y3R A;  1JRP A;  5I1V A;  4O95 A;  4PVH A;  2Y08 A;  3TX1 A;  5L6F A;  2GQU A;  1W1S A;  3FW8 A;  1DZN A;  2W3R A;  3D2H A;  5G5H B;  3AM9 A;  4XLO A;  5FXE A;  3W8Z A;  5FXD A;  4PVE A;  3W8W A;  3NRZ B;  5AE3 A;  1N63 C;  2I0K A;  5HQX A;  2R2Z A;  1X2G A;  2W3S A;  2Q4W A;  4DNS A;  5FXP A;  3POP A;  3NVV B;  1WVF A;  2YVS A;  1W1R A;  3W8X A;  2QKN A;  3A7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...