1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
1WYGA 2W3SA 5D79A 4EC3A 1VAOA 2VFTA 1X2GA 2YVSA 3TSHA 3C0PA 1N5XA 3TX1A 5AE2A 3A7AA 4TVWA 3R07C 1HSKA 2NQWA 3S1DA 1ZR6A 2RK5A 5HHZA 2AXRA 1FO4A 1UXYA 3W8WA 1W1OA 5FXPA 3JS8A 1QLUA 1W1JA 1X2HA 4PYTA 4DNSA 4PVJA 1E0YA 2R8DA 1V97A 1DZNA 2O3GA 4PWCA 2BVGA 2R2ZA 1FFVC 1JRPA 1DIIA 3VTEA 1FFUC 3NRZB 3PM9A 2E3TA 1MBTA 2EXRA 1AHUA 2VFUA 1AHZA 1T3QC 4UD8A 5AE1A 4MLAA 3ETRB 3NS1B 2BVHA 2MBRA 3LAEA 3DQ0A 3HRDC 3AM9A 3BW7A 3AMZA 3NVWB 1WVEA 3DEDA 4PVHA 5FXFA 5FXDA 4HG0A 1N61C 3KJMA 1ZXIC 4OALA 4PVKA 2VFRA 4JAYA 2VAOA 4BC9A 3W8ZA 1RM6B 2P3HA 3SR6B 3AN1A 4JB1A 2W54A 3TSJA 1JROA 1N5WC 3I99A 2PLSA 2PLIA 3EUB3 4BBYA 1E8FA 1W1KA 2Q4WA 1FIQB 1N60C 3S1CA 3D2HA 5HQXA 1N63C 1DIQA 5HMRA 5G5GB 1MBBA 5FXEA 1QLTA 3S1FA 3FWAA 1WVFA 4ZOHB 1W1MA 1W1RA 2W55A 3A7RA 2VFSA 2VFVA 3NVZB 5AE3A 2P13A 2E5AA 3NVYB 3S1EA 1W1QA 3D2JA 4O95A 2GQUA 2Q85A 3NVVB 1F0XA 2OAIA 2I0KA 4PZFA 2P4PA 3D2DA 3LLBA 1VDVA 4ML8A 2BVFA 3W8XA 1I19A 1SB3B 1E8HA 1W1LA 2QPMA 4PVEA 5G5HB 1N62C 3B9JB 1W1SA 2W3RA 1E8GA 3FW8A 4BCAA 4XLOA 2GQTA 3A7UA 5ADZA 4TVYA 4BC7A 4PWBA 3GSYA 1VQZA 2QKNA 1AHVA 3FW7A 3FW9A
chains in the Genus database with same CATH superfamily
1WYGA 4DX3A 5BOFA 4MMWA 3EJDB 3U9IA 5I1WA 1X2GA 3UCCA 3RCYA 3EEZA 3L8KA 2P0IA 3SJNA 4BV6A 3SSZA 3T8QA 1NHSA 3A7AA 4IL0A 3L5OA 2Y3SA 5I1VA 3I6TA 3P93A 3S1DA 2RK5A 2AKMA 3DESA 3GD3A 3RR1A 2AXRA 5IDZA 3VCNA 4EMWA 3UJRA 3NFUA 1W1JA 2CFYA 1X2HA 3JZUA 4PVJA 1NU5A 2R8DA 4IL2A 3EJBB 5FJUA 3TWAA 4KPLA 2TPRA 4YWOA 2XSXA 1GEUA 2ONEA 2BC1A 3NRZB 1OJTA 2E3TA 1ONFA 3R25A 3H12A 3ES8A 1NHPA 3NO1A 2YVJA 4IP4A 2PS2A 2PSNA 1NDAA 4UD8A 3O0HA 4LIIA 4H4YA 4ROPA 3R10A 3NS1B 3SBFA 2XGZA 1MOKA 2WDWA 3BW7A 4HNLA 3IJIA 3HSUA 2MUCA 1EBDA 3QTPA 3Q6JA 1TKKA 4H83A 2WBAA 3SQSA 2PODA 1KKRA 1N61C 1E9IA 3KJMA 4M6UA 2VFRA 2VAOA 4H50A 4E6MA 3HPFA 3ZLFA 3CT2A 3QN3A 3PG6A 3RJ8A 2Y08A 3R11A 4JQ9A 4J1OA 1JROA 3I99A 5FJPA 4A6GA 3EUB3 1ONEA 5KVHA 1GRTA 2ZZCA 3U4FA 1GV4A 1JPMA 1N63C 2YQUA 1GRFA 5HMRA 4H1ZA 5FXEA 4JDRA 3JW7A 1QLTA 2QGYA 4GRTA 1W1MA 4EMJA 3EAOA 2HNEA 3A7RA 1GRGA 2HXTA 3HW2A 3THUA 2VFVA 2PGWA 2E5AA 4H4PA 4EQRA 4NEVA 3NVYB 3S1EA 2X99A 3D2JA 4K7ZA 3VDGA 3NVVB 1F0XA 3DK8A 3NXLA 1WUEA 3VC6A 3VFCA 2OG9A 2I0KA 2GGIA 2DW7A 3CXBA 2GRTA 3I6EA 2P4PA 1F8WA 3UJSA 1SB3B 4BURA 2OQYA 2NPXA 2QDDA 4DWDA 2GGEA 3N4EA 1EBHA 3H8AA 3FW8A 2P8BA 3OPSA 1IYXA 1DTNA 3CK5A 2GQTA 3T9PA 3N4FA 4DN1A 2AAQA 4JHMA 4PWBA 4DHGA 3GSYA 3UXLA 3LXDA 1AHVA 4A35A 2W3SA 5D79A 1NPXA 4KT2A 3DG3A 2Y3RA 1JEHA 2YVSA 3R0UA 2QJNA 2ZZBA 2FYMA 2OKTA 3EANA 1N5XA 2PCEA 3ES7A 3N6HA 2YVGA 3D46A 3EKGA 3IK4A 3OW1A 3SN4A 4MGGA 4H4XA 3N6JA 3QKEA 3GY1A 3T4WA 2POZA 1W6TA 2XH0A 3DJJA 4FI4A 1FO4A 4JN7A 1GRHA 5BOEA 3PQBA 5K8EA 3JS8A 2PA6A 4ADWA 4EQWA 1DZNA 4ENLA 2PTZA 2V6OA 3CGEA 2GR1A 3II4A 3RO6A 3IJQA 2NQLA 3VTEA 1FFUC 3PM9A 3DG7A 4K8GA 4J3ZA 3CXOA 2QJJA 1TYTA 4FP1A 5JCIA 2PTWA 3RRAA 1NHRA 3MY9A 3Q4DA 3CGBA 2BVHA 1S7MA 3DQ0A 2F5ZA 2PP3A 3HRDC 2J3NA 3QFAA 3D47A 1WVEA 2GDQA 1XANA 3KLJA 3DEDA 2OZ8A 3H4KA 4HPNA 3GO2A 4OALA 4PVKA 4JAYA 1GSNA 1STZA 3TJ4A 1XHCA 4EM3A 1L8PA 3W8ZA 3P0WA 3CAWA 2UUUA 2ZZ0A 3DJGX 2P3HA 2GR3A 3DGZA 4GGHA 3AN1A 4JB1A 2C3CA 2PLIA 2GH5A 3BOXA 1JOAA 3TOYA 2W0HA 1N60C 6ENLA 3DIPA 3P3BA 1SJBA 4GIRA 4J57A 1MBBA 2OVLA 1Q1RA 4H4ZA 3S1FA 2RABA 1W1RA 3PWIA 4EQSA 1BWCA 1YQZA 4H4WA 1DXLA 5AE3A 2X50A 2P13A 3TQPA 5JRBA 5EU9A 3I4KA 3ENLA 3SN0A 3GD4A 5JCNA 1W1QA 4O95A 3DK4A 1KN0A 3CYJA 3DFYA 4YWSA 1F3PA 5ENLA 5FS8A 2O56A 1ZMDA 4HNCA 7ENLA 3LLBA 1VDVA 3MSYA 4H4TA 1ZDLA 1E8HA 4Z17A 2QPMA 4J56A 1SJCA 5G5HB 1N62C 3B9JB 1E8GA 2V3AA 1FHUA 3TWBA 4XLOA 2R9ZA 1EBGA 1KCZA 1P43A 2PU1A 3FV9A 4K8DA 3CGDA 1VQZA 2QKNA 1WUFA 2BC0A 2XH2A 3FW7A 2PPGA 1MNSA 3V3WA 4GYPA 2VFTA 3GRTA 2PMQA 4IT1A 3EF6A 3TSHA 2A8XA 1LPFA 4FX9A 2EQ6A 4EQXA 4X2PA 2EQ9A 4FDCB 2HQMA 1MDRA 2PTXA 1H6VA 3UCDA 3FJ4A 2OFJA 2XH7A 4DYEA 3DK9A 3T6CA 4JN8A 5J04A 4GGBA 3S5SA 3GRSA 2WP6A 4IHCA 1W1OA 4ZA0A 5FXPA 1SJAA 1QLUA 3UJFA 4KWSA 4DNSA 1V59A 2OLAA 2X8HA 2DW6A 1BQGA 3QPEA 1E0YA 3SN1A 1V97A 2OQHA 2O3GA 2BCPA 3TTEA 1ZKQA 3FXGA 3H70A 1FFVC 1BZLA 3DDMA 1XPYA 2QJMA 1MUCA 3CGCA 3DERA 1MBTA 1AHUA 2VFUA 1AHZA 5FJRA 3POPA 5FS9A 5FS6A 1H2IA 2GGGA 4MLAA 3ETRB 2GSHA 3QLDA 1NHQA 4EMIA 3B97A 1PDZA 4Z1YA 1DNCA 3BSMA 3IC9A 4K1WA 2OZTA 1GERA 3URHA 2WP5A 3SQPA 4E8GA 1FHVA 3NVWB 1MRAA 3V4BA 1GETA 4HCHA 1SJDA 4HG0A 2PP1A 1ZXIC 3NZGA 3JVAA 5AWVA 1K4QA 5L6FA 1RM6B 3ZVHB 3SR6B 4KEMA 2OPJA 3VC5A 3MQTA 2GL5A 3TSJA 1N5WC 2YVFA 2EQ8A 2PLSA 3UXKA 4BBYA 3BJSA 2FKPA 3LB8A 4A3RA 1FIQB 3S1CA 2P3ZA 5L6GA 3RITA 4GYPC 1DIQA 3QFBA 1GRBA 3LADA 3OZMA 4ZOHB 1BKHA 2W55A 1FEBA 5ER0A 3STPA 4APNA 3MUCA 3NVZB 3H7VA 5TR3A 2GQUA 2Q85A 1FEAA 2GR0A 3UJ2A 2HXUA 3TJIA 2OAIA 4PZFA 1XS2A 3OP2A 1ECQA 1JPDX 3ZVIA 4F4RA 3D2DA 5FJTA 2QDEA 2AL1A 4H4SA 3RNMA 4HCDA 3KUMA 2WOVA 5KVIA 1EC8A 2OX4A 4H4RA 1F9CA 3R1ZA 4IZGA 1PDYA 2UUVA 2Y4GA 4E4UA 1LVLA 2X8GA 1R6WA 2WPFA 5FJOA 3DH9A 2CDUA 3FVDA 5ADZA 3FW9A 2X8CA 1GXFA 2NVKX 2XH4A 2AL2A 2WOWA 4EC3A 1MDLA 1VAOA 4M52A 2QQ6A 1D7YA 3UGVA 3C0PA 3TX1A 1M6IA 5AE2A 3UJEA 4G7FA 5U1OA 4TVWA 3R07C 1KD0A 1HSKA 2GGHA 3PFRA 2NQWA 4HCLA 4H4UA 1ZR6A 4E5TA 5HHZA 3GD6A 1OEPA 4HYRA 3FCPA 3S47A 1UXYA 2PP0A 4GISA 3W8WA 2IPIA 3FG2P 1JDFA 1RVKA 1ZY8A 3MKCA 4E4FA 4PYTA 3EJEB 1P48A 2C3DA 4H4QA 1ZMCA 2ZC8A 3K1GA 2P88A 3ZVHA 3VCCA 4IP5A 4PWCA 2BVGA 3GC2A 2P8CA 1TZZA 3MZNA 2R2ZA 1R0MA 1JRPA 4EWJA 3DG6A 3ZLGA 2YAUA 1DIIA 2PU0A 2EXRA 1EC7A 3RGTA 3Q45A 1TYPA 1KKOA 5JCMA 4NEWA 1T3QC 5AE1A 3DGHA 1ZX9A 2HZGA 4K2SA 2MBRA 4GMEA 3LAEA 1GREA 5FMHA 2QVHA 4GR1A 3AM9A 2PGEA 3AMZA 4H4VA 4PVHA 3R0KA 2GGJA 5FXFA 5FXDA 5FS7A 5EBKA 1TE6A 1ELSA 2ZADA 4BC9A 2I5QA 3OC4A 3TW9A 1MO9A 3TCSA 3ZLHA 1EC9A 3FYYA 4H2HA 3DGBA 1YEYA 2WPEA 2OO6A 4DNAA 5GRTA 2JK6A 4DXKA 3IJLA 1GRAA 2AL2B 2W54A 2AKZA 3DFHA 2WOIA 1E8FA 1W1KA 2Q4WA 2CHRA 3D2HA 4LA1A 5HQXA 3PK7A 5JCKA 1Q1WA 5G5GB 1GESA 1XDIA 5U25A 3FWAA 1WVFA 1NELA 2VFSA 1JCTA 4H19A 3OZYA 3DEQA 3D9XA 3MWCA 1AOGA 4HN8A 2WPCA 2OZ3A 2GR2A 4MKSA 4ML8A 3OTRA 1FECA 4M0XA 2BVFA 2QAEA 3W8XA 1I19A 2V3BA 3CB3A 4G8TA 4KPRA 1W1LA 2PTYA 3VA8A 4PVEA 3V5FA 2GQWA 1W1SA 2W3RA 4BCAA 2EQ7A 4TVYA 3A7UA 3V5CA 1ZK7A 5JCLA 4BC7A 3RJAA 4ZCWA 2RDXA 3PWGA 4GFIA 2MNRA 4EM4A
chains in the Genus database with same CATH topology
1WYGA 2W3SA 5D79A 4EC3A 1VAOA 2Y3RA 2VFTA 1X2GA 2YVSA 3TSHA 3C0PA 1N5XA 3TX1A 5AE2A 3A7AA 2Y3SA 4TVWA 3R07C 5I1VA 1HSKA 2NQWA 3S1DA 1ZR6A 2RK5A 5HHZA 2AXRA 1FO4A 1UXYA 2IPIA 3W8WA 1W1OA 3PQBA 5K8EA 5FXPA 3JS8A 1QLUA 1W1JA 1X2HA 4PYTA 4DNSA 4PVJA 1E0YA 2R8DA 1V97A 1DZNA 2O3GA 4PWCA 2BVGA 2R2ZA 1FFVC 1JRPA 1DIIA 3VTEA 1FFUC 3NRZB 3PM9A 2E3TA 1MBTA 2EXRA 1AHUA 2VFUA 1AHZA 3POPA 1T3QC 4UD8A 5AE1A 4MLAA 3ETRB 3NS1B 2BVHA 2MBRA 3LAEA 3DQ0A 2WDWA 3HRDC 3AM9A 3BW7A 3AMZA 3NVWB 3HSUA 1WVEA 3DEDA 4PVHA 5FXFA 5FXDA 4HG0A 1N61C 3KJMA 1ZXIC 4OALA 4PVKA 2VFRA 4JAYA 2VAOA 4BC9A 5AWVA 5L6FA 3W8ZA 1RM6B 2UUUA 3RJ8A 2P3HA 3SR6B 3AN1A 2Y08A 4JB1A 2W54A 3TSJA 1JROA 1N5WC 3I99A 2PLSA 2PLIA 3EUB3 4BBYA 1E8FA 1W1KA 2Q4WA 1FIQB 1N60C 3S1CA 3D2HA 5HQXA 5L6GA 1N63C 1DIQA 5HMRA 5G5GB 1MBBA 5FXEA 1QLTA 3S1FA 3FWAA 1WVFA 4ZOHB 1W1MA 1W1RA 2W55A 3A7RA 2VFSA 2VFVA 3NVZB 5AE3A 2P13A 2E5AA 3NVYB 3S1EA 1W1QA 3D2JA 4O95A 2GQUA 2Q85A 3NVVB 1F0XA 2OAIA 2I0KA 4PZFA 2P4PA 3D2DA 3LLBA 1VDVA 4ML8A 2BVFA 3W8XA 1I19A 1SB3B 1E8HA 1W1LA 2QPMA 4PVEA 5G5HB 1N62C 3B9JB 1W1SA 2W3RA 1E8GA 3FW8A 4BCAA 4XLOA 2GQTA 3A7UA 5ADZA 4TVYA 4BC7A 4PWBA 2UUVA 3GSYA 3RJAA 2Y4GA 1VQZA 2QKNA 5I1WA 1AHVA 3FW7A 3FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYG A;  2W3S A;  5D79 A;  4EC3 A;  1VAO A;  2VFT A;  1X2G A;  2YVS A;  3TSH A;  3C0P A;  1N5X A;  3TX1 A;  5AE2 A;  3A7A A;  4TVW A;  3R07 C;  1HSK A;  2NQW A;  3S1D A;  1ZR6 A;  2RK5 A;  5HHZ A;  2AXR A;  1FO4 A;  1UXY A;  3W8W A;  1W1O A;  5FXP A;  3JS8 A;  1QLU A;  1W1J A;  1X2H A;  4PYT A;  4DNS A;  4PVJ A;  1E0Y A;  2R8D A;  1V97 A;  1DZN A;  2O3G A;  4PWC A;  2BVG A;  2R2Z A;  1FFV C;  1JRP A;  1DII A;  3VTE A;  1FFU C;  3NRZ B;  3PM9 A;  2E3T A;  1MBT A;  2EXR A;  1AHU A;  2VFU A;  1AHZ A;  1T3Q C;  4UD8 A;  5AE1 A;  4MLA A;  3ETR B;  3NS1 B;  2BVH A;  2MBR A;  3LAE A;  3DQ0 A;  3HRD C;  3AM9 A;  3BW7 A;  3AMZ A;  3NVW B;  1WVE A;  3DED A;  4PVH A;  5FXF A;  5FXD A;  4HG0 A;  1N61 C;  3KJM A;  1ZXI C;  4OAL A;  4PVK A;  2VFR A;  4JAY A;  2VAO A;  4BC9 A;  3W8Z A;  1RM6 B;  2P3H A;  3SR6 B;  3AN1 A;  4JB1 A;  2W54 A;  3TSJ A;  1JRO A;  1N5W C;  3I99 A;  2PLS A;  2PLI A;  3EUB 3;  4BBY A;  1E8F A;  1W1K A;  2Q4W A;  1FIQ B;  1N60 C;  3S1C A;  3D2H A;  5HQX A;  1N63 C;  1DIQ A;  5HMR A;  5G5G B;  1MBB A;  5FXE A;  1QLT A;  3S1F A;  3FWA A;  1WVF A;  4ZOH B;  1W1M A;  1W1R A;  2W55 A;  3A7R A;  2VFS A;  2VFV A;  3NVZ B;  5AE3 A;  2P13 A;  2E5A A;  3NVY B;  3S1E A;  1W1Q A;  3D2J A;  4O95 A;  2GQU A;  2Q85 A;  3NVV B;  1F0X A;  2OAI A;  2I0K A;  4PZF A;  2P4P A;  3D2D A;  3LLB A;  1VDV A;  4ML8 A;  2BVF A;  3W8X A;  1I19 A;  1SB3 B;  1E8H A;  1W1L A;  2QPM A;  4PVE A;  5G5H B;  1N62 C;  3B9J B;  1W1S A;  2W3R A;  1E8G A;  3FW8 A;  4BCA A;  4XLO A;  2GQT A;  3A7U A;  5ADZ A;  4TVY A;  4BC7 A;  4PWB A;  3GSY A;  1VQZ A;  2QKN A;  1AHV A;  3FW7 A;  3FW9 A; 
#chains in the Genus database with same CATH topology
 1WYG A;  4DX3 A;  5BOF A;  4MMW A;  3EJD B;  3U9I A;  5I1W A;  1X2G A;  3UCC A;  3RCY A;  3EEZ A;  3L8K A;  2P0I A;  3SJN A;  4BV6 A;  3SSZ A;  3T8Q A;  1NHS A;  3A7A A;  4IL0 A;  3L5O A;  2Y3S A;  5I1V A;  3I6T A;  3P93 A;  3S1D A;  2RK5 A;  2AKM A;  3DES A;  3GD3 A;  3RR1 A;  2AXR A;  5IDZ A;  3VCN A;  4EMW A;  3UJR A;  3NFU A;  1W1J A;  2CFY A;  1X2H A;  3JZU A;  4PVJ A;  1NU5 A;  2R8D A;  4IL2 A;  3EJB B;  5FJU A;  3TWA A;  4KPL A;  2TPR A;  4YWO A;  2XSX A;  1GEU A;  2ONE A;  2BC1 A;  3NRZ B;  1OJT A;  2E3T A;  1ONF A;  3R25 A;  3H12 A;  3ES8 A;  1NHP A;  3NO1 A;  2YVJ A;  4IP4 A;  2PS2 A;  2PSN A;  1NDA A;  4UD8 A;  3O0H A;  4LII A;  4H4Y A;  4ROP A;  3R10 A;  3NS1 B;  3SBF A;  2XGZ A;  1MOK A;  2WDW A;  3BW7 A;  4HNL A;  3IJI A;  3HSU A;  2MUC A;  1EBD A;  3QTP A;  3Q6J A;  1TKK A;  4H83 A;  2WBA A;  3SQS A;  2POD A;  1KKR A;  1N61 C;  1E9I A;  3KJM A;  4M6U A;  2VFR A;  2VAO A;  4H50 A;  4E6M A;  3HPF A;  3ZLF A;  3CT2 A;  3QN3 A;  3PG6 A;  3RJ8 A;  2Y08 A;  3R11 A;  4JQ9 A;  4J1O A;  1JRO A;  3I99 A;  5FJP A;  4A6G A;  3EUB 3;  1ONE A;  5KVH A;  1GRT A;  2ZZC A;  3U4F A;  1GV4 A;  1JPM A;  1N63 C;  2YQU A;  1GRF A;  5HMR A;  4H1Z A;  5FXE A;  4JDR A;  3JW7 A;  1QLT A;  2QGY A;  4GRT A;  1W1M A;  4EMJ A;  3EAO A;  2HNE A;  3A7R A;  1GRG A;  2HXT A;  3HW2 A;  3THU A;  2VFV A;  2PGW A;  2E5A A;  4H4P A;  4EQR A;  4NEV A;  3NVY B;  3S1E A;  2X99 A;  3D2J A;  4K7Z A;  3VDG A;  3NVV B;  1F0X A;  3DK8 A;  3NXL A;  1WUE A;  3VC6 A;  3VFC A;  2OG9 A;  2I0K A;  2GGI A;  2DW7 A;  3CXB A;  2GRT A;  3I6E A;  2P4P A;  1F8W A;  3UJS A;  1SB3 B;  4BUR A;  2OQY A;  2NPX A;  2QDD A;  4DWD A;  2GGE A;  3N4E A;  1EBH A;  3H8A A;  3FW8 A;  2P8B A;  3OPS A;  1IYX A;  1DTN A;  3CK5 A;  2GQT A;  3T9P A;  3N4F A;  4DN1 A;  2AAQ A;  4JHM A;  4PWB A;  4DHG A;  3GSY A;  3UXL A;  3LXD A;  1AHV A;  4A35 A;  2W3S A;  5D79 A;  1NPX A;  4KT2 A;  3DG3 A;  2Y3R A;  1JEH A;  2YVS A;  3R0U A;  2QJN A;  2ZZB A;  2FYM A;  2OKT A;  3EAN A;  1N5X A;  2PCE A;  3ES7 A;  3N6H A;  2YVG A;  3D46 A;  3EKG A;  3IK4 A;  3OW1 A;  3SN4 A;  4MGG A;  4H4X A;  3N6J A;  3QKE A;  3GY1 A;  3T4W A;  2POZ A;  1W6T A;  2XH0 A;  3DJJ A;  4FI4 A;  1FO4 A;  4JN7 A;  1GRH A;  5BOE A;  3PQB A;  5K8E A;  3JS8 A;  2PA6 A;  4ADW A;  4EQW A;  1DZN A;  4ENL A;  2PTZ A;  2V6O A;  3CGE A;  2GR1 A;  3II4 A;  3RO6 A;  3IJQ A;  2NQL A;  3VTE A;  1FFU C;  3PM9 A;  3DG7 A;  4K8G A;  4J3Z A;  3CXO A;  2QJJ A;  1TYT A;  4FP1 A;  5JCI A;  2PTW A;  3RRA A;  1NHR A;  3MY9 A;  3Q4D A;  3CGB A;  2BVH A;  1S7M A;  3DQ0 A;  2F5Z A;  2PP3 A;  3HRD C;  2J3N A;  3QFA A;  3D47 A;  1WVE A;  2GDQ A;  1XAN A;  3KLJ A;  3DED A;  2OZ8 A;  3H4K A;  4HPN A;  3GO2 A;  4OAL A;  4PVK A;  4JAY A;  1GSN A;  1STZ A;  3TJ4 A;  1XHC A;  4EM3 A;  1L8P A;  3W8Z A;  3P0W A;  3CAW A;  2UUU A;  2ZZ0 A;  3DJG X;  2P3H A;  2GR3 A;  3DGZ A;  4GGH A;  3AN1 A;  4JB1 A;  2C3C A;  2PLI A;  2GH5 A;  3BOX A;  1JOA A;  3TOY A;  2W0H A;  1N60 C;  6ENL A;  3DIP A;  3P3B A;  1SJB A;  4GIR A;  4J57 A;  1MBB A;  2OVL A;  1Q1R A;  4H4Z A;  3S1F A;  2RAB A;  1W1R A;  3PWI A;  4EQS A;  1BWC A;  1YQZ A;  4H4W A;  1DXL A;  5AE3 A;  2X50 A;  2P13 A;  3TQP A;  5JRB A;  5EU9 A;  3I4K A;  3ENL A;  3SN0 A;  3GD4 A;  5JCN A;  1W1Q A;  4O95 A;  3DK4 A;  1KN0 A;  3CYJ A;  3DFY A;  4YWS A;  1F3P A;  5ENL A;  5FS8 A;  2O56 A;  1ZMD A;  4HNC A;  7ENL A;  3LLB A;  1VDV A;  3MSY A;  4H4T A;  1ZDL A;  1E8H A;  4Z17 A;  2QPM A;  4J56 A;  1SJC A;  5G5H B;  1N62 C;  3B9J B;  1E8G A;  2V3A A;  1FHU A;  3TWB A;  4XLO A;  2R9Z A;  1EBG A;  1KCZ A;  1P43 A;  2PU1 A;  3FV9 A;  4K8D A;  3CGD A;  1VQZ A;  2QKN A;  1WUF A;  2BC0 A;  2XH2 A;  3FW7 A;  2PPG A;  1MNS A;  3V3W A;  4GYP A;  2VFT A;  3GRT A;  2PMQ A;  4IT1 A;  3EF6 A;  3TSH A;  2A8X A;  1LPF A;  4FX9 A;  2EQ6 A;  4EQX A;  4X2P A;  2EQ9 A;  4FDC B;  2HQM A;  1MDR A;  2PTX A;  1H6V A;  3UCD A;  3FJ4 A;  2OFJ A;  2XH7 A;  4DYE A;  3DK9 A;  3T6C A;  4JN8 A;  5J04 A;  4GGB A;  3S5S A;  3GRS A;  2WP6 A;  4IHC A;  1W1O A;  4ZA0 A;  5FXP A;  1SJA A;  1QLU A;  3UJF A;  4KWS A;  4DNS A;  1V59 A;  2OLA A;  2X8H A;  2DW6 A;  1BQG A;  3QPE A;  1E0Y A;  3SN1 A;  1V97 A;  2OQH A;  2O3G A;  2BCP A;  3TTE A;  1ZKQ A;  3FXG A;  3H70 A;  1FFV C;  1BZL A;  3DDM A;  1XPY A;  2QJM A;  1MUC A;  3CGC A;  3DER A;  1MBT A;  1AHU A;  2VFU A;  1AHZ A;  5FJR A;  3POP A;  5FS9 A;  5FS6 A;  1H2I A;  2GGG A;  4MLA A;  3ETR B;  2GSH A;  3QLD A;  1NHQ A;  4EMI A;  3B97 A;  1PDZ A;  4Z1Y A;  1DNC A;  3BSM A;  3IC9 A;  4K1W A;  2OZT A;  1GER A;  3URH A;  2WP5 A;  3SQP A;  4E8G A;  1FHV A;  3NVW B;  1MRA A;  3V4B A;  1GET A;  4HCH A;  1SJD A;  4HG0 A;  2PP1 A;  1ZXI C;  3NZG A;  3JVA A;  5AWV A;  1K4Q A;  5L6F A;  1RM6 B;  3ZVH B;  3SR6 B;  4KEM A;  2OPJ A;  3VC5 A;  3MQT A;  2GL5 A;  3TSJ A;  1N5W C;  2YVF A;  2EQ8 A;  2PLS A;  3UXK A;  4BBY A;  3BJS A;  2FKP A;  3LB8 A;  4A3R A;  1FIQ B;  3S1C A;  2P3Z A;  5L6G A;  3RIT A;  4GYP C;  1DIQ A;  3QFB A;  1GRB A;  3LAD A;  3OZM A;  4ZOH B;  1BKH A;  2W55 A;  1FEB A;  5ER0 A;  3STP A;  4APN A;  3MUC A;  3NVZ B;  3H7V A;  5TR3 A;  2GQU A;  2Q85 A;  1FEA A;  2GR0 A;  3UJ2 A;  2HXU A;  3TJI A;  2OAI A;  4PZF A;  1XS2 A;  3OP2 A;  1ECQ A;  1JPD X;  3ZVI A;  4F4R A;  3D2D A;  5FJT A;  2QDE A;  2AL1 A;  4H4S A;  3RNM A;  4HCD A;  3KUM A;  2WOV A;  5KVI A;  1EC8 A;  2OX4 A;  4H4R A;  1F9C A;  3R1Z A;  4IZG A;  1PDY A;  2UUV A;  2Y4G A;  4E4U A;  1LVL A;  2X8G A;  1R6W A;  2WPF A;  5FJO A;  3DH9 A;  2CDU A;  3FVD A;  5ADZ A;  3FW9 A;  2X8C A;  1GXF A;  2NVK X;  2XH4 A;  2AL2 A;  2WOW A;  4EC3 A;  1MDL A;  1VAO A;  4M52 A;  2QQ6 A;  1D7Y A;  3UGV A;  3C0P A;  3TX1 A;  1M6I A;  5AE2 A;  3UJE A;  4G7F A;  5U1O A;  4TVW A;  3R07 C;  1KD0 A;  1HSK A;  2GGH A;  3PFR A;  2NQW A;  4HCL A;  4H4U A;  1ZR6 A;  4E5T A;  5HHZ A;  3GD6 A;  1OEP A;  4HYR A;  3FCP A;  3S47 A;  1UXY A;  2PP0 A;  4GIS A;  3W8W A;  2IPI A;  3FG2 P;  1JDF A;  1RVK A;  1ZY8 A;  3MKC A;  4E4F A;  4PYT A;  3EJE B;  1P48 A;  2C3D A;  4H4Q A;  1ZMC A;  2ZC8 A;  3K1G A;  2P88 A;  3ZVH A;  3VCC A;  4IP5 A;  4PWC A;  2BVG A;  3GC2 A;  2P8C A;  1TZZ A;  3MZN A;  2R2Z A;  1R0M A;  1JRP A;  4EWJ A;  3DG6 A;  3ZLG A;  2YAU A;  1DII A;  2PU0 A;  2EXR A;  1EC7 A;  3RGT A;  3Q45 A;  1TYP A;  1KKO A;  5JCM A;  4NEW A;  1T3Q C;  5AE1 A;  3DGH A;  1ZX9 A;  2HZG A;  4K2S A;  2MBR A;  4GME A;  3LAE A;  1GRE A;  5FMH A;  2QVH A;  4GR1 A;  3AM9 A;  2PGE A;  3AMZ A;  4H4V A;  4PVH A;  3R0K A;  2GGJ A;  5FXF A;  5FXD A;  5FS7 A;  5EBK A;  1TE6 A;  1ELS A;  2ZAD A;  4BC9 A;  2I5Q A;  3OC4 A;  3TW9 A;  1MO9 A;  3TCS A;  3ZLH A;  1EC9 A;  3FYY A;  4H2H A;  3DGB A;  1YEY A;  2WPE A;  2OO6 A;  4DNA A;  5GRT A;  2JK6 A;  4DXK A;  3IJL A;  1GRA A;  2AL2 B;  2W54 A;  2AKZ A;  3DFH A;  2WOI A;  1E8F A;  1W1K A;  2Q4W A;  2CHR A;  3D2H A;  4LA1 A;  5HQX A;  3PK7 A;  5JCK A;  1Q1W A;  5G5G B;  1GES A;  1XDI A;  5U25 A;  3FWA A;  1WVF A;  1NEL A;  2VFS A;  1JCT A;  4H19 A;  3OZY A;  3DEQ A;  3D9X A;  3MWC A;  1AOG A;  4HN8 A;  2WPC A;  2OZ3 A;  2GR2 A;  4MKS A;  4ML8 A;  3OTR A;  1FEC A;  4M0X A;  2BVF A;  2QAE A;  3W8X A;  1I19 A;  2V3B A;  3CB3 A;  4G8T A;  4KPR A;  1W1L A;  2PTY A;  3VA8 A;  4PVE A;  3V5F A;  2GQW A;  1W1S A;  2W3R A;  4BCA A;  2EQ7 A;  4TVY A;  3A7U A;  3V5C A;  1ZK7 A;  5JCL A;  4BC7 A;  3RJA A;  4ZCW A;  2RDX A;  3PWG A;  4GFI A;  2MNR A;  4EM4 A; 
#chains in the Genus database with same CATH homology
 1WYG A;  2W3S A;  5D79 A;  4EC3 A;  1VAO A;  2Y3R A;  2VFT A;  1X2G A;  2YVS A;  3TSH A;  3C0P A;  1N5X A;  3TX1 A;  5AE2 A;  3A7A A;  2Y3S A;  4TVW A;  3R07 C;  5I1V A;  1HSK A;  2NQW A;  3S1D A;  1ZR6 A;  2RK5 A;  5HHZ A;  2AXR A;  1FO4 A;  1UXY A;  2IPI A;  3W8W A;  1W1O A;  3PQB A;  5K8E A;  5FXP A;  3JS8 A;  1QLU A;  1W1J A;  1X2H A;  4PYT A;  4DNS A;  4PVJ A;  1E0Y A;  2R8D A;  1V97 A;  1DZN A;  2O3G A;  4PWC A;  2BVG A;  2R2Z A;  1FFV C;  1JRP A;  1DII A;  3VTE A;  1FFU C;  3NRZ B;  3PM9 A;  2E3T A;  1MBT A;  2EXR A;  1AHU A;  2VFU A;  1AHZ A;  3POP A;  1T3Q C;  4UD8 A;  5AE1 A;  4MLA A;  3ETR B;  3NS1 B;  2BVH A;  2MBR A;  3LAE A;  3DQ0 A;  2WDW A;  3HRD C;  3AM9 A;  3BW7 A;  3AMZ A;  3NVW B;  3HSU A;  1WVE A;  3DED A;  4PVH A;  5FXF A;  5FXD A;  4HG0 A;  1N61 C;  3KJM A;  1ZXI C;  4OAL A;  4PVK A;  2VFR A;  4JAY A;  2VAO A;  4BC9 A;  5AWV A;  5L6F A;  3W8Z A;  1RM6 B;  2UUU A;  3RJ8 A;  2P3H A;  3SR6 B;  3AN1 A;  2Y08 A;  4JB1 A;  2W54 A;  3TSJ A;  1JRO A;  1N5W C;  3I99 A;  2PLS A;  2PLI A;  3EUB 3;  4BBY A;  1E8F A;  1W1K A;  2Q4W A;  1FIQ B;  1N60 C;  3S1C A;  3D2H A;  5HQX A;  5L6G A;  1N63 C;  1DIQ A;  5HMR A;  5G5G B;  1MBB A;  5FXE A;  1QLT A;  3S1F A;  3FWA A;  1WVF A;  4ZOH B;  1W1M A;  1W1R A;  2W55 A;  3A7R A;  2VFS A;  2VFV A;  3NVZ B;  5AE3 A;  2P13 A;  2E5A A;  3NVY B;  3S1E A;  1W1Q A;  3D2J A;  4O95 A;  2GQU A;  2Q85 A;  3NVV B;  1F0X A;  2OAI A;  2I0K A;  4PZF A;  2P4P A;  3D2D A;  3LLB A;  1VDV A;  4ML8 A;  2BVF A;  3W8X A;  1I19 A;  1SB3 B;  1E8H A;  1W1L A;  2QPM A;  4PVE A;  5G5H B;  1N62 C;  3B9J B;  1W1S A;  2W3R A;  1E8G A;  3FW8 A;  4BCA A;  4XLO A;  2GQT A;  3A7U A;  5ADZ A;  4TVY A;  4BC7 A;  4PWB A;  2UUV A;  3GSY A;  3RJA A;  2Y4G A;  1VQZ A;  2QKN A;  5I1W A;  1AHV A;  3FW7 A;  3FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...