1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
b'MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
4TVWA 1ZXIC 3HRDC 3AM9A 3C0PA 3S1CA 4TVYA 3W8WA 3LAEA 3NVWB 1W1LA 4ZOHB 1JROA 3W8ZA 1WYGA 3S1DA 1I19A 3SR6B 5AE2A 2W3SA 1N60C 2W3RA 1VDVA 4BCAA 3I99A 1W1SA 2Q4WA 4JB1A 2RK5A 4HG0A 3NRZB 1AHVA 1W1JA 3D2JA 1W1KA 3TSHA 2BVFA 1T3QC 4JAYA 5G5HB 4PYTA 3FW9A 2BVGA 1E8FA 3NS1B 1MBTA 2W55A 2VFTA 2PLSA 4MLAA 1N5WC 3AMZA 3D2HA 3NVZB 2AXRA 3FW7A 3NVYB 4PWCA 5HHZA 1W1QA 3A7UA 1F0XA 5FXFA 3A7RA 5HMRA 1X2GA 5AE1A 1X2HA 2P3HA 2QPMA 2W54A 2PLIA 4PVHA 3KJMA 3W8XA 2YVSA 4BC7A 3B9JB 1N5XA 1WVEA 2P13A 1DZNA 2EXRA 4PVKA 5ADZA 1RM6B 1FFUC 1QLTA 1W1RA 1VQZA 1HSKA 1W1OA 1E8GA 1JRPA 2I0KA 1MBBA 1DIIA 5G5GB 5D79A 3S1EA 2R8DA 1V97A 1E8HA 1N62C 4EC3A 1WVFA 1E0YA 3ETRB 3DEDA 3LLBA 3TSJA 3TX1A 1DIQA 2MBRA 3S1FA 4UD8A 3D2DA 4PZFA 2R2ZA 3BW7A 4ML8A 3EUB3 3AN1A 1VAOA 2E5AA 1FIQB 4DNSA 3FW8A 1W1MA 3FWAA 3A7AA 2O3GA 4BC9A 2VFRA 5AE3A 2P4PA 4PVJA 5FXDA 3NVVB 2QKNA 1N63C 3JS8A 1N61C 2BVHA 2OAIA 4O95A 1QLUA 1UXYA 4XLOA 1AHUA 3VTEA 2GQTA 5FXPA 2E3TA 1AHZA 5HQXA 2VFVA 3PM9A 1FO4A 2VFSA 1SB3B 3R07C 2GQUA 4PWBA 5FXEA 2NQWA 4BBYA 3DQ0A 4PVEA 2VAOA 2Q85A 1ZR6A 2VFUA 4OALA 3GSYA 1FFVC
chains in the Genus database with same CATH superfamily
3UCDA 1NHQA 5FJRA 4DX3A 3FYYA 4H50A 1EC8A 3W8WA 5K8EA 3NVWB 4EQXA 3MUCA 3NFUA 3W8ZA 2AKZA 2EQ7A 2ZC8A 3S1DA 5EBKA 1I19A 3CT2A 2O56A 3UJSA 1GESA 4GRTA 4EMJA 4H1ZA 1BQGA 4HG0A 3BOXA 1BWCA 4HNCA 2HZGA 3GO2A 3I6EA 3OC4A 1GRFA 3RITA 4MGGA 3UXKA 3ES8A 3D2JA 4G7FA 3RCYA 3R25A 3TSHA 2BVFA 3HW2A 1T3QC 1EBGA 4KWSA 5G5HB 3FW9A 2BVGA 3NS1B 4DHGA 2W55A 2GSHA 1N5WC 3POPA 2PGWA 2NQLA 3D2HA 4H4RA 3GD4A 4FDCB 2Y3SA 2X8HA 2IPIA 3NVYB 4PWCA 4EM3A 1P48A 2PA6A 2PP3A 3P93A 2WOIA 2W54A 3QPEA 3KJMA 3W8XA 2PMQA 2P13A 4GGBA 3JVAA 3TQPA 2GGGA 4EQWA 3SQSA 5ADZA 1RM6B 1W1RA 1FECA 3K1GA 1W1OA 3IJQA 3T8QA 2X8CA 4J56A 3MZNA 2QQ6A 2I5QA 4NEWA 1MBBA 3CGDA 3TOYA 1DIIA 4YWSA 5D79A 3UJRA 2A8XA 3DJGX 1STZA 3IK4A 2V3BA 3OPSA 2DW6A 4X2PA 2HNEA 4H4SA 1KCZA 5I1VA 3TSJA 4IL0A 5FS7A 4K8DA 3CK5A 3NO1A 4PZFA 4ML8A 4ROPA 3DFHA 5JRBA 1GREA 3A7AA 3FV9A 2O3GA 4BC9A 5AE3A 2P4PA 3ZLFA 2NVKX 2GDQA 4K7ZA 3TTEA 2QKNA 2WOWA 1SJAA 1YEYA 3DDMA 1S7MA 3RGTA 4O95A 2AL2A 3MKCA 4IHCA 1EBDA 3LB8A 3R11A 3R07C 2WDWA 3CYJA 2GQWA 4GIRA 1PDYA 1TE6A 3QKEA 3R10A 5BOEA 2GR2A 3DK9A 3FVDA 4IL2A 3VCNA 3I4KA 5I1WA 1XHCA 2Q85A 4JDRA 2JK6A 1ZR6A 1GEUA 3CB3A 2OQYA 1GRGA 3DGBA 3QFBA 1LVLA 1F3PA 1ZMCA 4JQ9A 3FCPA 5FJUA 5IDZA 1FFVC 4H4QA 3AM9A 2WPEA 5J04A 3C0PA 1F9CA 1BKHA 4TVYA 3RR1A 5JCNA 2PTYA 1YQZA 1WYGA 2OX4A 3TCSA 3ZVHA 3TJ4A 3T9PA 4KPLA 2W3SA 3KUMA 5U1OA 4BCAA 1Q1RA 3I99A 4JB1A 3GY1A 4H2HA 3ZLHA 2X8GA 4A3RA 2XGZA 3TWBA 1EBHA 1AHVA 1W1JA 2QJJA 2ONEA 1NHRA 1W1KA 1XS2A 3DIPA 5FJPA 5L6FA 2P88A 4E5TA 3MSYA 1E8FA 3EJEB 1MBTA 5JCLA 4MLAA 3H4KA 1NHPA 1ZX9A 2QGYA 2QJMA 5HHZA 3SN0A 1W1QA 3O0HA 4GISA 1F0XA 2QJNA 3PWGA 5FXFA 3A7RA 1X2GA 2PSNA 2ZADA 5AE1A 4MMWA 1IYXA 2P3HA 3NZGA 5TR3A 2PLIA 3R1ZA 1ZY8A 1MDRA 4BC7A 3IC9A 3B9JB 1TYTA 1R6WA 1DZNA 4IP5A 2P3ZA 2WPFA 3MQTA 4ZCWA 3VA8A 3BSMA 4LIIA 2EQ9A 2QDDA 3FJ4A 4M0XA 1GSNA 4HPNA 1VQZA 1HSKA 3RJAA 3LXDA 3H7VA 2V3AA 2ZZCA 2UUUA 4DN1A 2AL2B 2HXUA 3CGEA 1E8HA 3L5OA 3UJ2A 1WVFA 3ETRB 4J3ZA 3EKGA 3SSZA 2HQMA 3LADA 2C3DA 1FEBA 3DEQA 3DK4A 4FX9A 5ER0A 2V6OA 3TX1A 2PP0A 5KVIA 4IT1A 4UD8A 3DH9A 1JCTA 1NELA 2PGEA 4H4YA 2OKTA 3S47A 3EUB3 3STPA 4DNSA 1EC7A 1ONFA 3FWAA 4BV6A 2VFRA 4K8GA 2CFYA 3SBFA 2WPCA 1NU5A 2P0IA 2P8CA 3SJNA 3UXLA 1N63C 1WUFA 2EQ8A 5AWVA 2BVHA 3MY9A 3T4WA 4EM4A 3PQBA 1E9IA 4XLOA 1AHUA 1GETA 3VTEA 1NHSA 2GR0A 3GRSA 2X99A 3R0UA 5FXPA 2E3TA 5HQXA 3PM9A 1SJDA 1SB3B 5GRTA 5L6GA 1KKRA 2QDEA 4ADWA 4HCDA 1FHUA 2RABA 2PU0A 2YVFA 1AOGA 3PK7A 2VFUA 1GRTA 1ELSA 3GRTA 2DW7A 3IJLA 3N4EA 2AAQA 2GGIA 4FI4A 4LA1A 1KN0A 1GRBA 4IZGA 3H70A 1GRHA 4TVWA 1ZXIC 1FHVA 1DTNA 1Q1WA 3OTRA 1JEHA 3S1CA 2PCEA 3LAEA 5EU9A 4ZOHB 4JN8A 2BC0A 1JROA 2F5ZA 2WOVA 3EAOA 1NDAA 3T6CA 4DYEA 3SR6B 3I6TA 4GGHA 2MUCA 1N60C 4Z17A 1W1SA 4A6GA 3EJBB 1JPDX 1GV4A 1MOKA 3P0WA 3TW9A 3SQPA 1W6TA 2GGEA 4YWOA 2XH0A 2QAEA 3GD3A 2Y4GA 3RJ8A 2XH4A 3GD6A 4JAYA 2GH5A 2PP1A 3DESA 1GXFA 4DXKA 4GR1A 2Y08A 2PLSA 2PODA 2WBAA 3L8KA 4BURA 3NVZB 2GRTA 3UGVA 2AXRA 3CGBA 3FW7A 5JCIA 3R0KA 3A7UA 3DJJA 3URHA 3VC6A 7ENLA 1XANA 1X2HA 4E4FA 2QPMA 1NPXA 4PVHA 1MUCA 4Z1YA 2NPXA 2PTWA 3RRAA 1KD0A 2GGJA 3II4A 4ZA0A 2EXRA 1PDZA 3VFCA 4PVKA 5FMHA 1FEAA 3HPFA 1ZDLA 3OZYA 3EANA 1GRAA 4HNLA 1ZMDA 4GFIA 1JOAA 1JRPA 2J3NA 2I0KA 2GR3A 3GC2A 3CGCA 1N62C 4EC3A 2AL1A 3B97A 1SJBA 4HCLA 1LPFA 2CHRA 2X50A 4DWDA 3OP2A 4H4TA 1DNCA 2MBRA 2QVHA 4DNAA 3S1FA 2YQUA 4J57A 5FS6A 3BW7A 1ZKQA 2R2ZA 3DFYA 3AN1A 1VAOA 3THUA 4K1WA 1FIQB 3FW8A 1ONEA 2P8BA 2PS2A 2OZ8A 3CAWA 3NVVB 3TJIA 3D9XA 4ENLA 4F4RA 3PG6A 2PPGA 3D46A 1GERA 1N61C 5FJTA 2OAIA 3CXOA 3V5CA 4IP4A 1UXYA 1KKOA 3H8AA 2PTXA 2GQTA 1WUEA 3EJDB 2OO6A 4KPRA 2RDXA 3IJIA 2ZZBA 4PWBA 3N6HA 4JN7A 5FXEA 2BC1A 3OW1A 3EF6A 3TWAA 4MKSA 2NQWA 6ENLA 4BBYA 2VAOA 4KT2A 4OALA 1TKKA 3P3BA 3DG7A 1M6IA 3V3WA 4NEVA 3UCCA 3HRDC 2YAUA 4EQSA 5ENLA 3SN1A 3RNMA 2OPJA 1W1LA 4M6UA 3H12A 2CDUA 3NXLA 1JPMA 4EQRA 5AE2A 3Q45A 3ZVHB 4H83A 4FP1A 2W3RA 1VDVA 2RK5A 2Q4WA 2WP5A 4EMIA 2PU1A 3NRZB 2Y3RA 3VC5A 4J1OA 1V59A 3OZMA 1XPYA 2OLAA 3UJEA 4M52A 3D47A 3U9IA 1MDLA 3JW7A 1DXLA 2XH7A 3N4FA 4H4XA 3SN4A 2FKPA 1OJTA 1SJCA 4PYTA 1EC9A 3N6JA 3QLDA 3VDGA 3ZVIA 1RVKA 1TYPA 3V4BA 2AKMA 4HCHA 3KLJA 2VFTA 5KVHA 4H19A 4KEMA 2UUVA 1F8WA 3AMZA 3ENLA 4H4ZA 4JHMA 2WP6A 2GR1A 2YVGA 4EMWA 3BJSA 5FJOA 4E6MA 1K4QA 5HMRA 3FXGA 1L8PA 4HYRA 3VCCA 2YVSA 4K2SA 1MRAA 1H2IA 1N5XA 2XH2A 1WVEA 3ES7A 2OZ3A 3QFAA 4APNA 2MNRA 2GL5A 1FFUC 1OEPA 1QLTA 2EQ6A 3DGHA 1MNSA 3QTPA 1E8GA 3Q6JA 1TZZA 2C3CA 2OZTA 5G5GB 3S1EA 2R8DA 2TPRA 3MWCA 1V97A 1ECQA 3RO6A 2OVLA 3DG6A 1E0YA 3DEDA 1JDFA 3QN3A 1MO9A 4H4VA 3FG2P 3LLBA 2R9ZA 5FS9A 5BOFA 2ZZ0A 3ZLGA 1DIQA 1R0MA 1XDIA 1BZLA 2OFJA 3PWIA 3D2DA 2GGHA 5JCMA 2OG9A 2XSXA 2E5AA 4EWJA 1W1MA 4HN8A 3U4FA 4GMEA 1D7YA 2W0HA 4PVJA 2PTZA 4G8TA 4GYPA 4H4PA 5FXDA 2BCPA 3DG3A 4H4UA 2POZA 3JS8A 3JZUA 3CXBA 3EEZA 3HSUA 4E8GA 1QLUA 5FS8A 3DK8A 1AHZA 2VFVA 1FO4A 2VFSA 3V5FA 4H4WA 4E4UA 2GQUA 4GYPC 5U25A 4A35A 2YVJA 3Q4DA 1P43A 3DQ0A 4PVEA 3DGZA 2FYMA 2HXTA 5JCKA 2OQHA 3DERA 3S5SA 3GSYA 1ZK7A 3UJFA 1H6VA 3PFRA
chains in the Genus database with same CATH topology
4TVWA 1ZXIC 3HRDC 3AM9A 3C0PA 3S1CA 4TVYA 3W8WA 5K8EA 3LAEA 3NVWB 1W1LA 4ZOHB 1JROA 3W8ZA 1WYGA 3S1DA 1I19A 3SR6B 5AE2A 2W3SA 1N60C 2W3RA 1VDVA 4BCAA 3I99A 1W1SA 2Q4WA 4JB1A 2RK5A 4HG0A 3NRZB 2Y3RA 1AHVA 1W1JA 3D2JA 2Y4GA 3RJ8A 1W1KA 3TSHA 5L6FA 2BVFA 1T3QC 4JAYA 5G5HB 4PYTA 3FW9A 2BVGA 1E8FA 3NS1B 2Y08A 1MBTA 2W55A 2VFTA 2PLSA 2UUVA 4MLAA 1N5WC 3POPA 3AMZA 3D2HA 3NVZB 2AXRA 2Y3SA 2IPIA 3FW7A 3NVYB 4PWCA 5HHZA 1W1QA 3A7UA 1F0XA 5FXFA 3A7RA 5HMRA 1X2GA 5AE1A 1X2HA 2P3HA 2QPMA 2W54A 2PLIA 4PVHA 3KJMA 3W8XA 2YVSA 4BC7A 3B9JB 1N5XA 1WVEA 2P13A 1DZNA 2EXRA 4PVKA 5ADZA 1RM6B 1FFUC 1QLTA 1W1RA 1VQZA 1HSKA 3RJAA 1W1OA 1E8GA 1JRPA 2I0KA 1MBBA 2UUUA 1DIIA 5G5GB 5D79A 3S1EA 2R8DA 1V97A 1E8HA 1N62C 4EC3A 1WVFA 1E0YA 3ETRB 3DEDA 3LLBA 5I1VA 3TSJA 3TX1A 1DIQA 2MBRA 3S1FA 4UD8A 3D2DA 4PZFA 2R2ZA 3BW7A 4ML8A 3EUB3 3AN1A 1VAOA 2E5AA 1FIQB 4DNSA 3FW8A 1W1MA 3FWAA 3A7AA 2O3GA 4BC9A 2VFRA 5AE3A 2P4PA 4PVJA 5FXDA 3NVVB 2QKNA 1N63C 3JS8A 1N61C 5AWVA 2BVHA 2OAIA 3HSUA 4O95A 3PQBA 1QLUA 1UXYA 4XLOA 1AHUA 3VTEA 2GQTA 5FXPA 2E3TA 1AHZA 5HQXA 2VFVA 3PM9A 1FO4A 2VFSA 1SB3B 3R07C 2WDWA 5L6GA 2GQUA 4PWBA 5FXEA 2NQWA 4BBYA 5I1WA 3DQ0A 4PVEA 2VAOA 2Q85A 1ZR6A 2VFUA 4OALA 3GSYA 1FFVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVW A;  1ZXI C;  3HRD C;  3AM9 A;  3C0P A;  3S1C A;  4TVY A;  3W8W A;  3LAE A;  3NVW B;  1W1L A;  4ZOH B;  1JRO A;  3W8Z A;  1WYG A;  3S1D A;  1I19 A;  3SR6 B;  5AE2 A;  2W3S A;  1N60 C;  2W3R A;  1VDV A;  4BCA A;  3I99 A;  1W1S A;  2Q4W A;  4JB1 A;  2RK5 A;  4HG0 A;  3NRZ B;  1AHV A;  1W1J A;  3D2J A;  1W1K A;  3TSH A;  2BVF A;  1T3Q C;  4JAY A;  5G5H B;  4PYT A;  3FW9 A;  2BVG A;  1E8F A;  3NS1 B;  1MBT A;  2W55 A;  2VFT A;  2PLS A;  4MLA A;  1N5W C;  3AMZ A;  3D2H A;  3NVZ B;  2AXR A;  3FW7 A;  3NVY B;  4PWC A;  5HHZ A;  1W1Q A;  3A7U A;  1F0X A;  5FXF A;  3A7R A;  5HMR A;  1X2G A;  5AE1 A;  1X2H A;  2P3H A;  2QPM A;  2W54 A;  2PLI A;  4PVH A;  3KJM A;  3W8X A;  2YVS A;  4BC7 A;  3B9J B;  1N5X A;  1WVE A;  2P13 A;  1DZN A;  2EXR A;  4PVK A;  5ADZ A;  1RM6 B;  1FFU C;  1QLT A;  1W1R A;  1VQZ A;  1HSK A;  1W1O A;  1E8G A;  1JRP A;  2I0K A;  1MBB A;  1DII A;  5G5G B;  5D79 A;  3S1E A;  2R8D A;  1V97 A;  1E8H A;  1N62 C;  4EC3 A;  1WVF A;  1E0Y A;  3ETR B;  3DED A;  3LLB A;  3TSJ A;  3TX1 A;  1DIQ A;  2MBR A;  3S1F A;  4UD8 A;  3D2D A;  4PZF A;  2R2Z A;  3BW7 A;  4ML8 A;  3EUB 3;  3AN1 A;  1VAO A;  2E5A A;  1FIQ B;  4DNS A;  3FW8 A;  1W1M A;  3FWA A;  3A7A A;  2O3G A;  4BC9 A;  2VFR A;  5AE3 A;  2P4P A;  4PVJ A;  5FXD A;  3NVV B;  2QKN A;  1N63 C;  3JS8 A;  1N61 C;  2BVH A;  2OAI A;  4O95 A;  1QLU A;  1UXY A;  4XLO A;  1AHU A;  3VTE A;  2GQT A;  5FXP A;  2E3T A;  1AHZ A;  5HQX A;  2VFV A;  3PM9 A;  1FO4 A;  2VFS A;  1SB3 B;  3R07 C;  2GQU A;  4PWB A;  5FXE A;  2NQW A;  4BBY A;  3DQ0 A;  4PVE A;  2VAO A;  2Q85 A;  1ZR6 A;  2VFU A;  4OAL A;  3GSY A;  1FFV C; 
#chains in the Genus database with same CATH topology
 3UCD A;  1NHQ A;  5FJR A;  4DX3 A;  3FYY A;  4H50 A;  1EC8 A;  3W8W A;  5K8E A;  3NVW B;  4EQX A;  3MUC A;  3NFU A;  3W8Z A;  2AKZ A;  2EQ7 A;  2ZC8 A;  3S1D A;  5EBK A;  1I19 A;  3CT2 A;  2O56 A;  3UJS A;  1GES A;  4GRT A;  4EMJ A;  4H1Z A;  1BQG A;  4HG0 A;  3BOX A;  1BWC A;  4HNC A;  2HZG A;  3GO2 A;  3I6E A;  3OC4 A;  1GRF A;  3RIT A;  4MGG A;  3UXK A;  3ES8 A;  3D2J A;  4G7F A;  3RCY A;  3R25 A;  3TSH A;  2BVF A;  3HW2 A;  1T3Q C;  1EBG A;  4KWS A;  5G5H B;  3FW9 A;  2BVG A;  3NS1 B;  4DHG A;  2W55 A;  2GSH A;  1N5W C;  3POP A;  2PGW A;  2NQL A;  3D2H A;  4H4R A;  3GD4 A;  4FDC B;  2Y3S A;  2X8H A;  2IPI A;  3NVY B;  4PWC A;  4EM3 A;  1P48 A;  2PA6 A;  2PP3 A;  3P93 A;  2WOI A;  2W54 A;  3QPE A;  3KJM A;  3W8X A;  2PMQ A;  2P13 A;  4GGB A;  3JVA A;  3TQP A;  2GGG A;  4EQW A;  3SQS A;  5ADZ A;  1RM6 B;  1W1R A;  1FEC A;  3K1G A;  1W1O A;  3IJQ A;  3T8Q A;  2X8C A;  4J56 A;  3MZN A;  2QQ6 A;  2I5Q A;  4NEW A;  1MBB A;  3CGD A;  3TOY A;  1DII A;  4YWS A;  5D79 A;  3UJR A;  2A8X A;  3DJG X;  1STZ A;  3IK4 A;  2V3B A;  3OPS A;  2DW6 A;  4X2P A;  2HNE A;  4H4S A;  1KCZ A;  5I1V A;  3TSJ A;  4IL0 A;  5FS7 A;  4K8D A;  3CK5 A;  3NO1 A;  4PZF A;  4ML8 A;  4ROP A;  3DFH A;  5JRB A;  1GRE A;  3A7A A;  3FV9 A;  2O3G A;  4BC9 A;  5AE3 A;  2P4P A;  3ZLF A;  2NVK X;  2GDQ A;  4K7Z A;  3TTE A;  2QKN A;  2WOW A;  1SJA A;  1YEY A;  3DDM A;  1S7M A;  3RGT A;  4O95 A;  2AL2 A;  3MKC A;  4IHC A;  1EBD A;  3LB8 A;  3R11 A;  3R07 C;  2WDW A;  3CYJ A;  2GQW A;  4GIR A;  1PDY A;  1TE6 A;  3QKE A;  3R10 A;  5BOE A;  2GR2 A;  3DK9 A;  3FVD A;  4IL2 A;  3VCN A;  3I4K A;  5I1W A;  1XHC A;  2Q85 A;  4JDR A;  2JK6 A;  1ZR6 A;  1GEU A;  3CB3 A;  2OQY A;  1GRG A;  3DGB A;  3QFB A;  1LVL A;  1F3P A;  1ZMC A;  4JQ9 A;  3FCP A;  5FJU A;  5IDZ A;  1FFV C;  4H4Q A;  3AM9 A;  2WPE A;  5J04 A;  3C0P A;  1F9C A;  1BKH A;  4TVY A;  3RR1 A;  5JCN A;  2PTY A;  1YQZ A;  1WYG A;  2OX4 A;  3TCS A;  3ZVH A;  3TJ4 A;  3T9P A;  4KPL A;  2W3S A;  3KUM A;  5U1O A;  4BCA A;  1Q1R A;  3I99 A;  4JB1 A;  3GY1 A;  4H2H A;  3ZLH A;  2X8G A;  4A3R A;  2XGZ A;  3TWB A;  1EBH A;  1AHV A;  1W1J A;  2QJJ A;  2ONE A;  1NHR A;  1W1K A;  1XS2 A;  3DIP A;  5FJP A;  5L6F A;  2P88 A;  4E5T A;  3MSY A;  1E8F A;  3EJE B;  1MBT A;  5JCL A;  4MLA A;  3H4K A;  1NHP A;  1ZX9 A;  2QGY A;  2QJM A;  5HHZ A;  3SN0 A;  1W1Q A;  3O0H A;  4GIS A;  1F0X A;  2QJN A;  3PWG A;  5FXF A;  3A7R A;  1X2G A;  2PSN A;  2ZAD A;  5AE1 A;  4MMW A;  1IYX A;  2P3H A;  3NZG A;  5TR3 A;  2PLI A;  3R1Z A;  1ZY8 A;  1MDR A;  4BC7 A;  3IC9 A;  3B9J B;  1TYT A;  1R6W A;  1DZN A;  4IP5 A;  2P3Z A;  2WPF A;  3MQT A;  4ZCW A;  3VA8 A;  3BSM A;  4LII A;  2EQ9 A;  2QDD A;  3FJ4 A;  4M0X A;  1GSN A;  4HPN A;  1VQZ A;  1HSK A;  3RJA A;  3LXD A;  3H7V A;  2V3A A;  2ZZC A;  2UUU A;  4DN1 A;  2AL2 B;  2HXU A;  3CGE A;  1E8H A;  3L5O A;  3UJ2 A;  1WVF A;  3ETR B;  4J3Z A;  3EKG A;  3SSZ A;  2HQM A;  3LAD A;  2C3D A;  1FEB A;  3DEQ A;  3DK4 A;  4FX9 A;  5ER0 A;  2V6O A;  3TX1 A;  2PP0 A;  5KVI A;  4IT1 A;  4UD8 A;  3DH9 A;  1JCT A;  1NEL A;  2PGE A;  4H4Y A;  2OKT A;  3S47 A;  3EUB 3;  3STP A;  4DNS A;  1EC7 A;  1ONF A;  3FWA A;  4BV6 A;  2VFR A;  4K8G A;  2CFY A;  3SBF A;  2WPC A;  1NU5 A;  2P0I A;  2P8C A;  3SJN A;  3UXL A;  1N63 C;  1WUF A;  2EQ8 A;  5AWV A;  2BVH A;  3MY9 A;  3T4W A;  4EM4 A;  3PQB A;  1E9I A;  4XLO A;  1AHU A;  1GET A;  3VTE A;  1NHS A;  2GR0 A;  3GRS A;  2X99 A;  3R0U A;  5FXP A;  2E3T A;  5HQX A;  3PM9 A;  1SJD A;  1SB3 B;  5GRT A;  5L6G A;  1KKR A;  2QDE A;  4ADW A;  4HCD A;  1FHU A;  2RAB A;  2PU0 A;  2YVF A;  1AOG A;  3PK7 A;  2VFU A;  1GRT A;  1ELS A;  3GRT A;  2DW7 A;  3IJL A;  3N4E A;  2AAQ A;  2GGI A;  4FI4 A;  4LA1 A;  1KN0 A;  1GRB A;  4IZG A;  3H70 A;  1GRH A;  4TVW A;  1ZXI C;  1FHV A;  1DTN A;  1Q1W A;  3OTR A;  1JEH A;  3S1C A;  2PCE A;  3LAE A;  5EU9 A;  4ZOH B;  4JN8 A;  2BC0 A;  1JRO A;  2F5Z A;  2WOV A;  3EAO A;  1NDA A;  3T6C A;  4DYE A;  3SR6 B;  3I6T A;  4GGH A;  2MUC A;  1N60 C;  4Z17 A;  1W1S A;  4A6G A;  3EJB B;  1JPD X;  1GV4 A;  1MOK A;  3P0W A;  3TW9 A;  3SQP A;  1W6T A;  2GGE A;  4YWO A;  2XH0 A;  2QAE A;  3GD3 A;  2Y4G A;  3RJ8 A;  2XH4 A;  3GD6 A;  4JAY A;  2GH5 A;  2PP1 A;  3DES A;  1GXF A;  4DXK A;  4GR1 A;  2Y08 A;  2PLS A;  2POD A;  2WBA A;  3L8K A;  4BUR A;  3NVZ B;  2GRT A;  3UGV A;  2AXR A;  3CGB A;  3FW7 A;  5JCI A;  3R0K A;  3A7U A;  3DJJ A;  3URH A;  3VC6 A;  7ENL A;  1XAN A;  1X2H A;  4E4F A;  2QPM A;  1NPX A;  4PVH A;  1MUC A;  4Z1Y A;  2NPX A;  2PTW A;  3RRA A;  1KD0 A;  2GGJ A;  3II4 A;  4ZA0 A;  2EXR A;  1PDZ A;  3VFC A;  4PVK A;  5FMH A;  1FEA A;  3HPF A;  1ZDL A;  3OZY A;  3EAN A;  1GRA A;  4HNL A;  1ZMD A;  4GFI A;  1JOA A;  1JRP A;  2J3N A;  2I0K A;  2GR3 A;  3GC2 A;  3CGC A;  1N62 C;  4EC3 A;  2AL1 A;  3B97 A;  1SJB A;  4HCL A;  1LPF A;  2CHR A;  2X50 A;  4DWD A;  3OP2 A;  4H4T A;  1DNC A;  2MBR A;  2QVH A;  4DNA A;  3S1F A;  2YQU A;  4J57 A;  5FS6 A;  3BW7 A;  1ZKQ A;  2R2Z A;  3DFY A;  3AN1 A;  1VAO A;  3THU A;  4K1W A;  1FIQ B;  3FW8 A;  1ONE A;  2P8B A;  2PS2 A;  2OZ8 A;  3CAW A;  3NVV B;  3TJI A;  3D9X A;  4ENL A;  4F4R A;  3PG6 A;  2PPG A;  3D46 A;  1GER A;  1N61 C;  5FJT A;  2OAI A;  3CXO A;  3V5C A;  4IP4 A;  1UXY A;  1KKO A;  3H8A A;  2PTX A;  2GQT A;  1WUE A;  3EJD B;  2OO6 A;  4KPR A;  2RDX A;  3IJI A;  2ZZB A;  4PWB A;  3N6H A;  4JN7 A;  5FXE A;  2BC1 A;  3OW1 A;  3EF6 A;  3TWA A;  4MKS A;  2NQW A;  6ENL A;  4BBY A;  2VAO A;  4KT2 A;  4OAL A;  1TKK A;  3P3B A;  3DG7 A;  1M6I A;  3V3W A;  4NEV A;  3UCC A;  3HRD C;  2YAU A;  4EQS A;  5ENL A;  3SN1 A;  3RNM A;  2OPJ A;  1W1L A;  4M6U A;  3H12 A;  2CDU A;  3NXL A;  1JPM A;  4EQR A;  5AE2 A;  3Q45 A;  3ZVH B;  4H83 A;  4FP1 A;  2W3R A;  1VDV A;  2RK5 A;  2Q4W A;  2WP5 A;  4EMI A;  2PU1 A;  3NRZ B;  2Y3R A;  3VC5 A;  4J1O A;  1V59 A;  3OZM A;  1XPY A;  2OLA A;  3UJE A;  4M52 A;  3D47 A;  3U9I A;  1MDL A;  3JW7 A;  1DXL A;  2XH7 A;  3N4F A;  4H4X A;  3SN4 A;  2FKP A;  1OJT A;  1SJC A;  4PYT A;  1EC9 A;  3N6J A;  3QLD A;  3VDG A;  3ZVI A;  1RVK A;  1TYP A;  3V4B A;  2AKM A;  4HCH A;  3KLJ A;  2VFT A;  5KVH A;  4H19 A;  4KEM A;  2UUV A;  1F8W A;  3AMZ A;  3ENL A;  4H4Z A;  4JHM A;  2WP6 A;  2GR1 A;  2YVG A;  4EMW A;  3BJS A;  5FJO A;  4E6M A;  1K4Q A;  5HMR A;  3FXG A;  1L8P A;  4HYR A;  3VCC A;  2YVS A;  4K2S A;  1MRA A;  1H2I A;  1N5X A;  2XH2 A;  1WVE A;  3ES7 A;  2OZ3 A;  3QFA A;  4APN A;  2MNR A;  2GL5 A;  1FFU C;  1OEP A;  1QLT A;  2EQ6 A;  3DGH A;  1MNS A;  3QTP A;  1E8G A;  3Q6J A;  1TZZ A;  2C3C A;  2OZT A;  5G5G B;  3S1E A;  2R8D A;  2TPR A;  3MWC A;  1V97 A;  1ECQ A;  3RO6 A;  2OVL A;  3DG6 A;  1E0Y A;  3DED A;  1JDF A;  3QN3 A;  1MO9 A;  4H4V A;  3FG2 P;  3LLB A;  2R9Z A;  5FS9 A;  5BOF A;  2ZZ0 A;  3ZLG A;  1DIQ A;  1R0M A;  1XDI A;  1BZL A;  2OFJ A;  3PWI A;  3D2D A;  2GGH A;  5JCM A;  2OG9 A;  2XSX A;  2E5A A;  4EWJ A;  1W1M A;  4HN8 A;  3U4F A;  4GME A;  1D7Y A;  2W0H A;  4PVJ A;  2PTZ A;  4G8T A;  4GYP A;  4H4P A;  5FXD A;  2BCP A;  3DG3 A;  4H4U A;  2POZ A;  3JS8 A;  3JZU A;  3CXB A;  3EEZ A;  3HSU A;  4E8G A;  1QLU A;  5FS8 A;  3DK8 A;  1AHZ A;  2VFV A;  1FO4 A;  2VFS A;  3V5F A;  4H4W A;  4E4U A;  2GQU A;  4GYP C;  5U25 A;  4A35 A;  2YVJ A;  3Q4D A;  1P43 A;  3DQ0 A;  4PVE A;  3DGZ A;  2FYM A;  2HXT A;  5JCK A;  2OQH A;  3DER A;  3S5S A;  3GSY A;  1ZK7 A;  3UJF A;  1H6V A;  3PFR A; 
#chains in the Genus database with same CATH homology
 4TVW A;  1ZXI C;  3HRD C;  3AM9 A;  3C0P A;  3S1C A;  4TVY A;  3W8W A;  5K8E A;  3LAE A;  3NVW B;  1W1L A;  4ZOH B;  1JRO A;  3W8Z A;  1WYG A;  3S1D A;  1I19 A;  3SR6 B;  5AE2 A;  2W3S A;  1N60 C;  2W3R A;  1VDV A;  4BCA A;  3I99 A;  1W1S A;  2Q4W A;  4JB1 A;  2RK5 A;  4HG0 A;  3NRZ B;  2Y3R A;  1AHV A;  1W1J A;  3D2J A;  2Y4G A;  3RJ8 A;  1W1K A;  3TSH A;  5L6F A;  2BVF A;  1T3Q C;  4JAY A;  5G5H B;  4PYT A;  3FW9 A;  2BVG A;  1E8F A;  3NS1 B;  2Y08 A;  1MBT A;  2W55 A;  2VFT A;  2PLS A;  2UUV A;  4MLA A;  1N5W C;  3POP A;  3AMZ A;  3D2H A;  3NVZ B;  2AXR A;  2Y3S A;  2IPI A;  3FW7 A;  3NVY B;  4PWC A;  5HHZ A;  1W1Q A;  3A7U A;  1F0X A;  5FXF A;  3A7R A;  5HMR A;  1X2G A;  5AE1 A;  1X2H A;  2P3H A;  2QPM A;  2W54 A;  2PLI A;  4PVH A;  3KJM A;  3W8X A;  2YVS A;  4BC7 A;  3B9J B;  1N5X A;  1WVE A;  2P13 A;  1DZN A;  2EXR A;  4PVK A;  5ADZ A;  1RM6 B;  1FFU C;  1QLT A;  1W1R A;  1VQZ A;  1HSK A;  3RJA A;  1W1O A;  1E8G A;  1JRP A;  2I0K A;  1MBB A;  2UUU A;  1DII A;  5G5G B;  5D79 A;  3S1E A;  2R8D A;  1V97 A;  1E8H A;  1N62 C;  4EC3 A;  1WVF A;  1E0Y A;  3ETR B;  3DED A;  3LLB A;  5I1V A;  3TSJ A;  3TX1 A;  1DIQ A;  2MBR A;  3S1F A;  4UD8 A;  3D2D A;  4PZF A;  2R2Z A;  3BW7 A;  4ML8 A;  3EUB 3;  3AN1 A;  1VAO A;  2E5A A;  1FIQ B;  4DNS A;  3FW8 A;  1W1M A;  3FWA A;  3A7A A;  2O3G A;  4BC9 A;  2VFR A;  5AE3 A;  2P4P A;  4PVJ A;  5FXD A;  3NVV B;  2QKN A;  1N63 C;  3JS8 A;  1N61 C;  5AWV A;  2BVH A;  2OAI A;  3HSU A;  4O95 A;  3PQB A;  1QLU A;  1UXY A;  4XLO A;  1AHU A;  3VTE A;  2GQT A;  5FXP A;  2E3T A;  1AHZ A;  5HQX A;  2VFV A;  3PM9 A;  1FO4 A;  2VFS A;  1SB3 B;  3R07 C;  2WDW A;  5L6G A;  2GQU A;  4PWB A;  5FXE A;  2NQW A;  4BBY A;  5I1W A;  3DQ0 A;  4PVE A;  2VAO A;  2Q85 A;  1ZR6 A;  2VFU A;  4OAL A;  3GSY A;  1FFV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...