1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
3FW8A 1WVFA 4PVEA 3DQ0A 1X2GA 4BCAA 1X2HA 2P4PA 5HMRA 2QPMA 5AE1A 3GSYA 1N5XA 3S1DA 5ADZA 2I0KA 4HG0A 2VFRA 1JROA 2VFUA 2E3TA 1WYGA 3A7AA 2EXRA 1FO4A 3NVVB 3PM9A 1W1SA 3EUB3 5HHZA 2QKNA 5FXDA 4TVWA 3TSHA 4DNSA 2BVFA 2P13A 2E5AA 1VQZA 3VTEA 3BW7A 4JB1A 1UXYA 2GQTA 5AE2A 1W1OA 1I19A 2PLIA 3DEDA 3D2HA 2NQWA 2Q85A 1VAOA 2W54A 1W1QA 1T3QC 4OALA 1N5WC 1VDVA 5FXFA 1ZXIC 4PWBA 3W8ZA 2VAOA 2Q4WA 2W3RA 2BVGA 3D2JA 3C0PA 5AE3A 1E0YA 2VFSA 5G5HB 1MBTA 3TSJA 2O3GA 1E8GA 1V97A 3AN1A 1W1RA 1JRPA 1FFVC 4XLOA 4MLAA 1HSKA 4EC3A 5FXPA 1FFUC 2R8DA 1N63C 3NS1B 1MBBA 4PVKA 3FW7A 4O95A 5G5GB 4PVJA 2GQUA 4PZFA 3LLBA 4TVYA 3W8XA 1WVEA 1DIIA 2VFVA 1AHVA 1F0XA 3S1CA 5D79A 4BBYA 2OAIA 4ZOHB 4PYTA 4BC7A 2BVHA 3I99A 1RM6B 1FIQB 3JS8A 3NVZB 1QLTA 3AMZA 2R2ZA 3FW9A 5HQXA 1W1KA 4PVHA 3NRZB 2W55A 3HRDC 2AXRA 1DIQA 1AHUA 1DZNA 3TX1A 3A7RA 4BC9A 1W1LA 1N61C 5FXEA 3A7UA 3KJMA 4UD8A 1E8FA 4PWCA 1N60C 1E8HA 3W8WA 3NVWB 1QLUA 1AHZA 4ML8A 2RK5A 2P3HA 2YVSA 3LAEA 3ETRB 4JAYA 3S1FA 3R07C 3SR6B 2MBRA 2W3SA 3FWAA 1W1MA 3D2DA 3B9JB 1SB3B 3NVYB 3S1EA 3AM9A 2VFTA 2PLSA 1W1JA 1N62C 1ZR6A
chains in the Genus database with same CATH superfamily
4PVEA 4HN8A 2PP0A 2RABA 3FJ4A 3JZUA 1MO9A 4H4QA 3UCCA 4IZGA 5FS6A 5JCMA 2BC0A 1SJCA 2QPMA 5JCNA 3FXGA 2OQYA 4DYEA 2GL5A 4GISA 2AAQA 2UUUA 2V3AA 4IP4A 1F8WA 3NVVB 5GRTA 3IJIA 1EC9A 2X8GA 1GEUA 3TOYA 2GSHA 3EUB3 1XPYA 2X99A 3EKGA 2QKNA 4ZCWA 3SBFA 3TSHA 2CHRA 3B97A 3OZYA 3HPFA 3UCDA 2QAEA 4K8DA 4JB1A 1RVKA 3U9IA 4M0XA 3GRSA 1GESA 1ZKQA 2HXUA 3D2HA 2WP5A 3CT2A 3CYJA 2XH0A 3RRAA 3VC5A 2NQWA 1EC8A 3DGBA 1T3QC 1SJAA 1VDVA 4MKSA 3PWGA 3W8ZA 1ZMDA 1NHQA 3CB3A 3H8AA 2W3RA 3C0PA 1P43A 3LXDA 3T4WA 3RITA 1L8PA 3UJRA 1PDZA 3EJEB 1GETA 3DG6A 3IJQA 1GRAA 3BJSA 4H83A 4EQSA 4DN1A 4EM3A 1W1RA 2PGEA 4LIIA 4YWSA 3D9XA 1HSKA 1ZK7A 4EC3A 2XH7A 3UJSA 1ONEA 2P3ZA 2GR0A 5U1OA 1TKKA 2QJJA 4K2SA 3TJ4A 3EJBB 1AOGA 3SQPA 4PVJA 2GQUA 2PU0A 2OLAA 2GH5A 2GR2A 4HCLA 2PMQA 4EMJA 1GRBA 5FJPA 4GGHA 1AHVA 3DJGX 1F0XA 1V59A 4E6MA 4ZOHB 4BC7A 1JOAA 3DG3A 4JHMA 5JRBA 1P48A 3JVAA 3NVZB 3CGBA 2POZA 1QLTA 1NDAA 3DFHA 4JQ9A 5AWVA 2GGHA 2PSNA 4GIRA 2P8BA 2X8CA 2EQ6A 2AL2A 1BZLA 1DIQA 3JW7A 1BQGA 3MKCA 1EBGA 1H6VA 3GRTA 4H4TA 4J3ZA 3V4BA 5FJTA 3W8WA 3NVWB 4ML8A 1H2IA 3DJJA 3ETRB 3QTPA 4GRTA 2HZGA 2YVGA 2DW6A 1SJDA 4GYPA 2YQUA 2PTWA 1SB3B 1YQZA 3NVYB 3CAWA 3GO2A 3AM9A 3KUMA 1W1JA 3DGZA 1R6WA 3N4FA 4M52A 2OFJA 3N6JA 2C3CA 4H1ZA 2ONEA 4FX9A 2GQWA 4EMWA 2GGJA 4FDCB 1GV4A 2P4PA 3DGHA 2QJNA 5HMRA 3QLDA 2PODA 3S1DA 2I0KA 3EJDB 3BOXA 2BCPA 2E3TA 2EXRA 3OTRA 5J04A 3DH9A 4TVWA 3T8QA 4DNSA 5L6GA 3RO6A 2BVFA 4EQXA 2P13A 2NVKX 2QJMA 4YWOA 2WOIA 3P0WA 3Q6JA 1KCZA 4IL0A 1I19A 5KVIA 3IK4A 1FEAA 4A6GA 1TZZA 4OALA 4H4UA 1N5WC 1GXFA 4H4VA 1TE6A 1Q1WA 4JDRA 3STPA 4H4RA 4H4SA 2VAOA 2Q4WA 1R0MA 4EM4A 2HQMA 2F5ZA 3THUA 5G5HB 1OEPA 2NQLA 2O3GA 4BURA 3UJ2A 1FHUA 3GC2A 4A3RA 1V97A 3AN1A 3H7VA 3SN1A 1JRPA 4ENLA 1BKHA 1M6IA 2OG9A 3OPSA 4XLOA 4H50A 4MLAA 3FV9A 1MOKA 1MBBA 4IP5A 3S47A 4O95A 5G5GB 1F9CA 5L6FA 3U4FA 2Y08A 2YVFA 4ROPA 3LLBA 2OKTA 3DEQA 4TVYA 4H19A 3ZLGA 4EMIA 4H2HA 1WVEA 4BV6A 2GGEA 2WOWA 2OZ3A 3SJNA 2V6OA 1MUCA 4EQWA 3S1CA 5D79A 2AL1A 4IT1A 2ZZ0A 3RR1A 2CDUA 4H4PA 2QGYA 2XH2A 4K8GA 3URHA 1DXLA 1FIQB 1GRTA 3TQPA 4EWJA 3V5FA 3FW9A 3T9PA 4DXKA 1W1KA 5FS8A 4NEVA 4E5TA 1MNSA 2QDEA 3H12A 3PK7A 3VCCA 4J57A 2Y3RA 1NU5A 2AXRA 5ER0A 4KT2A 1WUFA 1AHUA 5FMHA 4HNCA 4BC9A 2GGGA 3TWBA 3NXLA 5JCLA 4Z17A 1LPFA 4PWCA 3I4KA 1AHZA 2YVSA 3SN0A 2P3HA 1DNCA 3S1FA 2WPFA 3SR6B 4HCDA 1ZDLA 3VC6A 4LA1A 3MWCA 1DTNA 2PTZA 4FP1A 2EQ9A 3L5OA 3S1EA 2VFTA 3PWIA 1JEHA 1GSNA 1ZR6A 3FW8A 2R9ZA 1WVFA 3R11A 5I1WA 3EF6A 3DESA 1X2GA 1KKRA 1X2HA 3GD6A 2PS2A 2W0HA 1XHCA 3OW1A 1OJTA 1ZX9A 1IYXA 3QPEA 5ADZA 4APNA 3A7AA 3R10A 2UUVA 2A8XA 2IPIA 2MUCA 2PTYA 3R25A 4IL2A 1JPMA 4K7ZA 2EQ7A 1XS2A 2E5AA 1VQZA 3GY1A 3MUCA 3VCNA 3ZVHB 4G7FA 1UXYA 2GQTA 3UJEA 4DHGA 3ZLHA 2PLIA 1STZA 1VAOA 2W54A 2TPRA 1W1QA 2PLSA 3HW2A 3UGVA 4PWBA 2OPJA 2WPEA 3RJAA 2XH4A 3OC4A 1MDRA 1XANA 2P0IA 3K1GA 2VFSA 3RJ8A 2BC1A 3R0UA 3SN4A 3ZLFA 3MSYA 2EQ8A 2WOVA 3TWAA 5I1VA 4GMEA 1W6TA 2X50A 3H70A 5U25A 2ZADA 4DX3A 2OVLA 1FFVC 4FI4A 3QFAA 4NEWA 1NHSA 2R8DA 1N63C 2CFYA 2QVHA 3FW7A 2QDDA 4GR1A 4J1OA 1ONFA 3ES8A 2HXTA 2AKZA 4DWDA 1EC7A 3DDMA 4J56A 3TCSA 4X2PA 1DIIA 2I5QA 4H4YA 4HNLA 3N6HA 4BBYA 1WUEA 2OAIA 4PYTA 3DIPA 1TYPA 1KN0A 2OQHA 3DK9A 3I99A 1RM6B 3P3BA 4KWSA 2J3NA 3RGTA 3PFRA 4M6UA 4HPNA 3LADA 4GGBA 3OP2A 3CGCA 5HQXA 1E9IA 1LVLA 3D46A 2RDXA 1GRGA 3MZNA 2PP1A 2MNRA 2XSXA 3NRZB 5K8EA 2W55A 1SJBA 2GGIA 2JK6A 3HRDC 3R0KA 2DW7A 4A35A 3SSZA 2P8CA 1DZNA 4KEMA 3A7RA 1W1LA 1MDLA 3KJMA 1JDFA 3NO1A 2WP6A 4UD8A 2PP3A 5IDZA 5TR3A 1NPXA 2GR1A 3BSMA 3NZGA 3QKEA 2WBAA 3ES7A 2RK5A 3S5SA 2PU1A 4JAYA 2P88A 3VFCA 7ENLA 1GRHA 2ZC8A 3PQBA 1F3PA 1KKOA 2PA6A 2Y3SA 3B9JB 2AKMA 3Q4DA 1ZMCA 2ZZBA 5FXPA 3NFUA 4K1WA 4GYPC 3OZMA 3VA8A 3II4A 2GRTA 5JCKA 3EANA 4IHCA 3ZVIA 3DQ0A 3SQSA 4BCAA 5EU9A 5AE1A 3MQTA 3GSYA 2YVJA 4EQRA 3RCYA 3MY9A 1N5XA 4H4WA 3FYYA 3V5CA 2ZZCA 3GD4A 3DERA 4HG0A 2VFRA 1JROA 2GDQA 3H4KA 3VDGA 2VFUA 2C3DA 1MRAA 1WYGA 3RNMA 3DK4A 1FO4A 3FCPA 3PM9A 1Q1RA 2GR3A 1W1SA 5HHZA 5FXDA 2NPXA 3I6TA 1GERA 1NHRA 3IC9A 2QQ6A 3VTEA 3BW7A 1ECQA 5FS7A 5AE2A 3CGEA 1W1OA 2AL2B 4E4UA 3DEDA 4JN8A 4DNAA 3CK5A 2Q85A 3T6CA 3UXLA 4MGGA 3UXKA 4H4ZA 3QFBA 5FXFA 1ZXIC 1FECA 1ZY8A 2BVGA 3D2JA 5AE3A 1E0YA 1KD0A 1MBTA 3TSJA 1E8GA 1PDYA 3IJLA 4F4RA 2OO6A 2X8HA 1S7MA 5BOFA 2YAUA 5ENLA 4KPLA 1ELSA 4HYRA 4JN7A 2Y4GA 3O0HA 5BOEA 3CXBA 3TJIA 4H4XA 1FFUC 3QN3A 3D47A 3NS1B 3Q45A 4Z1YA 3L8KA 4PVKA 2OX4A 5JCIA 4E8GA 2V3BA 4PZFA 2WPCA 1JPDX 3LB8A 3GD3A 1NHPA 1TYTA 3EEZA 3W8XA 2VFVA 5KVHA 3FVDA 3R1ZA 1JCTA 3I6EA 2PPGA 1BWCA 3CGDA 3P93A 1GREA 2BVHA 5FS9A 2PGWA 2FKPA 1N62C 1XDIA 3JS8A 4G8TA 5EBKA 3PG6A 1FEBA 3AMZA 2R2ZA 3POPA 1K4QA 4MMWA 4ADWA 3FG2P 2PCEA 3N4EA 1NELA 1GRFA 4HCHA 3ZVHA 4GFIA 5FJRA 4PVHA 2OZ8A 2XGZA 3DK8A 3CXOA 3DFYA 3V3WA 3TX1A 2PTXA 2FYMA 1N61C 5FXEA 2OZTA 3A7UA 3ENLA 4ZA0A 1E8FA 6ENLA 3HSUA 1N60C 1E8HA 1QLUA 3KLJA 3LAEA 2O56A 3TW9A 5FJUA 3R07C 5FJOA 2MBRA 2W3SA 3FWAA 1W1MA 3D2DA 1D7YA 3EAOA 2WDWA 3DG7A 1YEYA 3TTEA 2HNEA 4E4FA 3UJFA 1EBDA 1EBHA 1FHVA 4KPRA
chains in the Genus database with same CATH topology
3FW8A 1WVFA 4PVEA 5I1WA 3DQ0A 1X2GA 4BCAA 1X2HA 2P4PA 5HMRA 2QPMA 5AE1A 3GSYA 1N5XA 3S1DA 5ADZA 2I0KA 4HG0A 2VFRA 1JROA 2UUUA 2VFUA 2E3TA 1WYGA 3A7AA 2EXRA 1FO4A 3NVVB 2UUVA 3PM9A 2IPIA 1W1SA 3EUB3 5HHZA 2QKNA 5FXDA 4TVWA 3TSHA 4DNSA 5L6GA 2BVFA 2P13A 2E5AA 1VQZA 3VTEA 3BW7A 4JB1A 1UXYA 2GQTA 5AE2A 1W1OA 1I19A 2PLIA 3DEDA 3D2HA 2NQWA 2Q85A 1VAOA 2W54A 1W1QA 1T3QC 4OALA 1N5WC 1VDVA 5FXFA 1ZXIC 4PWBA 3W8ZA 3RJAA 2VAOA 2Q4WA 2W3RA 2BVGA 3D2JA 3C0PA 5AE3A 1E0YA 2VFSA 5G5HB 1MBTA 3TSJA 3RJ8A 2O3GA 1E8GA 5I1VA 1V97A 3AN1A 1W1RA 1JRPA 2Y4GA 1FFVC 4XLOA 4MLAA 1HSKA 4EC3A 5FXPA 1FFUC 2R8DA 1N63C 3NS1B 1MBBA 4PVKA 3FW7A 4O95A 5G5GB 4PVJA 2GQUA 4PZFA 5L6FA 2Y08A 3LLBA 4TVYA 3W8XA 1WVEA 1DIIA 2VFVA 1AHVA 1F0XA 3S1CA 5D79A 4BBYA 2OAIA 4ZOHB 4PYTA 4BC7A 2BVHA 3I99A 1RM6B 1FIQB 3JS8A 3NVZB 1QLTA 3AMZA 2R2ZA 5AWVA 3POPA 3FW9A 5HQXA 1W1KA 4PVHA 3NRZB 5K8EA 2W55A 2Y3RA 3HRDC 2AXRA 1DIQA 1AHUA 1DZNA 3TX1A 3A7RA 4BC9A 1W1LA 1N61C 5FXEA 3A7UA 3KJMA 4UD8A 1E8FA 3HSUA 4PWCA 1N60C 1E8HA 3W8WA 3NVWB 1QLUA 1AHZA 4ML8A 2RK5A 2P3HA 2YVSA 3LAEA 3ETRB 4JAYA 3S1FA 3R07C 3SR6B 2MBRA 2W3SA 3FWAA 3PQBA 1W1MA 3D2DA 2Y3SA 3B9JB 2WDWA 1SB3B 3NVYB 3S1EA 3AM9A 2VFTA 2PLSA 1W1JA 1N62C 1ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW8 A;  1WVF A;  4PVE A;  3DQ0 A;  1X2G A;  4BCA A;  1X2H A;  2P4P A;  5HMR A;  2QPM A;  5AE1 A;  3GSY A;  1N5X A;  3S1D A;  5ADZ A;  2I0K A;  4HG0 A;  2VFR A;  1JRO A;  2VFU A;  2E3T A;  1WYG A;  3A7A A;  2EXR A;  1FO4 A;  3NVV B;  3PM9 A;  1W1S A;  3EUB 3;  5HHZ A;  2QKN A;  5FXD A;  4TVW A;  3TSH A;  4DNS A;  2BVF A;  2P13 A;  2E5A A;  1VQZ A;  3VTE A;  3BW7 A;  4JB1 A;  1UXY A;  2GQT A;  5AE2 A;  1W1O A;  1I19 A;  2PLI A;  3DED A;  3D2H A;  2NQW A;  2Q85 A;  1VAO A;  2W54 A;  1W1Q A;  1T3Q C;  4OAL A;  1N5W C;  1VDV A;  5FXF A;  1ZXI C;  4PWB A;  3W8Z A;  2VAO A;  2Q4W A;  2W3R A;  2BVG A;  3D2J A;  3C0P A;  5AE3 A;  1E0Y A;  2VFS A;  5G5H B;  1MBT A;  3TSJ A;  2O3G A;  1E8G A;  1V97 A;  3AN1 A;  1W1R A;  1JRP A;  1FFV C;  4XLO A;  4MLA A;  1HSK A;  4EC3 A;  5FXP A;  1FFU C;  2R8D A;  1N63 C;  3NS1 B;  1MBB A;  4PVK A;  3FW7 A;  4O95 A;  5G5G B;  4PVJ A;  2GQU A;  4PZF A;  3LLB A;  4TVY A;  3W8X A;  1WVE A;  1DII A;  2VFV A;  1AHV A;  1F0X A;  3S1C A;  5D79 A;  4BBY A;  2OAI A;  4ZOH B;  4PYT A;  4BC7 A;  2BVH A;  3I99 A;  1RM6 B;  1FIQ B;  3JS8 A;  3NVZ B;  1QLT A;  3AMZ A;  2R2Z A;  3FW9 A;  5HQX A;  1W1K A;  4PVH A;  3NRZ B;  2W55 A;  3HRD C;  2AXR A;  1DIQ A;  1AHU A;  1DZN A;  3TX1 A;  3A7R A;  4BC9 A;  1W1L A;  1N61 C;  5FXE A;  3A7U A;  3KJM A;  4UD8 A;  1E8F A;  4PWC A;  1N60 C;  1E8H A;  3W8W A;  3NVW B;  1QLU A;  1AHZ A;  4ML8 A;  2RK5 A;  2P3H A;  2YVS A;  3LAE A;  3ETR B;  4JAY A;  3S1F A;  3R07 C;  3SR6 B;  2MBR A;  2W3S A;  3FWA A;  1W1M A;  3D2D A;  3B9J B;  1SB3 B;  3NVY B;  3S1E A;  3AM9 A;  2VFT A;  2PLS A;  1W1J A;  1N62 C;  1ZR6 A; 
#chains in the Genus database with same CATH topology
 4PVE A;  4HN8 A;  2PP0 A;  2RAB A;  3FJ4 A;  3JZU A;  1MO9 A;  4H4Q A;  3UCC A;  4IZG A;  5FS6 A;  5JCM A;  2BC0 A;  1SJC A;  2QPM A;  5JCN A;  3FXG A;  2OQY A;  4DYE A;  2GL5 A;  4GIS A;  2AAQ A;  2UUU A;  2V3A A;  4IP4 A;  1F8W A;  3NVV B;  5GRT A;  3IJI A;  1EC9 A;  2X8G A;  1GEU A;  3TOY A;  2GSH A;  3EUB 3;  1XPY A;  2X99 A;  3EKG A;  2QKN A;  4ZCW A;  3SBF A;  3TSH A;  2CHR A;  3B97 A;  3OZY A;  3HPF A;  3UCD A;  2QAE A;  4K8D A;  4JB1 A;  1RVK A;  3U9I A;  4M0X A;  3GRS A;  1GES A;  1ZKQ A;  2HXU A;  3D2H A;  2WP5 A;  3CT2 A;  3CYJ A;  2XH0 A;  3RRA A;  3VC5 A;  2NQW A;  1EC8 A;  3DGB A;  1T3Q C;  1SJA A;  1VDV A;  4MKS A;  3PWG A;  3W8Z A;  1ZMD A;  1NHQ A;  3CB3 A;  3H8A A;  2W3R A;  3C0P A;  1P43 A;  3LXD A;  3T4W A;  3RIT A;  1L8P A;  3UJR A;  1PDZ A;  3EJE B;  1GET A;  3DG6 A;  3IJQ A;  1GRA A;  3BJS A;  4H83 A;  4EQS A;  4DN1 A;  4EM3 A;  1W1R A;  2PGE A;  4LII A;  4YWS A;  3D9X A;  1HSK A;  1ZK7 A;  4EC3 A;  2XH7 A;  3UJS A;  1ONE A;  2P3Z A;  2GR0 A;  5U1O A;  1TKK A;  2QJJ A;  4K2S A;  3TJ4 A;  3EJB B;  1AOG A;  3SQP A;  4PVJ A;  2GQU A;  2PU0 A;  2OLA A;  2GH5 A;  2GR2 A;  4HCL A;  2PMQ A;  4EMJ A;  1GRB A;  5FJP A;  4GGH A;  1AHV A;  3DJG X;  1F0X A;  1V59 A;  4E6M A;  4ZOH B;  4BC7 A;  1JOA A;  3DG3 A;  4JHM A;  5JRB A;  1P48 A;  3JVA A;  3NVZ B;  3CGB A;  2POZ A;  1QLT A;  1NDA A;  3DFH A;  4JQ9 A;  5AWV A;  2GGH A;  2PSN A;  4GIR A;  2P8B A;  2X8C A;  2EQ6 A;  2AL2 A;  1BZL A;  1DIQ A;  3JW7 A;  1BQG A;  3MKC A;  1EBG A;  1H6V A;  3GRT A;  4H4T A;  4J3Z A;  3V4B A;  5FJT A;  3W8W A;  3NVW B;  4ML8 A;  1H2I A;  3DJJ A;  3ETR B;  3QTP A;  4GRT A;  2HZG A;  2YVG A;  2DW6 A;  1SJD A;  4GYP A;  2YQU A;  2PTW A;  1SB3 B;  1YQZ A;  3NVY B;  3CAW A;  3GO2 A;  3AM9 A;  3KUM A;  1W1J A;  3DGZ A;  1R6W A;  3N4F A;  4M52 A;  2OFJ A;  3N6J A;  2C3C A;  4H1Z A;  2ONE A;  4FX9 A;  2GQW A;  4EMW A;  2GGJ A;  4FDC B;  1GV4 A;  2P4P A;  3DGH A;  2QJN A;  5HMR A;  3QLD A;  2POD A;  3S1D A;  2I0K A;  3EJD B;  3BOX A;  2BCP A;  2E3T A;  2EXR A;  3OTR A;  5J04 A;  3DH9 A;  4TVW A;  3T8Q A;  4DNS A;  5L6G A;  3RO6 A;  2BVF A;  4EQX A;  2P13 A;  2NVK X;  2QJM A;  4YWO A;  2WOI A;  3P0W A;  3Q6J A;  1KCZ A;  4IL0 A;  1I19 A;  5KVI A;  3IK4 A;  1FEA A;  4A6G A;  1TZZ A;  4OAL A;  4H4U A;  1N5W C;  1GXF A;  4H4V A;  1TE6 A;  1Q1W A;  4JDR A;  3STP A;  4H4R A;  4H4S A;  2VAO A;  2Q4W A;  1R0M A;  4EM4 A;  2HQM A;  2F5Z A;  3THU A;  5G5H B;  1OEP A;  2NQL A;  2O3G A;  4BUR A;  3UJ2 A;  1FHU A;  3GC2 A;  4A3R A;  1V97 A;  3AN1 A;  3H7V A;  3SN1 A;  1JRP A;  4ENL A;  1BKH A;  1M6I A;  2OG9 A;  3OPS A;  4XLO A;  4H50 A;  4MLA A;  3FV9 A;  1MOK A;  1MBB A;  4IP5 A;  3S47 A;  4O95 A;  5G5G B;  1F9C A;  5L6F A;  3U4F A;  2Y08 A;  2YVF A;  4ROP A;  3LLB A;  2OKT A;  3DEQ A;  4TVY A;  4H19 A;  3ZLG A;  4EMI A;  4H2H A;  1WVE A;  4BV6 A;  2GGE A;  2WOW A;  2OZ3 A;  3SJN A;  2V6O A;  1MUC A;  4EQW A;  3S1C A;  5D79 A;  2AL1 A;  4IT1 A;  2ZZ0 A;  3RR1 A;  2CDU A;  4H4P A;  2QGY A;  2XH2 A;  4K8G A;  3URH A;  1DXL A;  1FIQ B;  1GRT A;  3TQP A;  4EWJ A;  3V5F A;  3FW9 A;  3T9P A;  4DXK A;  1W1K A;  5FS8 A;  4NEV A;  4E5T A;  1MNS A;  2QDE A;  3H12 A;  3PK7 A;  3VCC A;  4J57 A;  2Y3R A;  1NU5 A;  2AXR A;  5ER0 A;  4KT2 A;  1WUF A;  1AHU A;  5FMH A;  4HNC A;  4BC9 A;  2GGG A;  3TWB A;  3NXL A;  5JCL A;  4Z17 A;  1LPF A;  4PWC A;  3I4K A;  1AHZ A;  2YVS A;  3SN0 A;  2P3H A;  1DNC A;  3S1F A;  2WPF A;  3SR6 B;  4HCD A;  1ZDL A;  3VC6 A;  4LA1 A;  3MWC A;  1DTN A;  2PTZ A;  4FP1 A;  2EQ9 A;  3L5O A;  3S1E A;  2VFT A;  3PWI A;  1JEH A;  1GSN A;  1ZR6 A;  3FW8 A;  2R9Z A;  1WVF A;  3R11 A;  5I1W A;  3EF6 A;  3DES A;  1X2G A;  1KKR A;  1X2H A;  3GD6 A;  2PS2 A;  2W0H A;  1XHC A;  3OW1 A;  1OJT A;  1ZX9 A;  1IYX A;  3QPE A;  5ADZ A;  4APN A;  3A7A A;  3R10 A;  2UUV A;  2A8X A;  2IPI A;  2MUC A;  2PTY A;  3R25 A;  4IL2 A;  1JPM A;  4K7Z A;  2EQ7 A;  1XS2 A;  2E5A A;  1VQZ A;  3GY1 A;  3MUC A;  3VCN A;  3ZVH B;  4G7F A;  1UXY A;  2GQT A;  3UJE A;  4DHG A;  3ZLH A;  2PLI A;  1STZ A;  1VAO A;  2W54 A;  2TPR A;  1W1Q A;  2PLS A;  3HW2 A;  3UGV A;  4PWB A;  2OPJ A;  2WPE A;  3RJA A;  2XH4 A;  3OC4 A;  1MDR A;  1XAN A;  2P0I A;  3K1G A;  2VFS A;  3RJ8 A;  2BC1 A;  3R0U A;  3SN4 A;  3ZLF A;  3MSY A;  2EQ8 A;  2WOV A;  3TWA A;  5I1V A;  4GME A;  1W6T A;  2X50 A;  3H70 A;  5U25 A;  2ZAD A;  4DX3 A;  2OVL A;  1FFV C;  4FI4 A;  3QFA A;  4NEW A;  1NHS A;  2R8D A;  1N63 C;  2CFY A;  2QVH A;  3FW7 A;  2QDD A;  4GR1 A;  4J1O A;  1ONF A;  3ES8 A;  2HXT A;  2AKZ A;  4DWD A;  1EC7 A;  3DDM A;  4J56 A;  3TCS A;  4X2P A;  1DII A;  2I5Q A;  4H4Y A;  4HNL A;  3N6H A;  4BBY A;  1WUE A;  2OAI A;  4PYT A;  3DIP A;  1TYP A;  1KN0 A;  2OQH A;  3DK9 A;  3I99 A;  1RM6 B;  3P3B A;  4KWS A;  2J3N A;  3RGT A;  3PFR A;  4M6U A;  4HPN A;  3LAD A;  4GGB A;  3OP2 A;  3CGC A;  5HQX A;  1E9I A;  1LVL A;  3D46 A;  2RDX A;  1GRG A;  3MZN A;  2PP1 A;  2MNR A;  2XSX A;  3NRZ B;  5K8E A;  2W55 A;  1SJB A;  2GGI A;  2JK6 A;  3HRD C;  3R0K A;  2DW7 A;  4A35 A;  3SSZ A;  2P8C A;  1DZN A;  4KEM A;  3A7R A;  1W1L A;  1MDL A;  3KJM A;  1JDF A;  3NO1 A;  2WP6 A;  4UD8 A;  2PP3 A;  5IDZ A;  5TR3 A;  1NPX A;  2GR1 A;  3BSM A;  3NZG A;  3QKE A;  2WBA A;  3ES7 A;  2RK5 A;  3S5S A;  2PU1 A;  4JAY A;  2P88 A;  3VFC A;  7ENL A;  1GRH A;  2ZC8 A;  3PQB A;  1F3P A;  1KKO A;  2PA6 A;  2Y3S A;  3B9J B;  2AKM A;  3Q4D A;  1ZMC A;  2ZZB A;  5FXP A;  3NFU A;  4K1W A;  4GYP C;  3OZM A;  3VA8 A;  3II4 A;  2GRT A;  5JCK A;  3EAN A;  4IHC A;  3ZVI A;  3DQ0 A;  3SQS A;  4BCA A;  5EU9 A;  5AE1 A;  3MQT A;  3GSY A;  2YVJ A;  4EQR A;  3RCY A;  3MY9 A;  1N5X A;  4H4W A;  3FYY A;  3V5C A;  2ZZC A;  3GD4 A;  3DER A;  4HG0 A;  2VFR A;  1JRO A;  2GDQ A;  3H4K A;  3VDG A;  2VFU A;  2C3D A;  1MRA A;  1WYG A;  3RNM A;  3DK4 A;  1FO4 A;  3FCP A;  3PM9 A;  1Q1R A;  2GR3 A;  1W1S A;  5HHZ A;  5FXD A;  2NPX A;  3I6T A;  1GER A;  1NHR A;  3IC9 A;  2QQ6 A;  3VTE A;  3BW7 A;  1ECQ A;  5FS7 A;  5AE2 A;  3CGE A;  1W1O A;  2AL2 B;  4E4U A;  3DED A;  4JN8 A;  4DNA A;  3CK5 A;  2Q85 A;  3T6C A;  3UXL A;  4MGG A;  3UXK A;  4H4Z A;  3QFB A;  5FXF A;  1ZXI C;  1FEC A;  1ZY8 A;  2BVG A;  3D2J A;  5AE3 A;  1E0Y A;  1KD0 A;  1MBT A;  3TSJ A;  1E8G A;  1PDY A;  3IJL A;  4F4R A;  2OO6 A;  2X8H A;  1S7M A;  5BOF A;  2YAU A;  5ENL A;  4KPL A;  1ELS A;  4HYR A;  4JN7 A;  2Y4G A;  3O0H A;  5BOE A;  3CXB A;  3TJI A;  4H4X A;  1FFU C;  3QN3 A;  3D47 A;  3NS1 B;  3Q45 A;  4Z1Y A;  3L8K A;  4PVK A;  2OX4 A;  5JCI A;  4E8G A;  2V3B A;  4PZF A;  2WPC A;  1JPD X;  3LB8 A;  3GD3 A;  1NHP A;  1TYT A;  3EEZ A;  3W8X A;  2VFV A;  5KVH A;  3FVD A;  3R1Z A;  1JCT A;  3I6E A;  2PPG A;  1BWC A;  3CGD A;  3P93 A;  1GRE A;  2BVH A;  5FS9 A;  2PGW A;  2FKP A;  1N62 C;  1XDI A;  3JS8 A;  4G8T A;  5EBK A;  3PG6 A;  1FEB A;  3AMZ A;  2R2Z A;  3POP A;  1K4Q A;  4MMW A;  4ADW A;  3FG2 P;  2PCE A;  3N4E A;  1NEL A;  1GRF A;  4HCH A;  3ZVH A;  4GFI A;  5FJR A;  4PVH A;  2OZ8 A;  2XGZ A;  3DK8 A;  3CXO A;  3DFY A;  3V3W A;  3TX1 A;  2PTX A;  2FYM A;  1N61 C;  5FXE A;  2OZT A;  3A7U A;  3ENL A;  4ZA0 A;  1E8F A;  6ENL A;  3HSU A;  1N60 C;  1E8H A;  1QLU A;  3KLJ A;  3LAE A;  2O56 A;  3TW9 A;  5FJU A;  3R07 C;  5FJO A;  2MBR A;  2W3S A;  3FWA A;  1W1M A;  3D2D A;  1D7Y A;  3EAO A;  2WDW A;  3DG7 A;  1YEY A;  3TTE A;  2HNE A;  4E4F A;  3UJF A;  1EBD A;  1EBH A;  1FHV A;  4KPR A; 
#chains in the Genus database with same CATH homology
 3FW8 A;  1WVF A;  4PVE A;  5I1W A;  3DQ0 A;  1X2G A;  4BCA A;  1X2H A;  2P4P A;  5HMR A;  2QPM A;  5AE1 A;  3GSY A;  1N5X A;  3S1D A;  5ADZ A;  2I0K A;  4HG0 A;  2VFR A;  1JRO A;  2UUU A;  2VFU A;  2E3T A;  1WYG A;  3A7A A;  2EXR A;  1FO4 A;  3NVV B;  2UUV A;  3PM9 A;  2IPI A;  1W1S A;  3EUB 3;  5HHZ A;  2QKN A;  5FXD A;  4TVW A;  3TSH A;  4DNS A;  5L6G A;  2BVF A;  2P13 A;  2E5A A;  1VQZ A;  3VTE A;  3BW7 A;  4JB1 A;  1UXY A;  2GQT A;  5AE2 A;  1W1O A;  1I19 A;  2PLI A;  3DED A;  3D2H A;  2NQW A;  2Q85 A;  1VAO A;  2W54 A;  1W1Q A;  1T3Q C;  4OAL A;  1N5W C;  1VDV A;  5FXF A;  1ZXI C;  4PWB A;  3W8Z A;  3RJA A;  2VAO A;  2Q4W A;  2W3R A;  2BVG A;  3D2J A;  3C0P A;  5AE3 A;  1E0Y A;  2VFS A;  5G5H B;  1MBT A;  3TSJ A;  3RJ8 A;  2O3G A;  1E8G A;  5I1V A;  1V97 A;  3AN1 A;  1W1R A;  1JRP A;  2Y4G A;  1FFV C;  4XLO A;  4MLA A;  1HSK A;  4EC3 A;  5FXP A;  1FFU C;  2R8D A;  1N63 C;  3NS1 B;  1MBB A;  4PVK A;  3FW7 A;  4O95 A;  5G5G B;  4PVJ A;  2GQU A;  4PZF A;  5L6F A;  2Y08 A;  3LLB A;  4TVY A;  3W8X A;  1WVE A;  1DII A;  2VFV A;  1AHV A;  1F0X A;  3S1C A;  5D79 A;  4BBY A;  2OAI A;  4ZOH B;  4PYT A;  4BC7 A;  2BVH A;  3I99 A;  1RM6 B;  1FIQ B;  3JS8 A;  3NVZ B;  1QLT A;  3AMZ A;  2R2Z A;  5AWV A;  3POP A;  3FW9 A;  5HQX A;  1W1K A;  4PVH A;  3NRZ B;  5K8E A;  2W55 A;  2Y3R A;  3HRD C;  2AXR A;  1DIQ A;  1AHU A;  1DZN A;  3TX1 A;  3A7R A;  4BC9 A;  1W1L A;  1N61 C;  5FXE A;  3A7U A;  3KJM A;  4UD8 A;  1E8F A;  3HSU A;  4PWC A;  1N60 C;  1E8H A;  3W8W A;  3NVW B;  1QLU A;  1AHZ A;  4ML8 A;  2RK5 A;  2P3H A;  2YVS A;  3LAE A;  3ETR B;  4JAY A;  3S1F A;  3R07 C;  3SR6 B;  2MBR A;  2W3S A;  3FWA A;  3PQB A;  1W1M A;  3D2D A;  2Y3S A;  3B9J B;  2WDW A;  1SB3 B;  3NVY B;  3S1E A;  3AM9 A;  2VFT A;  2PLS A;  1W1J A;  1N62 C;  1ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...