1FFVC

Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
287
structure length
287
Chain Sequence
MIPPRFEYHAPKSVGEAVALLGQLGSDAKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGSTVVIGAMTVENDLISSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDIAHGDPGNDHPALSIAVEAHFVLEGPNGRRTVPADGFFLGTYMTLLEENEVMVEIRVPAFAQGTGWAYEKLKRKTGDWATAGCAVVMRKSGNTVSHIRIALTNVAPTALRAEAAEAALLGKAFTKEAVQAAADAAIAICEPAEDLRGDADYKTAMAGQMVKRALNAAWARCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CUTS, IRON-SULFUR PROTEIN OF CARBON MONOXIDE DEHYDROGENASE
publication title The effect of intracellular molybdenum in Hydrogenophaga pseudoflava on the crystallographic structure of the seleno-molybdo-iron-sulfur flavoenzyme carbon monoxide dehydrogenase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 82
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature ec 1.2.5.3: Aerobic carbon monoxide dehydrogenase.
pdb deposition date 2000-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
C PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 1ffvC01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 1ffvC02
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 1ffvC03
3TSHA 2R8DA 2P13A 1JRPA 1DZNA 1T3QC 3W8XA 3W8WA 2O3GA 1FFUC 1SB3B 3D2DA 2RK5A 4EC3A 2VFSA 1QLUA 5D79A 1FIQB 3ETRB 4DNSA 1N60C 3PM9A 4XLOA 2I0KA 2AXRA 4BCAA 2EXRA 4BBYA 5HQXA 2W3SA 3FW7A 5AE3A 1DIIA 4PVJA 3DEDA 1WVFA 1MBTA 3GSYA 3NRZB 4BC7A 1RM6B 2PLIA 3S1EA 4PWBA 1QLTA 1DIQA 1FFVC 3NVVB 3EUB3 4PVHA 4TVYA 3SR6B 3S1DA 3JS8A 5FXDA 2OAIA 1E8FA 1W1QA 4PVKA 1HSKA 3NVZB 1N61C 2YVSA 3KJMA 1N5XA 2PLSA 3FW9A 2Q85A 3BW7A 4PWCA 2Q4WA 3D2HA 2BVGA 3W8ZA 4JAYA 1N62C 1AHUA 1V97A 3S1FA 1UXYA 1JROA 2W54A 1WYGA 2MBRA 5AE1A 4PVEA 2QKNA 3AMZA 4HG0A 2NQWA 2VAOA 2E5AA 3HRDC 3FW8A 3A7UA 3NVYB 3R07C 3C0PA 1N63C 4ML8A 1X2HA 5AE2A 4PZFA 1I19A 4OALA 4TVWA 4JB1A 2VFVA 5G5HB 3S1CA 5FXFA 2E3TA 5FXPA 1W1OA 5FXEA 3FWAA 4MLAA 1W1KA 4PYTA 2P4PA 1VQZA 3AN1A 3LLBA 1W1SA 5ADZA 3VTEA 1E0YA 2VFUA 1W1LA 3DQ0A 4ZOHB 3A7RA 1VAOA 4BC9A 2R2ZA 1X2GA 1MBBA 3NVWB 2BVHA 5G5GB 3I99A 2P3HA 1VDVA 3AM9A 1W1RA 3A7AA 2GQUA 4O95A 1E8GA 2W55A 1WVEA 1F0XA 3B9JB 3D2JA 1FO4A 3NS1B 1ZR6A 1W1MA 1AHVA 1W1JA 2QPMA 2W3RA 5HMRA 4UD8A 1E8HA 2BVFA 3TX1A 1ZXIC 3LAEA 2VFRA 3TSJA 2VFTA 1AHZA 5HHZA 1N5WC 2GQTA
chains in the Genus database with same CATH superfamily
3UJ2A 3RO6A 4GRTA 3EJDB 4ZA0A 3W8XA 2V3BA 4HPNA 1ZY8A 1MRAA 1SB3B 2P8CA 5JCMA 2GR2A 2OQYA 3L8KA 3QFBA 1XDIA 3T6CA 5ENLA 3ZVHA 2X8GA 2AXRA 3PK7A 5L6FA 1MNSA 1FEBA 4HYRA 2AKMA 1EC7A 2PCEA 1FECA 3DFYA 1WVFA 3NRZB 1RM6B 2XH0A 3SN4A 1GRHA 3VCCA 1FFVC 5JCLA 4Z1YA 1F9CA 2WPEA 2OAIA 1W1QA 3RNMA 2P3ZA 2TPRA 4F4RA 1TKKA 1N5XA 1KKOA 3DGHA 3R10A 1GV4A 2GL5A 2EQ9A 4PWCA 2V6OA 3EKGA 3D2HA 2BVGA 3W8ZA 3CT2A 2PA6A 3I4KA 1N62C 1NPXA 3RCYA 3VDGA 1FHUA 2ZZCA 2PODA 4HG0A 2GH5A 4G8TA 2NQWA 1KKRA 1AOGA 2E5AA 3FW8A 1NELA 1KN0A 3FYYA 1MOKA 1XANA 3A7UA 3EJEB 2GGIA 3NVYB 2ZZBA 5FJTA 4H83A 1N63C 3IC9A 5AE2A 2I5QA 4HCDA 3UJEA 4OALA 4JB1A 2VFVA 5G5HB 3DG3A 3H4KA 3DJJA 5FXPA 3LXDA 5TR3A 5AWVA 5JRBA 2HQMA 1Q1WA 2Y4GA 3RRAA 1W1SA 3TW9A 3SQSA 2AL1A 2QDEA 2NVKX 2O56A 3A7RA 3DG6A 3ES7A 3P93A 1MO9A 3MKCA 1MBBA 4DHGA 2WOIA 2PTXA 3RJ8A 5G5GB 3UCDA 1JPMA 1PDYA 4HN8A 4FX9A 3THUA 3AM9A 3I6EA 3JVAA 1W1RA 1ECQA 3TWAA 4O95A 2GRTA 1ONFA 1WVEA 5FJPA 1GEUA 1P48A 1GREA 2J3NA 3B9JB 1JCTA 4YWSA 3PQBA 2P88A 3V4BA 3GY1A 3SSZA 5HMRA 2NPXA 3CXOA 5FS8A 2AL2A 4H4RA 3DFHA 3D46A 1RVKA 1GRGA 3ZVHB 2WP5A 2VFTA 5BOEA 1AHZA 2CFYA 2ZC8A 4H2HA 3PWIA 3CGCA 3TSHA 2PU1A 2RABA 3UJFA 2MNRA 4M6UA 2R8DA 3BJSA 3K1GA 1DZNA 2XH2A 4MMWA 3W8WA 1ELSA 2YVFA 2O3GA 1GRAA 4EC3A 4E8GA 3GRTA 4H4TA 1QLUA 3DH9A 5D79A 3QKEA 4EMJA 3PM9A 2OO6A 3NZGA 2I0KA 2PP3A 3CYJA 4IP5A 2W3SA 5FJUA 3FW7A 5AE3A 1JEHA 2OVLA 4PVJA 2PSNA 4MKSA 2HZGA 5IDZA 3GSYA 6ENLA 2PLIA 2OKTA 3OW1A 4PWBA 5FS6A 1L8PA 2QGYA 3NVVB 1MDLA 3KLJA 3EUB3 3I6TA 3LADA 4LIIA 3SR6B 3Q4DA 4EM3A 1E8FA 3MSYA 4NEWA 2OZ3A 2WBAA 2YVSA 3NVZB 2PTZA 3VC5A 5U1OA 4M52A 3HW2A 4BURA 2Y3RA 2Q85A 3NXLA 3EANA 3OZYA 3DK9A 3PG6A 3BW7A 3RGTA 4IHCA 1JDFA 4YWOA 4JAYA 1NHSA 3IJQA 5K8EA 1AHUA 1UXYA 1JROA 2W54A 1TZZA 2PTYA 4FP1A 5AE1A 1NU5A 4PVEA 3R25A 3UXLA 3H12A 3AMZA 2PU0A 2ONEA 3ENLA 3TOYA 4ADWA 2VAOA 3HRDC 4IP4A 2UUUA 2XH4A 3UXKA 4M0XA 3GD3A 1WUEA 2GGGA 3R07C 3ZLFA 4HCLA 2PTWA 4JHMA 4ML8A 1X2HA 2XGZA 2AAQA 4PZFA 2X50A 3TWBA 3VCNA 2R9ZA 3OP2A 4KEMA 3S1CA 4ENLA 3Q45A 3RITA 3O0HA 3SJNA 5FXEA 3FWAA 3QN3A 4PYTA 2YQUA 2CDUA 3VTEA 3P3BA 3UCCA 1E0YA 3II4A 2EQ6A 1PDZA 5FS7A 4DXKA 3ZLHA 1VAOA 4BC9A 5I1WA 2AL2B 3QTPA 3NVWB 3EJBB 3I99A 4H4QA 4FDCB 4K1WA 1FEAA 3FV9A 2P3HA 1VDVA 2CHRA 1ZX9A 2X8HA 3D9XA 1FHVA 4GYPA 3FCPA 3CGBA 3STPA 3GD4A 1W6TA 5KVIA 1W1JA 1NHPA 2QPMA 4EWJA 1E8HA 2BVFA 3TX1A 1GERA 3TSJA 2AKZA 2JK6A 1NDAA 3N4FA 3RR1A 3FXGA 4GR1A 4DN1A 3TCSA 3FJ4A 2X8CA 4JN7A 1SJDA 2EQ8A 2P8BA 3IJLA 2PP1A 3OZMA 4E4UA 3U4FA 1FFUC 3R0KA 4HNCA 2WP6A 2OLAA 2VFSA 3UGVA 2YAUA 1FIQB 3ETRB 4DNSA 3GRSA 1N60C 3T4WA 4XLOA 1OEPA 5I1VA 1ZMCA 1STZA 1DXLA 2EXRA 4BV6A 4IL0A 2QVHA 5HQXA 1XHCA 4GGHA 4K7ZA 3S5SA 1DIIA 3UJRA 3DEDA 4JQ9A 1MBTA 4BC7A 1TYTA 3S1EA 1DIQA 4H4XA 3OPSA 1DNCA 4TVYA 3D47A 2RDXA 3SN0A 1E9IA 4Z17A 4PVKA 3DGBA 1GRFA 1GRTA 5FMHA 2BC1A 1JOAA 3DERA 4H4SA 1LVLA 3S47A 1TYPA 4G7FA 3V5FA 2BCPA 2DW6A 4JN8A 1R0MA 4A35A 3N6JA 3ZVIA 2FKPA 1KCZA 3EF6A 3HSUA 2GGEA 3MY9A 1Q1RA 2HXTA 1V97A 2YVJA 3R11A 2P0IA 3H8AA 3QLDA 4GFIA 2EQ7A 3PFRA 4E6MA 4DYEA 2MBRA 5FJOA 1GRBA 4DNAA 3UJSA 1P43A 1ZKQA 2QJJA 3SN1A 2WOWA 2GGJA 3N6HA 2OG9A 1EBDA 2HXUA 2GSHA 4E4FA 5J04A 1WUFA 4FI4A 2GDQA 3CGEA 3FVDA 1ZMDA 1MDRA 4K8DA 3C0PA 3CAWA 3POPA 3U9IA 4A3RA 1BZLA 4GGBA 3CB3A 1I19A 4A6GA 4EQXA 3QFAA 1EBGA 5FXFA 2X99A 3BOXA 4GYPC 2E3TA 4KPLA 5JCNA 4MLAA 3EAOA 5FS9A 4IZGA 3R0UA 1VQZA 2XH7A 3AN1A 4GMEA 3LLBA 3DDMA 1YQZA 4J56A 1LPFA 3IJIA 4IT1A 1SJCA 5EU9A 4H4YA 4ZOHB 2MUCA 3JZUA 1SJAA 5KVHA 3Q6JA 3TQPA 2R2ZA 5L6GA 4NEVA 4MGGA 3SQPA 2GQUA 3EEZA 4ROPA 2POZA 2W55A 1F0XA 1EBHA 3D2JA 2W0HA 3NS1B 3DK8A 1W1MA 1S7MA 3TTEA 1ONEA 3BSMA 3MUCA 1NHRA 2W3RA 2QDDA 2FYMA 1ZXIC 1ZK7A 4X2PA 4EMIA 2VFRA 4EQWA 5HHZA 2PGWA 2GR0A 1N5WC 3MZNA 2C3DA 1D7YA 2BC0A 1GXFA 4ZCWA 2GR3A 4EQRA 2GGHA 4JDRA 1JRPA 1JPDX 1TE6A 2P13A 1T3QC 1OJTA 5FJRA 4GISA 5EBKA 1YEYA 5GRTA 2UUVA 2GR1A 3D2DA 2RK5A 2OZTA 3H70A 4DWDA 4DX3A 2DW7A 3CGDA 1F8WA 1SJBA 3IK4A 1EC8A 4BCAA 4BBYA 4H1ZA 4K8GA 1F3PA 2Y3SA 3T8QA 3MQTA 1DTNA 1QLTA 5ER0A 4PVHA 5U25A 3S1DA 3JS8A 5FXDA 3T9PA 1HSKA 1N61C 1GETA 3KJMA 3L5OA 4H50A 4KT2A 2HNEA 2PLSA 3FW9A 1KD0A 1M6IA 4J3ZA 2GQWA 2QJNA 5JCKA 2OX4A 4KPRA 2Q4WA 3JW7A 4GIRA 3DGZA 4J57A 2WDWA 3DK4A 3GO2A 1XPYA 3PWGA 3RJAA 3S1FA 3OC4A 1H2IA 3NO1A 1R6WA 3P0WA 3R1ZA 3ZLGA 4E5TA 1WYGA 3N4EA 1GESA 2PS2A 3GD6A 2QKNA 3DESA 3DG7A 4APNA 3V3WA 4H4VA 5JCIA 3GC2A 1MUCA 4EMWA 4IL2A 3HPFA 3TJ4A 2Y08A 4K2SA 3DJGX 2PPGA 2ZZ0A 4H4WA 3MWCA 4H4ZA 2C3CA 3VA8A 3B97A 2OQHA 3VFCA 2PGEA 1NHQA 1XS2A 4TVWA 2OPJA 2NQLA 2V3AA 2ZADA 3H7VA 3CXBA 4J1OA 3QPEA 1W1OA 3KUMA 1EC9A 1W1KA 4KWSA 5BOFA 1BKHA 2P4PA 2PP0A 3OTRA 4EM4A 3DIPA 2IPIA 5ADZA 2VFUA 2QJMA 1K4QA 1W1LA 2WOVA 1IYXA 3DQ0A 1V59A 2OZ8A 4EQSA 3V5CA 1X2GA 1BWCA 4H19A 2QAEA 3SBFA 2BVHA 3LB8A 1GSNA 3FG2P 3A7AA 2QQ6A 1E8GA 7ENLA 4LA1A 2WPCA 4H4UA 1H6VA 3NFUA 4H4PA 1FO4A 1ZR6A 1AHVA 4HCHA 4HNLA 1ZDLA 3URHA 3VC6A 2A8XA 2YVGA 4UD8A 2PMQA 2WPFA 3LAEA 3DEQA 3CK5A 2XSXA 3TJIA 1BQGA 2OFJA 2F5ZA 2GQTA 3ES8A
chains in the Genus database with same CATH topology
3TSHA 2R8DA 2P13A 1JRPA 1DZNA 1T3QC 3W8XA 3W8WA 2UUVA 2O3GA 1FFUC 1SB3B 3D2DA 2RK5A 4EC3A 2VFSA 1QLUA 5D79A 1FIQB 3ETRB 4DNSA 1N60C 3PM9A 4XLOA 5I1VA 2I0KA 2AXRA 5L6FA 4BCAA 2EXRA 4BBYA 2Y3SA 5HQXA 2W3SA 3FW7A 5AE3A 1DIIA 4PVJA 3DEDA 1WVFA 1MBTA 3GSYA 3NRZB 4BC7A 1RM6B 2PLIA 3S1EA 4PWBA 1QLTA 1DIQA 1FFVC 3NVVB 3EUB3 4PVHA 4TVYA 3SR6B 3S1DA 3JS8A 5FXDA 2OAIA 1E8FA 1W1QA 4PVKA 1HSKA 3NVZB 1N61C 2YVSA 3KJMA 1N5XA 2PLSA 3FW9A 2Y3RA 2Q85A 3BW7A 4PWCA 2Q4WA 3D2HA 2BVGA 3HSUA 3W8ZA 2WDWA 4JAYA 5K8EA 1N62C 1AHUA 1V97A 3S1FA 3RJAA 1UXYA 1JROA 2W54A 1WYGA 2MBRA 5AE1A 4PVEA 2QKNA 3AMZA 4HG0A 2NQWA 2VAOA 2Y08A 2E5AA 3HRDC 3FW8A 2UUUA 3A7UA 3NVYB 3R07C 3C0PA 1N63C 4ML8A 1X2HA 5AE2A 3POPA 4PZFA 1I19A 4OALA 4TVWA 4JB1A 2VFVA 5G5HB 3S1CA 5FXFA 2E3TA 5FXPA 1W1OA 5AWVA 5FXEA 3FWAA 4MLAA 1W1KA 4PYTA 2P4PA 1VQZA 2Y4GA 3AN1A 3LLBA 1W1SA 2IPIA 5ADZA 3VTEA 1E0YA 2VFUA 1W1LA 3DQ0A 4ZOHB 3A7RA 1VAOA 4BC9A 5I1WA 2R2ZA 1X2GA 1MBBA 3NVWB 2BVHA 3RJ8A 5G5GB 3I99A 5L6GA 2P3HA 1VDVA 3AM9A 1W1RA 3A7AA 2GQUA 4O95A 1E8GA 2W55A 1WVEA 1F0XA 3B9JB 3PQBA 3D2JA 1FO4A 3NS1B 1ZR6A 1W1MA 1AHVA 1W1JA 2QPMA 2W3RA 5HMRA 4UD8A 1E8HA 2BVFA 3TX1A 1ZXIC 3LAEA 2VFRA 3TSJA 2VFTA 1AHZA 5HHZA 1N5WC 2GQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSH A;  2R8D A;  2P13 A;  1JRP A;  1DZN A;  1T3Q C;  3W8X A;  3W8W A;  2O3G A;  1FFU C;  1SB3 B;  3D2D A;  2RK5 A;  4EC3 A;  2VFS A;  1QLU A;  5D79 A;  1FIQ B;  3ETR B;  4DNS A;  1N60 C;  3PM9 A;  4XLO A;  2I0K A;  2AXR A;  4BCA A;  2EXR A;  4BBY A;  5HQX A;  2W3S A;  3FW7 A;  5AE3 A;  1DII A;  4PVJ A;  3DED A;  1WVF A;  1MBT A;  3GSY A;  3NRZ B;  4BC7 A;  1RM6 B;  2PLI A;  3S1E A;  4PWB A;  1QLT A;  1DIQ A;  1FFV C;  3NVV B;  3EUB 3;  4PVH A;  4TVY A;  3SR6 B;  3S1D A;  3JS8 A;  5FXD A;  2OAI A;  1E8F A;  1W1Q A;  4PVK A;  1HSK A;  3NVZ B;  1N61 C;  2YVS A;  3KJM A;  1N5X A;  2PLS A;  3FW9 A;  2Q85 A;  3BW7 A;  4PWC A;  2Q4W A;  3D2H A;  2BVG A;  3W8Z A;  4JAY A;  1N62 C;  1AHU A;  1V97 A;  3S1F A;  1UXY A;  1JRO A;  2W54 A;  1WYG A;  2MBR A;  5AE1 A;  4PVE A;  2QKN A;  3AMZ A;  4HG0 A;  2NQW A;  2VAO A;  2E5A A;  3HRD C;  3FW8 A;  3A7U A;  3NVY B;  3R07 C;  3C0P A;  1N63 C;  4ML8 A;  1X2H A;  5AE2 A;  4PZF A;  1I19 A;  4OAL A;  4TVW A;  4JB1 A;  2VFV A;  5G5H B;  3S1C A;  5FXF A;  2E3T A;  5FXP A;  1W1O A;  5FXE A;  3FWA A;  4MLA A;  1W1K A;  4PYT A;  2P4P A;  1VQZ A;  3AN1 A;  3LLB A;  1W1S A;  5ADZ A;  3VTE A;  1E0Y A;  2VFU A;  1W1L A;  3DQ0 A;  4ZOH B;  3A7R A;  1VAO A;  4BC9 A;  2R2Z A;  1X2G A;  1MBB A;  3NVW B;  2BVH A;  5G5G B;  3I99 A;  2P3H A;  1VDV A;  3AM9 A;  1W1R A;  3A7A A;  2GQU A;  4O95 A;  1E8G A;  2W55 A;  1WVE A;  1F0X A;  3B9J B;  3D2J A;  1FO4 A;  3NS1 B;  1ZR6 A;  1W1M A;  1AHV A;  1W1J A;  2QPM A;  2W3R A;  5HMR A;  4UD8 A;  1E8H A;  2BVF A;  3TX1 A;  1ZXI C;  3LAE A;  2VFR A;  3TSJ A;  2VFT A;  1AHZ A;  5HHZ A;  1N5W C;  2GQT A; 
#chains in the Genus database with same CATH topology
 3UJ2 A;  3RO6 A;  4GRT A;  3EJD B;  4ZA0 A;  3W8X A;  2V3B A;  4HPN A;  1ZY8 A;  1MRA A;  1SB3 B;  2P8C A;  5JCM A;  2GR2 A;  2OQY A;  3L8K A;  3QFB A;  1XDI A;  3T6C A;  5ENL A;  3ZVH A;  2X8G A;  2AXR A;  3PK7 A;  5L6F A;  1MNS A;  1FEB A;  4HYR A;  2AKM A;  1EC7 A;  2PCE A;  1FEC A;  3DFY A;  1WVF A;  3NRZ B;  1RM6 B;  2XH0 A;  3SN4 A;  1GRH A;  3VCC A;  1FFV C;  5JCL A;  4Z1Y A;  1F9C A;  2WPE A;  2OAI A;  1W1Q A;  3RNM A;  2P3Z A;  2TPR A;  4F4R A;  1TKK A;  1N5X A;  1KKO A;  3DGH A;  3R10 A;  1GV4 A;  2GL5 A;  2EQ9 A;  4PWC A;  2V6O A;  3EKG A;  3D2H A;  2BVG A;  3W8Z A;  3CT2 A;  2PA6 A;  3I4K A;  1N62 C;  1NPX A;  3RCY A;  3VDG A;  1FHU A;  2ZZC A;  2POD A;  4HG0 A;  2GH5 A;  4G8T A;  2NQW A;  1KKR A;  1AOG A;  2E5A A;  3FW8 A;  1NEL A;  1KN0 A;  3FYY A;  1MOK A;  1XAN A;  3A7U A;  3EJE B;  2GGI A;  3NVY B;  2ZZB A;  5FJT A;  4H83 A;  1N63 C;  3IC9 A;  5AE2 A;  2I5Q A;  4HCD A;  3UJE A;  4OAL A;  4JB1 A;  2VFV A;  5G5H B;  3DG3 A;  3H4K A;  3DJJ A;  5FXP A;  3LXD A;  5TR3 A;  5AWV A;  5JRB A;  2HQM A;  1Q1W A;  2Y4G A;  3RRA A;  1W1S A;  3TW9 A;  3SQS A;  2AL1 A;  2QDE A;  2NVK X;  2O56 A;  3A7R A;  3DG6 A;  3ES7 A;  3P93 A;  1MO9 A;  3MKC A;  1MBB A;  4DHG A;  2WOI A;  2PTX A;  3RJ8 A;  5G5G B;  3UCD A;  1JPM A;  1PDY A;  4HN8 A;  4FX9 A;  3THU A;  3AM9 A;  3I6E A;  3JVA A;  1W1R A;  1ECQ A;  3TWA A;  4O95 A;  2GRT A;  1ONF A;  1WVE A;  5FJP A;  1GEU A;  1P48 A;  1GRE A;  2J3N A;  3B9J B;  1JCT A;  4YWS A;  3PQB A;  2P88 A;  3V4B A;  3GY1 A;  3SSZ A;  5HMR A;  2NPX A;  3CXO A;  5FS8 A;  2AL2 A;  4H4R A;  3DFH A;  3D46 A;  1RVK A;  1GRG A;  3ZVH B;  2WP5 A;  2VFT A;  5BOE A;  1AHZ A;  2CFY A;  2ZC8 A;  4H2H A;  3PWI A;  3CGC A;  3TSH A;  2PU1 A;  2RAB A;  3UJF A;  2MNR A;  4M6U A;  2R8D A;  3BJS A;  3K1G A;  1DZN A;  2XH2 A;  4MMW A;  3W8W A;  1ELS A;  2YVF A;  2O3G A;  1GRA A;  4EC3 A;  4E8G A;  3GRT A;  4H4T A;  1QLU A;  3DH9 A;  5D79 A;  3QKE A;  4EMJ A;  3PM9 A;  2OO6 A;  3NZG A;  2I0K A;  2PP3 A;  3CYJ A;  4IP5 A;  2W3S A;  5FJU A;  3FW7 A;  5AE3 A;  1JEH A;  2OVL A;  4PVJ A;  2PSN A;  4MKS A;  2HZG A;  5IDZ A;  3GSY A;  6ENL A;  2PLI A;  2OKT A;  3OW1 A;  4PWB A;  5FS6 A;  1L8P A;  2QGY A;  3NVV B;  1MDL A;  3KLJ A;  3EUB 3;  3I6T A;  3LAD A;  4LII A;  3SR6 B;  3Q4D A;  4EM3 A;  1E8F A;  3MSY A;  4NEW A;  2OZ3 A;  2WBA A;  2YVS A;  3NVZ B;  2PTZ A;  3VC5 A;  5U1O A;  4M52 A;  3HW2 A;  4BUR A;  2Y3R A;  2Q85 A;  3NXL A;  3EAN A;  3OZY A;  3DK9 A;  3PG6 A;  3BW7 A;  3RGT A;  4IHC A;  1JDF A;  4YWO A;  4JAY A;  1NHS A;  3IJQ A;  5K8E A;  1AHU A;  1UXY A;  1JRO A;  2W54 A;  1TZZ A;  2PTY A;  4FP1 A;  5AE1 A;  1NU5 A;  4PVE A;  3R25 A;  3UXL A;  3H12 A;  3AMZ A;  2PU0 A;  2ONE A;  3ENL A;  3TOY A;  4ADW A;  2VAO A;  3HRD C;  4IP4 A;  2UUU A;  2XH4 A;  3UXK A;  4M0X A;  3GD3 A;  1WUE A;  2GGG A;  3R07 C;  3ZLF A;  4HCL A;  2PTW A;  4JHM A;  4ML8 A;  1X2H A;  2XGZ A;  2AAQ A;  4PZF A;  2X50 A;  3TWB A;  3VCN A;  2R9Z A;  3OP2 A;  4KEM A;  3S1C A;  4ENL A;  3Q45 A;  3RIT A;  3O0H A;  3SJN A;  5FXE A;  3FWA A;  3QN3 A;  4PYT A;  2YQU A;  2CDU A;  3VTE A;  3P3B A;  3UCC A;  1E0Y A;  3II4 A;  2EQ6 A;  1PDZ A;  5FS7 A;  4DXK A;  3ZLH A;  1VAO A;  4BC9 A;  5I1W A;  2AL2 B;  3QTP A;  3NVW B;  3EJB B;  3I99 A;  4H4Q A;  4FDC B;  4K1W A;  1FEA A;  3FV9 A;  2P3H A;  1VDV A;  2CHR A;  1ZX9 A;  2X8H A;  3D9X A;  1FHV A;  4GYP A;  3FCP A;  3CGB A;  3STP A;  3GD4 A;  1W6T A;  5KVI A;  1W1J A;  1NHP A;  2QPM A;  4EWJ A;  1E8H A;  2BVF A;  3TX1 A;  1GER A;  3TSJ A;  2AKZ A;  2JK6 A;  1NDA A;  3N4F A;  3RR1 A;  3FXG A;  4GR1 A;  4DN1 A;  3TCS A;  3FJ4 A;  2X8C A;  4JN7 A;  1SJD A;  2EQ8 A;  2P8B A;  3IJL A;  2PP1 A;  3OZM A;  4E4U A;  3U4F A;  1FFU C;  3R0K A;  4HNC A;  2WP6 A;  2OLA A;  2VFS A;  3UGV A;  2YAU A;  1FIQ B;  3ETR B;  4DNS A;  3GRS A;  1N60 C;  3T4W A;  4XLO A;  1OEP A;  5I1V A;  1ZMC A;  1STZ A;  1DXL A;  2EXR A;  4BV6 A;  4IL0 A;  2QVH A;  5HQX A;  1XHC A;  4GGH A;  4K7Z A;  3S5S A;  1DII A;  3UJR A;  3DED A;  4JQ9 A;  1MBT A;  4BC7 A;  1TYT A;  3S1E A;  1DIQ A;  4H4X A;  3OPS A;  1DNC A;  4TVY A;  3D47 A;  2RDX A;  3SN0 A;  1E9I A;  4Z17 A;  4PVK A;  3DGB A;  1GRF A;  1GRT A;  5FMH A;  2BC1 A;  1JOA A;  3DER A;  4H4S A;  1LVL A;  3S47 A;  1TYP A;  4G7F A;  3V5F A;  2BCP A;  2DW6 A;  4JN8 A;  1R0M A;  4A35 A;  3N6J A;  3ZVI A;  2FKP A;  1KCZ A;  3EF6 A;  3HSU A;  2GGE A;  3MY9 A;  1Q1R A;  2HXT A;  1V97 A;  2YVJ A;  3R11 A;  2P0I A;  3H8A A;  3QLD A;  4GFI A;  2EQ7 A;  3PFR A;  4E6M A;  4DYE A;  2MBR A;  5FJO A;  1GRB A;  4DNA A;  3UJS A;  1P43 A;  1ZKQ A;  2QJJ A;  3SN1 A;  2WOW A;  2GGJ A;  3N6H A;  2OG9 A;  1EBD A;  2HXU A;  2GSH A;  4E4F A;  5J04 A;  1WUF A;  4FI4 A;  2GDQ A;  3CGE A;  3FVD A;  1ZMD A;  1MDR A;  4K8D A;  3C0P A;  3CAW A;  3POP A;  3U9I A;  4A3R A;  1BZL A;  4GGB A;  3CB3 A;  1I19 A;  4A6G A;  4EQX A;  3QFA A;  1EBG A;  5FXF A;  2X99 A;  3BOX A;  4GYP C;  2E3T A;  4KPL A;  5JCN A;  4MLA A;  3EAO A;  5FS9 A;  4IZG A;  3R0U A;  1VQZ A;  2XH7 A;  3AN1 A;  4GME A;  3LLB A;  3DDM A;  1YQZ A;  4J56 A;  1LPF A;  3IJI A;  4IT1 A;  1SJC A;  5EU9 A;  4H4Y A;  4ZOH B;  2MUC A;  3JZU A;  1SJA A;  5KVH A;  3Q6J A;  3TQP A;  2R2Z A;  5L6G A;  4NEV A;  4MGG A;  3SQP A;  2GQU A;  3EEZ A;  4ROP A;  2POZ A;  2W55 A;  1F0X A;  1EBH A;  3D2J A;  2W0H A;  3NS1 B;  3DK8 A;  1W1M A;  1S7M A;  3TTE A;  1ONE A;  3BSM A;  3MUC A;  1NHR A;  2W3R A;  2QDD A;  2FYM A;  1ZXI C;  1ZK7 A;  4X2P A;  4EMI A;  2VFR A;  4EQW A;  5HHZ A;  2PGW A;  2GR0 A;  1N5W C;  3MZN A;  2C3D A;  1D7Y A;  2BC0 A;  1GXF A;  4ZCW A;  2GR3 A;  4EQR A;  2GGH A;  4JDR A;  1JRP A;  1JPD X;  1TE6 A;  2P13 A;  1T3Q C;  1OJT A;  5FJR A;  4GIS A;  5EBK A;  1YEY A;  5GRT A;  2UUV A;  2GR1 A;  3D2D A;  2RK5 A;  2OZT A;  3H70 A;  4DWD A;  4DX3 A;  2DW7 A;  3CGD A;  1F8W A;  1SJB A;  3IK4 A;  1EC8 A;  4BCA A;  4BBY A;  4H1Z A;  4K8G A;  1F3P A;  2Y3S A;  3T8Q A;  3MQT A;  1DTN A;  1QLT A;  5ER0 A;  4PVH A;  5U25 A;  3S1D A;  3JS8 A;  5FXD A;  3T9P A;  1HSK A;  1N61 C;  1GET A;  3KJM A;  3L5O A;  4H50 A;  4KT2 A;  2HNE A;  2PLS A;  3FW9 A;  1KD0 A;  1M6I A;  4J3Z A;  2GQW A;  2QJN A;  5JCK A;  2OX4 A;  4KPR A;  2Q4W A;  3JW7 A;  4GIR A;  3DGZ A;  4J57 A;  2WDW A;  3DK4 A;  3GO2 A;  1XPY A;  3PWG A;  3RJA A;  3S1F A;  3OC4 A;  1H2I A;  3NO1 A;  1R6W A;  3P0W A;  3R1Z A;  3ZLG A;  4E5T A;  1WYG A;  3N4E A;  1GES A;  2PS2 A;  3GD6 A;  2QKN A;  3DES A;  3DG7 A;  4APN A;  3V3W A;  4H4V A;  5JCI A;  3GC2 A;  1MUC A;  4EMW A;  4IL2 A;  3HPF A;  3TJ4 A;  2Y08 A;  4K2S A;  3DJG X;  2PPG A;  2ZZ0 A;  4H4W A;  3MWC A;  4H4Z A;  2C3C A;  3VA8 A;  3B97 A;  2OQH A;  3VFC A;  2PGE A;  1NHQ A;  1XS2 A;  4TVW A;  2OPJ A;  2NQL A;  2V3A A;  2ZAD A;  3H7V A;  3CXB A;  4J1O A;  3QPE A;  1W1O A;  3KUM A;  1EC9 A;  1W1K A;  4KWS A;  5BOF A;  1BKH A;  2P4P A;  2PP0 A;  3OTR A;  4EM4 A;  3DIP A;  2IPI A;  5ADZ A;  2VFU A;  2QJM A;  1K4Q A;  1W1L A;  2WOV A;  1IYX A;  3DQ0 A;  1V59 A;  2OZ8 A;  4EQS A;  3V5C A;  1X2G A;  1BWC A;  4H19 A;  2QAE A;  3SBF A;  2BVH A;  3LB8 A;  1GSN A;  3FG2 P;  3A7A A;  2QQ6 A;  1E8G A;  7ENL A;  4LA1 A;  2WPC A;  4H4U A;  1H6V A;  3NFU A;  4H4P A;  1FO4 A;  1ZR6 A;  1AHV A;  4HCH A;  4HNL A;  1ZDL A;  3URH A;  3VC6 A;  2A8X A;  2YVG A;  4UD8 A;  2PMQ A;  2WPF A;  3LAE A;  3DEQ A;  3CK5 A;  2XSX A;  3TJI A;  1BQG A;  2OFJ A;  2F5Z A;  2GQT A;  3ES8 A; 
#chains in the Genus database with same CATH homology
 3TSH A;  2R8D A;  2P13 A;  1JRP A;  1DZN A;  1T3Q C;  3W8X A;  3W8W A;  2UUV A;  2O3G A;  1FFU C;  1SB3 B;  3D2D A;  2RK5 A;  4EC3 A;  2VFS A;  1QLU A;  5D79 A;  1FIQ B;  3ETR B;  4DNS A;  1N60 C;  3PM9 A;  4XLO A;  5I1V A;  2I0K A;  2AXR A;  5L6F A;  4BCA A;  2EXR A;  4BBY A;  2Y3S A;  5HQX A;  2W3S A;  3FW7 A;  5AE3 A;  1DII A;  4PVJ A;  3DED A;  1WVF A;  1MBT A;  3GSY A;  3NRZ B;  4BC7 A;  1RM6 B;  2PLI A;  3S1E A;  4PWB A;  1QLT A;  1DIQ A;  1FFV C;  3NVV B;  3EUB 3;  4PVH A;  4TVY A;  3SR6 B;  3S1D A;  3JS8 A;  5FXD A;  2OAI A;  1E8F A;  1W1Q A;  4PVK A;  1HSK A;  3NVZ B;  1N61 C;  2YVS A;  3KJM A;  1N5X A;  2PLS A;  3FW9 A;  2Y3R A;  2Q85 A;  3BW7 A;  4PWC A;  2Q4W A;  3D2H A;  2BVG A;  3HSU A;  3W8Z A;  2WDW A;  4JAY A;  5K8E A;  1N62 C;  1AHU A;  1V97 A;  3S1F A;  3RJA A;  1UXY A;  1JRO A;  2W54 A;  1WYG A;  2MBR A;  5AE1 A;  4PVE A;  2QKN A;  3AMZ A;  4HG0 A;  2NQW A;  2VAO A;  2Y08 A;  2E5A A;  3HRD C;  3FW8 A;  2UUU A;  3A7U A;  3NVY B;  3R07 C;  3C0P A;  1N63 C;  4ML8 A;  1X2H A;  5AE2 A;  3POP A;  4PZF A;  1I19 A;  4OAL A;  4TVW A;  4JB1 A;  2VFV A;  5G5H B;  3S1C A;  5FXF A;  2E3T A;  5FXP A;  1W1O A;  5AWV A;  5FXE A;  3FWA A;  4MLA A;  1W1K A;  4PYT A;  2P4P A;  1VQZ A;  2Y4G A;  3AN1 A;  3LLB A;  1W1S A;  2IPI A;  5ADZ A;  3VTE A;  1E0Y A;  2VFU A;  1W1L A;  3DQ0 A;  4ZOH B;  3A7R A;  1VAO A;  4BC9 A;  5I1W A;  2R2Z A;  1X2G A;  1MBB A;  3NVW B;  2BVH A;  3RJ8 A;  5G5G B;  3I99 A;  5L6G A;  2P3H A;  1VDV A;  3AM9 A;  1W1R A;  3A7A A;  2GQU A;  4O95 A;  1E8G A;  2W55 A;  1WVE A;  1F0X A;  3B9J B;  3PQB A;  3D2J A;  1FO4 A;  3NS1 B;  1ZR6 A;  1W1M A;  1AHV A;  1W1J A;  2QPM A;  2W3R A;  5HMR A;  4UD8 A;  1E8H A;  2BVF A;  3TX1 A;  1ZXI C;  3LAE A;  2VFR A;  3TSJ A;  2VFT A;  1AHZ A;  5HHZ A;  1N5W C;  2GQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...