2P4PA

Crystal structure of a corc_hlyc domain from haemophilus ducreyi
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
84
structure length
78
Chain Sequence
NAMRRNEDSWLIDGATPLEDVMRALNIHTFPRDENYETIGGFMMYMLRIPTDFVLYDYFEIIDTENFRIDQLMVSFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a CorC_HlyC domain from Haemophilus ducreyi
rcsb
source organism Haemophilus ducreyi
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HD1797
total genus 9
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2p4pA00
1AHVA 1MBTA 1W1MA 1W1LA 3NVWB 3W8XA 3LAEA 1AHZA 3NRZB 1FFVC 1N5XA 2W55A 1UXYA 2OAIA 2PLSA 1MBBA 4OALA 3SR6B 4O95A 1W1JA 1N5WC 4JB1A 2YVSA 2MBRA 2P3HA 3ETRB 3NVZB 1E8HA 3DEDA 2Q4WA 2Q85A 2I0KA 5HHZA 1E8FA 1N61C 5FXEA 1HSKA 4PYTA 1E0YA 2R2ZA 2VFTA 1F0XA 1WVEA 3S1DA 4BC9A 1W1RA 1DIQA 2QKNA 3AMZA 3S1EA 4XLOA 2W54A 2VAOA 3B9JB 4MLAA 1FIQB 2O3GA 4BC7A 4BCAA 2EXRA 2E3TA 3JS8A 3KJMA 3NVVB 3W8ZA 1WVFA 2PLIA 4HG0A 5HMRA 5G5HB 1N63C 3LLBA 2VFRA 1W1QA 3NS1B 1T3QC 5HQXA 1SB3B 3W8WA 1DIIA 1N60C 1DZNA 3PM9A 3BW7A 1ZR6A 2BVGA 3DQ0A 2BVHA 1WYGA 5FXFA 3C0PA 5AE3A 1FO4A 2P4PA 1W1OA 1FFUC 1VDVA 1W1SA 3S1FA 4BBYA 1VAOA 5ADZA 4JAYA 3EUB3 3S1CA 1AHUA 3TX1A 1I19A 1QLUA 1ZXIC 2RK5A 2R8DA 5AE2A 2P13A 1E8GA 5AE1A 2QPMA 4ML8A 2BVFA 1W1KA 1QLTA 5FXPA 1V97A 1RM6B 3AN1A 1N62C 2W3SA 3HRDC 3I99A 2AXRA 5G5GB 2NQWA 1JRPA 2GQTA 2GQUA 3NVYB 1JROA 4ZOHB 5FXDA 2VFVA 3AM9A 2W3RA 2VFSA 2VFUA
chains in the Genus database with same CATH superfamily
1AHVA 1MBTA 1W1MA 1W1LA 3NVWB 3W8XA 3LAEA 1AHZA 3NRZB 1FFVC 1N5XA 2W55A 1UXYA 2OAIA 2PLSA 1MBBA 4OALA 3SR6B 4O95A 1W1JA 1N5WC 4JB1A 2YVSA 2MBRA 2P3HA 3ETRB 3NVZB 1E8HA 4PWBA 3PQBA 4PVKA 3DEDA 2Q4WA 4UD8A 2Q85A 3FW7A 2I0KA 5HHZA 1E8FA 1N61C 2UUUA 5FXEA 1HSKA 3GSYA 4PYTA 3FW8A 1E0YA 2R2ZA 2VFTA 2WDWA 1F0XA 1WVEA 3TSJA 2Y08A 3S1DA 4BC9A 1W1RA 1DIQA 3D2JA 2QKNA 3D2DA 3AMZA 3S1EA 4XLOA 2W54A 2VAOA 3B9JB 4MLAA 3POPA 1FIQB 2O3GA 4PVJA 4BC7A 4BCAA 2EXRA 2E3TA 4DNSA 3JS8A 3KJMA 3NVVB 3W8ZA 1WVFA 2PLIA 4HG0A 5HMRA 5G5HB 2UUVA 2Y3RA 1N63C 3LLBA 2VFRA 3TSHA 5AWVA 1W1QA 3NS1B 1T3QC 5HQXA 1SB3B 2Y4GA 3W8WA 1DIIA 3RJ8A 5L6GA 1N60C 1DZNA 3PM9A 3BW7A 1ZR6A 2BVGA 3DQ0A 2IPIA 2BVHA 1WYGA 5FXFA 3C0PA 5AE3A 1FO4A 2P4PA 1W1OA 1FFUC 1VDVA 1W1SA 3S1FA 4BBYA 1VAOA 5ADZA 3VTEA 4JAYA 3D2HA 3EUB3 5D79A 3S1CA 1AHUA 3TX1A 1I19A 3FW9A 4PVEA 1QLUA 1ZXIC 2RK5A 2R8DA 5AE2A 4PVHA 2P13A 5K8EA 1E8GA 3HSUA 5AE1A 2QPMA 4ML8A 2BVFA 1W1KA 1QLTA 4PZFA 5FXPA 1V97A 5I1VA 1RM6B 3AN1A 1N62C 2W3SA 3HRDC 3I99A 4PWCA 3RJAA 2AXRA 2Y3SA 2NQWA 5G5GB 1JRPA 2GQTA 2GQUA 4EC3A 5I1WA 3NVYB 1JROA 4ZOHB 5FXDA 2VFVA 3AM9A 2W3RA 3FWAA 5L6FA 2VFSA 2VFUA
chains in the Genus database with same CATH topology
1AHVA 1MBTA 1W1MA 1W1LA 3NVWB 3W8XA 3LAEA 1AHZA 3NRZB 1FFVC 1N5XA 2W55A 1UXYA 2OAIA 2PLSA 1MBBA 4OALA 3SR6B 4O95A 1W1JA 1N5WC 4JB1A 2YVSA 2MBRA 2P3HA 3ETRB 3NVZB 1E8HA 4PWBA 3PQBA 4PVKA 3DEDA 2Q4WA 4UD8A 2Q85A 3FW7A 2I0KA 5HHZA 1E8FA 1N61C 2UUUA 5FXEA 1HSKA 3GSYA 4PYTA 3FW8A 1E0YA 2R2ZA 2VFTA 2WDWA 1F0XA 1WVEA 3TSJA 2Y08A 3S1DA 4BC9A 1W1RA 1DIQA 3D2JA 2QKNA 3D2DA 3AMZA 3S1EA 4XLOA 2W54A 2VAOA 3B9JB 4MLAA 3POPA 1FIQB 2O3GA 4PVJA 4BC7A 4BCAA 2EXRA 2E3TA 4DNSA 3JS8A 3KJMA 3NVVB 3W8ZA 1WVFA 2PLIA 4HG0A 5HMRA 5G5HB 2UUVA 2Y3RA 1N63C 3LLBA 2VFRA 3TSHA 5AWVA 1W1QA 3NS1B 1T3QC 5HQXA 1SB3B 2Y4GA 3W8WA 1DIIA 3RJ8A 5L6GA 1N60C 1DZNA 3PM9A 3BW7A 1ZR6A 2BVGA 3DQ0A 2IPIA 2BVHA 1WYGA 5FXFA 3C0PA 5AE3A 1FO4A 2P4PA 1W1OA 1FFUC 1VDVA 1W1SA 3S1FA 4BBYA 1VAOA 5ADZA 3VTEA 4JAYA 3D2HA 3EUB3 5D79A 3S1CA 1AHUA 3TX1A 1I19A 3FW9A 4PVEA 1QLUA 1ZXIC 2RK5A 2R8DA 5AE2A 4PVHA 2P13A 5K8EA 1E8GA 3HSUA 5AE1A 2QPMA 4ML8A 2BVFA 1W1KA 1QLTA 4PZFA 5FXPA 1V97A 5I1VA 1RM6B 3AN1A 1N62C 2W3SA 3HRDC 3I99A 4PWCA 3RJAA 2AXRA 2Y3SA 2NQWA 5G5GB 1JRPA 2GQTA 2GQUA 4EC3A 5I1WA 3NVYB 1JROA 4ZOHB 5FXDA 2VFVA 3AM9A 2W3RA 3FWAA 5L6FA 2VFSA 2VFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHV A;  1MBT A;  1W1M A;  1W1L A;  3NVW B;  3W8X A;  3LAE A;  1AHZ A;  3NRZ B;  1FFV C;  1N5X A;  2W55 A;  1UXY A;  2OAI A;  2PLS A;  1MBB A;  4OAL A;  3SR6 B;  4O95 A;  1W1J A;  1N5W C;  4JB1 A;  2YVS A;  2MBR A;  2P3H A;  3ETR B;  3NVZ B;  1E8H A;  3DED A;  2Q4W A;  2Q85 A;  2I0K A;  5HHZ A;  1E8F A;  1N61 C;  5FXE A;  1HSK A;  4PYT A;  1E0Y A;  2R2Z A;  2VFT A;  1F0X A;  1WVE A;  3S1D A;  4BC9 A;  1W1R A;  1DIQ A;  2QKN A;  3AMZ A;  3S1E A;  4XLO A;  2W54 A;  2VAO A;  3B9J B;  4MLA A;  1FIQ B;  2O3G A;  4BC7 A;  4BCA A;  2EXR A;  2E3T A;  3JS8 A;  3KJM A;  3NVV B;  3W8Z A;  1WVF A;  2PLI A;  4HG0 A;  5HMR A;  5G5H B;  1N63 C;  3LLB A;  2VFR A;  1W1Q A;  3NS1 B;  1T3Q C;  5HQX A;  1SB3 B;  3W8W A;  1DII A;  1N60 C;  1DZN A;  3PM9 A;  3BW7 A;  1ZR6 A;  2BVG A;  3DQ0 A;  2BVH A;  1WYG A;  5FXF A;  3C0P A;  5AE3 A;  1FO4 A;  2P4P A;  1W1O A;  1FFU C;  1VDV A;  1W1S A;  3S1F A;  4BBY A;  1VAO A;  5ADZ A;  4JAY A;  3EUB 3;  3S1C A;  1AHU A;  3TX1 A;  1I19 A;  1QLU A;  1ZXI C;  2RK5 A;  2R8D A;  5AE2 A;  2P13 A;  1E8G A;  5AE1 A;  2QPM A;  4ML8 A;  2BVF A;  1W1K A;  1QLT A;  5FXP A;  1V97 A;  1RM6 B;  3AN1 A;  1N62 C;  2W3S A;  3HRD C;  3I99 A;  2AXR A;  5G5G B;  2NQW A;  1JRP A;  2GQT A;  2GQU A;  3NVY B;  1JRO A;  4ZOH B;  5FXD A;  2VFV A;  3AM9 A;  2W3R A;  2VFS A;  2VFU A; 
#chains in the Genus database with same CATH topology
 1AHV A;  1MBT A;  1W1M A;  1W1L A;  3NVW B;  3W8X A;  3LAE A;  1AHZ A;  3NRZ B;  1FFV C;  1N5X A;  2W55 A;  1UXY A;  2OAI A;  2PLS A;  1MBB A;  4OAL A;  3SR6 B;  4O95 A;  1W1J A;  1N5W C;  4JB1 A;  2YVS A;  2MBR A;  2P3H A;  3ETR B;  3NVZ B;  1E8H A;  4PWB A;  3PQB A;  4PVK A;  3DED A;  2Q4W A;  4UD8 A;  2Q85 A;  3FW7 A;  2I0K A;  5HHZ A;  1E8F A;  1N61 C;  2UUU A;  5FXE A;  1HSK A;  3GSY A;  4PYT A;  3FW8 A;  1E0Y A;  2R2Z A;  2VFT A;  2WDW A;  1F0X A;  1WVE A;  3TSJ A;  2Y08 A;  3S1D A;  4BC9 A;  1W1R A;  1DIQ A;  3D2J A;  2QKN A;  3D2D A;  3AMZ A;  3S1E A;  4XLO A;  2W54 A;  2VAO A;  3B9J B;  4MLA A;  3POP A;  1FIQ B;  2O3G A;  4PVJ A;  4BC7 A;  4BCA A;  2EXR A;  2E3T A;  4DNS A;  3JS8 A;  3KJM A;  3NVV B;  3W8Z A;  1WVF A;  2PLI A;  4HG0 A;  5HMR A;  5G5H B;  2UUV A;  2Y3R A;  1N63 C;  3LLB A;  2VFR A;  3TSH A;  5AWV A;  1W1Q A;  3NS1 B;  1T3Q C;  5HQX A;  1SB3 B;  2Y4G A;  3W8W A;  1DII A;  3RJ8 A;  5L6G A;  1N60 C;  1DZN A;  3PM9 A;  3BW7 A;  1ZR6 A;  2BVG A;  3DQ0 A;  2IPI A;  2BVH A;  1WYG A;  5FXF A;  3C0P A;  5AE3 A;  1FO4 A;  2P4P A;  1W1O A;  1FFU C;  1VDV A;  1W1S A;  3S1F A;  4BBY A;  1VAO A;  5ADZ A;  3VTE A;  4JAY A;  3D2H A;  3EUB 3;  5D79 A;  3S1C A;  1AHU A;  3TX1 A;  1I19 A;  3FW9 A;  4PVE A;  1QLU A;  1ZXI C;  2RK5 A;  2R8D A;  5AE2 A;  4PVH A;  2P13 A;  5K8E A;  1E8G A;  3HSU A;  5AE1 A;  2QPM A;  4ML8 A;  2BVF A;  1W1K A;  1QLT A;  4PZF A;  5FXP A;  1V97 A;  5I1V A;  1RM6 B;  3AN1 A;  1N62 C;  2W3S A;  3HRD C;  3I99 A;  4PWC A;  3RJA A;  2AXR A;  2Y3S A;  2NQW A;  5G5G B;  1JRP A;  2GQT A;  2GQU A;  4EC3 A;  5I1W A;  3NVY B;  1JRO A;  4ZOH B;  5FXD A;  2VFV A;  3AM9 A;  2W3R A;  3FWA A;  5L6F A;  2VFS A;  2VFU A; 
#chains in the Genus database with same CATH homology
 1AHV A;  1MBT A;  1W1M A;  1W1L A;  3NVW B;  3W8X A;  3LAE A;  1AHZ A;  3NRZ B;  1FFV C;  1N5X A;  2W55 A;  1UXY A;  2OAI A;  2PLS A;  1MBB A;  4OAL A;  3SR6 B;  4O95 A;  1W1J A;  1N5W C;  4JB1 A;  2YVS A;  2MBR A;  2P3H A;  3ETR B;  3NVZ B;  1E8H A;  4PWB A;  3PQB A;  4PVK A;  3DED A;  2Q4W A;  4UD8 A;  2Q85 A;  3FW7 A;  2I0K A;  5HHZ A;  1E8F A;  1N61 C;  2UUU A;  5FXE A;  1HSK A;  3GSY A;  4PYT A;  3FW8 A;  1E0Y A;  2R2Z A;  2VFT A;  2WDW A;  1F0X A;  1WVE A;  3TSJ A;  2Y08 A;  3S1D A;  4BC9 A;  1W1R A;  1DIQ A;  3D2J A;  2QKN A;  3D2D A;  3AMZ A;  3S1E A;  4XLO A;  2W54 A;  2VAO A;  3B9J B;  4MLA A;  3POP A;  1FIQ B;  2O3G A;  4PVJ A;  4BC7 A;  4BCA A;  2EXR A;  2E3T A;  4DNS A;  3JS8 A;  3KJM A;  3NVV B;  3W8Z A;  1WVF A;  2PLI A;  4HG0 A;  5HMR A;  5G5H B;  2UUV A;  2Y3R A;  1N63 C;  3LLB A;  2VFR A;  3TSH A;  5AWV A;  1W1Q A;  3NS1 B;  1T3Q C;  5HQX A;  1SB3 B;  2Y4G A;  3W8W A;  1DII A;  3RJ8 A;  5L6G A;  1N60 C;  1DZN A;  3PM9 A;  3BW7 A;  1ZR6 A;  2BVG A;  3DQ0 A;  2IPI A;  2BVH A;  1WYG A;  5FXF A;  3C0P A;  5AE3 A;  1FO4 A;  2P4P A;  1W1O A;  1FFU C;  1VDV A;  1W1S A;  3S1F A;  4BBY A;  1VAO A;  5ADZ A;  3VTE A;  4JAY A;  3D2H A;  3EUB 3;  5D79 A;  3S1C A;  1AHU A;  3TX1 A;  1I19 A;  3FW9 A;  4PVE A;  1QLU A;  1ZXI C;  2RK5 A;  2R8D A;  5AE2 A;  4PVH A;  2P13 A;  5K8E A;  1E8G A;  3HSU A;  5AE1 A;  2QPM A;  4ML8 A;  2BVF A;  1W1K A;  1QLT A;  4PZF A;  5FXP A;  1V97 A;  5I1V A;  1RM6 B;  3AN1 A;  1N62 C;  2W3S A;  3HRD C;  3I99 A;  4PWC A;  3RJA A;  2AXR A;  2Y3S A;  2NQW A;  5G5G B;  1JRP A;  2GQT A;  2GQU A;  4EC3 A;  5I1W A;  3NVY B;  1JRO A;  4ZOH B;  5FXD A;  2VFV A;  3AM9 A;  2W3R A;  3FWA A;  5L6F A;  2VFS A;  2VFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...