2P4PA

Crystal structure of a corc_hlyc domain from haemophilus ducreyi
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
84
structure length
78
Chain Sequence
NAMRRNEDSWLIDGATPLEDVMRALNIHTFPRDENYETIGGFMMYMLRIPTDFVLYDYFEIIDTENFRIDQLMVSFRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HD1797
publication title The structure of a CorC_HlyC domain from Haemophilus ducreyi
rcsb
source organism Haemophilus ducreyi
molecule tags Structural genomics, unknown function
total genus 9
structure length 78
sequence length 84
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2p4pA00
4BC9A 3S1DA 1JRPA 2P4PA 5AE2A 3B9JB 3NS1B 4HG0A 2BVHA 2AXRA 1FO4A 1N60C 1N62C 2RK5A 2Q4WA 2P13A 1W1LA 1W1RA 2W54A 1SB3B 2YVSA 3W8ZA 2R2ZA 2BVGA 4BCAA 4BC7A 3NVZB 3S1EA 1VAOA 1N61C 2QPMA 1E8FA 1HSKA 1WVEA 4PYTA 5HHZA 5FXFA 3NRZB 3W8XA 3DQ0A 3NVVB 2MBRA 1FIQB 2PLIA 2VFRA 3LLBA 2GQUA 1W1SA 1FFUC 1WVFA 1T3QC 3LAEA 1E0YA 2PLSA 1FFVC 2VFTA 1DZNA 2NQWA 3EUB3 5G5HB 3TX1A 3AN1A 3KJMA 1MBBA 2QKNA 3AM9A 3SR6B 2Q85A 3DEDA 3BW7A 2R8DA 5FXPA 4JAYA 3AMZA 1WYGA 1QLUA 3JS8A 2OAIA 1AHZA 1E8GA 4O95A 5HMRA 4BBYA 3HRDC 2P3HA 2O3GA 1AHVA 1VDVA 1E8HA 5G5GB 2VAOA 1RM6B 3C0PA 1W1QA 1MBTA 1N5XA 2VFVA 2EXRA 3W8WA 1F0XA 1JROA 1AHUA 3I99A 1QLTA 1ZXIC 4XLOA 5AE3A 3NVYB 1DIQA 5HQXA 1W1MA 1N63C 5ADZA 5FXDA 2I0KA 1I19A 4ML8A 3PM9A 2W3SA 1W1JA 2VFSA 1ZR6A 4JB1A 1W1OA 2BVFA 5AE1A 1W1KA 4OALA 3NVWB 3S1CA 1V97A 5FXEA 3S1FA 1N5WC 2GQTA 2W3RA 2E3TA 4ZOHB 3ETRB 2W55A 1DIIA 1UXYA 2VFUA 4MLAA
chains in the Genus database with same CATH superfamily
4PVHA 4BC9A 3S1DA 1JRPA 5K8EA 2P4PA 5AE2A 3B9JB 3NS1B 4HG0A 2BVHA 2AXRA 1FO4A 1N60C 1N62C 3HSUA 2RK5A 2Q4WA 2P13A 3RJ8A 1W1LA 1W1RA 2W54A 1SB3B 3FW8A 2YVSA 3PQBA 3W8ZA 2R2ZA 2BVGA 4BCAA 3TSJA 4PVKA 4BC7A 2Y3RA 3FW9A 3NVZB 5D79A 3S1EA 1VAOA 1N61C 2QPMA 1E8FA 1HSKA 1WVEA 4PYTA 5HHZA 5FXFA 3NRZB 4PVJA 2Y4GA 3W8XA 3DQ0A 3RJAA 5I1VA 3NVVB 2UUVA 2MBRA 1FIQB 2PLIA 2VFRA 3LLBA 2GQUA 4DNSA 2IPIA 1W1SA 1FFUC 4PZFA 4PWCA 1WVFA 1T3QC 3D2DA 3LAEA 1E0YA 2PLSA 1FFVC 2VFTA 1DZNA 2NQWA 3EUB3 4PWBA 5G5HB 3TX1A 3AN1A 3KJMA 1MBBA 2QKNA 2UUUA 3AM9A 3SR6B 2Q85A 3DEDA 3BW7A 2WDWA 2R8DA 4PVEA 5FXPA 4JAYA 3AMZA 1WYGA 1QLUA 3JS8A 2OAIA 1AHZA 1E8GA 4O95A 5HMRA 4BBYA 3D2JA 3HRDC 5L6GA 2P3HA 2O3GA 1AHVA 5AWVA 1VDVA 2Y3SA 1E8HA 5G5GB 2VAOA 1RM6B 3C0PA 1W1QA 1MBTA 1N5XA 2VFVA 2EXRA 3W8WA 1F0XA 1JROA 1AHUA 3I99A 1QLTA 3FWAA 3FW7A 3POPA 1ZXIC 4XLOA 3TSHA 5AE3A 2Y08A 4UD8A 3NVYB 3VTEA 1DIQA 5HQXA 1W1MA 1N63C 5L6FA 5ADZA 4EC3A 5FXDA 2I0KA 1I19A 4ML8A 3PM9A 2W3SA 1W1JA 3D2HA 2VFSA 1ZR6A 4JB1A 5I1WA 1W1OA 2BVFA 5AE1A 1W1KA 4OALA 3NVWB 3S1CA 1V97A 5FXEA 3S1FA 1N5WC 2GQTA 2W3RA 2E3TA 4ZOHB 3ETRB 2W55A 1DIIA 1UXYA 3GSYA 2VFUA 4MLAA
chains in the Genus database with same CATH topology
4PVHA 4BC9A 3S1DA 1JRPA 5K8EA 2P4PA 5AE2A 3B9JB 3NS1B 4HG0A 2BVHA 2AXRA 1FO4A 1N60C 1N62C 3HSUA 2RK5A 2Q4WA 2P13A 3RJ8A 1W1LA 1W1RA 2W54A 1SB3B 3FW8A 2YVSA 3PQBA 3W8ZA 2R2ZA 2BVGA 4BCAA 3TSJA 4PVKA 4BC7A 2Y3RA 3FW9A 3NVZB 5D79A 3S1EA 1VAOA 1N61C 2QPMA 1E8FA 1HSKA 1WVEA 4PYTA 5HHZA 5FXFA 3NRZB 4PVJA 2Y4GA 3W8XA 3DQ0A 3RJAA 5I1VA 3NVVB 2UUVA 2MBRA 1FIQB 2PLIA 2VFRA 3LLBA 2GQUA 4DNSA 2IPIA 1W1SA 1FFUC 4PZFA 4PWCA 1WVFA 1T3QC 3D2DA 3LAEA 1E0YA 2PLSA 1FFVC 2VFTA 1DZNA 2NQWA 3EUB3 4PWBA 5G5HB 3TX1A 3AN1A 3KJMA 1MBBA 2QKNA 2UUUA 3AM9A 3SR6B 2Q85A 3DEDA 3BW7A 2WDWA 2R8DA 4PVEA 5FXPA 4JAYA 3AMZA 1WYGA 1QLUA 3JS8A 2OAIA 1AHZA 1E8GA 4O95A 5HMRA 4BBYA 3D2JA 3HRDC 5L6GA 2P3HA 2O3GA 1AHVA 5AWVA 1VDVA 2Y3SA 1E8HA 5G5GB 2VAOA 1RM6B 3C0PA 1W1QA 1MBTA 1N5XA 2VFVA 2EXRA 3W8WA 1F0XA 1JROA 1AHUA 3I99A 1QLTA 3FWAA 3FW7A 3POPA 1ZXIC 4XLOA 3TSHA 5AE3A 2Y08A 4UD8A 3NVYB 3VTEA 1DIQA 5HQXA 1W1MA 1N63C 5L6FA 5ADZA 4EC3A 5FXDA 2I0KA 1I19A 4ML8A 3PM9A 2W3SA 1W1JA 3D2HA 2VFSA 1ZR6A 4JB1A 5I1WA 1W1OA 2BVFA 5AE1A 1W1KA 4OALA 3NVWB 3S1CA 1V97A 5FXEA 3S1FA 1N5WC 2GQTA 2W3RA 2E3TA 4ZOHB 3ETRB 2W55A 1DIIA 1UXYA 3GSYA 2VFUA 4MLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BC9 A;  3S1D A;  1JRP A;  2P4P A;  5AE2 A;  3B9J B;  3NS1 B;  4HG0 A;  2BVH A;  2AXR A;  1FO4 A;  1N60 C;  1N62 C;  2RK5 A;  2Q4W A;  2P13 A;  1W1L A;  1W1R A;  2W54 A;  1SB3 B;  2YVS A;  3W8Z A;  2R2Z A;  2BVG A;  4BCA A;  4BC7 A;  3NVZ B;  3S1E A;  1VAO A;  1N61 C;  2QPM A;  1E8F A;  1HSK A;  1WVE A;  4PYT A;  5HHZ A;  5FXF A;  3NRZ B;  3W8X A;  3DQ0 A;  3NVV B;  2MBR A;  1FIQ B;  2PLI A;  2VFR A;  3LLB A;  2GQU A;  1W1S A;  1FFU C;  1WVF A;  1T3Q C;  3LAE A;  1E0Y A;  2PLS A;  1FFV C;  2VFT A;  1DZN A;  2NQW A;  3EUB 3;  5G5H B;  3TX1 A;  3AN1 A;  3KJM A;  1MBB A;  2QKN A;  3AM9 A;  3SR6 B;  2Q85 A;  3DED A;  3BW7 A;  2R8D A;  5FXP A;  4JAY A;  3AMZ A;  1WYG A;  1QLU A;  3JS8 A;  2OAI A;  1AHZ A;  1E8G A;  4O95 A;  5HMR A;  4BBY A;  3HRD C;  2P3H A;  2O3G A;  1AHV A;  1VDV A;  1E8H A;  5G5G B;  2VAO A;  1RM6 B;  3C0P A;  1W1Q A;  1MBT A;  1N5X A;  2VFV A;  2EXR A;  3W8W A;  1F0X A;  1JRO A;  1AHU A;  3I99 A;  1QLT A;  1ZXI C;  4XLO A;  5AE3 A;  3NVY B;  1DIQ A;  5HQX A;  1W1M A;  1N63 C;  5ADZ A;  5FXD A;  2I0K A;  1I19 A;  4ML8 A;  3PM9 A;  2W3S A;  1W1J A;  2VFS A;  1ZR6 A;  4JB1 A;  1W1O A;  2BVF A;  5AE1 A;  1W1K A;  4OAL A;  3NVW B;  3S1C A;  1V97 A;  5FXE A;  3S1F A;  1N5W C;  2GQT A;  2W3R A;  2E3T A;  4ZOH B;  3ETR B;  2W55 A;  1DII A;  1UXY A;  2VFU A;  4MLA A; 
#chains in the Genus database with same CATH topology
 4PVH A;  4BC9 A;  3S1D A;  1JRP A;  5K8E A;  2P4P A;  5AE2 A;  3B9J B;  3NS1 B;  4HG0 A;  2BVH A;  2AXR A;  1FO4 A;  1N60 C;  1N62 C;  3HSU A;  2RK5 A;  2Q4W A;  2P13 A;  3RJ8 A;  1W1L A;  1W1R A;  2W54 A;  1SB3 B;  3FW8 A;  2YVS A;  3PQB A;  3W8Z A;  2R2Z A;  2BVG A;  4BCA A;  3TSJ A;  4PVK A;  4BC7 A;  2Y3R A;  3FW9 A;  3NVZ B;  5D79 A;  3S1E A;  1VAO A;  1N61 C;  2QPM A;  1E8F A;  1HSK A;  1WVE A;  4PYT A;  5HHZ A;  5FXF A;  3NRZ B;  4PVJ A;  2Y4G A;  3W8X A;  3DQ0 A;  3RJA A;  5I1V A;  3NVV B;  2UUV A;  2MBR A;  1FIQ B;  2PLI A;  2VFR A;  3LLB A;  2GQU A;  4DNS A;  2IPI A;  1W1S A;  1FFU C;  4PZF A;  4PWC A;  1WVF A;  1T3Q C;  3D2D A;  3LAE A;  1E0Y A;  2PLS A;  1FFV C;  2VFT A;  1DZN A;  2NQW A;  3EUB 3;  4PWB A;  5G5H B;  3TX1 A;  3AN1 A;  3KJM A;  1MBB A;  2QKN A;  2UUU A;  3AM9 A;  3SR6 B;  2Q85 A;  3DED A;  3BW7 A;  2WDW A;  2R8D A;  4PVE A;  5FXP A;  4JAY A;  3AMZ A;  1WYG A;  1QLU A;  3JS8 A;  2OAI A;  1AHZ A;  1E8G A;  4O95 A;  5HMR A;  4BBY A;  3D2J A;  3HRD C;  5L6G A;  2P3H A;  2O3G A;  1AHV A;  5AWV A;  1VDV A;  2Y3S A;  1E8H A;  5G5G B;  2VAO A;  1RM6 B;  3C0P A;  1W1Q A;  1MBT A;  1N5X A;  2VFV A;  2EXR A;  3W8W A;  1F0X A;  1JRO A;  1AHU A;  3I99 A;  1QLT A;  3FWA A;  3FW7 A;  3POP A;  1ZXI C;  4XLO A;  3TSH A;  5AE3 A;  2Y08 A;  4UD8 A;  3NVY B;  3VTE A;  1DIQ A;  5HQX A;  1W1M A;  1N63 C;  5L6F A;  5ADZ A;  4EC3 A;  5FXD A;  2I0K A;  1I19 A;  4ML8 A;  3PM9 A;  2W3S A;  1W1J A;  3D2H A;  2VFS A;  1ZR6 A;  4JB1 A;  5I1W A;  1W1O A;  2BVF A;  5AE1 A;  1W1K A;  4OAL A;  3NVW B;  3S1C A;  1V97 A;  5FXE A;  3S1F A;  1N5W C;  2GQT A;  2W3R A;  2E3T A;  4ZOH B;  3ETR B;  2W55 A;  1DII A;  1UXY A;  3GSY A;  2VFU A;  4MLA A; 
#chains in the Genus database with same CATH homology
 4PVH A;  4BC9 A;  3S1D A;  1JRP A;  5K8E A;  2P4P A;  5AE2 A;  3B9J B;  3NS1 B;  4HG0 A;  2BVH A;  2AXR A;  1FO4 A;  1N60 C;  1N62 C;  3HSU A;  2RK5 A;  2Q4W A;  2P13 A;  3RJ8 A;  1W1L A;  1W1R A;  2W54 A;  1SB3 B;  3FW8 A;  2YVS A;  3PQB A;  3W8Z A;  2R2Z A;  2BVG A;  4BCA A;  3TSJ A;  4PVK A;  4BC7 A;  2Y3R A;  3FW9 A;  3NVZ B;  5D79 A;  3S1E A;  1VAO A;  1N61 C;  2QPM A;  1E8F A;  1HSK A;  1WVE A;  4PYT A;  5HHZ A;  5FXF A;  3NRZ B;  4PVJ A;  2Y4G A;  3W8X A;  3DQ0 A;  3RJA A;  5I1V A;  3NVV B;  2UUV A;  2MBR A;  1FIQ B;  2PLI A;  2VFR A;  3LLB A;  2GQU A;  4DNS A;  2IPI A;  1W1S A;  1FFU C;  4PZF A;  4PWC A;  1WVF A;  1T3Q C;  3D2D A;  3LAE A;  1E0Y A;  2PLS A;  1FFV C;  2VFT A;  1DZN A;  2NQW A;  3EUB 3;  4PWB A;  5G5H B;  3TX1 A;  3AN1 A;  3KJM A;  1MBB A;  2QKN A;  2UUU A;  3AM9 A;  3SR6 B;  2Q85 A;  3DED A;  3BW7 A;  2WDW A;  2R8D A;  4PVE A;  5FXP A;  4JAY A;  3AMZ A;  1WYG A;  1QLU A;  3JS8 A;  2OAI A;  1AHZ A;  1E8G A;  4O95 A;  5HMR A;  4BBY A;  3D2J A;  3HRD C;  5L6G A;  2P3H A;  2O3G A;  1AHV A;  5AWV A;  1VDV A;  2Y3S A;  1E8H A;  5G5G B;  2VAO A;  1RM6 B;  3C0P A;  1W1Q A;  1MBT A;  1N5X A;  2VFV A;  2EXR A;  3W8W A;  1F0X A;  1JRO A;  1AHU A;  3I99 A;  1QLT A;  3FWA A;  3FW7 A;  3POP A;  1ZXI C;  4XLO A;  3TSH A;  5AE3 A;  2Y08 A;  4UD8 A;  3NVY B;  3VTE A;  1DIQ A;  5HQX A;  1W1M A;  1N63 C;  5L6F A;  5ADZ A;  4EC3 A;  5FXD A;  2I0K A;  1I19 A;  4ML8 A;  3PM9 A;  2W3S A;  1W1J A;  3D2H A;  2VFS A;  1ZR6 A;  4JB1 A;  5I1W A;  1W1O A;  2BVF A;  5AE1 A;  1W1K A;  4OAL A;  3NVW B;  3S1C A;  1V97 A;  5FXE A;  3S1F A;  1N5W C;  2GQT A;  2W3R A;  2E3T A;  4ZOH B;  3ETR B;  2W55 A;  1DII A;  1UXY A;  3GSY A;  2VFU A;  4MLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...