2RK5A

Crystal structure of a domain of the putative hemolysin from streptococcus mutans ua159
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
QSREIADNTYIVLGTMTLNDFNEYFETDLESDNVDTIAGFYLTGVGTIPSQEEKEHFEVESNGKHLELINDKVKDGRVTKLKILVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159.
rcsb
source organism Streptococcus mutans ua159
molecule tags Toxin
molecule keywords Putative hemolysin
total genus 19
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2rk5A00
1RM6B 1N61C 1DZNA 2W54A 1W1SA 4HG0A 2P13A 1W1QA 2VAOA 3NVZB 5FXPA 1MBBA 1N60C 1W1MA 1AHVA 4BC7A 3C0PA 3AM9A 3EUB3 4JB1A 2QPMA 1FO4A 2GQUA 3NVWB 1W1KA 4JAYA 2VFUA 5ADZA 2PLIA 3B9JB 1FFUC 4BCAA 2EXRA 3ETRB 3AMZA 3AN1A 1V97A 3HRDC 1VAOA 1AHZA 1WVFA 1JRPA 3BW7A 3DEDA 4XLOA 4BC9A 3LLBA 2Q4WA 2R2ZA 1N63C 1FFVC 1W1LA 4O95A 2W3RA 1W1OA 2W3SA 5HMRA 5AE3A 1DIIA 1W1JA 3JS8A 5G5GB 3S1DA 1VDVA 1JROA 2BVGA 3W8WA 2VFRA 2P3HA 1WVEA 4PYTA 1MBTA 3S1EA 1T3QC 2RK5A 2VFVA 5HHZA 2PLSA 4BBYA 1N62C 5HQXA 2OAIA 2E3TA 1F0XA 1E0YA 3PM9A 1E8GA 1E8FA 2GQTA 3NS1B 3NVVB 3W8ZA 2I0KA 3W8XA 3TX1A 2VFSA 3S1CA 2YVSA 5FXDA 4OALA 1UXYA 4ML8A 2NQWA 1I19A 3I99A 1SB3B 2AXRA 2R8DA 2Q85A 1N5XA 1ZXIC 2QKNA 2P4PA 3DQ0A 5AE2A 3NRZB 3S1FA 3SR6B 3KJMA 4MLAA 5G5HB 5FXFA 1ZR6A 4ZOHB 5AE1A 3NVYB 2W55A 1FIQB 2BVFA 2BVHA 1W1RA 3LAEA 5FXEA 1E8HA 1DIQA 1WYGA 1AHUA 1N5WC 1QLUA 2O3GA 1HSKA 2MBRA 1QLTA 2VFTA
chains in the Genus database with same CATH superfamily
1RM6B 1N61C 1DZNA 2W54A 1W1SA 4HG0A 2P13A 1W1QA 2VAOA 3NVZB 5FXPA 5I1WA 1MBBA 1N60C 1W1MA 3PQBA 4UD8A 1AHVA 4BC7A 3C0PA 3AM9A 3EUB3 4JB1A 2QPMA 1FO4A 3RJ8A 4EC3A 3D2JA 2GQUA 3NVWB 1W1KA 4JAYA 2VFUA 5ADZA 2PLIA 3B9JB 1FFUC 4BCAA 2EXRA 3ETRB 3AMZA 3AN1A 1V97A 3FW9A 5K8EA 3HRDC 1VAOA 1AHZA 1WVFA 1JRPA 3RJAA 3BW7A 2UUUA 3DEDA 3FW8A 4XLOA 4BC9A 3LLBA 2Q4WA 2R2ZA 1N63C 1FFVC 1W1LA 4O95A 3TSHA 2W3RA 1W1OA 2W3SA 5HMRA 5AE3A 1DIIA 4PVHA 1W1JA 3JS8A 5G5GB 3S1DA 1VDVA 1JROA 2BVGA 3W8WA 2VFRA 2P3HA 1WVEA 4PYTA 1MBTA 3S1EA 2Y08A 1T3QC 2RK5A 2VFVA 5HHZA 2PLSA 4PZFA 3FWAA 5D79A 2UUVA 4BBYA 4PWCA 3GSYA 1N62C 5HQXA 2OAIA 2E3TA 1F0XA 1E0YA 3PM9A 1E8GA 4PWBA 1E8FA 2GQTA 2Y3SA 3NS1B 3NVVB 3W8ZA 2I0KA 3VTEA 3W8XA 5I1VA 3TX1A 4PVEA 2VFSA 3S1CA 2YVSA 4PVKA 5FXDA 4OALA 5AWVA 1UXYA 4ML8A 2NQWA 1I19A 3I99A 4PVJA 1SB3B 2AXRA 2R8DA 5L6FA 2Q85A 3D2HA 1N5XA 1ZXIC 2QKNA 2P4PA 3DQ0A 2Y4GA 5AE2A 3NRZB 3S1FA 3SR6B 3KJMA 4MLAA 5G5HB 5FXFA 1ZR6A 2Y3RA 4ZOHB 5AE1A 3NVYB 2W55A 1FIQB 2BVFA 2BVHA 1W1RA 2IPIA 2WDWA 3LAEA 5FXEA 3POPA 1E8HA 1DIQA 4DNSA 1WYGA 3TSJA 3HSUA 1AHUA 1N5WC 1QLUA 2O3GA 3D2DA 1HSKA 2MBRA 1QLTA 3FW7A 5L6GA 2VFTA
chains in the Genus database with same CATH topology
1RM6B 1N61C 1DZNA 2W54A 1W1SA 4HG0A 2P13A 1W1QA 2VAOA 3NVZB 5FXPA 5I1WA 1MBBA 1N60C 1W1MA 3PQBA 4UD8A 1AHVA 4BC7A 3C0PA 3AM9A 3EUB3 4JB1A 2QPMA 1FO4A 3RJ8A 4EC3A 3D2JA 2GQUA 3NVWB 1W1KA 4JAYA 2VFUA 5ADZA 2PLIA 3B9JB 1FFUC 4BCAA 2EXRA 3ETRB 3AMZA 3AN1A 1V97A 3FW9A 5K8EA 3HRDC 1VAOA 1AHZA 1WVFA 1JRPA 3RJAA 3BW7A 2UUUA 3DEDA 3FW8A 4XLOA 4BC9A 3LLBA 2Q4WA 2R2ZA 1N63C 1FFVC 1W1LA 4O95A 3TSHA 2W3RA 1W1OA 2W3SA 5HMRA 5AE3A 1DIIA 4PVHA 1W1JA 3JS8A 5G5GB 3S1DA 1VDVA 1JROA 2BVGA 3W8WA 2VFRA 2P3HA 1WVEA 4PYTA 1MBTA 3S1EA 2Y08A 1T3QC 2RK5A 2VFVA 5HHZA 2PLSA 4PZFA 3FWAA 5D79A 2UUVA 4BBYA 4PWCA 3GSYA 1N62C 5HQXA 2OAIA 2E3TA 1F0XA 1E0YA 3PM9A 1E8GA 4PWBA 1E8FA 2GQTA 2Y3SA 3NS1B 3NVVB 3W8ZA 2I0KA 3VTEA 3W8XA 5I1VA 3TX1A 4PVEA 2VFSA 3S1CA 2YVSA 4PVKA 5FXDA 4OALA 5AWVA 1UXYA 4ML8A 2NQWA 1I19A 3I99A 4PVJA 1SB3B 2AXRA 2R8DA 5L6FA 2Q85A 3D2HA 1N5XA 1ZXIC 2QKNA 2P4PA 3DQ0A 2Y4GA 5AE2A 3NRZB 3S1FA 3SR6B 3KJMA 4MLAA 5G5HB 5FXFA 1ZR6A 2Y3RA 4ZOHB 5AE1A 3NVYB 2W55A 1FIQB 2BVFA 2BVHA 1W1RA 2IPIA 2WDWA 3LAEA 5FXEA 3POPA 1E8HA 1DIQA 4DNSA 1WYGA 3TSJA 3HSUA 1AHUA 1N5WC 1QLUA 2O3GA 3D2DA 1HSKA 2MBRA 1QLTA 3FW7A 5L6GA 2VFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM6 B;  1N61 C;  1DZN A;  2W54 A;  1W1S A;  4HG0 A;  2P13 A;  1W1Q A;  2VAO A;  3NVZ B;  5FXP A;  1MBB A;  1N60 C;  1W1M A;  1AHV A;  4BC7 A;  3C0P A;  3AM9 A;  3EUB 3;  4JB1 A;  2QPM A;  1FO4 A;  2GQU A;  3NVW B;  1W1K A;  4JAY A;  2VFU A;  5ADZ A;  2PLI A;  3B9J B;  1FFU C;  4BCA A;  2EXR A;  3ETR B;  3AMZ A;  3AN1 A;  1V97 A;  3HRD C;  1VAO A;  1AHZ A;  1WVF A;  1JRP A;  3BW7 A;  3DED A;  4XLO A;  4BC9 A;  3LLB A;  2Q4W A;  2R2Z A;  1N63 C;  1FFV C;  1W1L A;  4O95 A;  2W3R A;  1W1O A;  2W3S A;  5HMR A;  5AE3 A;  1DII A;  1W1J A;  3JS8 A;  5G5G B;  3S1D A;  1VDV A;  1JRO A;  2BVG A;  3W8W A;  2VFR A;  2P3H A;  1WVE A;  4PYT A;  1MBT A;  3S1E A;  1T3Q C;  2RK5 A;  2VFV A;  5HHZ A;  2PLS A;  4BBY A;  1N62 C;  5HQX A;  2OAI A;  2E3T A;  1F0X A;  1E0Y A;  3PM9 A;  1E8G A;  1E8F A;  2GQT A;  3NS1 B;  3NVV B;  3W8Z A;  2I0K A;  3W8X A;  3TX1 A;  2VFS A;  3S1C A;  2YVS A;  5FXD A;  4OAL A;  1UXY A;  4ML8 A;  2NQW A;  1I19 A;  3I99 A;  1SB3 B;  2AXR A;  2R8D A;  2Q85 A;  1N5X A;  1ZXI C;  2QKN A;  2P4P A;  3DQ0 A;  5AE2 A;  3NRZ B;  3S1F A;  3SR6 B;  3KJM A;  4MLA A;  5G5H B;  5FXF A;  1ZR6 A;  4ZOH B;  5AE1 A;  3NVY B;  2W55 A;  1FIQ B;  2BVF A;  2BVH A;  1W1R A;  3LAE A;  5FXE A;  1E8H A;  1DIQ A;  1WYG A;  1AHU A;  1N5W C;  1QLU A;  2O3G A;  1HSK A;  2MBR A;  1QLT A;  2VFT A; 
#chains in the Genus database with same CATH topology
 1RM6 B;  1N61 C;  1DZN A;  2W54 A;  1W1S A;  4HG0 A;  2P13 A;  1W1Q A;  2VAO A;  3NVZ B;  5FXP A;  5I1W A;  1MBB A;  1N60 C;  1W1M A;  3PQB A;  4UD8 A;  1AHV A;  4BC7 A;  3C0P A;  3AM9 A;  3EUB 3;  4JB1 A;  2QPM A;  1FO4 A;  3RJ8 A;  4EC3 A;  3D2J A;  2GQU A;  3NVW B;  1W1K A;  4JAY A;  2VFU A;  5ADZ A;  2PLI A;  3B9J B;  1FFU C;  4BCA A;  2EXR A;  3ETR B;  3AMZ A;  3AN1 A;  1V97 A;  3FW9 A;  5K8E A;  3HRD C;  1VAO A;  1AHZ A;  1WVF A;  1JRP A;  3RJA A;  3BW7 A;  2UUU A;  3DED A;  3FW8 A;  4XLO A;  4BC9 A;  3LLB A;  2Q4W A;  2R2Z A;  1N63 C;  1FFV C;  1W1L A;  4O95 A;  3TSH A;  2W3R A;  1W1O A;  2W3S A;  5HMR A;  5AE3 A;  1DII A;  4PVH A;  1W1J A;  3JS8 A;  5G5G B;  3S1D A;  1VDV A;  1JRO A;  2BVG A;  3W8W A;  2VFR A;  2P3H A;  1WVE A;  4PYT A;  1MBT A;  3S1E A;  2Y08 A;  1T3Q C;  2RK5 A;  2VFV A;  5HHZ A;  2PLS A;  4PZF A;  3FWA A;  5D79 A;  2UUV A;  4BBY A;  4PWC A;  3GSY A;  1N62 C;  5HQX A;  2OAI A;  2E3T A;  1F0X A;  1E0Y A;  3PM9 A;  1E8G A;  4PWB A;  1E8F A;  2GQT A;  2Y3S A;  3NS1 B;  3NVV B;  3W8Z A;  2I0K A;  3VTE A;  3W8X A;  5I1V A;  3TX1 A;  4PVE A;  2VFS A;  3S1C A;  2YVS A;  4PVK A;  5FXD A;  4OAL A;  5AWV A;  1UXY A;  4ML8 A;  2NQW A;  1I19 A;  3I99 A;  4PVJ A;  1SB3 B;  2AXR A;  2R8D A;  5L6F A;  2Q85 A;  3D2H A;  1N5X A;  1ZXI C;  2QKN A;  2P4P A;  3DQ0 A;  2Y4G A;  5AE2 A;  3NRZ B;  3S1F A;  3SR6 B;  3KJM A;  4MLA A;  5G5H B;  5FXF A;  1ZR6 A;  2Y3R A;  4ZOH B;  5AE1 A;  3NVY B;  2W55 A;  1FIQ B;  2BVF A;  2BVH A;  1W1R A;  2IPI A;  2WDW A;  3LAE A;  5FXE A;  3POP A;  1E8H A;  1DIQ A;  4DNS A;  1WYG A;  3TSJ A;  3HSU A;  1AHU A;  1N5W C;  1QLU A;  2O3G A;  3D2D A;  1HSK A;  2MBR A;  1QLT A;  3FW7 A;  5L6G A;  2VFT A; 
#chains in the Genus database with same CATH homology
 1RM6 B;  1N61 C;  1DZN A;  2W54 A;  1W1S A;  4HG0 A;  2P13 A;  1W1Q A;  2VAO A;  3NVZ B;  5FXP A;  5I1W A;  1MBB A;  1N60 C;  1W1M A;  3PQB A;  4UD8 A;  1AHV A;  4BC7 A;  3C0P A;  3AM9 A;  3EUB 3;  4JB1 A;  2QPM A;  1FO4 A;  3RJ8 A;  4EC3 A;  3D2J A;  2GQU A;  3NVW B;  1W1K A;  4JAY A;  2VFU A;  5ADZ A;  2PLI A;  3B9J B;  1FFU C;  4BCA A;  2EXR A;  3ETR B;  3AMZ A;  3AN1 A;  1V97 A;  3FW9 A;  5K8E A;  3HRD C;  1VAO A;  1AHZ A;  1WVF A;  1JRP A;  3RJA A;  3BW7 A;  2UUU A;  3DED A;  3FW8 A;  4XLO A;  4BC9 A;  3LLB A;  2Q4W A;  2R2Z A;  1N63 C;  1FFV C;  1W1L A;  4O95 A;  3TSH A;  2W3R A;  1W1O A;  2W3S A;  5HMR A;  5AE3 A;  1DII A;  4PVH A;  1W1J A;  3JS8 A;  5G5G B;  3S1D A;  1VDV A;  1JRO A;  2BVG A;  3W8W A;  2VFR A;  2P3H A;  1WVE A;  4PYT A;  1MBT A;  3S1E A;  2Y08 A;  1T3Q C;  2RK5 A;  2VFV A;  5HHZ A;  2PLS A;  4PZF A;  3FWA A;  5D79 A;  2UUV A;  4BBY A;  4PWC A;  3GSY A;  1N62 C;  5HQX A;  2OAI A;  2E3T A;  1F0X A;  1E0Y A;  3PM9 A;  1E8G A;  4PWB A;  1E8F A;  2GQT A;  2Y3S A;  3NS1 B;  3NVV B;  3W8Z A;  2I0K A;  3VTE A;  3W8X A;  5I1V A;  3TX1 A;  4PVE A;  2VFS A;  3S1C A;  2YVS A;  4PVK A;  5FXD A;  4OAL A;  5AWV A;  1UXY A;  4ML8 A;  2NQW A;  1I19 A;  3I99 A;  4PVJ A;  1SB3 B;  2AXR A;  2R8D A;  5L6F A;  2Q85 A;  3D2H A;  1N5X A;  1ZXI C;  2QKN A;  2P4P A;  3DQ0 A;  2Y4G A;  5AE2 A;  3NRZ B;  3S1F A;  3SR6 B;  3KJM A;  4MLA A;  5G5H B;  5FXF A;  1ZR6 A;  2Y3R A;  4ZOH B;  5AE1 A;  3NVY B;  2W55 A;  1FIQ B;  2BVF A;  2BVH A;  1W1R A;  2IPI A;  2WDW A;  3LAE A;  5FXE A;  3POP A;  1E8H A;  1DIQ A;  4DNS A;  1WYG A;  3TSJ A;  3HSU A;  1AHU A;  1N5W C;  1QLU A;  2O3G A;  3D2D A;  1HSK A;  2MBR A;  1QLT A;  3FW7 A;  5L6G A;  2VFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...