2RK5A

Crystal structure of a domain of the putative hemolysin from streptococcus mutans ua159
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
QSREIADNTYIVLGTMTLNDFNEYFETDLESDNVDTIAGFYLTGVGTIPSQEEKEHFEVESNGKHLELINDKVKDGRVTKLKILVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hemolysin
publication title The crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159.
rcsb
source organism Streptococcus mutans ua159
molecule tags Toxin
total genus 19
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2rk5A00
3SR6B 1ZR6A 2GQTA 3DEDA 2P3HA 1FFUC 2Q4WA 2QPMA 4OALA 3TX1A 3C0PA 5FXPA 2I0KA 1N60C 2E3TA 2RK5A 1W1JA 1N62C 1MBBA 4JAYA 1E8HA 1E8GA 2MBRA 2W54A 2NQWA 5HQXA 3AM9A 3BW7A 1UXYA 1W1MA 4JB1A 3AN1A 2P4PA 3B9JB 3W8WA 4BCAA 1AHZA 3AMZA 3PM9A 2GQUA 2OAIA 2PLIA 5FXEA 3NVWB 5G5GB 1WYGA 5ADZA 3ETRB 3JS8A 1DIQA 3S1FA 5HMRA 1VAOA 5G5HB 4PYTA 3HRDC 2EXRA 5FXDA 5HHZA 1FO4A 1WVEA 2VFUA 1QLTA 1E8FA 1T3QC 2P13A 1HSKA 2VAOA 3W8ZA 1AHVA 3KJMA 2BVGA 2QKNA 1W1LA 2VFSA 2W3SA 1W1RA 2W3RA 3NS1B 4BBYA 1JRPA 1E0YA 2VFTA 1W1SA 5AE2A 2W55A 5AE3A 4ML8A 3S1CA 1N63C 1MBTA 4ZOHB 5AE1A 3W8XA 3DQ0A 1JROA 3LAEA 5FXFA 2AXRA 2VFRA 2R8DA 3LLBA 3EUB3 2Q85A 1QLUA 1V97A 1SB3B 2BVFA 2O3GA 3S1EA 4XLOA 3NVYB 4BC9A 1AHUA 3NVZB 1FIQB 1RM6B 3NRZB 2BVHA 3I99A 4BC7A 4MLAA 1DZNA 1FFVC 2PLSA 1W1KA 3NVVB 1DIIA 1F0XA 1I19A 3S1DA 1W1OA 1ZXIC 4O95A 1VDVA 2VFVA 2R2ZA 1N61C 1WVFA 1N5XA 1N5WC 4HG0A 1W1QA 2YVSA
chains in the Genus database with same CATH superfamily
3SR6B 1ZR6A 4PZFA 2GQTA 3DEDA 2P3HA 5L6FA 1FFUC 2UUUA 2Q4WA 2QPMA 3D2JA 4OALA 3TX1A 3C0PA 5FXPA 2I0KA 5I1WA 1N60C 2E3TA 2RK5A 3HSUA 2Y3RA 5L6GA 1W1JA 1N62C 1MBBA 4JAYA 1E8HA 1E8GA 2MBRA 2W54A 2NQWA 3PQBA 5HQXA 3AM9A 3BW7A 1UXYA 1W1MA 4JB1A 3AN1A 3VTEA 2P4PA 3B9JB 3W8WA 4BCAA 1AHZA 4EC3A 3AMZA 3PM9A 2GQUA 2OAIA 2PLIA 5FXEA 3NVWB 5G5GB 1WYGA 5ADZA 3GSYA 3ETRB 3JS8A 1DIQA 3S1FA 5HMRA 1VAOA 5G5HB 3POPA 3D2HA 3FW8A 4PYTA 3FW9A 3HRDC 2EXRA 3FW7A 5D79A 5FXDA 1WVEA 2VFUA 5HHZA 1FO4A 1QLTA 1E8FA 1T3QC 2P13A 1HSKA 4PWBA 2VAOA 3W8ZA 1AHVA 3KJMA 2BVGA 2QKNA 1W1LA 2VFSA 2W3SA 2WDWA 1W1RA 2W3RA 3NS1B 4BBYA 1JRPA 1E0YA 2VFTA 4DNSA 1W1SA 5AE2A 2W55A 5AE3A 4ML8A 3S1CA 1N63C 4PVKA 1MBTA 3FWAA 4ZOHB 5AE1A 4PVEA 3W8XA 5I1VA 3DQ0A 1JROA 3LAEA 5FXFA 2AXRA 2VFRA 2R8DA 3LLBA 3EUB3 2Q85A 4PVHA 1QLUA 1V97A 1SB3B 2BVFA 2O3GA 3S1EA 4XLOA 3RJAA 3NVYB 4BC9A 1AHUA 3NVZB 1FIQB 1RM6B 3NRZB 2BVHA 2UUVA 3I99A 4BC7A 4MLAA 1DZNA 1FFVC 2PLSA 5K8EA 2Y3SA 1W1KA 3NVVB 4PWCA 1DIIA 1F0XA 1I19A 4UD8A 1W1OA 3S1DA 1ZXIC 4O95A 1VDVA 2Y4GA 2VFVA 2IPIA 3TSJA 2R2ZA 1N61C 3TSHA 1WVFA 1N5XA 1N5WC 4PVJA 3D2DA 4HG0A 2Y08A 1W1QA 2YVSA 5AWVA 3RJ8A
chains in the Genus database with same CATH topology
3SR6B 1ZR6A 4PZFA 2GQTA 3DEDA 2P3HA 5L6FA 1FFUC 2UUUA 2Q4WA 2QPMA 3D2JA 4OALA 3TX1A 3C0PA 5FXPA 2I0KA 5I1WA 1N60C 2E3TA 2RK5A 3HSUA 2Y3RA 5L6GA 1W1JA 1N62C 1MBBA 4JAYA 1E8HA 1E8GA 2MBRA 2W54A 2NQWA 3PQBA 5HQXA 3AM9A 3BW7A 1UXYA 1W1MA 4JB1A 3AN1A 3VTEA 2P4PA 3B9JB 3W8WA 4BCAA 1AHZA 4EC3A 3AMZA 3PM9A 2GQUA 2OAIA 2PLIA 5FXEA 3NVWB 5G5GB 1WYGA 5ADZA 3GSYA 3ETRB 3JS8A 1DIQA 3S1FA 5HMRA 1VAOA 5G5HB 3POPA 3D2HA 3FW8A 4PYTA 3FW9A 3HRDC 2EXRA 3FW7A 5D79A 5FXDA 1WVEA 2VFUA 5HHZA 1FO4A 1QLTA 1E8FA 1T3QC 2P13A 1HSKA 4PWBA 2VAOA 3W8ZA 1AHVA 3KJMA 2BVGA 2QKNA 1W1LA 2VFSA 2W3SA 2WDWA 1W1RA 2W3RA 3NS1B 4BBYA 1JRPA 1E0YA 2VFTA 4DNSA 1W1SA 5AE2A 2W55A 5AE3A 4ML8A 3S1CA 1N63C 4PVKA 1MBTA 3FWAA 4ZOHB 5AE1A 4PVEA 3W8XA 5I1VA 3DQ0A 1JROA 3LAEA 5FXFA 2AXRA 2VFRA 2R8DA 3LLBA 3EUB3 2Q85A 4PVHA 1QLUA 1V97A 1SB3B 2BVFA 2O3GA 3S1EA 4XLOA 3RJAA 3NVYB 4BC9A 1AHUA 3NVZB 1FIQB 1RM6B 3NRZB 2BVHA 2UUVA 3I99A 4BC7A 4MLAA 1DZNA 1FFVC 2PLSA 5K8EA 2Y3SA 1W1KA 3NVVB 4PWCA 1DIIA 1F0XA 1I19A 4UD8A 1W1OA 3S1DA 1ZXIC 4O95A 1VDVA 2Y4GA 2VFVA 2IPIA 3TSJA 2R2ZA 1N61C 3TSHA 1WVFA 1N5XA 1N5WC 4PVJA 3D2DA 4HG0A 2Y08A 1W1QA 2YVSA 5AWVA 3RJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SR6 B;  1ZR6 A;  2GQT A;  3DED A;  2P3H A;  1FFU C;  2Q4W A;  2QPM A;  4OAL A;  3TX1 A;  3C0P A;  5FXP A;  2I0K A;  1N60 C;  2E3T A;  2RK5 A;  1W1J A;  1N62 C;  1MBB A;  4JAY A;  1E8H A;  1E8G A;  2MBR A;  2W54 A;  2NQW A;  5HQX A;  3AM9 A;  3BW7 A;  1UXY A;  1W1M A;  4JB1 A;  3AN1 A;  2P4P A;  3B9J B;  3W8W A;  4BCA A;  1AHZ A;  3AMZ A;  3PM9 A;  2GQU A;  2OAI A;  2PLI A;  5FXE A;  3NVW B;  5G5G B;  1WYG A;  5ADZ A;  3ETR B;  3JS8 A;  1DIQ A;  3S1F A;  5HMR A;  1VAO A;  5G5H B;  4PYT A;  3HRD C;  2EXR A;  5FXD A;  5HHZ A;  1FO4 A;  1WVE A;  2VFU A;  1QLT A;  1E8F A;  1T3Q C;  2P13 A;  1HSK A;  2VAO A;  3W8Z A;  1AHV A;  3KJM A;  2BVG A;  2QKN A;  1W1L A;  2VFS A;  2W3S A;  1W1R A;  2W3R A;  3NS1 B;  4BBY A;  1JRP A;  1E0Y A;  2VFT A;  1W1S A;  5AE2 A;  2W55 A;  5AE3 A;  4ML8 A;  3S1C A;  1N63 C;  1MBT A;  4ZOH B;  5AE1 A;  3W8X A;  3DQ0 A;  1JRO A;  3LAE A;  5FXF A;  2AXR A;  2VFR A;  2R8D A;  3LLB A;  3EUB 3;  2Q85 A;  1QLU A;  1V97 A;  1SB3 B;  2BVF A;  2O3G A;  3S1E A;  4XLO A;  3NVY B;  4BC9 A;  1AHU A;  3NVZ B;  1FIQ B;  1RM6 B;  3NRZ B;  2BVH A;  3I99 A;  4BC7 A;  4MLA A;  1DZN A;  1FFV C;  2PLS A;  1W1K A;  3NVV B;  1DII A;  1F0X A;  1I19 A;  3S1D A;  1W1O A;  1ZXI C;  4O95 A;  1VDV A;  2VFV A;  2R2Z A;  1N61 C;  1WVF A;  1N5X A;  1N5W C;  4HG0 A;  1W1Q A;  2YVS A; 
#chains in the Genus database with same CATH topology
 3SR6 B;  1ZR6 A;  4PZF A;  2GQT A;  3DED A;  2P3H A;  5L6F A;  1FFU C;  2UUU A;  2Q4W A;  2QPM A;  3D2J A;  4OAL A;  3TX1 A;  3C0P A;  5FXP A;  2I0K A;  5I1W A;  1N60 C;  2E3T A;  2RK5 A;  3HSU A;  2Y3R A;  5L6G A;  1W1J A;  1N62 C;  1MBB A;  4JAY A;  1E8H A;  1E8G A;  2MBR A;  2W54 A;  2NQW A;  3PQB A;  5HQX A;  3AM9 A;  3BW7 A;  1UXY A;  1W1M A;  4JB1 A;  3AN1 A;  3VTE A;  2P4P A;  3B9J B;  3W8W A;  4BCA A;  1AHZ A;  4EC3 A;  3AMZ A;  3PM9 A;  2GQU A;  2OAI A;  2PLI A;  5FXE A;  3NVW B;  5G5G B;  1WYG A;  5ADZ A;  3GSY A;  3ETR B;  3JS8 A;  1DIQ A;  3S1F A;  5HMR A;  1VAO A;  5G5H B;  3POP A;  3D2H A;  3FW8 A;  4PYT A;  3FW9 A;  3HRD C;  2EXR A;  3FW7 A;  5D79 A;  5FXD A;  1WVE A;  2VFU A;  5HHZ A;  1FO4 A;  1QLT A;  1E8F A;  1T3Q C;  2P13 A;  1HSK A;  4PWB A;  2VAO A;  3W8Z A;  1AHV A;  3KJM A;  2BVG A;  2QKN A;  1W1L A;  2VFS A;  2W3S A;  2WDW A;  1W1R A;  2W3R A;  3NS1 B;  4BBY A;  1JRP A;  1E0Y A;  2VFT A;  4DNS A;  1W1S A;  5AE2 A;  2W55 A;  5AE3 A;  4ML8 A;  3S1C A;  1N63 C;  4PVK A;  1MBT A;  3FWA A;  4ZOH B;  5AE1 A;  4PVE A;  3W8X A;  5I1V A;  3DQ0 A;  1JRO A;  3LAE A;  5FXF A;  2AXR A;  2VFR A;  2R8D A;  3LLB A;  3EUB 3;  2Q85 A;  4PVH A;  1QLU A;  1V97 A;  1SB3 B;  2BVF A;  2O3G A;  3S1E A;  4XLO A;  3RJA A;  3NVY B;  4BC9 A;  1AHU A;  3NVZ B;  1FIQ B;  1RM6 B;  3NRZ B;  2BVH A;  2UUV A;  3I99 A;  4BC7 A;  4MLA A;  1DZN A;  1FFV C;  2PLS A;  5K8E A;  2Y3S A;  1W1K A;  3NVV B;  4PWC A;  1DII A;  1F0X A;  1I19 A;  4UD8 A;  1W1O A;  3S1D A;  1ZXI C;  4O95 A;  1VDV A;  2Y4G A;  2VFV A;  2IPI A;  3TSJ A;  2R2Z A;  1N61 C;  3TSH A;  1WVF A;  1N5X A;  1N5W C;  4PVJ A;  3D2D A;  4HG0 A;  2Y08 A;  1W1Q A;  2YVS A;  5AWV A;  3RJ8 A; 
#chains in the Genus database with same CATH homology
 3SR6 B;  1ZR6 A;  4PZF A;  2GQT A;  3DED A;  2P3H A;  5L6F A;  1FFU C;  2UUU A;  2Q4W A;  2QPM A;  3D2J A;  4OAL A;  3TX1 A;  3C0P A;  5FXP A;  2I0K A;  5I1W A;  1N60 C;  2E3T A;  2RK5 A;  3HSU A;  2Y3R A;  5L6G A;  1W1J A;  1N62 C;  1MBB A;  4JAY A;  1E8H A;  1E8G A;  2MBR A;  2W54 A;  2NQW A;  3PQB A;  5HQX A;  3AM9 A;  3BW7 A;  1UXY A;  1W1M A;  4JB1 A;  3AN1 A;  3VTE A;  2P4P A;  3B9J B;  3W8W A;  4BCA A;  1AHZ A;  4EC3 A;  3AMZ A;  3PM9 A;  2GQU A;  2OAI A;  2PLI A;  5FXE A;  3NVW B;  5G5G B;  1WYG A;  5ADZ A;  3GSY A;  3ETR B;  3JS8 A;  1DIQ A;  3S1F A;  5HMR A;  1VAO A;  5G5H B;  3POP A;  3D2H A;  3FW8 A;  4PYT A;  3FW9 A;  3HRD C;  2EXR A;  3FW7 A;  5D79 A;  5FXD A;  1WVE A;  2VFU A;  5HHZ A;  1FO4 A;  1QLT A;  1E8F A;  1T3Q C;  2P13 A;  1HSK A;  4PWB A;  2VAO A;  3W8Z A;  1AHV A;  3KJM A;  2BVG A;  2QKN A;  1W1L A;  2VFS A;  2W3S A;  2WDW A;  1W1R A;  2W3R A;  3NS1 B;  4BBY A;  1JRP A;  1E0Y A;  2VFT A;  4DNS A;  1W1S A;  5AE2 A;  2W55 A;  5AE3 A;  4ML8 A;  3S1C A;  1N63 C;  4PVK A;  1MBT A;  3FWA A;  4ZOH B;  5AE1 A;  4PVE A;  3W8X A;  5I1V A;  3DQ0 A;  1JRO A;  3LAE A;  5FXF A;  2AXR A;  2VFR A;  2R8D A;  3LLB A;  3EUB 3;  2Q85 A;  4PVH A;  1QLU A;  1V97 A;  1SB3 B;  2BVF A;  2O3G A;  3S1E A;  4XLO A;  3RJA A;  3NVY B;  4BC9 A;  1AHU A;  3NVZ B;  1FIQ B;  1RM6 B;  3NRZ B;  2BVH A;  2UUV A;  3I99 A;  4BC7 A;  4MLA A;  1DZN A;  1FFV C;  2PLS A;  5K8E A;  2Y3S A;  1W1K A;  3NVV B;  4PWC A;  1DII A;  1F0X A;  1I19 A;  4UD8 A;  1W1O A;  3S1D A;  1ZXI C;  4O95 A;  1VDV A;  2Y4G A;  2VFV A;  2IPI A;  3TSJ A;  2R2Z A;  1N61 C;  3TSH A;  1WVF A;  1N5X A;  1N5W C;  4PVJ A;  3D2D A;  4HG0 A;  2Y08 A;  1W1Q A;  2YVS A;  5AWV A;  3RJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...