2RK5A

Crystal structure of a domain of the putative hemolysin from streptococcus mutans ua159
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
QSREIADNTYIVLGTMTLNDFNEYFETDLESDNVDTIAGFYLTGVGTIPSQEEKEHFEVESNGKHLELINDKVKDGRVTKLKILVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159.
rcsb
source organism Streptococcus mutans ua159
molecule tags Toxin
molecule keywords Putative hemolysin
total genus 19
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2rk5A00
2E3TA 3W8WA 3LAEA 1W1SA 2W55A 3B9JB 3PM9A 2YVSA 1N5WC 2VFSA 5FXDA 4O95A 3S1DA 1E0YA 1WYGA 5HHZA 1JROA 2R8DA 1MBBA 2P3HA 1N63C 2QKNA 3AM9A 1DZNA 2W3RA 1DIQA 2AXRA 1W1MA 2P13A 2BVGA 3S1CA 3LLBA 3C0PA 5FXEA 2Q85A 5ADZA 2PLIA 3NRZB 5G5GB 3JS8A 2PLSA 1FIQB 5AE1A 1W1LA 1QLTA 4JB1A 1N5XA 1QLUA 4HG0A 1W1OA 5AE2A 2OAIA 2EXRA 1I19A 2VFTA 1RM6B 3I99A 4PYTA 4BC9A 1ZR6A 1E8HA 2BVFA 2QPMA 3DEDA 5HMRA 1VAOA 2R2ZA 2I0KA 2P4PA 2VFUA 3BW7A 2VAOA 3NVYB 1N60C 3NS1B 2MBRA 3AMZA 4OALA 1WVFA 1FFVC 1ZXIC 5FXPA 3TX1A 2NQWA 4ML8A 1HSKA 3S1EA 5G5HB 3SR6B 4JAYA 1W1RA 2W3SA 3NVZB 2VFVA 1W1JA 3EUB3 3HRDC 1VDVA 1T3QC 3W8ZA 1F0XA 1AHZA 3DQ0A 1FO4A 4BCAA 2GQUA 1JRPA 1V97A 2RK5A 3KJMA 3W8XA 1N61C 2W54A 3NVVB 2O3GA 5AE3A 3ETRB 1W1QA 1FFUC 1SB3B 1DIIA 3AN1A 4ZOHB 1W1KA 4BC7A 1WVEA 2GQTA 1AHVA 1AHUA 1E8GA 4MLAA 5HQXA 1N62C 2BVHA 3S1FA 2VFRA 1MBTA 1E8FA 4XLOA 4BBYA 1UXYA 2Q4WA 3NVWB 5FXFA
chains in the Genus database with same CATH superfamily
2E3TA 3W8WA 3LAEA 1W1SA 2W55A 3B9JB 4PWCA 3PM9A 2YVSA 1N5WC 2UUVA 2VFSA 5FXDA 3TSHA 5L6GA 4O95A 3S1DA 1E0YA 1WYGA 5HHZA 2UUUA 1JROA 3FW9A 2R8DA 1MBBA 2P3HA 1N63C 3GSYA 2QKNA 3AM9A 1DZNA 2W3RA 1DIQA 2AXRA 1W1MA 2P13A 4DNSA 2BVGA 4PZFA 3D2HA 3S1CA 3LLBA 3RJ8A 4PWBA 3C0PA 4PVEA 5FXEA 2Q85A 3TSJA 4PVJA 5ADZA 2Y4GA 3D2JA 2PLIA 3NRZB 5G5GB 3JS8A 2PLSA 1FIQB 5AE1A 1W1LA 1QLTA 4JB1A 1N5XA 1QLUA 4HG0A 1W1OA 5AE2A 2OAIA 2EXRA 1I19A 2IPIA 1RM6B 2VFTA 3I99A 4PYTA 4BC9A 1ZR6A 1E8HA 2BVFA 2QPMA 3DEDA 5HMRA 1VAOA 2R2ZA 2I0KA 2P4PA 2VFUA 3BW7A 3POPA 2VAOA 3NVYB 1N60C 3NS1B 2MBRA 3AMZA 4OALA 1WVFA 2WDWA 1FFVC 3FW7A 1ZXIC 5AWVA 5L6FA 3FWAA 5FXPA 3TX1A 5I1VA 2NQWA 4ML8A 1HSKA 3S1EA 5G5HB 3FW8A 4PVKA 2Y3SA 3SR6B 4JAYA 1W1RA 4UD8A 2W3SA 3NVZB 2VFVA 1W1JA 3EUB3 3HRDC 1VDVA 1T3QC 4PVHA 3PQBA 3W8ZA 1F0XA 1AHZA 3DQ0A 1FO4A 4BCAA 2GQUA 1JRPA 2Y3RA 1V97A 2RK5A 3KJMA 3W8XA 1N61C 2Y08A 2W54A 3NVVB 2O3GA 5AE3A 3ETRB 1W1QA 3RJAA 5I1WA 3D2DA 1FFUC 1SB3B 1DIIA 3AN1A 4ZOHB 1W1KA 4BC7A 1WVEA 2GQTA 1AHVA 3HSUA 1AHUA 5D79A 3VTEA 1E8GA 4MLAA 5HQXA 1N62C 2BVHA 3S1FA 5K8EA 2VFRA 1MBTA 1E8FA 4XLOA 4BBYA 1UXYA 2Q4WA 3NVWB 5FXFA 4EC3A
chains in the Genus database with same CATH topology
2E3TA 3W8WA 3LAEA 1W1SA 2W55A 3B9JB 4PWCA 3PM9A 2YVSA 1N5WC 2UUVA 2VFSA 5FXDA 3TSHA 5L6GA 4O95A 3S1DA 1E0YA 1WYGA 5HHZA 2UUUA 1JROA 3FW9A 2R8DA 1MBBA 2P3HA 1N63C 3GSYA 2QKNA 3AM9A 1DZNA 2W3RA 1DIQA 2AXRA 1W1MA 2P13A 4DNSA 2BVGA 4PZFA 3D2HA 3S1CA 3LLBA 3RJ8A 4PWBA 3C0PA 4PVEA 5FXEA 2Q85A 3TSJA 4PVJA 5ADZA 2Y4GA 3D2JA 2PLIA 3NRZB 5G5GB 3JS8A 2PLSA 1FIQB 5AE1A 1W1LA 1QLTA 4JB1A 1N5XA 1QLUA 4HG0A 1W1OA 5AE2A 2OAIA 2EXRA 1I19A 2IPIA 1RM6B 2VFTA 3I99A 4PYTA 4BC9A 1ZR6A 1E8HA 2BVFA 2QPMA 3DEDA 5HMRA 1VAOA 2R2ZA 2I0KA 2P4PA 2VFUA 3BW7A 3POPA 2VAOA 3NVYB 1N60C 3NS1B 2MBRA 3AMZA 4OALA 1WVFA 2WDWA 1FFVC 3FW7A 1ZXIC 5AWVA 5L6FA 3FWAA 5FXPA 3TX1A 5I1VA 2NQWA 4ML8A 1HSKA 3S1EA 5G5HB 3FW8A 4PVKA 2Y3SA 3SR6B 4JAYA 1W1RA 4UD8A 2W3SA 3NVZB 2VFVA 1W1JA 3EUB3 3HRDC 1VDVA 1T3QC 4PVHA 3PQBA 3W8ZA 1F0XA 1AHZA 3DQ0A 1FO4A 4BCAA 2GQUA 1JRPA 2Y3RA 1V97A 2RK5A 3KJMA 3W8XA 1N61C 2Y08A 2W54A 3NVVB 2O3GA 5AE3A 3ETRB 1W1QA 3RJAA 5I1WA 3D2DA 1FFUC 1SB3B 1DIIA 3AN1A 4ZOHB 1W1KA 4BC7A 1WVEA 2GQTA 1AHVA 3HSUA 1AHUA 5D79A 3VTEA 1E8GA 4MLAA 5HQXA 1N62C 2BVHA 3S1FA 5K8EA 2VFRA 1MBTA 1E8FA 4XLOA 4BBYA 1UXYA 2Q4WA 3NVWB 5FXFA 4EC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3T A;  3W8W A;  3LAE A;  1W1S A;  2W55 A;  3B9J B;  3PM9 A;  2YVS A;  1N5W C;  2VFS A;  5FXD A;  4O95 A;  3S1D A;  1E0Y A;  1WYG A;  5HHZ A;  1JRO A;  2R8D A;  1MBB A;  2P3H A;  1N63 C;  2QKN A;  3AM9 A;  1DZN A;  2W3R A;  1DIQ A;  2AXR A;  1W1M A;  2P13 A;  2BVG A;  3S1C A;  3LLB A;  3C0P A;  5FXE A;  2Q85 A;  5ADZ A;  2PLI A;  3NRZ B;  5G5G B;  3JS8 A;  2PLS A;  1FIQ B;  5AE1 A;  1W1L A;  1QLT A;  4JB1 A;  1N5X A;  1QLU A;  4HG0 A;  1W1O A;  5AE2 A;  2OAI A;  2EXR A;  1I19 A;  2VFT A;  1RM6 B;  3I99 A;  4PYT A;  4BC9 A;  1ZR6 A;  1E8H A;  2BVF A;  2QPM A;  3DED A;  5HMR A;  1VAO A;  2R2Z A;  2I0K A;  2P4P A;  2VFU A;  3BW7 A;  2VAO A;  3NVY B;  1N60 C;  3NS1 B;  2MBR A;  3AMZ A;  4OAL A;  1WVF A;  1FFV C;  1ZXI C;  5FXP A;  3TX1 A;  2NQW A;  4ML8 A;  1HSK A;  3S1E A;  5G5H B;  3SR6 B;  4JAY A;  1W1R A;  2W3S A;  3NVZ B;  2VFV A;  1W1J A;  3EUB 3;  3HRD C;  1VDV A;  1T3Q C;  3W8Z A;  1F0X A;  1AHZ A;  3DQ0 A;  1FO4 A;  4BCA A;  2GQU A;  1JRP A;  1V97 A;  2RK5 A;  3KJM A;  3W8X A;  1N61 C;  2W54 A;  3NVV B;  2O3G A;  5AE3 A;  3ETR B;  1W1Q A;  1FFU C;  1SB3 B;  1DII A;  3AN1 A;  4ZOH B;  1W1K A;  4BC7 A;  1WVE A;  2GQT A;  1AHV A;  1AHU A;  1E8G A;  4MLA A;  5HQX A;  1N62 C;  2BVH A;  3S1F A;  2VFR A;  1MBT A;  1E8F A;  4XLO A;  4BBY A;  1UXY A;  2Q4W A;  3NVW B;  5FXF A; 
#chains in the Genus database with same CATH topology
 2E3T A;  3W8W A;  3LAE A;  1W1S A;  2W55 A;  3B9J B;  4PWC A;  3PM9 A;  2YVS A;  1N5W C;  2UUV A;  2VFS A;  5FXD A;  3TSH A;  5L6G A;  4O95 A;  3S1D A;  1E0Y A;  1WYG A;  5HHZ A;  2UUU A;  1JRO A;  3FW9 A;  2R8D A;  1MBB A;  2P3H A;  1N63 C;  3GSY A;  2QKN A;  3AM9 A;  1DZN A;  2W3R A;  1DIQ A;  2AXR A;  1W1M A;  2P13 A;  4DNS A;  2BVG A;  4PZF A;  3D2H A;  3S1C A;  3LLB A;  3RJ8 A;  4PWB A;  3C0P A;  4PVE A;  5FXE A;  2Q85 A;  3TSJ A;  4PVJ A;  5ADZ A;  2Y4G A;  3D2J A;  2PLI A;  3NRZ B;  5G5G B;  3JS8 A;  2PLS A;  1FIQ B;  5AE1 A;  1W1L A;  1QLT A;  4JB1 A;  1N5X A;  1QLU A;  4HG0 A;  1W1O A;  5AE2 A;  2OAI A;  2EXR A;  1I19 A;  2IPI A;  1RM6 B;  2VFT A;  3I99 A;  4PYT A;  4BC9 A;  1ZR6 A;  1E8H A;  2BVF A;  2QPM A;  3DED A;  5HMR A;  1VAO A;  2R2Z A;  2I0K A;  2P4P A;  2VFU A;  3BW7 A;  3POP A;  2VAO A;  3NVY B;  1N60 C;  3NS1 B;  2MBR A;  3AMZ A;  4OAL A;  1WVF A;  2WDW A;  1FFV C;  3FW7 A;  1ZXI C;  5AWV A;  5L6F A;  3FWA A;  5FXP A;  3TX1 A;  5I1V A;  2NQW A;  4ML8 A;  1HSK A;  3S1E A;  5G5H B;  3FW8 A;  4PVK A;  2Y3S A;  3SR6 B;  4JAY A;  1W1R A;  4UD8 A;  2W3S A;  3NVZ B;  2VFV A;  1W1J A;  3EUB 3;  3HRD C;  1VDV A;  1T3Q C;  4PVH A;  3PQB A;  3W8Z A;  1F0X A;  1AHZ A;  3DQ0 A;  1FO4 A;  4BCA A;  2GQU A;  1JRP A;  2Y3R A;  1V97 A;  2RK5 A;  3KJM A;  3W8X A;  1N61 C;  2Y08 A;  2W54 A;  3NVV B;  2O3G A;  5AE3 A;  3ETR B;  1W1Q A;  3RJA A;  5I1W A;  3D2D A;  1FFU C;  1SB3 B;  1DII A;  3AN1 A;  4ZOH B;  1W1K A;  4BC7 A;  1WVE A;  2GQT A;  1AHV A;  3HSU A;  1AHU A;  5D79 A;  3VTE A;  1E8G A;  4MLA A;  5HQX A;  1N62 C;  2BVH A;  3S1F A;  5K8E A;  2VFR A;  1MBT A;  1E8F A;  4XLO A;  4BBY A;  1UXY A;  2Q4W A;  3NVW B;  5FXF A;  4EC3 A; 
#chains in the Genus database with same CATH homology
 2E3T A;  3W8W A;  3LAE A;  1W1S A;  2W55 A;  3B9J B;  4PWC A;  3PM9 A;  2YVS A;  1N5W C;  2UUV A;  2VFS A;  5FXD A;  3TSH A;  5L6G A;  4O95 A;  3S1D A;  1E0Y A;  1WYG A;  5HHZ A;  2UUU A;  1JRO A;  3FW9 A;  2R8D A;  1MBB A;  2P3H A;  1N63 C;  3GSY A;  2QKN A;  3AM9 A;  1DZN A;  2W3R A;  1DIQ A;  2AXR A;  1W1M A;  2P13 A;  4DNS A;  2BVG A;  4PZF A;  3D2H A;  3S1C A;  3LLB A;  3RJ8 A;  4PWB A;  3C0P A;  4PVE A;  5FXE A;  2Q85 A;  3TSJ A;  4PVJ A;  5ADZ A;  2Y4G A;  3D2J A;  2PLI A;  3NRZ B;  5G5G B;  3JS8 A;  2PLS A;  1FIQ B;  5AE1 A;  1W1L A;  1QLT A;  4JB1 A;  1N5X A;  1QLU A;  4HG0 A;  1W1O A;  5AE2 A;  2OAI A;  2EXR A;  1I19 A;  2IPI A;  1RM6 B;  2VFT A;  3I99 A;  4PYT A;  4BC9 A;  1ZR6 A;  1E8H A;  2BVF A;  2QPM A;  3DED A;  5HMR A;  1VAO A;  2R2Z A;  2I0K A;  2P4P A;  2VFU A;  3BW7 A;  3POP A;  2VAO A;  3NVY B;  1N60 C;  3NS1 B;  2MBR A;  3AMZ A;  4OAL A;  1WVF A;  2WDW A;  1FFV C;  3FW7 A;  1ZXI C;  5AWV A;  5L6F A;  3FWA A;  5FXP A;  3TX1 A;  5I1V A;  2NQW A;  4ML8 A;  1HSK A;  3S1E A;  5G5H B;  3FW8 A;  4PVK A;  2Y3S A;  3SR6 B;  4JAY A;  1W1R A;  4UD8 A;  2W3S A;  3NVZ B;  2VFV A;  1W1J A;  3EUB 3;  3HRD C;  1VDV A;  1T3Q C;  4PVH A;  3PQB A;  3W8Z A;  1F0X A;  1AHZ A;  3DQ0 A;  1FO4 A;  4BCA A;  2GQU A;  1JRP A;  2Y3R A;  1V97 A;  2RK5 A;  3KJM A;  3W8X A;  1N61 C;  2Y08 A;  2W54 A;  3NVV B;  2O3G A;  5AE3 A;  3ETR B;  1W1Q A;  3RJA A;  5I1W A;  3D2D A;  1FFU C;  1SB3 B;  1DII A;  3AN1 A;  4ZOH B;  1W1K A;  4BC7 A;  1WVE A;  2GQT A;  1AHV A;  3HSU A;  1AHU A;  5D79 A;  3VTE A;  1E8G A;  4MLA A;  5HQX A;  1N62 C;  2BVH A;  3S1F A;  5K8E A;  2VFR A;  1MBT A;  1E8F A;  4XLO A;  4BBY A;  1UXY A;  2Q4W A;  3NVW B;  5FXF A;  4EC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...