2RK5A

Crystal structure of a domain of the putative hemolysin from streptococcus mutans ua159
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
QSREIADNTYIVLGTMTLNDFNEYFETDLESDNVDTIAGFYLTGVGTIPSQEEKEHFEVESNGKHLELINDKVKDGRVTKLKILVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hemolysin
publication title The crystal structure of a domain of the putative hemolysin from Streptococcus mutans UA159.
rcsb
source organism Streptococcus mutans ua159
molecule tags Toxin
total genus 19
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2007-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2rk5A00
2VFSA 2R8DA 1W1KA 3AMZA 2Q85A 1FIQB 2GQTA 1V97A 1I19A 2P13A 5HQXA 5HHZA 5FXFA 1DIIA 2Q4WA 3KJMA 1RM6B 1UXYA 2RK5A 3W8ZA 5ADZA 1E0YA 1WYGA 3SR6B 2I0KA 1F0XA 5FXEA 4JB1A 1E8FA 1N61C 1QLTA 2PLSA 4XLOA 1E8HA 5FXDA 1FO4A 3C0PA 4JAYA 4ML8A 1QLUA 2W55A 3BW7A 1FFUC 1MBTA 2NQWA 2OAIA 4BC7A 3LLBA 1N62C 2AXRA 2MBRA 1W1SA 2QKNA 1N5WC 1N63C 3I99A 4ZOHB 5AE3A 1MBBA 3EUB3 1DIQA 3NVVB 3NS1B 3PM9A 5G5HB 3S1FA 1HSKA 1JROA 1N5XA 2P3HA 3NVYB 4MLAA 1VDVA 1W1QA 3W8XA 1W1JA 1W1RA 2VFRA 4PYTA 3TX1A 1JRPA 5AE2A 1WVFA 3S1EA 2W3SA 1WVEA 1W1OA 3S1DA 4OALA 5G5GB 5HMRA 2YVSA 1DZNA 3NVZB 4BC9A 3AN1A 1SB3B 3NVWB 2PLIA 1N60C 3AM9A 2W3RA 3W8WA 2BVGA 2VFUA 3LAEA 2VFTA 3ETRB 5FXPA 3JS8A 2O3GA 1E8GA 2R2ZA 4BBYA 3NRZB 3DEDA 2BVFA 2GQUA 4BCAA 3HRDC 1AHUA 5AE1A 1ZXIC 2P4PA 2EXRA 1VAOA 2E3TA 1AHZA 4O95A 2BVHA 1AHVA 3S1CA 1W1LA 1W1MA 2VFVA 1T3QC 2QPMA 1ZR6A 2W54A 3B9JB 4HG0A 1FFVC 3DQ0A 2VAOA
chains in the Genus database with same CATH superfamily
2VFSA 3FW7A 2R8DA 1W1KA 3AMZA 2Q85A 3D2HA 4PZFA 1FIQB 2GQTA 1V97A 1I19A 2P13A 5HQXA 5HHZA 5FXFA 1DIIA 2Q4WA 3KJMA 4PVKA 4PWBA 1RM6B 1UXYA 2RK5A 3W8ZA 5ADZA 3TSJA 5L6FA 1E0YA 1WYGA 3SR6B 2I0KA 1F0XA 5FXEA 4JB1A 3PQBA 1E8FA 5I1WA 5L6GA 3FW9A 1N61C 1QLTA 2UUVA 2PLSA 4XLOA 1E8HA 5K8EA 3D2DA 5FXDA 1FO4A 3C0PA 4JAYA 3HSUA 4ML8A 4PVJA 5I1VA 1QLUA 2W55A 3BW7A 3TSHA 3RJAA 1FFUC 2UUUA 1MBTA 3POPA 4UD8A 2WDWA 2NQWA 2OAIA 4BC7A 3LLBA 1N62C 2AXRA 2MBRA 2Y3RA 1W1SA 2QKNA 1N5WC 1N63C 3I99A 4ZOHB 5AE3A 3FW8A 1MBBA 3EUB3 1DIQA 3NVVB 3NS1B 3PM9A 5G5HB 3S1FA 1HSKA 4PVHA 1JROA 1N5XA 2P3HA 3NVYB 4PVEA 4MLAA 1VDVA 1W1QA 3W8XA 1W1JA 1W1RA 2VFRA 4PYTA 3TX1A 3VTEA 1JRPA 5AE2A 1WVFA 3S1EA 2W3SA 1WVEA 1W1OA 3S1DA 4OALA 5G5GB 5HMRA 4PWCA 2IPIA 2YVSA 1DZNA 3NVZB 4BC9A 3AN1A 1SB3B 3NVWB 2PLIA 4DNSA 1N60C 3AM9A 3RJ8A 2W3RA 3W8WA 2BVGA 2VFUA 2Y08A 5D79A 3LAEA 2VFTA 3ETRB 5FXPA 3JS8A 3D2JA 2O3GA 1E8GA 2R2ZA 4BBYA 3NRZB 3DEDA 2BVFA 2GQUA 4EC3A 4BCAA 3GSYA 3HRDC 2Y3SA 1AHUA 5AE1A 1ZXIC 2P4PA 2EXRA 1VAOA 2E3TA 1AHZA 4O95A 2BVHA 5AWVA 1AHVA 3S1CA 1W1LA 1W1MA 2VFVA 1T3QC 2QPMA 1ZR6A 2W54A 3B9JB 4HG0A 1FFVC 2Y4GA 3FWAA 3DQ0A 2VAOA
chains in the Genus database with same CATH topology
2VFSA 3FW7A 2R8DA 1W1KA 3AMZA 2Q85A 3D2HA 4PZFA 1FIQB 2GQTA 1V97A 1I19A 2P13A 5HQXA 5HHZA 5FXFA 1DIIA 2Q4WA 3KJMA 4PVKA 4PWBA 1RM6B 1UXYA 2RK5A 3W8ZA 5ADZA 3TSJA 5L6FA 1E0YA 1WYGA 3SR6B 2I0KA 1F0XA 5FXEA 4JB1A 3PQBA 1E8FA 5I1WA 5L6GA 3FW9A 1N61C 1QLTA 2UUVA 2PLSA 4XLOA 1E8HA 5K8EA 3D2DA 5FXDA 1FO4A 3C0PA 4JAYA 3HSUA 4ML8A 4PVJA 5I1VA 1QLUA 2W55A 3BW7A 3TSHA 3RJAA 1FFUC 2UUUA 1MBTA 3POPA 4UD8A 2WDWA 2NQWA 2OAIA 4BC7A 3LLBA 1N62C 2AXRA 2MBRA 2Y3RA 1W1SA 2QKNA 1N5WC 1N63C 3I99A 4ZOHB 5AE3A 3FW8A 1MBBA 3EUB3 1DIQA 3NVVB 3NS1B 3PM9A 5G5HB 3S1FA 1HSKA 4PVHA 1JROA 1N5XA 2P3HA 3NVYB 4PVEA 4MLAA 1VDVA 1W1QA 3W8XA 1W1JA 1W1RA 2VFRA 4PYTA 3TX1A 3VTEA 1JRPA 5AE2A 1WVFA 3S1EA 2W3SA 1WVEA 1W1OA 3S1DA 4OALA 5G5GB 5HMRA 4PWCA 2IPIA 2YVSA 1DZNA 3NVZB 4BC9A 3AN1A 1SB3B 3NVWB 2PLIA 4DNSA 1N60C 3AM9A 3RJ8A 2W3RA 3W8WA 2BVGA 2VFUA 2Y08A 5D79A 3LAEA 2VFTA 3ETRB 5FXPA 3JS8A 3D2JA 2O3GA 1E8GA 2R2ZA 4BBYA 3NRZB 3DEDA 2BVFA 2GQUA 4EC3A 4BCAA 3GSYA 3HRDC 2Y3SA 1AHUA 5AE1A 1ZXIC 2P4PA 2EXRA 1VAOA 2E3TA 1AHZA 4O95A 2BVHA 5AWVA 1AHVA 3S1CA 1W1LA 1W1MA 2VFVA 1T3QC 2QPMA 1ZR6A 2W54A 3B9JB 4HG0A 1FFVC 2Y4GA 3FWAA 3DQ0A 2VAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VFS A;  2R8D A;  1W1K A;  3AMZ A;  2Q85 A;  1FIQ B;  2GQT A;  1V97 A;  1I19 A;  2P13 A;  5HQX A;  5HHZ A;  5FXF A;  1DII A;  2Q4W A;  3KJM A;  1RM6 B;  1UXY A;  2RK5 A;  3W8Z A;  5ADZ A;  1E0Y A;  1WYG A;  3SR6 B;  2I0K A;  1F0X A;  5FXE A;  4JB1 A;  1E8F A;  1N61 C;  1QLT A;  2PLS A;  4XLO A;  1E8H A;  5FXD A;  1FO4 A;  3C0P A;  4JAY A;  4ML8 A;  1QLU A;  2W55 A;  3BW7 A;  1FFU C;  1MBT A;  2NQW A;  2OAI A;  4BC7 A;  3LLB A;  1N62 C;  2AXR A;  2MBR A;  1W1S A;  2QKN A;  1N5W C;  1N63 C;  3I99 A;  4ZOH B;  5AE3 A;  1MBB A;  3EUB 3;  1DIQ A;  3NVV B;  3NS1 B;  3PM9 A;  5G5H B;  3S1F A;  1HSK A;  1JRO A;  1N5X A;  2P3H A;  3NVY B;  4MLA A;  1VDV A;  1W1Q A;  3W8X A;  1W1J A;  1W1R A;  2VFR A;  4PYT A;  3TX1 A;  1JRP A;  5AE2 A;  1WVF A;  3S1E A;  2W3S A;  1WVE A;  1W1O A;  3S1D A;  4OAL A;  5G5G B;  5HMR A;  2YVS A;  1DZN A;  3NVZ B;  4BC9 A;  3AN1 A;  1SB3 B;  3NVW B;  2PLI A;  1N60 C;  3AM9 A;  2W3R A;  3W8W A;  2BVG A;  2VFU A;  3LAE A;  2VFT A;  3ETR B;  5FXP A;  3JS8 A;  2O3G A;  1E8G A;  2R2Z A;  4BBY A;  3NRZ B;  3DED A;  2BVF A;  2GQU A;  4BCA A;  3HRD C;  1AHU A;  5AE1 A;  1ZXI C;  2P4P A;  2EXR A;  1VAO A;  2E3T A;  1AHZ A;  4O95 A;  2BVH A;  1AHV A;  3S1C A;  1W1L A;  1W1M A;  2VFV A;  1T3Q C;  2QPM A;  1ZR6 A;  2W54 A;  3B9J B;  4HG0 A;  1FFV C;  3DQ0 A;  2VAO A; 
#chains in the Genus database with same CATH topology
 2VFS A;  3FW7 A;  2R8D A;  1W1K A;  3AMZ A;  2Q85 A;  3D2H A;  4PZF A;  1FIQ B;  2GQT A;  1V97 A;  1I19 A;  2P13 A;  5HQX A;  5HHZ A;  5FXF A;  1DII A;  2Q4W A;  3KJM A;  4PVK A;  4PWB A;  1RM6 B;  1UXY A;  2RK5 A;  3W8Z A;  5ADZ A;  3TSJ A;  5L6F A;  1E0Y A;  1WYG A;  3SR6 B;  2I0K A;  1F0X A;  5FXE A;  4JB1 A;  3PQB A;  1E8F A;  5I1W A;  5L6G A;  3FW9 A;  1N61 C;  1QLT A;  2UUV A;  2PLS A;  4XLO A;  1E8H A;  5K8E A;  3D2D A;  5FXD A;  1FO4 A;  3C0P A;  4JAY A;  3HSU A;  4ML8 A;  4PVJ A;  5I1V A;  1QLU A;  2W55 A;  3BW7 A;  3TSH A;  3RJA A;  1FFU C;  2UUU A;  1MBT A;  3POP A;  4UD8 A;  2WDW A;  2NQW A;  2OAI A;  4BC7 A;  3LLB A;  1N62 C;  2AXR A;  2MBR A;  2Y3R A;  1W1S A;  2QKN A;  1N5W C;  1N63 C;  3I99 A;  4ZOH B;  5AE3 A;  3FW8 A;  1MBB A;  3EUB 3;  1DIQ A;  3NVV B;  3NS1 B;  3PM9 A;  5G5H B;  3S1F A;  1HSK A;  4PVH A;  1JRO A;  1N5X A;  2P3H A;  3NVY B;  4PVE A;  4MLA A;  1VDV A;  1W1Q A;  3W8X A;  1W1J A;  1W1R A;  2VFR A;  4PYT A;  3TX1 A;  3VTE A;  1JRP A;  5AE2 A;  1WVF A;  3S1E A;  2W3S A;  1WVE A;  1W1O A;  3S1D A;  4OAL A;  5G5G B;  5HMR A;  4PWC A;  2IPI A;  2YVS A;  1DZN A;  3NVZ B;  4BC9 A;  3AN1 A;  1SB3 B;  3NVW B;  2PLI A;  4DNS A;  1N60 C;  3AM9 A;  3RJ8 A;  2W3R A;  3W8W A;  2BVG A;  2VFU A;  2Y08 A;  5D79 A;  3LAE A;  2VFT A;  3ETR B;  5FXP A;  3JS8 A;  3D2J A;  2O3G A;  1E8G A;  2R2Z A;  4BBY A;  3NRZ B;  3DED A;  2BVF A;  2GQU A;  4EC3 A;  4BCA A;  3GSY A;  3HRD C;  2Y3S A;  1AHU A;  5AE1 A;  1ZXI C;  2P4P A;  2EXR A;  1VAO A;  2E3T A;  1AHZ A;  4O95 A;  2BVH A;  5AWV A;  1AHV A;  3S1C A;  1W1L A;  1W1M A;  2VFV A;  1T3Q C;  2QPM A;  1ZR6 A;  2W54 A;  3B9J B;  4HG0 A;  1FFV C;  2Y4G A;  3FWA A;  3DQ0 A;  2VAO A; 
#chains in the Genus database with same CATH homology
 2VFS A;  3FW7 A;  2R8D A;  1W1K A;  3AMZ A;  2Q85 A;  3D2H A;  4PZF A;  1FIQ B;  2GQT A;  1V97 A;  1I19 A;  2P13 A;  5HQX A;  5HHZ A;  5FXF A;  1DII A;  2Q4W A;  3KJM A;  4PVK A;  4PWB A;  1RM6 B;  1UXY A;  2RK5 A;  3W8Z A;  5ADZ A;  3TSJ A;  5L6F A;  1E0Y A;  1WYG A;  3SR6 B;  2I0K A;  1F0X A;  5FXE A;  4JB1 A;  3PQB A;  1E8F A;  5I1W A;  5L6G A;  3FW9 A;  1N61 C;  1QLT A;  2UUV A;  2PLS A;  4XLO A;  1E8H A;  5K8E A;  3D2D A;  5FXD A;  1FO4 A;  3C0P A;  4JAY A;  3HSU A;  4ML8 A;  4PVJ A;  5I1V A;  1QLU A;  2W55 A;  3BW7 A;  3TSH A;  3RJA A;  1FFU C;  2UUU A;  1MBT A;  3POP A;  4UD8 A;  2WDW A;  2NQW A;  2OAI A;  4BC7 A;  3LLB A;  1N62 C;  2AXR A;  2MBR A;  2Y3R A;  1W1S A;  2QKN A;  1N5W C;  1N63 C;  3I99 A;  4ZOH B;  5AE3 A;  3FW8 A;  1MBB A;  3EUB 3;  1DIQ A;  3NVV B;  3NS1 B;  3PM9 A;  5G5H B;  3S1F A;  1HSK A;  4PVH A;  1JRO A;  1N5X A;  2P3H A;  3NVY B;  4PVE A;  4MLA A;  1VDV A;  1W1Q A;  3W8X A;  1W1J A;  1W1R A;  2VFR A;  4PYT A;  3TX1 A;  3VTE A;  1JRP A;  5AE2 A;  1WVF A;  3S1E A;  2W3S A;  1WVE A;  1W1O A;  3S1D A;  4OAL A;  5G5G B;  5HMR A;  4PWC A;  2IPI A;  2YVS A;  1DZN A;  3NVZ B;  4BC9 A;  3AN1 A;  1SB3 B;  3NVW B;  2PLI A;  4DNS A;  1N60 C;  3AM9 A;  3RJ8 A;  2W3R A;  3W8W A;  2BVG A;  2VFU A;  2Y08 A;  5D79 A;  3LAE A;  2VFT A;  3ETR B;  5FXP A;  3JS8 A;  3D2J A;  2O3G A;  1E8G A;  2R2Z A;  4BBY A;  3NRZ B;  3DED A;  2BVF A;  2GQU A;  4EC3 A;  4BCA A;  3GSY A;  3HRD C;  2Y3S A;  1AHU A;  5AE1 A;  1ZXI C;  2P4P A;  2EXR A;  1VAO A;  2E3T A;  1AHZ A;  4O95 A;  2BVH A;  5AWV A;  1AHV A;  3S1C A;  1W1L A;  1W1M A;  2VFV A;  1T3Q C;  2QPM A;  1ZR6 A;  2W54 A;  3B9J B;  4HG0 A;  1FFV C;  2Y4G A;  3FWA A;  3DQ0 A;  2VAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...