4ZOHB

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
277
structure length
274
Chain Sequence
MYPPKFGYVIPDNLNEALEFLEEHQDARPLAGGHSLIPMLKLRLIRPSYIVEIRRFSNLSYITKDGNLYKIGALTTHYNISKSSIPLLSETASNIGDPQVRNMGTIGGSISHLDPSADYPAALIAMDAKVKITSRKGDRVVNFKSFAKDMFTPDLNPGELVTEIQVPTFEGYKFSYQKLERRAGDFAIVGVALLLKLSGDVIEDVRIGLTAVNNVAVRAKGAEEELLGKRLNDEIIEKAATRAMESANPTSGSAEYKKKMVKVLTKRAIITALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 274
sequence length 277
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
B PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4zohB01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 4zohB03
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4zohB02
1I19A 3S1CA 1QLTA 2VFSA 4MLAA 1E0YA 1FO4A 1MBBA 1W1LA 1AHUA 3VTEA 4O95A 3GSYA 3ETRB 4ML8A 3SR6B 2RK5A 1VDVA 3W8XA 2W3RA 3AMZA 3NVZB 3A7AA 2PLSA 1W1QA 1T3QC 5FXFA 3R07C 2NQWA 3FW8A 1QLUA 3A7RA 5FXDA 1ZR6A 1JRPA 3JS8A 2GQTA 4PZFA 3D2JA 2AXRA 1N5XA 4BBYA 2PLIA 3S1FA 1F0XA 1AHVA 4PVEA 2OAIA 3KJMA 1E8FA 2BVHA 2QKNA 1N61C 3NRZB 3DEDA 4JAYA 2MBRA 2VFRA 4PWBA 2GQUA 1VAOA 1W1OA 3NS1B 1N5WC 2VAOA 3LAEA 3AM9A 5AE1A 4TVWA 2Q85A 3TX1A 4ZOHB 1W1MA 3S1DA 3S1EA 5AE2A 5D79A 1E8HA 3FWAA 5G5HB 1VQZA 5FXPA 2E5AA 4HG0A 1W1JA 3BW7A 5HQXA 1DIIA 2W3SA 2P3HA 4PVKA 3FW9A 2BVGA 2VFUA 1JROA 3B9JB 4BCAA 1WVFA 1FFVC 5HMRA 1UXYA 2Q4WA 4DNSA 1DIQA 1SB3B 2I0KA 4OALA 4PWCA 1N63C 5ADZA 1WVEA 2R2ZA 1FIQB 3LLBA 2W54A 3AN1A 3TSHA 1E8GA 2QPMA 1MBTA 4TVYA 2R8DA 3FW7A 1WYGA 3I99A 2VFTA 4PVJA 4PVHA 3PM9A 5FXEA 1AHZA 3W8ZA 4BC9A 1X2GA 3NVVB 5G5GB 3C0PA 1N60C 2O3GA 1X2HA 2YVSA 2BVFA 3NVWB 3W8WA 2VFVA 1RM6B 3HRDC 1N62C 2EXRA 4UD8A 2W55A 3A7UA 4XLOA 3D2HA 1W1SA 5HHZA 4EC3A 1FFUC 5AE3A 3DQ0A 1W1RA 4PYTA 2P4PA 2E3TA 3EUB3 4BC7A 1DZNA 2P13A 3D2DA 3NVYB 1W1KA 1HSKA 4JB1A 1V97A 3TSJA 1ZXIC
chains in the Genus database with same CATH superfamily
4X2PA 1I19A 2PP0A 5L6FA 2VFSA 4HPNA 1E0YA 1NDAA 2AKZA 3V4BA 2PP1A 1W1LA 3CGBA 3VTEA 1F8WA 1XS2A 2BC0A 1MNSA 2OX4A 4O95A 3GSYA 1W6TA 2ZC8A 3SR6B 2YVFA 3FJ4A 3DFHA 2W3RA 4IT1A 4JDRA 1ZK7A 1T3QC 3VCNA 2C3CA 1MUCA 4HCHA 1TE6A 1F9CA 2WPFA 3FW8A 1AOGA 3A7RA 3CK5A 5FXDA 2A8XA 2CDUA 2P88A 3EEZA 2POZA 2GQTA 5JCKA 4KEMA 2PGEA 2FYMA 2V3BA 3FXGA 2ZZBA 1N5XA 3DGBA 3S1FA 3EJEB 4GGBA 4K7ZA 5ER0A 1GETA 1LPFA 4PVEA 4NEWA 2C3DA 4DXKA 2OG9A 2PS2A 4EQWA 2OFJA 1ZKQA 2HQMA 1NPXA 3SN1A 1NELA 3DEDA 4PWBA 1ZMDA 1M6IA 4IZGA 2WBAA 3GD4A 3UJFA 3ZLFA 5IDZA 2QQ6A 3STPA 3EJBB 3SJNA 5EBKA 1ONEA 4H2HA 4EM3A 3T6CA 1JOAA 2WP5A 3PK7A 4IP4A 4ZOHB 2HXUA 2YVGA 1W1MA 3DGHA 3FVDA 2PTYA 5FS7A 1K4QA 5D79A 1EBDA 2AL2B 1XHCA 4APNA 3UJ2A 4HG0A 2X8GA 2X8CA 3Q45A 2PTZA 4KPRA 2WOVA 2RABA 1YEYA 3TJIA 3GC2A 2OLAA 3B97A 1JCTA 3B9JB 1WVFA 1RVKA 5U25A 1UXYA 2Q4WA 3P93A 2GGJA 3THUA 2GH5A 3T4WA 2HNEA 2YAUA 3TOYA 1WVEA 4FX9A 3LLBA 3AN1A 3VC5A 1MO9A 3RJ8A 3UCDA 4GGHA 4H4SA 2QAEA 2QPMA 5JCIA 1MBTA 2UUVA 3RJAA 3II4A 4G8TA 3FW7A 2OQHA 5G5GB 3PM9A 3NVVB 5L6GA 1X2HA 2OO6A 2AAQA 4H83A 2R9ZA 3DJGX 1N62C 2W55A 1H6VA 2YQUA 4XLOA 3N6JA 5J04A 2QJJA 2PGWA 1ZDLA 4ADWA 3VC6A 5AE3A 3ENLA 4H19A 3MKCA 2PTXA 4HN8A 1GRGA 4FDCB 3UJEA 2E3TA 3UXLA 1R0MA 3CGDA 1TYPA 1W1KA 3QTPA 3MWCA 1ZXIC 1FECA 3POPA 1L8PA 3OC4A 2P3HA 3IC9A 5FJPA 3N4EA 4H4ZA 3ZLHA 3ETRB 4ML8A 1VDVA 1WUEA 3W8XA 3U9IA 3R11A 5I1VA 5FXFA 2NQWA 3DJJA 3BJSA 1GRAA 2ZADA 1ZR6A 2AKMA 4MGGA 1KCZA 1JPMA 3I4KA 4GYPA 5FJOA 1ZX9A 3D2JA 4J57A 4GR1A 1GSNA 2ONEA 3IK4A 3TWAA 3CT2A 1AHVA 2WP6A 3NXLA 3KJMA 2QKNA 4K8GA 4A3RA 4H4XA 4ZCWA 1DXLA 3V3WA 1NU5A 2RDXA 3T9PA 2EQ8A 4K8DA 1NHQA 3TJ4A 2GR1A 4LA1A 5BOEA 3LAEA 4EQSA 2MNRA 2PU1A 2QDEA 3RNMA 4TVWA 1TYTA 2Q85A 1GESA 3TX1A 1TZZA 4HCDA 5AWVA 3RITA 1GV4A 1EC9A 5KVHA 3QFBA 3ES7A 3OZMA 2PPGA 1NHRA 2JK6A 5JRBA 5G5HB 2E5AA 3I6EA 2X50A 3I6TA 1EBGA 3FCPA 3OTRA 1BZLA 3SN0A 3BW7A 2GR3A 1KN0A 2P8CA 5HQXA 4EMWA 2IPIA 3DESA 5GRTA 3DK4A 3GD3A 3LB8A 2OVLA 3FW9A 3DH9A 1SJCA 3P3BA 3PWIA 4FI4A 4E6MA 2VFUA 1JROA 5HMRA 3FYYA 1FEBA 2NVKX 1DTNA 1GRHA 2P8BA 1WUFA 1H2IA 3EJDB 3FG2P 4E4FA 4OALA 3PFRA 1FEAA 5ADZA 3EAOA 3R0KA 5FS9A 3PWGA 5K8EA 1OEPA 1P43A 4DX3A 2GGGA 2OZ8A 4TVYA 3MQTA 2BC1A 2R8DA 3W8ZA 4JN7A 2VFTA 4PVJA 4PVHA 2AL1A 2PCEA 3Q4DA 3Q6JA 4GMEA 4G7FA 4ENLA 2UUUA 2CFYA 3NVWB 3W8WA 2VFVA 3BSMA 3HRDC 3DFYA 3SSZA 3VDGA 2WPEA 3A7UA 3BOXA 4BV6A 4HNLA 4JQ9A 1XDIA 3DGZA 2AL2A 4GFIA 4J3ZA 1LVLA 4PYTA 2P4PA 2PSNA 4M52A 3EUB3 3ZVIA 2P13A 1IYXA 4NEVA 2TPRA 4DN1A 2GGEA 3ES8A 3LADA 3DK8A 1ELSA 4ROPA 2O3GA 3S1CA 1QLTA 1XPYA 2GGIA 4MMWA 4H4UA 3URHA 1SJBA 2QVHA 1AHUA 4EQRA 3MZNA 3OW1A 3H12A 1GREA 1GXFA 1XANA 5U1OA 2PA6A 3A7AA 2PLSA 1DNCA 2Y3SA 2WPCA 3UGVA 1JPDX 1MDLA 2EQ9A 3D46A 4JN8A 5ENLA 2OPJA 1GRFA 3JS8A 3QLDA 4PZFA 3GRSA 4DHGA 2GRTA 2V3AA 2WDWA 3H8AA 3ZVHB 2Y08A 3RR1A 1F0XA 1STZA 3TQPA 5TR3A 2OAIA 1E8FA 4KT2A 2NQLA 2HXTA 4H4TA 1N61C 4JAYA 2MBRA 2VFRA 1GRTA 2GQUA 1VAOA 2XH4A 3NS1B 5JCMA 1N5WC 2OKTA 4A6GA 4ZA0A 3SQSA 2I5QA 5FJUA 1MRAA 5AE1A 4M0XA 3UJRA 4H4YA 3VCCA 3JW7A 3MY9A 1TKKA 3QKEA 2EQ6A 4HYRA 2XGZA 1FHUA 5AE2A 1GERA 1E8HA 1VQZA 3GD6A 2P0IA 1KD0A 3CXOA 3CXBA 1DIIA 4LIIA 2BVGA 4Z17A 1SJAA 4BCAA 2QJNA 1FFVC 1KKOA 5BOFA 4DNSA 4E5TA 3GO2A 3TCSA 1DIQA 5FJTA 2HZGA 3DG7A 3R10A 3SBFA 1FIQB 3DERA 4GISA 2W54A 4F4RA 3TSHA 2XH0A 4Z1YA 4MKSA 1E8GA 2PU0A 3TTEA 2QDDA 3MSYA 5FMHA 1R6WA 2WOIA 3VA8A 3I99A 4H4PA 2EQ7A 5FXEA 1AHZA 4BC9A 1X2GA 3GY1A 2PP3A 3C0PA 1E9IA 2YVSA 1YQZA 1RM6B 3DG3A 4UD8A 2OZTA 3CB3A 4DYEA 1W1SA 5HHZA 4EC3A 3HPFA 3O0HA 3H70A 2F5ZA 3K1GA 2XSXA 2XH2A 2GQWA 4H1ZA 3ZLGA 4K1WA 3DQ0A 3UCCA 1W1RA 1MOKA 3NZGA 2BCPA 2MUCA 2WOWA 3NVYB 3QFAA 3H7VA 1HSKA 4JB1A 4J1OA 2GL5A 3OZYA 1N60C 3TSJA 1PDYA 3IJLA 4JHMA 1EBHA 3MUCA 4MLAA 3V5FA 1FO4A 1MBBA 2FKPA 1BQGA 1ZY8A 3CGCA 3EF6A 1NHSA 3NFUA 2PTWA 3PG6A 4EWJA 2V6OA 3S5SA 1GEUA 4H50A 5EU9A 5FS6A 2OZ3A 3SQPA 4GYPC 3AMZA 3NVZB 2GSHA 6ENLA 1W1QA 4FP1A 1BWCA 2PMQA 3R07C 3DK9A 1QLUA 3NO1A 4H4QA 1JRPA 1EC8A 3L5OA 3R25A 1ZMCA 1OJTA 3KUMA 4K2SA 2GR2A 4GRTA 4EM4A 3QN3A 1MDRA 3HSUA 3PQBA 5KVIA 2AXRA 4BBYA 3U4FA 2PLIA 4GIRA 4IHCA 3TW9A 2GDQA 4IP5A 3D9XA 3RCYA 5FS8A 2BVHA 1P48A 1ECQA 3L8KA 3TWBA 3NRZB 1Q1RA 3N4FA 4H4RA 1W1OA 4BURA 3FV9A 1ONFA 4J56A 2ZZ0A 2QJMA 1JEHA 1V59A 4EQXA 2VAOA 3AM9A 4DNAA 4IL0A 7ENLA 4EMIA 3DG6A 2X99A 3D47A 3CGEA 1D7YA 1KKRA 4KWSA 3N6HA 3S1DA 3R1ZA 3S1EA 2W0HA 3FWAA 5FXPA 1GRBA 1EC7A 1W1JA 2O56A 2W3SA 3S47A 4PVKA 3SN4A 4M6UA 1PDZA 3RO6A 3OP2A 3ZVHA 2DW7A 2GGHA 3RRAA 4A35A 1Q1WA 3UJSA 3IJIA 3R0UA 3DDMA 3JVAA 1SB3B 2I0KA 4PWCA 2GR0A 1N63C 2R2ZA 3VFCA 2OQYA 1BKHA 3H4KA 3RGTA 1NHPA 3EANA 3V5CA 1JDFA 3DEQA 2Y3RA 1WYGA 3HW2A 4YWSA 2NPXA 3IJQA 4YWOA 2QGYA 2J3NA 4HNCA 2BVFA 2XH7A 4IL2A 4HCLA 2EXRA 1S7MA 4E4UA 4EMJA 4DWDA 2Y4GA 3D2HA 1SJDA 5I1WA 3KLJA 4H4WA 3OPSA 1FFUC 3T8QA 2CHRA 5JCNA 3CYJA 2DW6A 3QPEA 1FHVA 2PODA 5FJRA 4H4VA 2X8HA 3CAWA 3UXKA 3EKGA 2P3ZA 2YVJA 3DIPA 5JCLA 4KPLA 4BC7A 1DZNA 3GRTA 3D2DA 3JZUA 3LXDA 3P0WA 2ZZCA 4E8GA 1F3PA 1V97A 2RK5A
chains in the Genus database with same CATH topology
3POPA 1I19A 3S1CA 1QLTA 5L6FA 2VFSA 4MLAA 1E0YA 1FO4A 1MBBA 1W1LA 1AHUA 3VTEA 4O95A 3GSYA 3ETRB 4ML8A 3SR6B 2RK5A 1VDVA 3W8XA 2W3RA 3AMZA 3NVZB 3A7AA 2PLSA 1W1QA 1T3QC 2Y3SA 5FXFA 3R07C 2NQWA 3FW8A 1QLUA 3A7RA 5FXDA 1ZR6A 1JRPA 3JS8A 2GQTA 4PZFA 3D2JA 3HSUA 2WDWA 3PQBA 2AXRA 1N5XA 4BBYA 2PLIA 2Y08A 3S1FA 1F0XA 1AHVA 4PVEA 2OAIA 3KJMA 1E8FA 2BVHA 2QKNA 1N61C 3NRZB 3DEDA 4JAYA 2MBRA 2VFRA 4PWBA 2GQUA 1VAOA 1W1OA 3NS1B 1N5WC 2VAOA 3LAEA 3AM9A 5AE1A 4TVWA 2Q85A 3TX1A 4ZOHB 5AWVA 1W1MA 3S1DA 3S1EA 5AE2A 5D79A 1E8HA 3FWAA 5G5HB 1VQZA 5FXPA 2E5AA 4HG0A 1W1JA 3BW7A 5HQXA 1DIIA 2IPIA 5I1VA 2W3SA 2P3HA 4PVKA 3FW9A 2BVGA 2VFUA 1JROA 3B9JB 4BCAA 1WVFA 1FFVC 5HMRA 1UXYA 2Q4WA 4DNSA 1DIQA 1SB3B 2I0KA 4OALA 4PWCA 1N63C 5ADZA 1WVEA 2R2ZA 1FIQB 3LLBA 2W54A 3AN1A 5K8EA 3TSHA 1E8GA 3RJ8A 2QPMA 1MBTA 2Y3RA 2UUVA 4TVYA 3RJAA 2R8DA 3FW7A 1WYGA 3I99A 2VFTA 4PVJA 4PVHA 3PM9A 5FXEA 1AHZA 3W8ZA 4BC9A 1X2GA 3NVVB 5G5GB 3C0PA 1N60C 2O3GA 1X2HA 2YVSA 5L6GA 2UUUA 2BVFA 3NVWB 3W8WA 2VFVA 1RM6B 3HRDC 1N62C 2EXRA 4UD8A 2W55A 3A7UA 2Y4GA 4XLOA 3D2HA 1W1SA 5I1WA 5HHZA 4EC3A 1FFUC 5AE3A 3DQ0A 1W1RA 4PYTA 2P4PA 2E3TA 3EUB3 4BC7A 1DZNA 2P13A 3D2DA 3NVYB 1W1KA 1HSKA 4JB1A 1V97A 3TSJA 1ZXIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I19 A;  3S1C A;  1QLT A;  2VFS A;  4MLA A;  1E0Y A;  1FO4 A;  1MBB A;  1W1L A;  1AHU A;  3VTE A;  4O95 A;  3GSY A;  3ETR B;  4ML8 A;  3SR6 B;  2RK5 A;  1VDV A;  3W8X A;  2W3R A;  3AMZ A;  3NVZ B;  3A7A A;  2PLS A;  1W1Q A;  1T3Q C;  5FXF A;  3R07 C;  2NQW A;  3FW8 A;  1QLU A;  3A7R A;  5FXD A;  1ZR6 A;  1JRP A;  3JS8 A;  2GQT A;  4PZF A;  3D2J A;  2AXR A;  1N5X A;  4BBY A;  2PLI A;  3S1F A;  1F0X A;  1AHV A;  4PVE A;  2OAI A;  3KJM A;  1E8F A;  2BVH A;  2QKN A;  1N61 C;  3NRZ B;  3DED A;  4JAY A;  2MBR A;  2VFR A;  4PWB A;  2GQU A;  1VAO A;  1W1O A;  3NS1 B;  1N5W C;  2VAO A;  3LAE A;  3AM9 A;  5AE1 A;  4TVW A;  2Q85 A;  3TX1 A;  4ZOH B;  1W1M A;  3S1D A;  3S1E A;  5AE2 A;  5D79 A;  1E8H A;  3FWA A;  5G5H B;  1VQZ A;  5FXP A;  2E5A A;  4HG0 A;  1W1J A;  3BW7 A;  5HQX A;  1DII A;  2W3S A;  2P3H A;  4PVK A;  3FW9 A;  2BVG A;  2VFU A;  1JRO A;  3B9J B;  4BCA A;  1WVF A;  1FFV C;  5HMR A;  1UXY A;  2Q4W A;  4DNS A;  1DIQ A;  1SB3 B;  2I0K A;  4OAL A;  4PWC A;  1N63 C;  5ADZ A;  1WVE A;  2R2Z A;  1FIQ B;  3LLB A;  2W54 A;  3AN1 A;  3TSH A;  1E8G A;  2QPM A;  1MBT A;  4TVY A;  2R8D A;  3FW7 A;  1WYG A;  3I99 A;  2VFT A;  4PVJ A;  4PVH A;  3PM9 A;  5FXE A;  1AHZ A;  3W8Z A;  4BC9 A;  1X2G A;  3NVV B;  5G5G B;  3C0P A;  1N60 C;  2O3G A;  1X2H A;  2YVS A;  2BVF A;  3NVW B;  3W8W A;  2VFV A;  1RM6 B;  3HRD C;  1N62 C;  2EXR A;  4UD8 A;  2W55 A;  3A7U A;  4XLO A;  3D2H A;  1W1S A;  5HHZ A;  4EC3 A;  1FFU C;  5AE3 A;  3DQ0 A;  1W1R A;  4PYT A;  2P4P A;  2E3T A;  3EUB 3;  4BC7 A;  1DZN A;  2P13 A;  3D2D A;  3NVY B;  1W1K A;  1HSK A;  4JB1 A;  1V97 A;  3TSJ A;  1ZXI C; 
#chains in the Genus database with same CATH topology
 4X2P A;  1I19 A;  2PP0 A;  5L6F A;  2VFS A;  4HPN A;  1E0Y A;  1NDA A;  2AKZ A;  3V4B A;  2PP1 A;  1W1L A;  3CGB A;  3VTE A;  1F8W A;  1XS2 A;  2BC0 A;  1MNS A;  2OX4 A;  4O95 A;  3GSY A;  1W6T A;  2ZC8 A;  3SR6 B;  2YVF A;  3FJ4 A;  3DFH A;  2W3R A;  4IT1 A;  4JDR A;  1ZK7 A;  1T3Q C;  3VCN A;  2C3C A;  1MUC A;  4HCH A;  1TE6 A;  1F9C A;  2WPF A;  3FW8 A;  1AOG A;  3A7R A;  3CK5 A;  5FXD A;  2A8X A;  2CDU A;  2P88 A;  3EEZ A;  2POZ A;  2GQT A;  5JCK A;  4KEM A;  2PGE A;  2FYM A;  2V3B A;  3FXG A;  2ZZB A;  1N5X A;  3DGB A;  3S1F A;  3EJE B;  4GGB A;  4K7Z A;  5ER0 A;  1GET A;  1LPF A;  4PVE A;  4NEW A;  2C3D A;  4DXK A;  2OG9 A;  2PS2 A;  4EQW A;  2OFJ A;  1ZKQ A;  2HQM A;  1NPX A;  3SN1 A;  1NEL A;  3DED A;  4PWB A;  1ZMD A;  1M6I A;  4IZG A;  2WBA A;  3GD4 A;  3UJF A;  3ZLF A;  5IDZ A;  2QQ6 A;  3STP A;  3EJB B;  3SJN A;  5EBK A;  1ONE A;  4H2H A;  4EM3 A;  3T6C A;  1JOA A;  2WP5 A;  3PK7 A;  4IP4 A;  4ZOH B;  2HXU A;  2YVG A;  1W1M A;  3DGH A;  3FVD A;  2PTY A;  5FS7 A;  1K4Q A;  5D79 A;  1EBD A;  2AL2 B;  1XHC A;  4APN A;  3UJ2 A;  4HG0 A;  2X8G A;  2X8C A;  3Q45 A;  2PTZ A;  4KPR A;  2WOV A;  2RAB A;  1YEY A;  3TJI A;  3GC2 A;  2OLA A;  3B97 A;  1JCT A;  3B9J B;  1WVF A;  1RVK A;  5U25 A;  1UXY A;  2Q4W A;  3P93 A;  2GGJ A;  3THU A;  2GH5 A;  3T4W A;  2HNE A;  2YAU A;  3TOY A;  1WVE A;  4FX9 A;  3LLB A;  3AN1 A;  3VC5 A;  1MO9 A;  3RJ8 A;  3UCD A;  4GGH A;  4H4S A;  2QAE A;  2QPM A;  5JCI A;  1MBT A;  2UUV A;  3RJA A;  3II4 A;  4G8T A;  3FW7 A;  2OQH A;  5G5G B;  3PM9 A;  3NVV B;  5L6G A;  1X2H A;  2OO6 A;  2AAQ A;  4H83 A;  2R9Z A;  3DJG X;  1N62 C;  2W55 A;  1H6V A;  2YQU A;  4XLO A;  3N6J A;  5J04 A;  2QJJ A;  2PGW A;  1ZDL A;  4ADW A;  3VC6 A;  5AE3 A;  3ENL A;  4H19 A;  3MKC A;  2PTX A;  4HN8 A;  1GRG A;  4FDC B;  3UJE A;  2E3T A;  3UXL A;  1R0M A;  3CGD A;  1TYP A;  1W1K A;  3QTP A;  3MWC A;  1ZXI C;  1FEC A;  3POP A;  1L8P A;  3OC4 A;  2P3H A;  3IC9 A;  5FJP A;  3N4E A;  4H4Z A;  3ZLH A;  3ETR B;  4ML8 A;  1VDV A;  1WUE A;  3W8X A;  3U9I A;  3R11 A;  5I1V A;  5FXF A;  2NQW A;  3DJJ A;  3BJS A;  1GRA A;  2ZAD A;  1ZR6 A;  2AKM A;  4MGG A;  1KCZ A;  1JPM A;  3I4K A;  4GYP A;  5FJO A;  1ZX9 A;  3D2J A;  4J57 A;  4GR1 A;  1GSN A;  2ONE A;  3IK4 A;  3TWA A;  3CT2 A;  1AHV A;  2WP6 A;  3NXL A;  3KJM A;  2QKN A;  4K8G A;  4A3R A;  4H4X A;  4ZCW A;  1DXL A;  3V3W A;  1NU5 A;  2RDX A;  3T9P A;  2EQ8 A;  4K8D A;  1NHQ A;  3TJ4 A;  2GR1 A;  4LA1 A;  5BOE A;  3LAE A;  4EQS A;  2MNR A;  2PU1 A;  2QDE A;  3RNM A;  4TVW A;  1TYT A;  2Q85 A;  1GES A;  3TX1 A;  1TZZ A;  4HCD A;  5AWV A;  3RIT A;  1GV4 A;  1EC9 A;  5KVH A;  3QFB A;  3ES7 A;  3OZM A;  2PPG A;  1NHR A;  2JK6 A;  5JRB A;  5G5H B;  2E5A A;  3I6E A;  2X50 A;  3I6T A;  1EBG A;  3FCP A;  3OTR A;  1BZL A;  3SN0 A;  3BW7 A;  2GR3 A;  1KN0 A;  2P8C A;  5HQX A;  4EMW A;  2IPI A;  3DES A;  5GRT A;  3DK4 A;  3GD3 A;  3LB8 A;  2OVL A;  3FW9 A;  3DH9 A;  1SJC A;  3P3B A;  3PWI A;  4FI4 A;  4E6M A;  2VFU A;  1JRO A;  5HMR A;  3FYY A;  1FEB A;  2NVK X;  1DTN A;  1GRH A;  2P8B A;  1WUF A;  1H2I A;  3EJD B;  3FG2 P;  4E4F A;  4OAL A;  3PFR A;  1FEA A;  5ADZ A;  3EAO A;  3R0K A;  5FS9 A;  3PWG A;  5K8E A;  1OEP A;  1P43 A;  4DX3 A;  2GGG A;  2OZ8 A;  4TVY A;  3MQT A;  2BC1 A;  2R8D A;  3W8Z A;  4JN7 A;  2VFT A;  4PVJ A;  4PVH A;  2AL1 A;  2PCE A;  3Q4D A;  3Q6J A;  4GME A;  4G7F A;  4ENL A;  2UUU A;  2CFY A;  3NVW B;  3W8W A;  2VFV A;  3BSM A;  3HRD C;  3DFY A;  3SSZ A;  3VDG A;  2WPE A;  3A7U A;  3BOX A;  4BV6 A;  4HNL A;  4JQ9 A;  1XDI A;  3DGZ A;  2AL2 A;  4GFI A;  4J3Z A;  1LVL A;  4PYT A;  2P4P A;  2PSN A;  4M52 A;  3EUB 3;  3ZVI A;  2P13 A;  1IYX A;  4NEV A;  2TPR A;  4DN1 A;  2GGE A;  3ES8 A;  3LAD A;  3DK8 A;  1ELS A;  4ROP A;  2O3G A;  3S1C A;  1QLT A;  1XPY A;  2GGI A;  4MMW A;  4H4U A;  3URH A;  1SJB A;  2QVH A;  1AHU A;  4EQR A;  3MZN A;  3OW1 A;  3H12 A;  1GRE A;  1GXF A;  1XAN A;  5U1O A;  2PA6 A;  3A7A A;  2PLS A;  1DNC A;  2Y3S A;  2WPC A;  3UGV A;  1JPD X;  1MDL A;  2EQ9 A;  3D46 A;  4JN8 A;  5ENL A;  2OPJ A;  1GRF A;  3JS8 A;  3QLD A;  4PZF A;  3GRS A;  4DHG A;  2GRT A;  2V3A A;  2WDW A;  3H8A A;  3ZVH B;  2Y08 A;  3RR1 A;  1F0X A;  1STZ A;  3TQP A;  5TR3 A;  2OAI A;  1E8F A;  4KT2 A;  2NQL A;  2HXT A;  4H4T A;  1N61 C;  4JAY A;  2MBR A;  2VFR A;  1GRT A;  2GQU A;  1VAO A;  2XH4 A;  3NS1 B;  5JCM A;  1N5W C;  2OKT A;  4A6G A;  4ZA0 A;  3SQS A;  2I5Q A;  5FJU A;  1MRA A;  5AE1 A;  4M0X A;  3UJR A;  4H4Y A;  3VCC A;  3JW7 A;  3MY9 A;  1TKK A;  3QKE A;  2EQ6 A;  4HYR A;  2XGZ A;  1FHU A;  5AE2 A;  1GER A;  1E8H A;  1VQZ A;  3GD6 A;  2P0I A;  1KD0 A;  3CXO A;  3CXB A;  1DII A;  4LII A;  2BVG A;  4Z17 A;  1SJA A;  4BCA A;  2QJN A;  1FFV C;  1KKO A;  5BOF A;  4DNS A;  4E5T A;  3GO2 A;  3TCS A;  1DIQ A;  5FJT A;  2HZG A;  3DG7 A;  3R10 A;  3SBF A;  1FIQ B;  3DER A;  4GIS A;  2W54 A;  4F4R A;  3TSH A;  2XH0 A;  4Z1Y A;  4MKS A;  1E8G A;  2PU0 A;  3TTE A;  2QDD A;  3MSY A;  5FMH A;  1R6W A;  2WOI A;  3VA8 A;  3I99 A;  4H4P A;  2EQ7 A;  5FXE A;  1AHZ A;  4BC9 A;  1X2G A;  3GY1 A;  2PP3 A;  3C0P A;  1E9I A;  2YVS A;  1YQZ A;  1RM6 B;  3DG3 A;  4UD8 A;  2OZT A;  3CB3 A;  4DYE A;  1W1S A;  5HHZ A;  4EC3 A;  3HPF A;  3O0H A;  3H70 A;  2F5Z A;  3K1G A;  2XSX A;  2XH2 A;  2GQW A;  4H1Z A;  3ZLG A;  4K1W A;  3DQ0 A;  3UCC A;  1W1R A;  1MOK A;  3NZG A;  2BCP A;  2MUC A;  2WOW A;  3NVY B;  3QFA A;  3H7V A;  1HSK A;  4JB1 A;  4J1O A;  2GL5 A;  3OZY A;  1N60 C;  3TSJ A;  1PDY A;  3IJL A;  4JHM A;  1EBH A;  3MUC A;  4MLA A;  3V5F A;  1FO4 A;  1MBB A;  2FKP A;  1BQG A;  1ZY8 A;  3CGC A;  3EF6 A;  1NHS A;  3NFU A;  2PTW A;  3PG6 A;  4EWJ A;  2V6O A;  3S5S A;  1GEU A;  4H50 A;  5EU9 A;  5FS6 A;  2OZ3 A;  3SQP A;  4GYP C;  3AMZ A;  3NVZ B;  2GSH A;  6ENL A;  1W1Q A;  4FP1 A;  1BWC A;  2PMQ A;  3R07 C;  3DK9 A;  1QLU A;  3NO1 A;  4H4Q A;  1JRP A;  1EC8 A;  3L5O A;  3R25 A;  1ZMC A;  1OJT A;  3KUM A;  4K2S A;  2GR2 A;  4GRT A;  4EM4 A;  3QN3 A;  1MDR A;  3HSU A;  3PQB A;  5KVI A;  2AXR A;  4BBY A;  3U4F A;  2PLI A;  4GIR A;  4IHC A;  3TW9 A;  2GDQ A;  4IP5 A;  3D9X A;  3RCY A;  5FS8 A;  2BVH A;  1P48 A;  1ECQ A;  3L8K A;  3TWB A;  3NRZ B;  1Q1R A;  3N4F A;  4H4R A;  1W1O A;  4BUR A;  3FV9 A;  1ONF A;  4J56 A;  2ZZ0 A;  2QJM A;  1JEH A;  1V59 A;  4EQX A;  2VAO A;  3AM9 A;  4DNA A;  4IL0 A;  7ENL A;  4EMI A;  3DG6 A;  2X99 A;  3D47 A;  3CGE A;  1D7Y A;  1KKR A;  4KWS A;  3N6H A;  3S1D A;  3R1Z A;  3S1E A;  2W0H A;  3FWA A;  5FXP A;  1GRB A;  1EC7 A;  1W1J A;  2O56 A;  2W3S A;  3S47 A;  4PVK A;  3SN4 A;  4M6U A;  1PDZ A;  3RO6 A;  3OP2 A;  3ZVH A;  2DW7 A;  2GGH A;  3RRA A;  4A35 A;  1Q1W A;  3UJS A;  3IJI A;  3R0U A;  3DDM A;  3JVA A;  1SB3 B;  2I0K A;  4PWC A;  2GR0 A;  1N63 C;  2R2Z A;  3VFC A;  2OQY A;  1BKH A;  3H4K A;  3RGT A;  1NHP A;  3EAN A;  3V5C A;  1JDF A;  3DEQ A;  2Y3R A;  1WYG A;  3HW2 A;  4YWS A;  2NPX A;  3IJQ A;  4YWO A;  2QGY A;  2J3N A;  4HNC A;  2BVF A;  2XH7 A;  4IL2 A;  4HCL A;  2EXR A;  1S7M A;  4E4U A;  4EMJ A;  4DWD A;  2Y4G A;  3D2H A;  1SJD A;  5I1W A;  3KLJ A;  4H4W A;  3OPS A;  1FFU C;  3T8Q A;  2CHR A;  5JCN A;  3CYJ A;  2DW6 A;  3QPE A;  1FHV A;  2POD A;  5FJR A;  4H4V A;  2X8H A;  3CAW A;  3UXK A;  3EKG A;  2P3Z A;  2YVJ A;  3DIP A;  5JCL A;  4KPL A;  4BC7 A;  1DZN A;  3GRT A;  3D2D A;  3JZU A;  3LXD A;  3P0W A;  2ZZC A;  4E8G A;  1F3P A;  1V97 A;  2RK5 A; 
#chains in the Genus database with same CATH homology
 3POP A;  1I19 A;  3S1C A;  1QLT A;  5L6F A;  2VFS A;  4MLA A;  1E0Y A;  1FO4 A;  1MBB A;  1W1L A;  1AHU A;  3VTE A;  4O95 A;  3GSY A;  3ETR B;  4ML8 A;  3SR6 B;  2RK5 A;  1VDV A;  3W8X A;  2W3R A;  3AMZ A;  3NVZ B;  3A7A A;  2PLS A;  1W1Q A;  1T3Q C;  2Y3S A;  5FXF A;  3R07 C;  2NQW A;  3FW8 A;  1QLU A;  3A7R A;  5FXD A;  1ZR6 A;  1JRP A;  3JS8 A;  2GQT A;  4PZF A;  3D2J A;  3HSU A;  2WDW A;  3PQB A;  2AXR A;  1N5X A;  4BBY A;  2PLI A;  2Y08 A;  3S1F A;  1F0X A;  1AHV A;  4PVE A;  2OAI A;  3KJM A;  1E8F A;  2BVH A;  2QKN A;  1N61 C;  3NRZ B;  3DED A;  4JAY A;  2MBR A;  2VFR A;  4PWB A;  2GQU A;  1VAO A;  1W1O A;  3NS1 B;  1N5W C;  2VAO A;  3LAE A;  3AM9 A;  5AE1 A;  4TVW A;  2Q85 A;  3TX1 A;  4ZOH B;  5AWV A;  1W1M A;  3S1D A;  3S1E A;  5AE2 A;  5D79 A;  1E8H A;  3FWA A;  5G5H B;  1VQZ A;  5FXP A;  2E5A A;  4HG0 A;  1W1J A;  3BW7 A;  5HQX A;  1DII A;  2IPI A;  5I1V A;  2W3S A;  2P3H A;  4PVK A;  3FW9 A;  2BVG A;  2VFU A;  1JRO A;  3B9J B;  4BCA A;  1WVF A;  1FFV C;  5HMR A;  1UXY A;  2Q4W A;  4DNS A;  1DIQ A;  1SB3 B;  2I0K A;  4OAL A;  4PWC A;  1N63 C;  5ADZ A;  1WVE A;  2R2Z A;  1FIQ B;  3LLB A;  2W54 A;  3AN1 A;  5K8E A;  3TSH A;  1E8G A;  3RJ8 A;  2QPM A;  1MBT A;  2Y3R A;  2UUV A;  4TVY A;  3RJA A;  2R8D A;  3FW7 A;  1WYG A;  3I99 A;  2VFT A;  4PVJ A;  4PVH A;  3PM9 A;  5FXE A;  1AHZ A;  3W8Z A;  4BC9 A;  1X2G A;  3NVV B;  5G5G B;  3C0P A;  1N60 C;  2O3G A;  1X2H A;  2YVS A;  5L6G A;  2UUU A;  2BVF A;  3NVW B;  3W8W A;  2VFV A;  1RM6 B;  3HRD C;  1N62 C;  2EXR A;  4UD8 A;  2W55 A;  3A7U A;  2Y4G A;  4XLO A;  3D2H A;  1W1S A;  5I1W A;  5HHZ A;  4EC3 A;  1FFU C;  5AE3 A;  3DQ0 A;  1W1R A;  4PYT A;  2P4P A;  2E3T A;  3EUB 3;  4BC7 A;  1DZN A;  2P13 A;  3D2D A;  3NVY B;  1W1K A;  1HSK A;  4JB1 A;  1V97 A;  3TSJ A;  1ZXI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...