4ZOHB

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
277
structure length
274
Chain Sequence
b'MYPPKFGYVIPDNLNEALEFLEEHQDARPLAGGHSLIPMLKLRLIRPSYIVEIRRFSNLSYITKDGNLYKIGALTTHYNISKSSIPLLSETASNIGDPQVRNMGTIGGSISHLDPSADYPAALIAMDAKVKITSRKGDRVVNFKSFAKDMFTPDLNPGELVTEIQVPTFEGYKFSYQKLERRAGDFAIVGVALLLKLSGDVIEDVRIGLTAVNNVAVRAKGAEEELLGKRLNDEIIEKAATRAMESANPTSGSAEYKKKMVKVLTKRAIITALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
molecule tags Oxidoreductase
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
total genus 84
structure length 274
sequence length 277
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
B PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4zohB01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 4zohB03
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4zohB02
4JB1A 2PLSA 4BBYA 1WYGA 1DZNA 1UXYA 2QKNA 1T3QC 4MLAA 2R2ZA 5AE2A 3KJMA 1X2HA 1VQZA 2BVHA 1ZXIC 3NS1B 3W8ZA 1W1QA 3VTEA 1W1SA 1E0YA 4BC7A 2Q85A 4PVKA 2I0KA 1AHVA 4PZFA 2O3GA 4ML8A 2VAOA 2QPMA 2NQWA 3W8XA 5ADZA 1FFVC 3TX1A 4BC9A 3S1DA 2GQTA 4PVJA 4ZOHB 4TVWA 2W54A 1W1KA 3TSHA 3NVWB 3C0PA 1W1LA 1W1JA 4UD8A 1DIIA 3BW7A 4BCAA 2RK5A 1N63C 5HHZA 5FXPA 2VFUA 3I99A 3EUB3 3DEDA 5AE3A 1V97A 1QLUA 3AMZA 1VAOA 3S1EA 1AHZA 4DNSA 2YVSA 2E5AA 3FW9A 1N5XA 1W1MA 3TSJA 1WVFA 3D2DA 1ZR6A 1JRPA 2AXRA 2VFSA 3S1CA 2MBRA 1X2GA 3R07C 2EXRA 4JAYA 2OAIA 4PWBA 3FWAA 5FXEA 2VFTA 2BVFA 1FO4A 2P3HA 1SB3B 4PWCA 1VDVA 1N60C 3SR6B 4PVHA 1N5WC 3NVYB 3DQ0A 3PM9A 1HSKA 1W1RA 2BVGA 3ETRB 2PLIA 5FXFA 1N62C 3AN1A 1F0XA 2E3TA 4O95A 5HMRA 1JROA 3NRZB 4HG0A 1FIQB 1W1OA 4EC3A 3A7UA 5G5GB 1E8FA 5HQXA 3A7RA 3HRDC 5G5HB 3LAEA 1E8HA 2GQUA 5FXDA 4OALA 4PYTA 1WVEA 5D79A 2VFVA 3D2JA 1MBTA 3W8WA 3FW7A 1AHUA 2W55A 3LLBA 4TVYA 3JS8A 1MBBA 4XLOA 3D2HA 2Q4WA 3A7AA 1QLTA 1E8GA 3NVVB 2P4PA 3NVZB 5AE1A 2R8DA 1DIQA 2W3SA 3B9JB 3GSYA 1I19A 2P13A 1N61C 2VFRA 1FFUC 3AM9A 3S1FA 1RM6B 4PVEA 2W3RA 3FW8A
chains in the Genus database with same CATH superfamily
4GRTA 2GH5A 3CAWA 4H1ZA 4K7ZA 3Q6JA 1KCZA 3QTPA 1OEPA 1TYTA 1JOAA 1EBGA 2HZGA 2ZZCA 3FVDA 3JVAA 3PWGA 2W0HA 3KJMA 1WUEA 1BKHA 2WPEA 3EANA 3R0KA 3T6CA 1FHVA 4BC7A 2I0KA 4BV6A 1GESA 4H4UA 3TJIA 4ML8A 3W8XA 5ADZA 4BC9A 3EJDB 2HNEA 3MWCA 2GSHA 2X8GA 4EMWA 5FS7A 4EM3A 2GGJA 4H4WA 2GQTA 1V59A 2W54A 1BZLA 3I6EA 1H6VA 1Q1RA 3DGHA 2C3CA 3C0PA 2MUCA 3DIPA 3IK4A 3UJFA 2UUUA 1W1JA 2PTWA 1N63C 1JDFA 5HHZA 5FXPA 4HCHA 3RRAA 2YVJA 2OG9A 2GGEA 4KT2A 1P48A 2OFJA 5IDZA 3L5OA 3ZVHB 3UXLA 3DFHA 3IJIA 3SN4A 2X99A 2OVLA 3DDMA 3HW2A 4IHCA 3ZLGA 4LA1A 3Q45A 4J56A 3MY9A 2GRTA 4DN1A 4IP5A 3TQPA 2GR3A 3T4WA 3ZLFA 2EQ8A 2X50A 2E5AA 1N5XA 1ZR6A 2WP5A 3DFYA 2GDQA 1RVKA 3S1CA 3NZGA 3UJRA 1MDLA 3URHA 1KKRA 3II4A 4F4RA 2Y4GA 5FJOA 3FCPA 5FS6A 4HNLA 2PP3A 2OAIA 1F3PA 3SSZA 2VFTA 3ZVHA 2GR2A 1GRAA 2PCEA 1MO9A 3STPA 3TTEA 3SR6B 4K2SA 1N5WC 1WUFA 3DQ0A 1W1RA 3OZYA 3PFRA 3MSYA 4JN7A 3UCCA 1GEUA 4EQWA 4FI4A 2PLIA 3NO1A 1STZA 1JEHA 3P3BA 1NHQA 1P43A 5EBKA 1W1OA 1GXFA 2X8CA 3A7UA 3DERA 5G5GB 3SN0A 3LAEA 1GSNA 2IPIA 4YWSA 3ZVIA 3FYYA 3UJEA 5D79A 1ONEA 3GC2A 4IL2A 1ZX9A 1ONFA 3MQTA 3KUMA 3FW7A 4E8GA 1SJBA 2P88A 3KLJA 5FJPA 1MBBA 3H4KA 1SJCA 2GGIA 2WOVA 3A7AA 4KPRA 3QKEA 2WPFA 2HXTA 4H4VA 3UGVA 1YEYA 2QAEA 2WDWA 2QVHA 1N61C 2OLAA 2VFRA 1W6TA 1RM6B 2TPRA 5JCNA 1GRHA 3SN1A 1MRAA 2QJNA 4ADWA 4NEWA 1ZMCA 3DK4A 3R0UA 1DZNA 3V5FA 4DXKA 1EBHA 3DGZA 4IT1A 3EF6A 4MLAA 5AE2A 2OZ8A 2QDEA 2BVHA 5K8EA 1W1QA 5KVHA 4PVKA 5JCKA 4NEVA 1AHVA 1NELA 3ES7A 2JK6A 2XGZA 2O56A 1L8PA 2WOIA 3B97A 3S1DA 1GV4A 2PS2A 4Z1YA 1H2IA 4FP1A 1OJTA 3QPEA 5ENLA 4TVWA 2P3ZA 2OPJA 3H7VA 4KWSA 1JCTA 4UD8A 4BCAA 2P8CA 3DGBA 3GRSA 4M0XA 5L6GA 3BOXA 3V3WA 4FDCB 2PU0A 1SJAA 3TCSA 3I99A 2AL1A 2PP1A 3GD4A 4MMWA 3GD6A 1R6WA 2PGEA 1F9CA 2ONEA 1TE6A 3OPSA 3DJGX 2PSNA 1V97A 4K8DA 5JCMA 4EMIA 1MUCA 3VC5A 4ENLA 3DG7A 2BC0A 4DNSA 3CB3A 3QFAA 3FW9A 1W1MA 1WVFA 1JRPA 6ENLA 2AXRA 2WBAA 3HPFA 1GRFA 2MBRA 3GRTA 1BQGA 1GRGA 4J57A 4IZGA 3DG3A 4JAYA 2AKMA 5FXEA 3N6HA 4GGBA 3UJ2A 1XANA 3CGDA 1LVLA 2DW6A 1N60C 2NQLA 2PTZA 3MKCA 2YVFA 1HSKA 2BVGA 2WPCA 5FXFA 2PU1A 3RCYA 4GISA 4ROPA 2EQ6A 4MKSA 2XH4A 2OZTA 2GGGA 3FV9A 5G5HB 4ZCWA 3UXKA 2GQUA 5FS9A 2NVKX 1FEAA 1R0MA 1WVEA 3T9PA 3OP2A 4EMJA 3EAOA 3EEZA 1TZZA 3D9XA 4DHGA 3RNMA 3EJBB 2YVGA 3IC9A 5U25A 3QN3A 4HCLA 4H4RA 3JS8A 4XLOA 3VCCA 3P93A 4H19A 1QLTA 2P4PA 1PDYA 5FJTA 4H4TA 2R8DA 3DJJA 4H83A 1I19A 1NHPA 2Y3SA 5U1OA 3JZUA 1IYXA 4HN8A 2W3RA 3IJLA 3PG6A 4APNA 2WP6A 4JB1A 2OKTA 2PLSA 3UCDA 1DTNA 1KN0A 4GMEA 5L6FA 2HQMA 5KVIA 4H50A 2X8HA 4DYEA 4DNAA 3R11A 2OX4A 1MOKA 3VTEA 5EU9A 1E0YA 2C3DA 3VDGA 2OO6A 2P0IA 1GETA 4PZFA 1JPDX 3SJNA 3V5CA 3OZMA 1FEBA 2CHRA 3TX1A 1NDAA 2ZC8A 3H70A 2A8XA 3R10A 3D46A 3UJSA 5BOFA 4ZOHB 2P8BA 3N4FA 3VC6A 3TSHA 2XH7A 3NVWB 1GRBA 3IJQA 3HSUA 2XSXA 3BJSA 2PODA 3EKGA 4H4YA 4KEMA 4JN8A 3RGTA 4J3ZA 4GIRA 3VA8A 3H12A 2RABA 4E5TA 5AE3A 3N6JA 2QJJA 2ZADA 3L8KA 4GFIA 4H4PA 5JRBA 5ER0A 3U9IA 4E4UA 1F8WA 5FJRA 4KPLA 3DK8A 1NHRA 3S1EA 3CGBA 3MZNA 1AHZA 3TOYA 1ZY8A 2V3BA 3SQPA 3TSJA 1ZDLA 3EJEB 2GL5A 3SQSA 4HCDA 3S5SA 4IP4A 1X2GA 2EQ9A 1ZK7A 2GQWA 1MNSA 3CYJA 3I4KA 4PWBA 1E9IA 3T8QA 2FKPA 2QJMA 3OW1A 3DEQA 3TWBA 1SJDA 2UUVA 4M52A 3THUA 3NVYB 1XS2A 3PM9A 4EM4A 1MDRA 4EWJA 3GO2A 7ENLA 1N62C 1F0XA 1JROA 2AL2B 3NRZB 3TWAA 4DX3A 1FIQB 1Q1WA 3GD3A 1S7MA 3SBFA 5FJUA 4J1OA 4X2PA 5FXDA 2QGYA 4A6GA 4OALA 5FS8A 3VFCA 3CT2A 3D2JA 1MBTA 3W8WA 1AHUA 1YQZA 2W55A 4GYPC 4TVYA 3D2HA 4K1WA 3NVVB 1E8GA 3K1GA 1XHCA 2V3AA 1GERA 2I5QA 1DIQA 1NPXA 3B9JB 2AKZA 3N4EA 1KD0A 1LPFA 1GREA 3O0HA 3NFUA 2P13A 1XPYA 4H4XA 3AM9A 4HPNA 4PVEA 1ZKQA 3QFBA 3FW8A 5TR3A 2OQYA 3R25A 4BBYA 1GRTA 1WYGA 1K4QA 1JPMA 3DG6A 4E4FA 2Y3RA 2V6OA 4LIIA 4IL0A 1UXYA 2QKNA 1T3QC 3QLDA 2FYMA 4EQSA 1M6IA 2GGHA 4G7FA 4Z17A 2R2ZA 1X2HA 1VQZA 4H4QA 1ZXIC 3NS1B 3W8ZA 3CXOA 4K8GA 5I1WA 1W1SA 5JCLA 5AWVA 2Q85A 3H8AA 2NPXA 1NU5A 3FXGA 1BWCA 2O3GA 2VAOA 2QPMA 2NQWA 2PTYA 2CFYA 1FFVC 3RJAA 3CGCA 3POPA 3CGEA 2R9ZA 1ZMDA 3CK5A 3ENLA 3S47A 4PVJA 1TYPA 4JDRA 4DWDA 4A35A 1W1KA 2XH2A 2WOWA 1DXLA 4FX9A 4GGHA 5J04A 1TKKA 5GRTA 1W1LA 3U4FA 1FECA 2DW7A 1DIIA 3BW7A 2ZZBA 2RK5A 2PGWA 3TW9A 2YAUA 3BSMA 5JCIA 4A3RA 3DESA 3DH9A 2VFUA 3Q4DA 2HXUA 3D47A 3EUB3 2F5ZA 4H2HA 4H4ZA 3ZLHA 3RR1A 3LXDA 1KKOA 3PK7A 3NXLA 3DEDA 5BOEA 2EQ7A 3VCNA 4JHMA 1EC9A 1QLUA 3AMZA 1D7YA 1XDIA 4G8TA 1ELSA 1VAOA 4E6MA 2OQHA 2PMQA 3R1ZA 5FMHA 4BURA 4EQXA 3DK9A 3PWIA 2QQ6A 3TJ4A 3FJ4A 4EQRA 2ZZ0A 2YVSA 2GR1A 3MUCA 3D2DA 2BC1A 2VFSA 3GY1A 4H4SA 3R07C 4HNCA 2EXRA 2J3NA 3CXBA 2XH0A 3FWAA 3OC4A 2BVFA 2PA6A 1FO4A 2P3HA 1SB3B 4PWCA 1VDVA 4PVHA 2MNRA 2PTXA 3ETRB 2POZA 3AN1A 5HMRA 3FG2P 2E3TA 4O95A 4HG0A 4EC3A 2PP0A 3P0WA 3JW7A 3LADA 3RITA 1E8FA 5HQXA 3A7RA 2QDDA 3HRDC 3OTRA 1EC8A 3RJ8A 1FHUA 3ES8A 1E8HA 1DNCA 2Y08A 2BCPA 4M6UA 2PPGA 4PYTA 1EBDA 4YWOA 2VFVA 2OZ3A 3I6TA 3RO6A 3LLBA 3V4BA 4HYRA 2Q4WA 4GR1A 1ECQA 3LB8A 3NVZB 5AE1A 4JQ9A 4ZA0A 1AOGA 3PQBA 1PDZA 2W3SA 1EC7A 2YQUA 3GSYA 2AL2A 2AAQA 2RDXA 2GR0A 5I1VA 2CDUA 1FFUC 3S1FA 1NHSA 4GYPA 4MGGA
chains in the Genus database with same CATH topology
4JB1A 2PLSA 4BBYA 1WYGA 1DZNA 2Y3RA 1UXYA 2QKNA 1T3QC 4MLAA 2R2ZA 5L6FA 5AE2A 3KJMA 1X2HA 1VQZA 2BVHA 1ZXIC 3NS1B 3W8ZA 1W1QA 5I1WA 5K8EA 3VTEA 1W1SA 1E0YA 4BC7A 5AWVA 2Q85A 4PVKA 2I0KA 1AHVA 4PZFA 2O3GA 4ML8A 2VAOA 2QPMA 2NQWA 3W8XA 5ADZA 1FFVC 3TX1A 4BC9A 3POPA 3S1DA 3PQBA 3RJAA 2GQTA 4PVJA 4ZOHB 4TVWA 2W54A 1W1KA 3TSHA 3NVWB 3C0PA 2UUUA 1W1LA 3HSUA 1W1JA 4UD8A 1DIIA 3BW7A 4BCAA 2RK5A 5L6GA 1N63C 5HHZA 5FXPA 2VFUA 3I99A 3EUB3 3DEDA 5AE3A 1V97A 1QLUA 3AMZA 1VAOA 3S1EA 1AHZA 4DNSA 2YVSA 2E5AA 3FW9A 1N5XA 1W1MA 3TSJA 1WVFA 3D2DA 1ZR6A 1JRPA 2AXRA 2VFSA 3S1CA 2MBRA 1X2GA 3R07C 2EXRA 2Y4GA 4JAYA 2OAIA 4PWBA 3FWAA 5FXEA 2VFTA 2BVFA 1FO4A 2P3HA 1SB3B 4PWCA 2UUVA 1VDVA 1N60C 3SR6B 4PVHA 1N5WC 3NVYB 3DQ0A 3PM9A 1HSKA 1W1RA 2BVGA 3ETRB 2PLIA 5FXFA 1N62C 3AN1A 1F0XA 2E3TA 4O95A 5HMRA 1JROA 3NRZB 4HG0A 1FIQB 1W1OA 4EC3A 3A7UA 5G5GB 1E8FA 5HQXA 3A7RA 3HRDC 5G5HB 2IPIA 3LAEA 3RJ8A 1E8HA 2Y08A 2GQUA 5FXDA 4OALA 4PYTA 1WVEA 5D79A 2VFVA 3D2JA 1MBTA 3W8WA 3FW7A 1AHUA 2W55A 3LLBA 4TVYA 3JS8A 1MBBA 4XLOA 3D2HA 2Q4WA 3A7AA 1QLTA 1E8GA 3NVVB 2P4PA 3NVZB 5AE1A 2R8DA 1DIQA 2W3SA 3B9JB 3GSYA 1I19A 2WDWA 2Y3SA 2P13A 1N61C 2VFRA 5I1VA 1FFUC 3AM9A 3S1FA 1RM6B 4PVEA 2W3RA 3FW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JB1 A;  2PLS A;  4BBY A;  1WYG A;  1DZN A;  1UXY A;  2QKN A;  1T3Q C;  4MLA A;  2R2Z A;  5AE2 A;  3KJM A;  1X2H A;  1VQZ A;  2BVH A;  1ZXI C;  3NS1 B;  3W8Z A;  1W1Q A;  3VTE A;  1W1S A;  1E0Y A;  4BC7 A;  2Q85 A;  4PVK A;  2I0K A;  1AHV A;  4PZF A;  2O3G A;  4ML8 A;  2VAO A;  2QPM A;  2NQW A;  3W8X A;  5ADZ A;  1FFV C;  3TX1 A;  4BC9 A;  3S1D A;  2GQT A;  4PVJ A;  4ZOH B;  4TVW A;  2W54 A;  1W1K A;  3TSH A;  3NVW B;  3C0P A;  1W1L A;  1W1J A;  4UD8 A;  1DII A;  3BW7 A;  4BCA A;  2RK5 A;  1N63 C;  5HHZ A;  5FXP A;  2VFU A;  3I99 A;  3EUB 3;  3DED A;  5AE3 A;  1V97 A;  1QLU A;  3AMZ A;  1VAO A;  3S1E A;  1AHZ A;  4DNS A;  2YVS A;  2E5A A;  3FW9 A;  1N5X A;  1W1M A;  3TSJ A;  1WVF A;  3D2D A;  1ZR6 A;  1JRP A;  2AXR A;  2VFS A;  3S1C A;  2MBR A;  1X2G A;  3R07 C;  2EXR A;  4JAY A;  2OAI A;  4PWB A;  3FWA A;  5FXE A;  2VFT A;  2BVF A;  1FO4 A;  2P3H A;  1SB3 B;  4PWC A;  1VDV A;  1N60 C;  3SR6 B;  4PVH A;  1N5W C;  3NVY B;  3DQ0 A;  3PM9 A;  1HSK A;  1W1R A;  2BVG A;  3ETR B;  2PLI A;  5FXF A;  1N62 C;  3AN1 A;  1F0X A;  2E3T A;  4O95 A;  5HMR A;  1JRO A;  3NRZ B;  4HG0 A;  1FIQ B;  1W1O A;  4EC3 A;  3A7U A;  5G5G B;  1E8F A;  5HQX A;  3A7R A;  3HRD C;  5G5H B;  3LAE A;  1E8H A;  2GQU A;  5FXD A;  4OAL A;  4PYT A;  1WVE A;  5D79 A;  2VFV A;  3D2J A;  1MBT A;  3W8W A;  3FW7 A;  1AHU A;  2W55 A;  3LLB A;  4TVY A;  3JS8 A;  1MBB A;  4XLO A;  3D2H A;  2Q4W A;  3A7A A;  1QLT A;  1E8G A;  3NVV B;  2P4P A;  3NVZ B;  5AE1 A;  2R8D A;  1DIQ A;  2W3S A;  3B9J B;  3GSY A;  1I19 A;  2P13 A;  1N61 C;  2VFR A;  1FFU C;  3AM9 A;  3S1F A;  1RM6 B;  4PVE A;  2W3R A;  3FW8 A; 
#chains in the Genus database with same CATH topology
 4GRT A;  2GH5 A;  3CAW A;  4H1Z A;  4K7Z A;  3Q6J A;  1KCZ A;  3QTP A;  1OEP A;  1TYT A;  1JOA A;  1EBG A;  2HZG A;  2ZZC A;  3FVD A;  3JVA A;  3PWG A;  2W0H A;  3KJM A;  1WUE A;  1BKH A;  2WPE A;  3EAN A;  3R0K A;  3T6C A;  1FHV A;  4BC7 A;  2I0K A;  4BV6 A;  1GES A;  4H4U A;  3TJI A;  4ML8 A;  3W8X A;  5ADZ A;  4BC9 A;  3EJD B;  2HNE A;  3MWC A;  2GSH A;  2X8G A;  4EMW A;  5FS7 A;  4EM3 A;  2GGJ A;  4H4W A;  2GQT A;  1V59 A;  2W54 A;  1BZL A;  3I6E A;  1H6V A;  1Q1R A;  3DGH A;  2C3C A;  3C0P A;  2MUC A;  3DIP A;  3IK4 A;  3UJF A;  2UUU A;  1W1J A;  2PTW A;  1N63 C;  1JDF A;  5HHZ A;  5FXP A;  4HCH A;  3RRA A;  2YVJ A;  2OG9 A;  2GGE A;  4KT2 A;  1P48 A;  2OFJ A;  5IDZ A;  3L5O A;  3ZVH B;  3UXL A;  3DFH A;  3IJI A;  3SN4 A;  2X99 A;  2OVL A;  3DDM A;  3HW2 A;  4IHC A;  3ZLG A;  4LA1 A;  3Q45 A;  4J56 A;  3MY9 A;  2GRT A;  4DN1 A;  4IP5 A;  3TQP A;  2GR3 A;  3T4W A;  3ZLF A;  2EQ8 A;  2X50 A;  2E5A A;  1N5X A;  1ZR6 A;  2WP5 A;  3DFY A;  2GDQ A;  1RVK A;  3S1C A;  3NZG A;  3UJR A;  1MDL A;  3URH A;  1KKR A;  3II4 A;  4F4R A;  2Y4G A;  5FJO A;  3FCP A;  5FS6 A;  4HNL A;  2PP3 A;  2OAI A;  1F3P A;  3SSZ A;  2VFT A;  3ZVH A;  2GR2 A;  1GRA A;  2PCE A;  1MO9 A;  3STP A;  3TTE A;  3SR6 B;  4K2S A;  1N5W C;  1WUF A;  3DQ0 A;  1W1R A;  3OZY A;  3PFR A;  3MSY A;  4JN7 A;  3UCC A;  1GEU A;  4EQW A;  4FI4 A;  2PLI A;  3NO1 A;  1STZ A;  1JEH A;  3P3B A;  1NHQ A;  1P43 A;  5EBK A;  1W1O A;  1GXF A;  2X8C A;  3A7U A;  3DER A;  5G5G B;  3SN0 A;  3LAE A;  1GSN A;  2IPI A;  4YWS A;  3ZVI A;  3FYY A;  3UJE A;  5D79 A;  1ONE A;  3GC2 A;  4IL2 A;  1ZX9 A;  1ONF A;  3MQT A;  3KUM A;  3FW7 A;  4E8G A;  1SJB A;  2P88 A;  3KLJ A;  5FJP A;  1MBB A;  3H4K A;  1SJC A;  2GGI A;  2WOV A;  3A7A A;  4KPR A;  3QKE A;  2WPF A;  2HXT A;  4H4V A;  3UGV A;  1YEY A;  2QAE A;  2WDW A;  2QVH A;  1N61 C;  2OLA A;  2VFR A;  1W6T A;  1RM6 B;  2TPR A;  5JCN A;  1GRH A;  3SN1 A;  1MRA A;  2QJN A;  4ADW A;  4NEW A;  1ZMC A;  3DK4 A;  3R0U A;  1DZN A;  3V5F A;  4DXK A;  1EBH A;  3DGZ A;  4IT1 A;  3EF6 A;  4MLA A;  5AE2 A;  2OZ8 A;  2QDE A;  2BVH A;  5K8E A;  1W1Q A;  5KVH A;  4PVK A;  5JCK A;  4NEV A;  1AHV A;  1NEL A;  3ES7 A;  2JK6 A;  2XGZ A;  2O56 A;  1L8P A;  2WOI A;  3B97 A;  3S1D A;  1GV4 A;  2PS2 A;  4Z1Y A;  1H2I A;  4FP1 A;  1OJT A;  3QPE A;  5ENL A;  4TVW A;  2P3Z A;  2OPJ A;  3H7V A;  4KWS A;  1JCT A;  4UD8 A;  4BCA A;  2P8C A;  3DGB A;  3GRS A;  4M0X A;  5L6G A;  3BOX A;  3V3W A;  4FDC B;  2PU0 A;  1SJA A;  3TCS A;  3I99 A;  2AL1 A;  2PP1 A;  3GD4 A;  4MMW A;  3GD6 A;  1R6W A;  2PGE A;  1F9C A;  2ONE A;  1TE6 A;  3OPS A;  3DJG X;  2PSN A;  1V97 A;  4K8D A;  5JCM A;  4EMI A;  1MUC A;  3VC5 A;  4ENL A;  3DG7 A;  2BC0 A;  4DNS A;  3CB3 A;  3QFA A;  3FW9 A;  1W1M A;  1WVF A;  1JRP A;  6ENL A;  2AXR A;  2WBA A;  3HPF A;  1GRF A;  2MBR A;  3GRT A;  1BQG A;  1GRG A;  4J57 A;  4IZG A;  3DG3 A;  4JAY A;  2AKM A;  5FXE A;  3N6H A;  4GGB A;  3UJ2 A;  1XAN A;  3CGD A;  1LVL A;  2DW6 A;  1N60 C;  2NQL A;  2PTZ A;  3MKC A;  2YVF A;  1HSK A;  2BVG A;  2WPC A;  5FXF A;  2PU1 A;  3RCY A;  4GIS A;  4ROP A;  2EQ6 A;  4MKS A;  2XH4 A;  2OZT A;  2GGG A;  3FV9 A;  5G5H B;  4ZCW A;  3UXK A;  2GQU A;  5FS9 A;  2NVK X;  1FEA A;  1R0M A;  1WVE A;  3T9P A;  3OP2 A;  4EMJ A;  3EAO A;  3EEZ A;  1TZZ A;  3D9X A;  4DHG A;  3RNM A;  3EJB B;  2YVG A;  3IC9 A;  5U25 A;  3QN3 A;  4HCL A;  4H4R A;  3JS8 A;  4XLO A;  3VCC A;  3P93 A;  4H19 A;  1QLT A;  2P4P A;  1PDY A;  5FJT A;  4H4T A;  2R8D A;  3DJJ A;  4H83 A;  1I19 A;  1NHP A;  2Y3S A;  5U1O A;  3JZU A;  1IYX A;  4HN8 A;  2W3R A;  3IJL A;  3PG6 A;  4APN A;  2WP6 A;  4JB1 A;  2OKT A;  2PLS A;  3UCD A;  1DTN A;  1KN0 A;  4GME A;  5L6F A;  2HQM A;  5KVI A;  4H50 A;  2X8H A;  4DYE A;  4DNA A;  3R11 A;  2OX4 A;  1MOK A;  3VTE A;  5EU9 A;  1E0Y A;  2C3D A;  3VDG A;  2OO6 A;  2P0I A;  1GET A;  4PZF A;  1JPD X;  3SJN A;  3V5C A;  3OZM A;  1FEB A;  2CHR A;  3TX1 A;  1NDA A;  2ZC8 A;  3H70 A;  2A8X A;  3R10 A;  3D46 A;  3UJS A;  5BOF A;  4ZOH B;  2P8B A;  3N4F A;  3VC6 A;  3TSH A;  2XH7 A;  3NVW B;  1GRB A;  3IJQ A;  3HSU A;  2XSX A;  3BJS A;  2POD A;  3EKG A;  4H4Y A;  4KEM A;  4JN8 A;  3RGT A;  4J3Z A;  4GIR A;  3VA8 A;  3H12 A;  2RAB A;  4E5T A;  5AE3 A;  3N6J A;  2QJJ A;  2ZAD A;  3L8K A;  4GFI A;  4H4P A;  5JRB A;  5ER0 A;  3U9I A;  4E4U A;  1F8W A;  5FJR A;  4KPL A;  3DK8 A;  1NHR A;  3S1E A;  3CGB A;  3MZN A;  1AHZ A;  3TOY A;  1ZY8 A;  2V3B A;  3SQP A;  3TSJ A;  1ZDL A;  3EJE B;  2GL5 A;  3SQS A;  4HCD A;  3S5S A;  4IP4 A;  1X2G A;  2EQ9 A;  1ZK7 A;  2GQW A;  1MNS A;  3CYJ A;  3I4K A;  4PWB A;  1E9I A;  3T8Q A;  2FKP A;  2QJM A;  3OW1 A;  3DEQ A;  3TWB A;  1SJD A;  2UUV A;  4M52 A;  3THU A;  3NVY B;  1XS2 A;  3PM9 A;  4EM4 A;  1MDR A;  4EWJ A;  3GO2 A;  7ENL A;  1N62 C;  1F0X A;  1JRO A;  2AL2 B;  3NRZ B;  3TWA A;  4DX3 A;  1FIQ B;  1Q1W A;  3GD3 A;  1S7M A;  3SBF A;  5FJU A;  4J1O A;  4X2P A;  5FXD A;  2QGY A;  4A6G A;  4OAL A;  5FS8 A;  3VFC A;  3CT2 A;  3D2J A;  1MBT A;  3W8W A;  1AHU A;  1YQZ A;  2W55 A;  4GYP C;  4TVY A;  3D2H A;  4K1W A;  3NVV B;  1E8G A;  3K1G A;  1XHC A;  2V3A A;  1GER A;  2I5Q A;  1DIQ A;  1NPX A;  3B9J B;  2AKZ A;  3N4E A;  1KD0 A;  1LPF A;  1GRE A;  3O0H A;  3NFU A;  2P13 A;  1XPY A;  4H4X A;  3AM9 A;  4HPN A;  4PVE A;  1ZKQ A;  3QFB A;  3FW8 A;  5TR3 A;  2OQY A;  3R25 A;  4BBY A;  1GRT A;  1WYG A;  1K4Q A;  1JPM A;  3DG6 A;  4E4F A;  2Y3R A;  2V6O A;  4LII A;  4IL0 A;  1UXY A;  2QKN A;  1T3Q C;  3QLD A;  2FYM A;  4EQS A;  1M6I A;  2GGH A;  4G7F A;  4Z17 A;  2R2Z A;  1X2H A;  1VQZ A;  4H4Q A;  1ZXI C;  3NS1 B;  3W8Z A;  3CXO A;  4K8G A;  5I1W A;  1W1S A;  5JCL A;  5AWV A;  2Q85 A;  3H8A A;  2NPX A;  1NU5 A;  3FXG A;  1BWC A;  2O3G A;  2VAO A;  2QPM A;  2NQW A;  2PTY A;  2CFY A;  1FFV C;  3RJA A;  3CGC A;  3POP A;  3CGE A;  2R9Z A;  1ZMD A;  3CK5 A;  3ENL A;  3S47 A;  4PVJ A;  1TYP A;  4JDR A;  4DWD A;  4A35 A;  1W1K A;  2XH2 A;  2WOW A;  1DXL A;  4FX9 A;  4GGH A;  5J04 A;  1TKK A;  5GRT A;  1W1L A;  3U4F A;  1FEC A;  2DW7 A;  1DII A;  3BW7 A;  2ZZB A;  2RK5 A;  2PGW A;  3TW9 A;  2YAU A;  3BSM A;  5JCI A;  4A3R A;  3DES A;  3DH9 A;  2VFU A;  3Q4D A;  2HXU A;  3D47 A;  3EUB 3;  2F5Z A;  4H2H A;  4H4Z A;  3ZLH A;  3RR1 A;  3LXD A;  1KKO A;  3PK7 A;  3NXL A;  3DED A;  5BOE A;  2EQ7 A;  3VCN A;  4JHM A;  1EC9 A;  1QLU A;  3AMZ A;  1D7Y A;  1XDI A;  4G8T A;  1ELS A;  1VAO A;  4E6M A;  2OQH A;  2PMQ A;  3R1Z A;  5FMH A;  4BUR A;  4EQX A;  3DK9 A;  3PWI A;  2QQ6 A;  3TJ4 A;  3FJ4 A;  4EQR A;  2ZZ0 A;  2YVS A;  2GR1 A;  3MUC A;  3D2D A;  2BC1 A;  2VFS A;  3GY1 A;  4H4S A;  3R07 C;  4HNC A;  2EXR A;  2J3N A;  3CXB A;  2XH0 A;  3FWA A;  3OC4 A;  2BVF A;  2PA6 A;  1FO4 A;  2P3H A;  1SB3 B;  4PWC A;  1VDV A;  4PVH A;  2MNR A;  2PTX A;  3ETR B;  2POZ A;  3AN1 A;  5HMR A;  3FG2 P;  2E3T A;  4O95 A;  4HG0 A;  4EC3 A;  2PP0 A;  3P0W A;  3JW7 A;  3LAD A;  3RIT A;  1E8F A;  5HQX A;  3A7R A;  2QDD A;  3HRD C;  3OTR A;  1EC8 A;  3RJ8 A;  1FHU A;  3ES8 A;  1E8H A;  1DNC A;  2Y08 A;  2BCP A;  4M6U A;  2PPG A;  4PYT A;  1EBD A;  4YWO A;  2VFV A;  2OZ3 A;  3I6T A;  3RO6 A;  3LLB A;  3V4B A;  4HYR A;  2Q4W A;  4GR1 A;  1ECQ A;  3LB8 A;  3NVZ B;  5AE1 A;  4JQ9 A;  4ZA0 A;  1AOG A;  3PQB A;  1PDZ A;  2W3S A;  1EC7 A;  2YQU A;  3GSY A;  2AL2 A;  2AAQ A;  2RDX A;  2GR0 A;  5I1V A;  2CDU A;  1FFU C;  3S1F A;  1NHS A;  4GYP A;  4MGG A; 
#chains in the Genus database with same CATH homology
 4JB1 A;  2PLS A;  4BBY A;  1WYG A;  1DZN A;  2Y3R A;  1UXY A;  2QKN A;  1T3Q C;  4MLA A;  2R2Z A;  5L6F A;  5AE2 A;  3KJM A;  1X2H A;  1VQZ A;  2BVH A;  1ZXI C;  3NS1 B;  3W8Z A;  1W1Q A;  5I1W A;  5K8E A;  3VTE A;  1W1S A;  1E0Y A;  4BC7 A;  5AWV A;  2Q85 A;  4PVK A;  2I0K A;  1AHV A;  4PZF A;  2O3G A;  4ML8 A;  2VAO A;  2QPM A;  2NQW A;  3W8X A;  5ADZ A;  1FFV C;  3TX1 A;  4BC9 A;  3POP A;  3S1D A;  3PQB A;  3RJA A;  2GQT A;  4PVJ A;  4ZOH B;  4TVW A;  2W54 A;  1W1K A;  3TSH A;  3NVW B;  3C0P A;  2UUU A;  1W1L A;  3HSU A;  1W1J A;  4UD8 A;  1DII A;  3BW7 A;  4BCA A;  2RK5 A;  5L6G A;  1N63 C;  5HHZ A;  5FXP A;  2VFU A;  3I99 A;  3EUB 3;  3DED A;  5AE3 A;  1V97 A;  1QLU A;  3AMZ A;  1VAO A;  3S1E A;  1AHZ A;  4DNS A;  2YVS A;  2E5A A;  3FW9 A;  1N5X A;  1W1M A;  3TSJ A;  1WVF A;  3D2D A;  1ZR6 A;  1JRP A;  2AXR A;  2VFS A;  3S1C A;  2MBR A;  1X2G A;  3R07 C;  2EXR A;  2Y4G A;  4JAY A;  2OAI A;  4PWB A;  3FWA A;  5FXE A;  2VFT A;  2BVF A;  1FO4 A;  2P3H A;  1SB3 B;  4PWC A;  2UUV A;  1VDV A;  1N60 C;  3SR6 B;  4PVH A;  1N5W C;  3NVY B;  3DQ0 A;  3PM9 A;  1HSK A;  1W1R A;  2BVG A;  3ETR B;  2PLI A;  5FXF A;  1N62 C;  3AN1 A;  1F0X A;  2E3T A;  4O95 A;  5HMR A;  1JRO A;  3NRZ B;  4HG0 A;  1FIQ B;  1W1O A;  4EC3 A;  3A7U A;  5G5G B;  1E8F A;  5HQX A;  3A7R A;  3HRD C;  5G5H B;  2IPI A;  3LAE A;  3RJ8 A;  1E8H A;  2Y08 A;  2GQU A;  5FXD A;  4OAL A;  4PYT A;  1WVE A;  5D79 A;  2VFV A;  3D2J A;  1MBT A;  3W8W A;  3FW7 A;  1AHU A;  2W55 A;  3LLB A;  4TVY A;  3JS8 A;  1MBB A;  4XLO A;  3D2H A;  2Q4W A;  3A7A A;  1QLT A;  1E8G A;  3NVV B;  2P4P A;  3NVZ B;  5AE1 A;  2R8D A;  1DIQ A;  2W3S A;  3B9J B;  3GSY A;  1I19 A;  2WDW A;  2Y3S A;  2P13 A;  1N61 C;  2VFR A;  5I1V A;  1FFU C;  3AM9 A;  3S1F A;  1RM6 B;  4PVE A;  2W3R A;  3FW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...