4ZOHB

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
277
structure length
274
Chain Sequence
MYPPKFGYVIPDNLNEALEFLEEHQDARPLAGGHSLIPMLKLRLIRPSYIVEIRRFSNLSYITKDGNLYKIGALTTHYNISKSSIPLLSETASNIGDPQVRNMGTIGGSISHLDPSADYPAALIAMDAKVKITSRKGDRVVNFKSFAKDMFTPDLNPGELVTEIQVPTFEGYKFSYQKLERRAGDFAIVGVALLLKLSGDVIEDVRIGLTAVNNVAVRAKGAEEELLGKRLNDEIIEKAATRAMESANPTSGSAEYKKKMVKVLTKRAIITALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
total genus 84
structure length 274
sequence length 277
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
B PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4zohB01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 4zohB03
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4zohB02
3W8XA 1VAOA 1I19A 1DIQA 1VDVA 3NVZB 4DNSA 3DEDA 1X2HA 1JRPA 5FXEA 5FXPA 1N5XA 3ETRB 3TSJA 2W55A 3W8WA 1SB3B 2PLSA 5ADZA 5D79A 3NVYB 4PWBA 1N63C 5G5HB 2BVFA 3NVWB 1W1RA 5AE3A 4PVKA 1N60C 1WYGA 4PVJA 3A7AA 1FFVC 1ZXIC 2W3RA 1W1MA 2VFTA 3KJMA 3NS1B 1DZNA 2VAOA 2VFVA 3TSHA 4JAYA 4PYTA 4BC7A 5AE1A 3AM9A 1E8GA 3VTEA 1QLTA 2VFUA 4TVYA 3R07C 2O3GA 3C0PA 1W1SA 2OAIA 1E8FA 3D2JA 3FWAA 3W8ZA 2BVGA 3S1EA 2YVSA 3LAEA 1JROA 3PM9A 4TVWA 1T3QC 1VQZA 3I99A 4JB1A 3GSYA 1FO4A 2W3SA 2E3TA 5FXFA 4BBYA 2MBRA 2BVHA 2I0KA 1X2GA 1E0YA 2QKNA 3HRDC 1AHVA 2EXRA 5G5GB 2P3HA 1UXYA 3FW9A 4PVEA 2GQUA 3TX1A 3FW7A 4PWCA 2R2ZA 1MBBA 4BC9A 2GQTA 1N62C 3D2HA 3BW7A 1N61C 1WVEA 3NRZB 4ML8A 1HSKA 3A7RA 3NVVB 2PLIA 3AMZA 4PVHA 1E8HA 1N5WC 2E5AA 2R8DA 3S1FA 4PZFA 2RK5A 1W1OA 3AN1A 2AXRA 4XLOA 2P13A 1FIQB 1QLUA 4UD8A 4BCAA 2VFSA 4ZOHB 5HHZA 3B9JB 4HG0A 1W1LA 3SR6B 2VFRA 3FW8A 4EC3A 1ZR6A 2QPMA 1DIIA 1W1KA 2P4PA 3EUB3 1MBTA 5HQXA 3S1DA 3DQ0A 5AE2A 3S1CA 2NQWA 2Q85A 4OALA 5FXDA 3D2DA 1WVFA 1FFUC 3LLBA 2Q4WA 3A7UA 2W54A 1W1QA 5HMRA 4O95A 1V97A 3JS8A 1F0XA 1AHZA 1AHUA 1W1JA 1RM6B 4MLAA
chains in the Genus database with same CATH superfamily
2QJNA 3W8XA 2CFYA 3BSMA 4DNSA 3DGHA 4KWSA 5J04A 3W8WA 3OP2A 3GO2A 3NZGA 5JRBA 4H4ZA 2GGGA 4MMWA 1BZLA 2BVFA 3ZVHA 1NHQA 3II4A 3DK4A 2QDDA 2DW7A 4H4PA 3QKEA 4HCDA 4JDRA 2HXUA 3HPFA 1R0MA 3N4EA 3GD6A 1NPXA 3DFYA 1W1MA 2VFTA 1DZNA 2VAOA 3DG6A 1KD0A 1W6TA 4H4QA 1GEUA 3CAWA 4PYTA 3S5SA 3AM9A 3QN3A 1GETA 3VTEA 4FDCB 4K8DA 3HW2A 2OAIA 3D2JA 3GD4A 3S1EA 1JROA 4LA1A 3CXOA 4TVWA 1T3QC 1KCZA 2P8CA 1RVKA 3V4BA 3N6HA 2OZ3A 3I99A 4GR1A 3QLDA 1H2IA 4K1WA 2DW6A 3RJ8A 4H4VA 1FO4A 4HPNA 2PMQA 4ADWA 2BCPA 2EQ8A 1OJTA 3UJEA 3PQBA 2I0KA 4DX3A 3IK4A 5FJRA 3H7VA 4DWDA 1E0YA 2FYMA 1GXFA 3HRDC 3I6EA 1R6WA 3DJGX 3JVAA 1EC7A 2WOWA 1UXYA 3FW9A 3QFAA 3TX1A 3FW7A 1NHSA 3DFHA 4ZCWA 3D46A 1TYPA 3MUCA 1SJBA 5FJOA 4NEWA 3D2HA 2OLAA 6ENLA 1N61C 2OZ8A 5JCLA 4GMEA 1NDAA 4ML8A 2PLIA 1TKKA 4M6UA 3AMZA 3DK9A 3TJIA 1E8HA 2P88A 2ZZ0A 3T6CA 3MZNA 2EQ7A 3OZYA 3S1FA 4PZFA 2RK5A 1W1OA 3SQSA 2X8GA 5FJUA 1FIQB 2VFSA 5HHZA 4FI4A 4H1ZA 5K8EA 3BOXA 4EMJA 2HNEA 3R0KA 2GR2A 1ZR6A 2GGIA 4G8TA 2IPIA 1MBTA 1NELA 3DQ0A 3S1CA 4H4TA 3H4KA 2Q85A 1D7YA 3D2DA 3DGZA 3GY1A 1KKRA 3N6JA 3S47A 2Q4WA 3A7UA 2XSXA 3VCCA 4O95A 3EJEB 1V97A 3FXGA 3UCCA 3FJ4A 1ZKQA 3R0UA 1AHZA 1AHUA 3V5CA 3ZLHA 4F4RA 1ECQA 1VAOA 2PODA 5KVIA 3BJSA 1JPMA 1VDVA 1EC9A 3VA8A 3R10A 3RJAA 3DEDA 4DNAA 2QGYA 1JRPA 5FXEA 2NVKX 3CGBA 4K8GA 1N5XA 3TSJA 1EBHA 1SB3B 2PSNA 5FS9A 5ADZA 3UXKA 3QTPA 1GESA 5D79A 2MUCA 2PTXA 3NVYB 4PWBA 2OVLA 3GC2A 4H83A 3NVWB 2YVJA 3U9IA 4KPRA 3TCSA 2AKZA 3PK7A 3T9PA 1JDFA 4PVJA 1WYGA 2ZADA 2HZGA 3DG3A 2GGEA 2W3RA 2XH4A 3R11A 3IJIA 3RCYA 1BQGA 3EKGA 1L8PA 2ZC8A 3TSHA 1BWCA 3SN4A 2PP0A 4IP4A 4IZGA 2RABA 4HYRA 2Y08A 2VFUA 4APNA 3T8QA 2GR3A 2XH0A 1E8FA 3JW7A 2BVGA 4GGHA 5AWVA 3LAEA 3SN1A 1IYXA 2GR1A 4IL2A 5BOEA 4GISA 4HNCA 2NPXA 3IJQA 3UJSA 2AKMA 3EEZA 3VCNA 1MRAA 2W0HA 4JB1A 1NU5A 3GD3A 3PWIA 3IJLA 1KN0A 1ONEA 3H12A 2QDEA 1DXLA 5FS6A 2Y3RA 2BVHA 3FG2P 1GRGA 2P8BA 4A6GA 2V3AA 4NEVA 3DERA 1X2GA 2QKNA 1DTNA 5KVHA 3CYJA 5G5GB 3V5FA 4EQWA 3SJNA 2WPCA 4E8GA 4A3RA 3P93A 2EQ9A 7ENLA 2GQUA 2WDWA 4X2PA 5L6FA 4PWCA 2R2ZA 4BC9A 1GRFA 5I1WA 4J56A 1N62C 3MWCA 3P0WA 3FV9A 2ZZCA 3PG6A 3BW7A 3RNMA 1XPYA 3EJBB 1ELSA 1N5WC 1TZZA 2E5AA 2UUVA 2POZA 4M52A 1DNCA 4K7ZA 3QPEA 3R1ZA 4HCHA 4KEMA 2GSHA 3LB8A 2P13A 2WP5A 2X99A 2V3BA 1MO9A 4ZOHB 4HG0A 1PDYA 2R9ZA 3SR6B 2OG9A 4HCLA 2QPMA 3PWGA 1DIIA 3L8KA 4EM4A 1W1KA 3ES7A 3EUB3 1F8WA 1EBDA 1F3PA 3MSYA 3S1DA 2NQWA 3VFCA 3U4FA 1WUFA 5FJPA 4HN8A 1GERA 3TTEA 3LLBA 1JOAA 2QJJA 1W1QA 1WUEA 3SQPA 1ZK7A 4DYEA 2PGWA 2GGHA 3JS8A 3LXDA 1K4QA 2OO6A 5JCMA 4H4XA 2PA6A 1YQZA 1RM6B 3UJFA 1I19A 1DIQA 2TPRA 2AL2A 2F5ZA 4E4FA 1SJDA 1ZMDA 2X8HA 5FXPA 3ETRB 2W55A 2GQWA 2OZTA 3TQPA 2GGJA 3K1GA 3CGEA 1GSNA 3TWAA 1V59A 1FECA 4E5TA 2Y4GA 4ROPA 3MKCA 3DEQA 4HNLA 3CGCA 3CT2A 1NHRA 5AE3A 1JEHA 4EQRA 3DESA 1MDLA 4PVKA 1N60C 3A7AA 3TOYA 3QFBA 3I6TA 3MY9A 4H50A 4IP5A 3RITA 5BOFA 2YAUA 3NS1B 1KKOA 1GRTA 3PFRA 2QJMA 2PCEA 4H4SA 2OQHA 4JAYA 2J3NA 4BC7A 3OC4A 5AE1A 1MNSA 2FKPA 1QLTA 2UUUA 1EC8A 2C3DA 2O3GA 3C0PA 3P3BA 3CB3A 3O0HA 4A35A 2YVSA 1XANA 1FHUA 2QVHA 4ENLA 4DHGA 2WP6A 1ZY8A 2PGEA 2PU0A 3UGVA 2BC1A 3VDGA 2WOVA 2V6OA 4H4UA 3RO6A 2YVGA 3UJRA 2E3TA 3N4FA 2HQMA 3GRSA 1ZX9A 2BC0A 2RDXA 4H4RA 2OX4A 1PDZA 2WOIA 3EANA 3URHA 4Z17A 4H4WA 4JN8A 3DDMA 1AHVA 2EXRA 2PP3A 4GFIA 4KT2A 4K2SA 2P3HA 4GYPC 5JCIA 4JN7A 5FMHA 1TE6A 3D47A 3TW9A 2AAQA 3OTRA 4GRTA 3V3WA 5TR3A 3CGDA 3UCDA 3LADA 2WPFA 1FHVA 2P3ZA 4GGBA 2A8XA 3H70A 3A7RA 1NHPA 4PVHA 3IC9A 3ENLA 3KLJA 2I5QA 3ZVIA 3FVDA 2P0IA 3Q6JA 1M6IA 3ES8A 4ZA0A 4UD8A 1XHCA 3B9JB 2JK6A 2QAEA 4M0XA 3DG7A 3RRAA 1OEPA 2VFRA 2XGZA 4EC3A 1ONFA 2AL2B 2NQLA 1LPFA 2OFJA 4EQXA 4H4YA 2P4PA 1S7MA 3UJ2A 5FXDA 3VC6A 5JCKA 4GYPA 1FFUC 1GV4A 4J1OA 4EMWA 2W54A 5HMRA 2HXTA 3EAOA 2YQUA 2OQYA 2GRTA 2C3CA 3Q45A 1W1JA 1ZDLA 3STPA 3NFUA 1MOKA 4E6MA 5U1OA 4LIIA 3TWBA 2AL1A 3EJDB 2QQ6A 3NVZB 3D9XA 3DH9A 4FX9A 4EQSA 1AOGA 3I4KA 1X2HA 4MGGA 3ZLGA 1LVLA 2PLSA 3VC5A 2XH7A 3FCPA 1N63C 1Q1WA 5G5HB 5IDZA 1GRBA 1W1RA 1XS2A 3DJJA 1STZA 3FYYA 1SJCA 1FFVC 2PP1A 1ZXIC 3L5OA 3OZMA 3CK5A 3KJMA 4DXKA 2WPEA 2CHRA 2WBAA 2Y3SA 3MQTA 2VFVA 3T4WA 1E9IA 1JCTA 2PPGA 1E8GA 4JHMA 4TVYA 2X8CA 1GREA 4YWOA 4E4UA 1GRAA 3R07C 5L6GA 1W1SA 3DK8A 4FP1A 5I1VA 3FWAA 3W8ZA 5EBKA 4J57A 4GIRA 4EMIA 3OPSA 2PTYA 3H8AA 5FS8A 5GRTA 3PM9A 1EBGA 2PTZA 4H19A 4YWSA 1TYTA 3R25A 1VQZA 3NXLA 2CDUA 3DIPA 5U25A 3RGTA 2ONEA 3GSYA 3RR1A 4BURA 2W3SA 5FXFA 4BBYA 3SBFA 2MBRA 1JPDX 3HSUA 2PU1A 4MKSA 3B97A 2GDQA 1XDIA 3JZUA 1Q1RA 3POPA 4IL0A 4BV6A 4EWJA 4H2HA 1MUCA 5JCNA 4PVEA 1ZMCA 3SN0A 2XH2A 2OKTA 3TJ4A 1MBBA 2GQTA 2OPJA 3EF6A 3THUA 1YEYA 3ZLFA 4IT1A 1P43A 2MNRA 1WVEA 3NRZB 2PTWA 5EU9A 3NVVB 1HSKA 2YVFA 2R8DA 1SJAA 4EM3A 3OW1A 5FS7A 1H6VA 1MDRA 1F9CA 3AN1A 4JQ9A 2AXRA 4XLOA 3CXBA 5ENLA 1QLUA 4BCAA 2GR0A 2ZZBA 1W1LA 3ZVHB 3FW8A 3KUMA 3UXLA 5FJTA 4Z1YA 2EQ6A 3GRTA 1FEBA 1GRHA 4IHCA 5HQXA 5ER0A 5AE2A 1P48A 2O56A 2PS2A 4OALA 2X50A 3DGBA 1FEAA 1WVFA 2GH5A 4KPLA 4J3ZA 4DN1A 3SSZA 1BKHA 2GL5A 4G7FA 3Q4DA 1F0XA 4MLAA 3NO1A
chains in the Genus database with same CATH topology
3W8XA 1VAOA 1I19A 1DIQA 1VDVA 3NVZB 4DNSA 3RJAA 3DEDA 1X2HA 1JRPA 5FXEA 5FXPA 1N5XA 3ETRB 3TSJA 2W55A 3W8WA 1SB3B 2PLSA 5ADZA 2Y4GA 5D79A 3NVYB 4PWBA 1N63C 5G5HB 2BVFA 3NVWB 1W1RA 5AE3A 4PVKA 1N60C 1WYGA 4PVJA 3A7AA 1FFVC 1ZXIC 2W3RA 1W1MA 2VFTA 3KJMA 3NS1B 1DZNA 2VAOA 2Y3SA 2VFVA 3TSHA 4JAYA 4PYTA 4BC7A 5AE1A 3AM9A 1E8GA 3VTEA 2Y08A 1QLTA 2VFUA 4TVYA 2UUUA 3R07C 2O3GA 3C0PA 5L6GA 1W1SA 2OAIA 1E8FA 3D2JA 5I1VA 3FWAA 3W8ZA 2BVGA 5AWVA 3S1EA 2YVSA 3LAEA 1JROA 3PM9A 4TVWA 1T3QC 1VQZA 3I99A 4JB1A 3RJ8A 3GSYA 1FO4A 2W3SA 2E3TA 5FXFA 4BBYA 2Y3RA 2MBRA 2BVHA 3PQBA 2I0KA 3HSUA 1X2GA 1E0YA 2QKNA 3HRDC 1AHVA 2EXRA 5G5GB 3POPA 2P3HA 1UXYA 3FW9A 4PVEA 2GQUA 2WDWA 3TX1A 3FW7A 5L6FA 4PWCA 2R2ZA 1MBBA 4BC9A 2GQTA 5I1WA 1N62C 3D2HA 3BW7A 1N61C 1WVEA 3NRZB 4ML8A 1HSKA 3A7RA 3NVVB 2PLIA 3AMZA 4PVHA 1E8HA 1N5WC 2E5AA 2R8DA 2UUVA 3S1FA 4PZFA 2RK5A 1W1OA 3AN1A 2AXRA 4XLOA 2P13A 1FIQB 1QLUA 4UD8A 4BCAA 2VFSA 4ZOHB 5HHZA 3B9JB 4HG0A 5K8EA 1W1LA 3SR6B 2VFRA 3FW8A 4EC3A 1ZR6A 2QPMA 1DIIA 1W1KA 2P4PA 3EUB3 2IPIA 1MBTA 5HQXA 3S1DA 3DQ0A 5AE2A 3S1CA 2NQWA 2Q85A 4OALA 5FXDA 3D2DA 1WVFA 1FFUC 3LLBA 2Q4WA 3A7UA 2W54A 1W1QA 5HMRA 4O95A 1V97A 3JS8A 1F0XA 1AHZA 1AHUA 1W1JA 1RM6B 4MLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W8X A;  1VAO A;  1I19 A;  1DIQ A;  1VDV A;  3NVZ B;  4DNS A;  3DED A;  1X2H A;  1JRP A;  5FXE A;  5FXP A;  1N5X A;  3ETR B;  3TSJ A;  2W55 A;  3W8W A;  1SB3 B;  2PLS A;  5ADZ A;  5D79 A;  3NVY B;  4PWB A;  1N63 C;  5G5H B;  2BVF A;  3NVW B;  1W1R A;  5AE3 A;  4PVK A;  1N60 C;  1WYG A;  4PVJ A;  3A7A A;  1FFV C;  1ZXI C;  2W3R A;  1W1M A;  2VFT A;  3KJM A;  3NS1 B;  1DZN A;  2VAO A;  2VFV A;  3TSH A;  4JAY A;  4PYT A;  4BC7 A;  5AE1 A;  3AM9 A;  1E8G A;  3VTE A;  1QLT A;  2VFU A;  4TVY A;  3R07 C;  2O3G A;  3C0P A;  1W1S A;  2OAI A;  1E8F A;  3D2J A;  3FWA A;  3W8Z A;  2BVG A;  3S1E A;  2YVS A;  3LAE A;  1JRO A;  3PM9 A;  4TVW A;  1T3Q C;  1VQZ A;  3I99 A;  4JB1 A;  3GSY A;  1FO4 A;  2W3S A;  2E3T A;  5FXF A;  4BBY A;  2MBR A;  2BVH A;  2I0K A;  1X2G A;  1E0Y A;  2QKN A;  3HRD C;  1AHV A;  2EXR A;  5G5G B;  2P3H A;  1UXY A;  3FW9 A;  4PVE A;  2GQU A;  3TX1 A;  3FW7 A;  4PWC A;  2R2Z A;  1MBB A;  4BC9 A;  2GQT A;  1N62 C;  3D2H A;  3BW7 A;  1N61 C;  1WVE A;  3NRZ B;  4ML8 A;  1HSK A;  3A7R A;  3NVV B;  2PLI A;  3AMZ A;  4PVH A;  1E8H A;  1N5W C;  2E5A A;  2R8D A;  3S1F A;  4PZF A;  2RK5 A;  1W1O A;  3AN1 A;  2AXR A;  4XLO A;  2P13 A;  1FIQ B;  1QLU A;  4UD8 A;  4BCA A;  2VFS A;  4ZOH B;  5HHZ A;  3B9J B;  4HG0 A;  1W1L A;  3SR6 B;  2VFR A;  3FW8 A;  4EC3 A;  1ZR6 A;  2QPM A;  1DII A;  1W1K A;  2P4P A;  3EUB 3;  1MBT A;  5HQX A;  3S1D A;  3DQ0 A;  5AE2 A;  3S1C A;  2NQW A;  2Q85 A;  4OAL A;  5FXD A;  3D2D A;  1WVF A;  1FFU C;  3LLB A;  2Q4W A;  3A7U A;  2W54 A;  1W1Q A;  5HMR A;  4O95 A;  1V97 A;  3JS8 A;  1F0X A;  1AHZ A;  1AHU A;  1W1J A;  1RM6 B;  4MLA A; 
#chains in the Genus database with same CATH topology
 2QJN A;  3W8X A;  2CFY A;  3BSM A;  4DNS A;  3DGH A;  4KWS A;  5J04 A;  3W8W A;  3OP2 A;  3GO2 A;  3NZG A;  5JRB A;  4H4Z A;  2GGG A;  4MMW A;  1BZL A;  2BVF A;  3ZVH A;  1NHQ A;  3II4 A;  3DK4 A;  2QDD A;  2DW7 A;  4H4P A;  3QKE A;  4HCD A;  4JDR A;  2HXU A;  3HPF A;  1R0M A;  3N4E A;  3GD6 A;  1NPX A;  3DFY A;  1W1M A;  2VFT A;  1DZN A;  2VAO A;  3DG6 A;  1KD0 A;  1W6T A;  4H4Q A;  1GEU A;  3CAW A;  4PYT A;  3S5S A;  3AM9 A;  3QN3 A;  1GET A;  3VTE A;  4FDC B;  4K8D A;  3HW2 A;  2OAI A;  3D2J A;  3GD4 A;  3S1E A;  1JRO A;  4LA1 A;  3CXO A;  4TVW A;  1T3Q C;  1KCZ A;  2P8C A;  1RVK A;  3V4B A;  3N6H A;  2OZ3 A;  3I99 A;  4GR1 A;  3QLD A;  1H2I A;  4K1W A;  2DW6 A;  3RJ8 A;  4H4V A;  1FO4 A;  4HPN A;  2PMQ A;  4ADW A;  2BCP A;  2EQ8 A;  1OJT A;  3UJE A;  3PQB A;  2I0K A;  4DX3 A;  3IK4 A;  5FJR A;  3H7V A;  4DWD A;  1E0Y A;  2FYM A;  1GXF A;  3HRD C;  3I6E A;  1R6W A;  3DJG X;  3JVA A;  1EC7 A;  2WOW A;  1UXY A;  3FW9 A;  3QFA A;  3TX1 A;  3FW7 A;  1NHS A;  3DFH A;  4ZCW A;  3D46 A;  1TYP A;  3MUC A;  1SJB A;  5FJO A;  4NEW A;  3D2H A;  2OLA A;  6ENL A;  1N61 C;  2OZ8 A;  5JCL A;  4GME A;  1NDA A;  4ML8 A;  2PLI A;  1TKK A;  4M6U A;  3AMZ A;  3DK9 A;  3TJI A;  1E8H A;  2P88 A;  2ZZ0 A;  3T6C A;  3MZN A;  2EQ7 A;  3OZY A;  3S1F A;  4PZF A;  2RK5 A;  1W1O A;  3SQS A;  2X8G A;  5FJU A;  1FIQ B;  2VFS A;  5HHZ A;  4FI4 A;  4H1Z A;  5K8E A;  3BOX A;  4EMJ A;  2HNE A;  3R0K A;  2GR2 A;  1ZR6 A;  2GGI A;  4G8T A;  2IPI A;  1MBT A;  1NEL A;  3DQ0 A;  3S1C A;  4H4T A;  3H4K A;  2Q85 A;  1D7Y A;  3D2D A;  3DGZ A;  3GY1 A;  1KKR A;  3N6J A;  3S47 A;  2Q4W A;  3A7U A;  2XSX A;  3VCC A;  4O95 A;  3EJE B;  1V97 A;  3FXG A;  3UCC A;  3FJ4 A;  1ZKQ A;  3R0U A;  1AHZ A;  1AHU A;  3V5C A;  3ZLH A;  4F4R A;  1ECQ A;  1VAO A;  2POD A;  5KVI A;  3BJS A;  1JPM A;  1VDV A;  1EC9 A;  3VA8 A;  3R10 A;  3RJA A;  3DED A;  4DNA A;  2QGY A;  1JRP A;  5FXE A;  2NVK X;  3CGB A;  4K8G A;  1N5X A;  3TSJ A;  1EBH A;  1SB3 B;  2PSN A;  5FS9 A;  5ADZ A;  3UXK A;  3QTP A;  1GES A;  5D79 A;  2MUC A;  2PTX A;  3NVY B;  4PWB A;  2OVL A;  3GC2 A;  4H83 A;  3NVW B;  2YVJ A;  3U9I A;  4KPR A;  3TCS A;  2AKZ A;  3PK7 A;  3T9P A;  1JDF A;  4PVJ A;  1WYG A;  2ZAD A;  2HZG A;  3DG3 A;  2GGE A;  2W3R A;  2XH4 A;  3R11 A;  3IJI A;  3RCY A;  1BQG A;  3EKG A;  1L8P A;  2ZC8 A;  3TSH A;  1BWC A;  3SN4 A;  2PP0 A;  4IP4 A;  4IZG A;  2RAB A;  4HYR A;  2Y08 A;  2VFU A;  4APN A;  3T8Q A;  2GR3 A;  2XH0 A;  1E8F A;  3JW7 A;  2BVG A;  4GGH A;  5AWV A;  3LAE A;  3SN1 A;  1IYX A;  2GR1 A;  4IL2 A;  5BOE A;  4GIS A;  4HNC A;  2NPX A;  3IJQ A;  3UJS A;  2AKM A;  3EEZ A;  3VCN A;  1MRA A;  2W0H A;  4JB1 A;  1NU5 A;  3GD3 A;  3PWI A;  3IJL A;  1KN0 A;  1ONE A;  3H12 A;  2QDE A;  1DXL A;  5FS6 A;  2Y3R A;  2BVH A;  3FG2 P;  1GRG A;  2P8B A;  4A6G A;  2V3A A;  4NEV A;  3DER A;  1X2G A;  2QKN A;  1DTN A;  5KVH A;  3CYJ A;  5G5G B;  3V5F A;  4EQW A;  3SJN A;  2WPC A;  4E8G A;  4A3R A;  3P93 A;  2EQ9 A;  7ENL A;  2GQU A;  2WDW A;  4X2P A;  5L6F A;  4PWC A;  2R2Z A;  4BC9 A;  1GRF A;  5I1W A;  4J56 A;  1N62 C;  3MWC A;  3P0W A;  3FV9 A;  2ZZC A;  3PG6 A;  3BW7 A;  3RNM A;  1XPY A;  3EJB B;  1ELS A;  1N5W C;  1TZZ A;  2E5A A;  2UUV A;  2POZ A;  4M52 A;  1DNC A;  4K7Z A;  3QPE A;  3R1Z A;  4HCH A;  4KEM A;  2GSH A;  3LB8 A;  2P13 A;  2WP5 A;  2X99 A;  2V3B A;  1MO9 A;  4ZOH B;  4HG0 A;  1PDY A;  2R9Z A;  3SR6 B;  2OG9 A;  4HCL A;  2QPM A;  3PWG A;  1DII A;  3L8K A;  4EM4 A;  1W1K A;  3ES7 A;  3EUB 3;  1F8W A;  1EBD A;  1F3P A;  3MSY A;  3S1D A;  2NQW A;  3VFC A;  3U4F A;  1WUF A;  5FJP A;  4HN8 A;  1GER A;  3TTE A;  3LLB A;  1JOA A;  2QJJ A;  1W1Q A;  1WUE A;  3SQP A;  1ZK7 A;  4DYE A;  2PGW A;  2GGH A;  3JS8 A;  3LXD A;  1K4Q A;  2OO6 A;  5JCM A;  4H4X A;  2PA6 A;  1YQZ A;  1RM6 B;  3UJF A;  1I19 A;  1DIQ A;  2TPR A;  2AL2 A;  2F5Z A;  4E4F A;  1SJD A;  1ZMD A;  2X8H A;  5FXP A;  3ETR B;  2W55 A;  2GQW A;  2OZT A;  3TQP A;  2GGJ A;  3K1G A;  3CGE A;  1GSN A;  3TWA A;  1V59 A;  1FEC A;  4E5T A;  2Y4G A;  4ROP A;  3MKC A;  3DEQ A;  4HNL A;  3CGC A;  3CT2 A;  1NHR A;  5AE3 A;  1JEH A;  4EQR A;  3DES A;  1MDL A;  4PVK A;  1N60 C;  3A7A A;  3TOY A;  3QFB A;  3I6T A;  3MY9 A;  4H50 A;  4IP5 A;  3RIT A;  5BOF A;  2YAU A;  3NS1 B;  1KKO A;  1GRT A;  3PFR A;  2QJM A;  2PCE A;  4H4S A;  2OQH A;  4JAY A;  2J3N A;  4BC7 A;  3OC4 A;  5AE1 A;  1MNS A;  2FKP A;  1QLT A;  2UUU A;  1EC8 A;  2C3D A;  2O3G A;  3C0P A;  3P3B A;  3CB3 A;  3O0H A;  4A35 A;  2YVS A;  1XAN A;  1FHU A;  2QVH A;  4ENL A;  4DHG A;  2WP6 A;  1ZY8 A;  2PGE A;  2PU0 A;  3UGV A;  2BC1 A;  3VDG A;  2WOV A;  2V6O A;  4H4U A;  3RO6 A;  2YVG A;  3UJR A;  2E3T A;  3N4F A;  2HQM A;  3GRS A;  1ZX9 A;  2BC0 A;  2RDX A;  4H4R A;  2OX4 A;  1PDZ A;  2WOI A;  3EAN A;  3URH A;  4Z17 A;  4H4W A;  4JN8 A;  3DDM A;  1AHV A;  2EXR A;  2PP3 A;  4GFI A;  4KT2 A;  4K2S A;  2P3H A;  4GYP C;  5JCI A;  4JN7 A;  5FMH A;  1TE6 A;  3D47 A;  3TW9 A;  2AAQ A;  3OTR A;  4GRT A;  3V3W A;  5TR3 A;  3CGD A;  3UCD A;  3LAD A;  2WPF A;  1FHV A;  2P3Z A;  4GGB A;  2A8X A;  3H70 A;  3A7R A;  1NHP A;  4PVH A;  3IC9 A;  3ENL A;  3KLJ A;  2I5Q A;  3ZVI A;  3FVD A;  2P0I A;  3Q6J A;  1M6I A;  3ES8 A;  4ZA0 A;  4UD8 A;  1XHC A;  3B9J B;  2JK6 A;  2QAE A;  4M0X A;  3DG7 A;  3RRA A;  1OEP A;  2VFR A;  2XGZ A;  4EC3 A;  1ONF A;  2AL2 B;  2NQL A;  1LPF A;  2OFJ A;  4EQX A;  4H4Y A;  2P4P A;  1S7M A;  3UJ2 A;  5FXD A;  3VC6 A;  5JCK A;  4GYP A;  1FFU C;  1GV4 A;  4J1O A;  4EMW A;  2W54 A;  5HMR A;  2HXT A;  3EAO A;  2YQU A;  2OQY A;  2GRT A;  2C3C A;  3Q45 A;  1W1J A;  1ZDL A;  3STP A;  3NFU A;  1MOK A;  4E6M A;  5U1O A;  4LII A;  3TWB A;  2AL1 A;  3EJD B;  2QQ6 A;  3NVZ B;  3D9X A;  3DH9 A;  4FX9 A;  4EQS A;  1AOG A;  3I4K A;  1X2H A;  4MGG A;  3ZLG A;  1LVL A;  2PLS A;  3VC5 A;  2XH7 A;  3FCP A;  1N63 C;  1Q1W A;  5G5H B;  5IDZ A;  1GRB A;  1W1R A;  1XS2 A;  3DJJ A;  1STZ A;  3FYY A;  1SJC A;  1FFV C;  2PP1 A;  1ZXI C;  3L5O A;  3OZM A;  3CK5 A;  3KJM A;  4DXK A;  2WPE A;  2CHR A;  2WBA A;  2Y3S A;  3MQT A;  2VFV A;  3T4W A;  1E9I A;  1JCT A;  2PPG A;  1E8G A;  4JHM A;  4TVY A;  2X8C A;  1GRE A;  4YWO A;  4E4U A;  1GRA A;  3R07 C;  5L6G A;  1W1S A;  3DK8 A;  4FP1 A;  5I1V A;  3FWA A;  3W8Z A;  5EBK A;  4J57 A;  4GIR A;  4EMI A;  3OPS A;  2PTY A;  3H8A A;  5FS8 A;  5GRT A;  3PM9 A;  1EBG A;  2PTZ A;  4H19 A;  4YWS A;  1TYT A;  3R25 A;  1VQZ A;  3NXL A;  2CDU A;  3DIP A;  5U25 A;  3RGT A;  2ONE A;  3GSY A;  3RR1 A;  4BUR A;  2W3S A;  5FXF A;  4BBY A;  3SBF A;  2MBR A;  1JPD X;  3HSU A;  2PU1 A;  4MKS A;  3B97 A;  2GDQ A;  1XDI A;  3JZU A;  1Q1R A;  3POP A;  4IL0 A;  4BV6 A;  4EWJ A;  4H2H A;  1MUC A;  5JCN A;  4PVE A;  1ZMC A;  3SN0 A;  2XH2 A;  2OKT A;  3TJ4 A;  1MBB A;  2GQT A;  2OPJ A;  3EF6 A;  3THU A;  1YEY A;  3ZLF A;  4IT1 A;  1P43 A;  2MNR A;  1WVE A;  3NRZ B;  2PTW A;  5EU9 A;  3NVV B;  1HSK A;  2YVF A;  2R8D A;  1SJA A;  4EM3 A;  3OW1 A;  5FS7 A;  1H6V A;  1MDR A;  1F9C A;  3AN1 A;  4JQ9 A;  2AXR A;  4XLO A;  3CXB A;  5ENL A;  1QLU A;  4BCA A;  2GR0 A;  2ZZB A;  1W1L A;  3ZVH B;  3FW8 A;  3KUM A;  3UXL A;  5FJT A;  4Z1Y A;  2EQ6 A;  3GRT A;  1FEB A;  1GRH A;  4IHC A;  5HQX A;  5ER0 A;  5AE2 A;  1P48 A;  2O56 A;  2PS2 A;  4OAL A;  2X50 A;  3DGB A;  1FEA A;  1WVF A;  2GH5 A;  4KPL A;  4J3Z A;  4DN1 A;  3SSZ A;  1BKH A;  2GL5 A;  4G7F A;  3Q4D A;  1F0X A;  4MLA A;  3NO1 A; 
#chains in the Genus database with same CATH homology
 3W8X A;  1VAO A;  1I19 A;  1DIQ A;  1VDV A;  3NVZ B;  4DNS A;  3RJA A;  3DED A;  1X2H A;  1JRP A;  5FXE A;  5FXP A;  1N5X A;  3ETR B;  3TSJ A;  2W55 A;  3W8W A;  1SB3 B;  2PLS A;  5ADZ A;  2Y4G A;  5D79 A;  3NVY B;  4PWB A;  1N63 C;  5G5H B;  2BVF A;  3NVW B;  1W1R A;  5AE3 A;  4PVK A;  1N60 C;  1WYG A;  4PVJ A;  3A7A A;  1FFV C;  1ZXI C;  2W3R A;  1W1M A;  2VFT A;  3KJM A;  3NS1 B;  1DZN A;  2VAO A;  2Y3S A;  2VFV A;  3TSH A;  4JAY A;  4PYT A;  4BC7 A;  5AE1 A;  3AM9 A;  1E8G A;  3VTE A;  2Y08 A;  1QLT A;  2VFU A;  4TVY A;  2UUU A;  3R07 C;  2O3G A;  3C0P A;  5L6G A;  1W1S A;  2OAI A;  1E8F A;  3D2J A;  5I1V A;  3FWA A;  3W8Z A;  2BVG A;  5AWV A;  3S1E A;  2YVS A;  3LAE A;  1JRO A;  3PM9 A;  4TVW A;  1T3Q C;  1VQZ A;  3I99 A;  4JB1 A;  3RJ8 A;  3GSY A;  1FO4 A;  2W3S A;  2E3T A;  5FXF A;  4BBY A;  2Y3R A;  2MBR A;  2BVH A;  3PQB A;  2I0K A;  3HSU A;  1X2G A;  1E0Y A;  2QKN A;  3HRD C;  1AHV A;  2EXR A;  5G5G B;  3POP A;  2P3H A;  1UXY A;  3FW9 A;  4PVE A;  2GQU A;  2WDW A;  3TX1 A;  3FW7 A;  5L6F A;  4PWC A;  2R2Z A;  1MBB A;  4BC9 A;  2GQT A;  5I1W A;  1N62 C;  3D2H A;  3BW7 A;  1N61 C;  1WVE A;  3NRZ B;  4ML8 A;  1HSK A;  3A7R A;  3NVV B;  2PLI A;  3AMZ A;  4PVH A;  1E8H A;  1N5W C;  2E5A A;  2R8D A;  2UUV A;  3S1F A;  4PZF A;  2RK5 A;  1W1O A;  3AN1 A;  2AXR A;  4XLO A;  2P13 A;  1FIQ B;  1QLU A;  4UD8 A;  4BCA A;  2VFS A;  4ZOH B;  5HHZ A;  3B9J B;  4HG0 A;  5K8E A;  1W1L A;  3SR6 B;  2VFR A;  3FW8 A;  4EC3 A;  1ZR6 A;  2QPM A;  1DII A;  1W1K A;  2P4P A;  3EUB 3;  2IPI A;  1MBT A;  5HQX A;  3S1D A;  3DQ0 A;  5AE2 A;  3S1C A;  2NQW A;  2Q85 A;  4OAL A;  5FXD A;  3D2D A;  1WVF A;  1FFU C;  3LLB A;  2Q4W A;  3A7U A;  2W54 A;  1W1Q A;  5HMR A;  4O95 A;  1V97 A;  3JS8 A;  1F0X A;  1AHZ A;  1AHU A;  1W1J A;  1RM6 B;  4MLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...