4ZOHB

Crystal structure of glyceraldehyde oxidoreductase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
277
structure length
274
Chain Sequence
MYPPKFGYVIPDNLNEALEFLEEHQDARPLAGGHSLIPMLKLRLIRPSYIVEIRRFSNLSYITKDGNLYKIGALTTHYNISKSSIPLLSETASNIGDPQVRNMGTIGGSISHLDPSADYPAALIAMDAKVKITSRKGDRVVNFKSFAKDMFTPDLNPGELVTEIQVPTFEGYKFSYQKLERRAGDFAIVGVALLLKLSGDVIEDVRIGLTAVNNVAVRAKGAEEELLGKRLNDEIIEKAATRAMESANPTSGSAEYKKKMVKVLTKRAIITALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase molybdopterin-binding subunit
publication title Archaeal Mo-Containing Glyceraldehyde Oxidoreductase Isozymes Exhibit Diverse Substrate Specificities through Unique Subunit Assemblies.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 84
structure length 274
sequence length 277
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
B PF03450 CO_deh_flav_C CO dehydrogenase flavoprotein C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4zohB01
3.30.390.50 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 CO dehydrogenase flavoprotein, C-terminal domain 4zohB03
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4zohB02
5ADZA 1DIQA 1FIQB 3GSYA 3S1EA 1W1JA 3W8XA 5G5GB 4ZOHB 4JB1A 2YVSA 4ML8A 1SB3B 2Q85A 1E8GA 4JAYA 4PVJA 1N62C 2QKNA 1N60C 3FW9A 1W1KA 3BW7A 2E5AA 3PM9A 2AXRA 2P13A 2GQTA 1W1LA 2VFVA 2E3TA 3NVZB 3S1FA 1N5XA 4BCAA 1JROA 1E0YA 2VFSA 1VDVA 1I19A 4TVYA 1W1RA 1E8HA 3FW8A 3A7UA 4BBYA 3C0PA 3TX1A 3EUB3 1FFVC 3S1CA 1RM6B 4PVEA 3NVVB 4PVHA 4EC3A 2BVFA 2QPMA 3I99A 3D2HA 3AN1A 1X2HA 2MBRA 1V97A 5FXFA 5AE3A 3LAEA 4PZFA 2PLSA 1FFUC 2W55A 1QLUA 3AM9A 1X2GA 2RK5A 2P4PA 5D79A 3A7AA 3W8ZA 1WVEA 1E8FA 4MLAA 4HG0A 1DZNA 3JS8A 1MBTA 4PVKA 3TSHA 3NVYB 2R2ZA 3LLBA 1DIIA 2BVHA 4UD8A 2NQWA 1ZXIC 1VAOA 1MBBA 3NS1B 5AE2A 3NVWB 4DNSA 3VTEA 5HHZA 3B9JB 1JRPA 1FO4A 1WVFA 3D2JA 2O3GA 2OAIA 1W1SA 1VQZA 5FXDA 1WYGA 1QLTA 4BC9A 5G5HB 3KJMA 3D2DA 1W1MA 2W3SA 3FW7A 2VFRA 3SR6B 1F0XA 2VFUA 1AHZA 4PWBA 1ZR6A 2W3RA 3A7RA 1W1QA 2BVGA 2W54A 3W8WA 5HQXA 4PWCA 2Q4WA 2GQUA 3TSJA 5FXPA 1AHUA 1N63C 4O95A 4XLOA 3S1DA 4TVWA 2EXRA 2P3HA 1N5WC 2I0KA 3DEDA 3ETRB 4OALA 2VFTA 3DQ0A 4PYTA 1T3QC 3R07C 3HRDC 2R8DA 5AE1A 3FWAA 1UXYA 4BC7A 5FXEA 2PLIA 1HSKA 1W1OA 3NRZB 1AHVA 2VAOA 1N61C 3AMZA 5HMRA
chains in the Genus database with same CATH superfamily
1DIQA 5JCIA 4Z17A 1W1JA 2OO6A 2QQ6A 3DEQA 3T9PA 3UGVA 3GO2A 3RO6A 3DJGX 3RITA 3GRTA 5FJOA 3DGZA 3OPSA 3FW9A 1MDRA 3FV9A 1SJDA 3BW7A 2E5AA 2QGYA 3PM9A 2GQWA 3CXBA 1BKHA 1JDFA 3N6JA 1GERA 4H4ZA 3PWIA 2E3TA 3S1FA 3V5CA 1EBGA 4A6GA 3MSYA 3EJEB 5FJRA 1NHPA 3FW8A 1R0MA 2RDXA 1ZKQA 1FHUA 4DWDA 1RM6B 2DW6A 1P48A 3BSMA 3II4A 4PVHA 3L8KA 4MKSA 5EBKA 3TTEA 3FYYA 2WP5A 1JPDX 3JW7A 4NEVA 1P43A 3UJFA 1K4QA 3UCDA 4IL2A 3GD4A 1X2GA 2P4PA 5D79A 1NHQA 3W8ZA 2OZ8A 3U9IA 2CDUA 2GGHA 1WVEA 3URHA 1DZNA 1ELSA 3D9XA 3JS8A 1SJCA 1PDZA 2FYMA 4BURA 4MMWA 2PMQA 1NELA 1LVLA 2QDEA 3EANA 3CT2A 4FDCB 3H12A 3GY1A 2AL2A 3LLBA 4K7ZA 1ECQA 2BVHA 1EC9A 3PWGA 3QFAA 2A8XA 3RR1A 3TOYA 4GRTA 1MBBA 5FS6A 3SQSA 2V3AA 2PSNA 4IL0A 3VTEA 5HHZA 5FS8A 1EBHA 2WPCA 2PTXA 3D2JA 1EC7A 3CGCA 2YAUA 4HPNA 3IJLA 4LIIA 3HSUA 3RCYA 2OLAA 3D2DA 4H4PA 1W1MA 4H4YA 2W3SA 2GR2A 2PA6A 3EAOA 1F0XA 2BC0A 2XH0A 4PWBA 4KPRA 2MUCA 1W1QA 5HQXA 5TR3A 4H4RA 2AL2B 3DJJA 2Q4WA 3TSJA 2W0HA 3BJSA 4O95A 2HQMA 1IYXA 3DEDA 1XHCA 2O56A 4GGHA 1H6VA 4OALA 3SN1A 1BWCA 3NZGA 4GGBA 2YQUA 1T3QC 3R07C 2PPGA 3HRDC 1TKKA 4G8TA 2X8CA 2P8BA 3OZMA 1GREA 4BC7A 1ZY8A 2ZC8A 1JOAA 1W1OA 3JVAA 2NVKX 2VAOA 1N61C 4IP4A 3DK9A 4JDRA 2ONEA 4EMWA 3HPFA 1FIQB 3S1EA 1XANA 4HCLA 3CYJA 1ZX9A 1JEHA 4ZOHB 1GXFA 4JB1A 1XPYA 4KPLA 2GSHA 4M52A 4JAYA 4IHCA 1N62C 2QKNA 2PGWA 4H4TA 4Z1YA 2Y3RA 3FXGA 3EEZA 2Y08A 2PP0A 2Y3SA 1GRTA 2CHRA 1W1KA 2V6OA 3CK5A 3DK8A 3GD3A 5AWVA 1TE6A 2GRTA 3RNMA 2P13A 2GQTA 1GV4A 4J3ZA 3NVZB 3MZNA 2IPIA 1RVKA 3MQTA 4BCAA 4ZA0A 3PK7A 3DGBA 1E0YA 1VDVA 4TVYA 5L6FA 3CAWA 1W1RA 1E8HA 3A7UA 4DYEA 2GL5A 4HCDA 5JCKA 3NVVB 1FFVC 1XDIA 2XH7A 3DFHA 2YVJA 3V4BA 3MWCA 3I99A 3DFYA 3VA8A 1GRAA 2GR0A 3R10A 1TZZA 1XS2A 1X2HA 2WPFA 2YVGA 2MBRA 3QLDA 3TW9A 1V97A 2BC1A 3ZVHA 4PZFA 4A35A 2EQ7A 1FFUC 2DW7A 4FX9A 3PG6A 1ZDLA 3IJIA 3SN0A 2PP3A 1M6IA 3H4KA 3PQBA 4DHGA 6ENLA 1E8FA 3RGTA 4GMEA 2P8CA 1WUEA 1E9IA 4DN1A 2PCEA 2GH5A 2GGIA 2OZ3A 3IJQA 2NQWA 1ZXIC 4HNCA 1KN0A 2CFYA 2HXUA 4ADWA 3EF6A 3LADA 5I1WA 3H7VA 1R6WA 4DNSA 3VCCA 2MNRA 3CGBA 1WVFA 3FCPA 1BQGA 1Q1RA 2Y4GA 3SBFA 2OAIA 1W1SA 3ZVHB 4EMJA 5FXDA 5K8EA 1F9CA 1ZMCA 2PS2A 3N4FA 4GISA 2UUVA 4HYRA 3R25A 3FW7A 5KVIA 2UUUA 3SR6B 4K8GA 2YVFA 3RJ8A 1TYTA 4ROPA 3OTRA 2AAQA 3NO1A 3SJNA 4E4FA 5FS9A 1F8WA 2RABA 3CGDA 2ZADA 4H4XA 4YWSA 2XSXA 4PWCA 2WPEA 2PTWA 1SJAA 1GSNA 5JRBA 4LA1A 1AOGA 5FXPA 4TVWA 1YQZA 3OW1A 1MUCA 3R0KA 3KLJA 3DQ0A 4PYTA 1BZLA 1DTNA 2J3NA 3NXLA 1FHVA 2QAEA 3EJBB 3MKCA 2PLIA 2EQ6A 3FJ4A 1GEUA 3N6HA 2C3CA 4E4UA 3AMZA 2GGEA 2P3ZA 3GRSA 1MDLA 3H70A 3W8XA 2ZZCA 1KKOA 5G5GB 2ZZBA 2I5QA 4MGGA 2OQHA 4ML8A 2Q85A 2X50A 2PTZA 3VDGA 3ZLHA 5L6GA 1Q1WA 4HCHA 2OZTA 1N60C 2QDDA 3KUMA 3THUA 4H4QA 3R1ZA 2JK6A 3QPEA 3DG7A 2WDWA 1KD0A 1PDYA 3SSZA 2VFVA 2WOVA 3Q4DA 2C3DA 4GYPA 3UJSA 3UJRA 4DXKA 1JROA 1NHSA 1MNSA 2OQYA 3N4EA 3ENLA 4JHMA 4H4SA 2QJNA 4K8DA 3TWAA 3TX1A 3EUB3 3S1CA 5J04A 4PVEA 5JCNA 5U1OA 4EC3A 2QPMA 3EKGA 3D2HA 3AN1A 5FS7A 3IK4A 2TPRA 2PGEA 5FMHA 2R9ZA 5FXFA 5AE3A 2GR1A 2QVHA 4K2SA 5IDZA 2W55A 1QLUA 2RK5A 2ZZ0A 1LPFA 2AKZA 4EQWA 3DDMA 3RRAA 3L5OA 5KVHA 3DIPA 3TWBA 2WOIA 4IP5A 4MLAA 1SJBA 3V5FA 3P0WA 4KT2A 4EQRA 2EQ9A 3TJIA 5JCMA 3SN4A 1MBTA 4FI4A 4PVKA 3O0HA 2GGGA 3DG6A 2OFJA 2WP6A 1MO9A 3TCSA 5U25A 4M0XA 3VFCA 1TYPA 5EU9A 3S47A 3T8QA 1OJTA 3JZUA 4J57A 4H2HA 3NVWB 5AE2A 1MRAA 3MY9A 4F4RA 2XH2A 5I1VA 3VCNA 5BOFA 2X8GA 2O3GA 1VQZA 1GRGA 1FEAA 3VC6A 3QFBA 3RJAA 1QLTA 4BC9A 1NHRA 1NU5A 4K1WA 3UJEA 5FJUA 4E6MA 2GDQA 1ZMDA 3I6EA 2PODA 2W3RA 4ENLA 2POZA 4HN8A 2PTYA 4FP1A 2W54A 2PP1A 1V59A 3ES8A 5ENLA 2PU1A 1H2IA 2GQUA 1WUFA 1N63C 4XLOA 3S1DA 3LXDA 3DH9A 3DESA 3OP2A 1N5WC 4JN7A 3HW2A 3GD6A 5FJTA 2HNEA 2X99A 1GRBA 1JCTA 2R8DA 2HZGA 3D47A 3FVDA 1UXYA 3PFRA 5FXEA 2F5ZA 2GR3A 1NPXA 3DERA 4E8GA 1ONFA 1HSKA 5GRTA 1AHVA 2OVLA 4GFIA 1SB3B 5ADZA 3B97A 3GSYA 1W6TA 3CB3A 4DX3A 4H50A 3S5SA 3QN3A 4E5TA 2QJMA 1EC8A 3P93A 7ENLA 3DG3A 2YVSA 5FJPA 3UCCA 1FECA 1E8GA 4PVJA 4DNAA 3H8AA 3QKEA 3POPA 2GGJA 3T6CA 4APNA 3UJ2A 4A3RA 3I4KA 3U4FA 4GYPC 2QJJA 2AXRA 3EJDB 1GRHA 1W1LA 2OG9A 3STPA 1STZA 4H1ZA 1N5XA 2P88A 4BV6A 2VFSA 1I19A 4ZCWA 1YEYA 4BBYA 3C0PA 2WOWA 3R0UA 3QTPA 2OPJA 3P3BA 1KKRA 3MUCA 4H4VA 4EM4A 2BVFA 4IZGA 4KWSA 4JQ9A 2NPXA 2OX4A 3TJ4A 1ZK7A 4G7FA 4IT1A 3LAEA 4JN8A 2PLSA 3Q45A 3AM9A 3ZLFA 4H4UA 1DXLA 3A7AA 4YWOA 1F3PA 2EQ8A 3D46A 4M6UA 3V3WA 3BOXA 5BOEA 4HG0A 1OEPA 3CXOA 1ONEA 4EM3A 3UXLA 3ZVIA 3TSHA 3NVYB 4H19A 2R2ZA 3Q6JA 4EMIA 4J56A 2X8HA 3ES7A 1DIIA 4UD8A 2BCPA 3NFUA 2V3BA 3UXKA 1VAOA 3IC9A 1NDAA 1S7MA 4EQXA 3NS1B 2P0IA 4HNLA 3DK4A 1JRPA 3B9JB 4X2PA 1FO4A 4J1OA 4H4WA 4KEMA 2HXTA 5ER0A 3OZYA 1MOKA 2FKPA 3CGEA 4H83A 1WYGA 1D7YA 3GC2A 1KCZA 1FEBA 5G5HB 3KJMA 3VC5A 5JCLA 2VFRA 2VFUA 1AHZA 1ZR6A 1DNCA 3A7RA 4EQSA 3SQPA 3R11A 1L8PA 2BVGA 3I6TA 3W8WA 4GR1A 3FG2P 3TQPA 3OC4A 3LB8A 1GRFA 3ZLGA 3K1GA 1JPMA 1AHUA 2XGZA 2EXRA 2P3HA 1GESA 2AKMA 2I0KA 4EWJA 1GETA 3ETRB 1EBDA 2VFTA 2PU0A 2NQLA 3T4WA 2OKTA 5AE1A 3FWAA 4GIRA 2XH4A 2AL1A 2WBAA 3NRZB 3DGHA 4NEWA 5HMRA
chains in the Genus database with same CATH topology
5ADZA 1DIQA 1FIQB 3GSYA 3S1EA 1W1JA 3W8XA 5G5GB 4ZOHB 4JB1A 2YVSA 4ML8A 1SB3B 2Q85A 1E8GA 4JAYA 4PVJA 1N62C 2QKNA 2Y3RA 5L6GA 3POPA 1N60C 2Y08A 2Y3SA 3FW9A 1W1KA 3BW7A 2E5AA 3PM9A 2AXRA 5AWVA 2P13A 2GQTA 2WDWA 1W1LA 2VFVA 2E3TA 3NVZB 3S1FA 2IPIA 1N5XA 4BCAA 1JROA 1E0YA 2VFSA 1VDVA 1I19A 4TVYA 5L6FA 1W1RA 1E8HA 3FW8A 3A7UA 4BBYA 3C0PA 3TX1A 3EUB3 1FFVC 3S1CA 1RM6B 4PVEA 3NVVB 4PVHA 4EC3A 2BVFA 2QPMA 3I99A 3D2HA 3AN1A 1X2HA 2MBRA 1V97A 5FXFA 5AE3A 3LAEA 4PZFA 2PLSA 1FFUC 2W55A 1QLUA 3AM9A 1X2GA 2RK5A 2P4PA 5D79A 3A7AA 3W8ZA 3PQBA 1WVEA 1E8FA 4MLAA 4HG0A 1DZNA 3JS8A 1MBTA 4PVKA 3TSHA 3NVYB 2R2ZA 3LLBA 1DIIA 2BVHA 4UD8A 2NQWA 1ZXIC 1VAOA 1MBBA 5I1WA 3NS1B 5AE2A 3NVWB 4DNSA 3VTEA 5HHZA 3B9JB 1JRPA 5I1VA 1FO4A 1WVFA 2Y4GA 3D2JA 2O3GA 2OAIA 1W1SA 1VQZA 5FXDA 1WYGA 3HSUA 5K8EA 3RJAA 1QLTA 4BC9A 5G5HB 3KJMA 3D2DA 1W1MA 2UUVA 2W3SA 3FW7A 2VFRA 3SR6B 2UUUA 1F0XA 2VFUA 1AHZA 3RJ8A 4PWBA 1ZR6A 2W3RA 3A7RA 1W1QA 2BVGA 2W54A 3W8WA 5HQXA 4PWCA 2Q4WA 2GQUA 3TSJA 5FXPA 1AHUA 1N63C 4O95A 4XLOA 3S1DA 4TVWA 2EXRA 2P3HA 1N5WC 2I0KA 3DEDA 3ETRB 4OALA 2VFTA 3DQ0A 4PYTA 1T3QC 3R07C 3HRDC 2R8DA 5AE1A 3FWAA 1UXYA 4BC7A 5FXEA 2PLIA 1HSKA 1W1OA 3NRZB 1AHVA 2VAOA 1N61C 3AMZA 5HMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ADZ A;  1DIQ A;  1FIQ B;  3GSY A;  3S1E A;  1W1J A;  3W8X A;  5G5G B;  4ZOH B;  4JB1 A;  2YVS A;  4ML8 A;  1SB3 B;  2Q85 A;  1E8G A;  4JAY A;  4PVJ A;  1N62 C;  2QKN A;  1N60 C;  3FW9 A;  1W1K A;  3BW7 A;  2E5A A;  3PM9 A;  2AXR A;  2P13 A;  2GQT A;  1W1L A;  2VFV A;  2E3T A;  3NVZ B;  3S1F A;  1N5X A;  4BCA A;  1JRO A;  1E0Y A;  2VFS A;  1VDV A;  1I19 A;  4TVY A;  1W1R A;  1E8H A;  3FW8 A;  3A7U A;  4BBY A;  3C0P A;  3TX1 A;  3EUB 3;  1FFV C;  3S1C A;  1RM6 B;  4PVE A;  3NVV B;  4PVH A;  4EC3 A;  2BVF A;  2QPM A;  3I99 A;  3D2H A;  3AN1 A;  1X2H A;  2MBR A;  1V97 A;  5FXF A;  5AE3 A;  3LAE A;  4PZF A;  2PLS A;  1FFU C;  2W55 A;  1QLU A;  3AM9 A;  1X2G A;  2RK5 A;  2P4P A;  5D79 A;  3A7A A;  3W8Z A;  1WVE A;  1E8F A;  4MLA A;  4HG0 A;  1DZN A;  3JS8 A;  1MBT A;  4PVK A;  3TSH A;  3NVY B;  2R2Z A;  3LLB A;  1DII A;  2BVH A;  4UD8 A;  2NQW A;  1ZXI C;  1VAO A;  1MBB A;  3NS1 B;  5AE2 A;  3NVW B;  4DNS A;  3VTE A;  5HHZ A;  3B9J B;  1JRP A;  1FO4 A;  1WVF A;  3D2J A;  2O3G A;  2OAI A;  1W1S A;  1VQZ A;  5FXD A;  1WYG A;  1QLT A;  4BC9 A;  5G5H B;  3KJM A;  3D2D A;  1W1M A;  2W3S A;  3FW7 A;  2VFR A;  3SR6 B;  1F0X A;  2VFU A;  1AHZ A;  4PWB A;  1ZR6 A;  2W3R A;  3A7R A;  1W1Q A;  2BVG A;  2W54 A;  3W8W A;  5HQX A;  4PWC A;  2Q4W A;  2GQU A;  3TSJ A;  5FXP A;  1AHU A;  1N63 C;  4O95 A;  4XLO A;  3S1D A;  4TVW A;  2EXR A;  2P3H A;  1N5W C;  2I0K A;  3DED A;  3ETR B;  4OAL A;  2VFT A;  3DQ0 A;  4PYT A;  1T3Q C;  3R07 C;  3HRD C;  2R8D A;  5AE1 A;  3FWA A;  1UXY A;  4BC7 A;  5FXE A;  2PLI A;  1HSK A;  1W1O A;  3NRZ B;  1AHV A;  2VAO A;  1N61 C;  3AMZ A;  5HMR A; 
#chains in the Genus database with same CATH topology
 1DIQ A;  5JCI A;  4Z17 A;  1W1J A;  2OO6 A;  2QQ6 A;  3DEQ A;  3T9P A;  3UGV A;  3GO2 A;  3RO6 A;  3DJG X;  3RIT A;  3GRT A;  5FJO A;  3DGZ A;  3OPS A;  3FW9 A;  1MDR A;  3FV9 A;  1SJD A;  3BW7 A;  2E5A A;  2QGY A;  3PM9 A;  2GQW A;  3CXB A;  1BKH A;  1JDF A;  3N6J A;  1GER A;  4H4Z A;  3PWI A;  2E3T A;  3S1F A;  3V5C A;  1EBG A;  4A6G A;  3MSY A;  3EJE B;  5FJR A;  1NHP A;  3FW8 A;  1R0M A;  2RDX A;  1ZKQ A;  1FHU A;  4DWD A;  1RM6 B;  2DW6 A;  1P48 A;  3BSM A;  3II4 A;  4PVH A;  3L8K A;  4MKS A;  5EBK A;  3TTE A;  3FYY A;  2WP5 A;  1JPD X;  3JW7 A;  4NEV A;  1P43 A;  3UJF A;  1K4Q A;  3UCD A;  4IL2 A;  3GD4 A;  1X2G A;  2P4P A;  5D79 A;  1NHQ A;  3W8Z A;  2OZ8 A;  3U9I A;  2CDU A;  2GGH A;  1WVE A;  3URH A;  1DZN A;  1ELS A;  3D9X A;  3JS8 A;  1SJC A;  1PDZ A;  2FYM A;  4BUR A;  4MMW A;  2PMQ A;  1NEL A;  1LVL A;  2QDE A;  3EAN A;  3CT2 A;  4FDC B;  3H12 A;  3GY1 A;  2AL2 A;  3LLB A;  4K7Z A;  1ECQ A;  2BVH A;  1EC9 A;  3PWG A;  3QFA A;  2A8X A;  3RR1 A;  3TOY A;  4GRT A;  1MBB A;  5FS6 A;  3SQS A;  2V3A A;  2PSN A;  4IL0 A;  3VTE A;  5HHZ A;  5FS8 A;  1EBH A;  2WPC A;  2PTX A;  3D2J A;  1EC7 A;  3CGC A;  2YAU A;  4HPN A;  3IJL A;  4LII A;  3HSU A;  3RCY A;  2OLA A;  3D2D A;  4H4P A;  1W1M A;  4H4Y A;  2W3S A;  2GR2 A;  2PA6 A;  3EAO A;  1F0X A;  2BC0 A;  2XH0 A;  4PWB A;  4KPR A;  2MUC A;  1W1Q A;  5HQX A;  5TR3 A;  4H4R A;  2AL2 B;  3DJJ A;  2Q4W A;  3TSJ A;  2W0H A;  3BJS A;  4O95 A;  2HQM A;  1IYX A;  3DED A;  1XHC A;  2O56 A;  4GGH A;  1H6V A;  4OAL A;  3SN1 A;  1BWC A;  3NZG A;  4GGB A;  2YQU A;  1T3Q C;  3R07 C;  2PPG A;  3HRD C;  1TKK A;  4G8T A;  2X8C A;  2P8B A;  3OZM A;  1GRE A;  4BC7 A;  1ZY8 A;  2ZC8 A;  1JOA A;  1W1O A;  3JVA A;  2NVK X;  2VAO A;  1N61 C;  4IP4 A;  3DK9 A;  4JDR A;  2ONE A;  4EMW A;  3HPF A;  1FIQ B;  3S1E A;  1XAN A;  4HCL A;  3CYJ A;  1ZX9 A;  1JEH A;  4ZOH B;  1GXF A;  4JB1 A;  1XPY A;  4KPL A;  2GSH A;  4M52 A;  4JAY A;  4IHC A;  1N62 C;  2QKN A;  2PGW A;  4H4T A;  4Z1Y A;  2Y3R A;  3FXG A;  3EEZ A;  2Y08 A;  2PP0 A;  2Y3S A;  1GRT A;  2CHR A;  1W1K A;  2V6O A;  3CK5 A;  3DK8 A;  3GD3 A;  5AWV A;  1TE6 A;  2GRT A;  3RNM A;  2P13 A;  2GQT A;  1GV4 A;  4J3Z A;  3NVZ B;  3MZN A;  2IPI A;  1RVK A;  3MQT A;  4BCA A;  4ZA0 A;  3PK7 A;  3DGB A;  1E0Y A;  1VDV A;  4TVY A;  5L6F A;  3CAW A;  1W1R A;  1E8H A;  3A7U A;  4DYE A;  2GL5 A;  4HCD A;  5JCK A;  3NVV B;  1FFV C;  1XDI A;  2XH7 A;  3DFH A;  2YVJ A;  3V4B A;  3MWC A;  3I99 A;  3DFY A;  3VA8 A;  1GRA A;  2GR0 A;  3R10 A;  1TZZ A;  1XS2 A;  1X2H A;  2WPF A;  2YVG A;  2MBR A;  3QLD A;  3TW9 A;  1V97 A;  2BC1 A;  3ZVH A;  4PZF A;  4A35 A;  2EQ7 A;  1FFU C;  2DW7 A;  4FX9 A;  3PG6 A;  1ZDL A;  3IJI A;  3SN0 A;  2PP3 A;  1M6I A;  3H4K A;  3PQB A;  4DHG A;  6ENL A;  1E8F A;  3RGT A;  4GME A;  2P8C A;  1WUE A;  1E9I A;  4DN1 A;  2PCE A;  2GH5 A;  2GGI A;  2OZ3 A;  3IJQ A;  2NQW A;  1ZXI C;  4HNC A;  1KN0 A;  2CFY A;  2HXU A;  4ADW A;  3EF6 A;  3LAD A;  5I1W A;  3H7V A;  1R6W A;  4DNS A;  3VCC A;  2MNR A;  3CGB A;  1WVF A;  3FCP A;  1BQG A;  1Q1R A;  2Y4G A;  3SBF A;  2OAI A;  1W1S A;  3ZVH B;  4EMJ A;  5FXD A;  5K8E A;  1F9C A;  1ZMC A;  2PS2 A;  3N4F A;  4GIS A;  2UUV A;  4HYR A;  3R25 A;  3FW7 A;  5KVI A;  2UUU A;  3SR6 B;  4K8G A;  2YVF A;  3RJ8 A;  1TYT A;  4ROP A;  3OTR A;  2AAQ A;  3NO1 A;  3SJN A;  4E4F A;  5FS9 A;  1F8W A;  2RAB A;  3CGD A;  2ZAD A;  4H4X A;  4YWS A;  2XSX A;  4PWC A;  2WPE A;  2PTW A;  1SJA A;  1GSN A;  5JRB A;  4LA1 A;  1AOG A;  5FXP A;  4TVW A;  1YQZ A;  3OW1 A;  1MUC A;  3R0K A;  3KLJ A;  3DQ0 A;  4PYT A;  1BZL A;  1DTN A;  2J3N A;  3NXL A;  1FHV A;  2QAE A;  3EJB B;  3MKC A;  2PLI A;  2EQ6 A;  3FJ4 A;  1GEU A;  3N6H A;  2C3C A;  4E4U A;  3AMZ A;  2GGE A;  2P3Z A;  3GRS A;  1MDL A;  3H70 A;  3W8X A;  2ZZC A;  1KKO A;  5G5G B;  2ZZB A;  2I5Q A;  4MGG A;  2OQH A;  4ML8 A;  2Q85 A;  2X50 A;  2PTZ A;  3VDG A;  3ZLH A;  5L6G A;  1Q1W A;  4HCH A;  2OZT A;  1N60 C;  2QDD A;  3KUM A;  3THU A;  4H4Q A;  3R1Z A;  2JK6 A;  3QPE A;  3DG7 A;  2WDW A;  1KD0 A;  1PDY A;  3SSZ A;  2VFV A;  2WOV A;  3Q4D A;  2C3D A;  4GYP A;  3UJS A;  3UJR A;  4DXK A;  1JRO A;  1NHS A;  1MNS A;  2OQY A;  3N4E A;  3ENL A;  4JHM A;  4H4S A;  2QJN A;  4K8D A;  3TWA A;  3TX1 A;  3EUB 3;  3S1C A;  5J04 A;  4PVE A;  5JCN A;  5U1O A;  4EC3 A;  2QPM A;  3EKG A;  3D2H A;  3AN1 A;  5FS7 A;  3IK4 A;  2TPR A;  2PGE A;  5FMH A;  2R9Z A;  5FXF A;  5AE3 A;  2GR1 A;  2QVH A;  4K2S A;  5IDZ A;  2W55 A;  1QLU A;  2RK5 A;  2ZZ0 A;  1LPF A;  2AKZ A;  4EQW A;  3DDM A;  3RRA A;  3L5O A;  5KVH A;  3DIP A;  3TWB A;  2WOI A;  4IP5 A;  4MLA A;  1SJB A;  3V5F A;  3P0W A;  4KT2 A;  4EQR A;  2EQ9 A;  3TJI A;  5JCM A;  3SN4 A;  1MBT A;  4FI4 A;  4PVK A;  3O0H A;  2GGG A;  3DG6 A;  2OFJ A;  2WP6 A;  1MO9 A;  3TCS A;  5U25 A;  4M0X A;  3VFC A;  1TYP A;  5EU9 A;  3S47 A;  3T8Q A;  1OJT A;  3JZU A;  4J57 A;  4H2H A;  3NVW B;  5AE2 A;  1MRA A;  3MY9 A;  4F4R A;  2XH2 A;  5I1V A;  3VCN A;  5BOF A;  2X8G A;  2O3G A;  1VQZ A;  1GRG A;  1FEA A;  3VC6 A;  3QFB A;  3RJA A;  1QLT A;  4BC9 A;  1NHR A;  1NU5 A;  4K1W A;  3UJE A;  5FJU A;  4E6M A;  2GDQ A;  1ZMD A;  3I6E A;  2POD A;  2W3R A;  4ENL A;  2POZ A;  4HN8 A;  2PTY A;  4FP1 A;  2W54 A;  2PP1 A;  1V59 A;  3ES8 A;  5ENL A;  2PU1 A;  1H2I A;  2GQU A;  1WUF A;  1N63 C;  4XLO A;  3S1D A;  3LXD A;  3DH9 A;  3DES A;  3OP2 A;  1N5W C;  4JN7 A;  3HW2 A;  3GD6 A;  5FJT A;  2HNE A;  2X99 A;  1GRB A;  1JCT A;  2R8D A;  2HZG A;  3D47 A;  3FVD A;  1UXY A;  3PFR A;  5FXE A;  2F5Z A;  2GR3 A;  1NPX A;  3DER A;  4E8G A;  1ONF A;  1HSK A;  5GRT A;  1AHV A;  2OVL A;  4GFI A;  1SB3 B;  5ADZ A;  3B97 A;  3GSY A;  1W6T A;  3CB3 A;  4DX3 A;  4H50 A;  3S5S A;  3QN3 A;  4E5T A;  2QJM A;  1EC8 A;  3P93 A;  7ENL A;  3DG3 A;  2YVS A;  5FJP A;  3UCC A;  1FEC A;  1E8G A;  4PVJ A;  4DNA A;  3H8A A;  3QKE A;  3POP A;  2GGJ A;  3T6C A;  4APN A;  3UJ2 A;  4A3R A;  3I4K A;  3U4F A;  4GYP C;  2QJJ A;  2AXR A;  3EJD B;  1GRH A;  1W1L A;  2OG9 A;  3STP A;  1STZ A;  4H1Z A;  1N5X A;  2P88 A;  4BV6 A;  2VFS A;  1I19 A;  4ZCW A;  1YEY A;  4BBY A;  3C0P A;  2WOW A;  3R0U A;  3QTP A;  2OPJ A;  3P3B A;  1KKR A;  3MUC A;  4H4V A;  4EM4 A;  2BVF A;  4IZG A;  4KWS A;  4JQ9 A;  2NPX A;  2OX4 A;  3TJ4 A;  1ZK7 A;  4G7F A;  4IT1 A;  3LAE A;  4JN8 A;  2PLS A;  3Q45 A;  3AM9 A;  3ZLF A;  4H4U A;  1DXL A;  3A7A A;  4YWO A;  1F3P A;  2EQ8 A;  3D46 A;  4M6U A;  3V3W A;  3BOX A;  5BOE A;  4HG0 A;  1OEP A;  3CXO A;  1ONE A;  4EM3 A;  3UXL A;  3ZVI A;  3TSH A;  3NVY B;  4H19 A;  2R2Z A;  3Q6J A;  4EMI A;  4J56 A;  2X8H A;  3ES7 A;  1DII A;  4UD8 A;  2BCP A;  3NFU A;  2V3B A;  3UXK A;  1VAO A;  3IC9 A;  1NDA A;  1S7M A;  4EQX A;  3NS1 B;  2P0I A;  4HNL A;  3DK4 A;  1JRP A;  3B9J B;  4X2P A;  1FO4 A;  4J1O A;  4H4W A;  4KEM A;  2HXT A;  5ER0 A;  3OZY A;  1MOK A;  2FKP A;  3CGE A;  4H83 A;  1WYG A;  1D7Y A;  3GC2 A;  1KCZ A;  1FEB A;  5G5H B;  3KJM A;  3VC5 A;  5JCL A;  2VFR A;  2VFU A;  1AHZ A;  1ZR6 A;  1DNC A;  3A7R A;  4EQS A;  3SQP A;  3R11 A;  1L8P A;  2BVG A;  3I6T A;  3W8W A;  4GR1 A;  3FG2 P;  3TQP A;  3OC4 A;  3LB8 A;  1GRF A;  3ZLG A;  3K1G A;  1JPM A;  1AHU A;  2XGZ A;  2EXR A;  2P3H A;  1GES A;  2AKM A;  2I0K A;  4EWJ A;  1GET A;  3ETR B;  1EBD A;  2VFT A;  2PU0 A;  2NQL A;  3T4W A;  2OKT A;  5AE1 A;  3FWA A;  4GIR A;  2XH4 A;  2AL1 A;  2WBA A;  3NRZ B;  3DGH A;  4NEW A;  5HMR A; 
#chains in the Genus database with same CATH homology
 5ADZ A;  1DIQ A;  1FIQ B;  3GSY A;  3S1E A;  1W1J A;  3W8X A;  5G5G B;  4ZOH B;  4JB1 A;  2YVS A;  4ML8 A;  1SB3 B;  2Q85 A;  1E8G A;  4JAY A;  4PVJ A;  1N62 C;  2QKN A;  2Y3R A;  5L6G A;  3POP A;  1N60 C;  2Y08 A;  2Y3S A;  3FW9 A;  1W1K A;  3BW7 A;  2E5A A;  3PM9 A;  2AXR A;  5AWV A;  2P13 A;  2GQT A;  2WDW A;  1W1L A;  2VFV A;  2E3T A;  3NVZ B;  3S1F A;  2IPI A;  1N5X A;  4BCA A;  1JRO A;  1E0Y A;  2VFS A;  1VDV A;  1I19 A;  4TVY A;  5L6F A;  1W1R A;  1E8H A;  3FW8 A;  3A7U A;  4BBY A;  3C0P A;  3TX1 A;  3EUB 3;  1FFV C;  3S1C A;  1RM6 B;  4PVE A;  3NVV B;  4PVH A;  4EC3 A;  2BVF A;  2QPM A;  3I99 A;  3D2H A;  3AN1 A;  1X2H A;  2MBR A;  1V97 A;  5FXF A;  5AE3 A;  3LAE A;  4PZF A;  2PLS A;  1FFU C;  2W55 A;  1QLU A;  3AM9 A;  1X2G A;  2RK5 A;  2P4P A;  5D79 A;  3A7A A;  3W8Z A;  3PQB A;  1WVE A;  1E8F A;  4MLA A;  4HG0 A;  1DZN A;  3JS8 A;  1MBT A;  4PVK A;  3TSH A;  3NVY B;  2R2Z A;  3LLB A;  1DII A;  2BVH A;  4UD8 A;  2NQW A;  1ZXI C;  1VAO A;  1MBB A;  5I1W A;  3NS1 B;  5AE2 A;  3NVW B;  4DNS A;  3VTE A;  5HHZ A;  3B9J B;  1JRP A;  5I1V A;  1FO4 A;  1WVF A;  2Y4G A;  3D2J A;  2O3G A;  2OAI A;  1W1S A;  1VQZ A;  5FXD A;  1WYG A;  3HSU A;  5K8E A;  3RJA A;  1QLT A;  4BC9 A;  5G5H B;  3KJM A;  3D2D A;  1W1M A;  2UUV A;  2W3S A;  3FW7 A;  2VFR A;  3SR6 B;  2UUU A;  1F0X A;  2VFU A;  1AHZ A;  3RJ8 A;  4PWB A;  1ZR6 A;  2W3R A;  3A7R A;  1W1Q A;  2BVG A;  2W54 A;  3W8W A;  5HQX A;  4PWC A;  2Q4W A;  2GQU A;  3TSJ A;  5FXP A;  1AHU A;  1N63 C;  4O95 A;  4XLO A;  3S1D A;  4TVW A;  2EXR A;  2P3H A;  1N5W C;  2I0K A;  3DED A;  3ETR B;  4OAL A;  2VFT A;  3DQ0 A;  4PYT A;  1T3Q C;  3R07 C;  3HRD C;  2R8D A;  5AE1 A;  3FWA A;  1UXY A;  4BC7 A;  5FXE A;  2PLI A;  1HSK A;  1W1O A;  3NRZ B;  1AHV A;  2VAO A;  1N61 C;  3AMZ A;  5HMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...