4PVEA

Wild-type phl p 4.0202, a glucose dehydrogenase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 162
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pveA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pveA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pveA03
4O95A 1ZXIC 2QKNA 5HQXA 3EUB3 3W8XA 3JS8A 3AM9A 1FFVC 3GSYA 4EC3A 1AHUA 5FXFA 3TX1A 4DNSA 5D79A 2MBRA 3KJMA 1WVFA 1W1JA 1ZR6A 1N61C 3FW9A 2I0KA 1W1LA 2QPMA 1T3QC 5AE1A 5K8EA 1QLUA 1WYGA 4JB1A 3HSUA 1V97A 5AE2A 4PWCA 1DIIA 1UXYA 2Y4GA 1QLTA 2VAOA 4BBYA 2Y08A 2Y3SA 2BVFA 1DIQA 3ETRB 2W54A 3FWAA 4MLAA 4ZOHB 1HSKA 3S1DA 3FW8A 2IPIA 3AMZA 3I99A 2VFSA 4PYTA 2GQUA 5AE3A 5HMRA 2Q85A 2WDWA 3VTEA 3AN1A 3S1CA 4PVHA 1W1QA 2W3RA 2EXRA 1WVEA 3RJAA 5FXEA 1N5WC 4JAYA 3NVZB 3W8ZA 3NS1B 1W1OA 1E8HA 3D2HA 2VFUA 3BW7A 1E8FA 3S1FA 4PVEA 5ADZA 5I1VA 2GQTA 3B9JB 5HHZA 1JROA 1FFUC 3C0PA 4PVJA 3D2DA 1VDVA 1W1SA 3S1EA 3DQ0A 1VAOA 1F0XA 2Q4WA 1N62C 4ML8A 2W3SA 1MBBA 3FW7A 5AWVA 2BVHA 1N63C 4BC7A 5L6GA 2AXRA 5FXPA 1E8GA 1N60C 1W1RA 2VFVA 4BCAA 4PZFA 3PQBA 1AHZA 4OALA 5L6FA 1E0YA 3W8WA 3D2JA 1MBTA 5FXDA 2W55A 4PWBA 4XLOA 1DZNA 1I19A 2Y3RA 2VFRA 3POPA 3TSJA 2VFTA 3TSHA 2BVGA 1W1MA 1FIQB 4UD8A 1FO4A 3NRZB 1N5XA 4BC9A 3SR6B 4PVKA 1W1KA 5I1WA 2E3TA 1AHVA 3RJ8A 3PM9A
chains in the Genus database with same CATH superfamily
2R8DA 2P3HA 4O95A 2PLIA 1ZXIC 5G5HB 2QKNA 3NVVB 5HQXA 1RM6B 3EUB3 3W8XA 3JS8A 3HRDC 2PLSA 3AM9A 1FFVC 3GSYA 4EC3A 1AHUA 5FXFA 3TX1A 4DNSA 3EJBB 5D79A 2MBRA 1JRPA 3KJMA 3LLBA 1WVFA 1W1JA 1ZR6A 1N61C 3FW9A 2I0KA 1W1LA 2QPMA 1T3QC 5AE1A 5K8EA 1QLUA 1WYGA 4JB1A 3HSUA 1V97A 5AE2A 4PWCA 1DIIA 1UXYA 2Y4GA 1QLTA 2VAOA 4BBYA 2Y08A 2Y3SA 2BVFA 1DIQA 4HG0A 2RK5A 3ETRB 3EJDB 1SB3B 2W54A 3FWAA 4MLAA 4ZOHB 1HSKA 3S1DA 3FW8A 2IPIA 3AMZA 3I99A 2VFSA 4PYTA 2UUVA 2GQUA 5AE3A 5HMRA 2Q85A 2WDWA 3NVYB 3VTEA 3AN1A 3S1CA 4PVHA 1W1QA 2W3RA 2EXRA 1WVEA 3RJAA 5FXEA 1N5WC 3EJEB 4JAYA 3NVZB 3W8ZA 3NS1B 1W1OA 2P13A 1E8HA 3NVWB 3D2HA 2VFUA 3BW7A 1E8FA 3S1FA 4PVEA 5ADZA 5I1VA 2GQTA 3B9JB 5HHZA 1JROA 1FFUC 3C0PA 4PVJA 3D2DA 1VDVA 1W1SA 2O3GA 3S1EA 3DQ0A 1VAOA 1F0XA 2Q4WA 1N62C 4ML8A 2W3SA 1MBBA 3FW7A 5AWVA 2BVHA 1N63C 4BC7A 2NQWA 5L6GA 2AXRA 5FXPA 1E8GA 1N60C 1W1RA 2VFVA 4BCAA 4PZFA 2R2ZA 3PQBA 1AHZA 4OALA 5L6FA 1E0YA 2UUUA 3W8WA 3D2JA 1MBTA 5FXDA 2W55A 4PWBA 4XLOA 1DZNA 1I19A 2Y3RA 2VFRA 3POPA 3TSJA 2YVSA 2VFTA 2OAIA 2P4PA 3LAEA 3TSHA 2BVGA 1W1MA 1FIQB 4UD8A 1FO4A 3NRZB 1N5XA 4BC9A 3SR6B 4PVKA 1W1KA 3DEDA 5G5GB 5I1WA 2E3TA 1AHVA 3RJ8A 3PM9A
chains in the Genus database with same CATH topology
2R8DA 2P3HA 4O95A 2PLIA 1ZXIC 5G5HB 2QKNA 5HQXA 1RM6B 3NVVB 3EUB3 3W8XA 3JS8A 3HRDC 2PLSA 3AM9A 1FFVC 3GSYA 4EC3A 1AHUA 5FXFA 3TX1A 4DNSA 5D79A 2MBRA 1JRPA 3KJMA 3LLBA 1WVFA 1W1JA 1ZR6A 1N61C 3FW9A 2I0KA 1W1LA 2QPMA 1T3QC 5AE1A 5K8EA 1QLUA 1WYGA 4JB1A 3HSUA 1V97A 5AE2A 4PWCA 1DIIA 1UXYA 2Y4GA 1QLTA 2VAOA 4BBYA 2Y08A 2Y3SA 2BVFA 1DIQA 4HG0A 2RK5A 3ETRB 1SB3B 2W54A 3FWAA 4MLAA 4ZOHB 1HSKA 3S1DA 3FW8A 2IPIA 3AMZA 3I99A 2VFSA 4PYTA 2UUVA 2GQUA 5AE3A 5HMRA 2Q85A 2WDWA 3NVYB 3VTEA 3AN1A 3S1CA 4PVHA 1W1QA 2W3RA 2EXRA 1WVEA 3RJAA 5FXEA 1N5WC 4JAYA 3NVZB 3W8ZA 3NS1B 1W1OA 2P13A 1E8HA 3NVWB 3D2HA 2VFUA 3BW7A 1E8FA 3S1FA 4PVEA 5ADZA 5I1VA 2GQTA 3B9JB 5HHZA 1JROA 1FFUC 3C0PA 4PVJA 3D2DA 1VDVA 1W1SA 2O3GA 3S1EA 3DQ0A 1VAOA 1F0XA 2Q4WA 1N62C 4ML8A 2W3SA 1MBBA 3FW7A 5AWVA 2BVHA 1N63C 4BC7A 2NQWA 5L6GA 2AXRA 5FXPA 1E8GA 1N60C 1W1RA 2VFVA 4BCAA 4PZFA 2R2ZA 3PQBA 1AHZA 4OALA 5L6FA 1E0YA 2UUUA 3W8WA 3D2JA 1MBTA 5FXDA 2W55A 4PWBA 4XLOA 1DZNA 1I19A 2Y3RA 2VFRA 3POPA 3TSJA 2YVSA 2VFTA 2OAIA 2P4PA 3LAEA 3TSHA 2BVGA 1W1MA 1FIQB 4UD8A 1FO4A 3NRZB 1N5XA 4BC9A 3SR6B 4PVKA 1W1KA 3DEDA 5G5GB 5I1WA 2E3TA 1AHVA 3RJ8A 3PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O95 A;  1ZXI C;  2QKN A;  5HQX A;  3EUB 3;  3W8X A;  3JS8 A;  3AM9 A;  1FFV C;  3GSY A;  4EC3 A;  1AHU A;  5FXF A;  3TX1 A;  4DNS A;  5D79 A;  2MBR A;  3KJM A;  1WVF A;  1W1J A;  1ZR6 A;  1N61 C;  3FW9 A;  2I0K A;  1W1L A;  2QPM A;  1T3Q C;  5AE1 A;  5K8E A;  1QLU A;  1WYG A;  4JB1 A;  3HSU A;  1V97 A;  5AE2 A;  4PWC A;  1DII A;  1UXY A;  2Y4G A;  1QLT A;  2VAO A;  4BBY A;  2Y08 A;  2Y3S A;  2BVF A;  1DIQ A;  3ETR B;  2W54 A;  3FWA A;  4MLA A;  4ZOH B;  1HSK A;  3S1D A;  3FW8 A;  2IPI A;  3AMZ A;  3I99 A;  2VFS A;  4PYT A;  2GQU A;  5AE3 A;  5HMR A;  2Q85 A;  2WDW A;  3VTE A;  3AN1 A;  3S1C A;  4PVH A;  1W1Q A;  2W3R A;  2EXR A;  1WVE A;  3RJA A;  5FXE A;  1N5W C;  4JAY A;  3NVZ B;  3W8Z A;  3NS1 B;  1W1O A;  1E8H A;  3D2H A;  2VFU A;  3BW7 A;  1E8F A;  3S1F A;  4PVE A;  5ADZ A;  5I1V A;  2GQT A;  3B9J B;  5HHZ A;  1JRO A;  1FFU C;  3C0P A;  4PVJ A;  3D2D A;  1VDV A;  1W1S A;  3S1E A;  3DQ0 A;  1VAO A;  1F0X A;  2Q4W A;  1N62 C;  4ML8 A;  2W3S A;  1MBB A;  3FW7 A;  5AWV A;  2BVH A;  1N63 C;  4BC7 A;  5L6G A;  2AXR A;  5FXP A;  1E8G A;  1N60 C;  1W1R A;  2VFV A;  4BCA A;  4PZF A;  3PQB A;  1AHZ A;  4OAL A;  5L6F A;  1E0Y A;  3W8W A;  3D2J A;  1MBT A;  5FXD A;  2W55 A;  4PWB A;  4XLO A;  1DZN A;  1I19 A;  2Y3R A;  2VFR A;  3POP A;  3TSJ A;  2VFT A;  3TSH A;  2BVG A;  1W1M A;  1FIQ B;  4UD8 A;  1FO4 A;  3NRZ B;  1N5X A;  4BC9 A;  3SR6 B;  4PVK A;  1W1K A;  5I1W A;  2E3T A;  1AHV A;  3RJ8 A;  3PM9 A; 
#chains in the Genus database with same CATH topology
 2R8D A;  2P3H A;  4O95 A;  2PLI A;  1ZXI C;  5G5H B;  2QKN A;  3NVV B;  5HQX A;  1RM6 B;  3EUB 3;  3W8X A;  3JS8 A;  3HRD C;  2PLS A;  3AM9 A;  1FFV C;  3GSY A;  4EC3 A;  1AHU A;  5FXF A;  3TX1 A;  4DNS A;  3EJB B;  5D79 A;  2MBR A;  1JRP A;  3KJM A;  3LLB A;  1WVF A;  1W1J A;  1ZR6 A;  1N61 C;  3FW9 A;  2I0K A;  1W1L A;  2QPM A;  1T3Q C;  5AE1 A;  5K8E A;  1QLU A;  1WYG A;  4JB1 A;  3HSU A;  1V97 A;  5AE2 A;  4PWC A;  1DII A;  1UXY A;  2Y4G A;  1QLT A;  2VAO A;  4BBY A;  2Y08 A;  2Y3S A;  2BVF A;  1DIQ A;  4HG0 A;  2RK5 A;  3ETR B;  3EJD B;  1SB3 B;  2W54 A;  3FWA A;  4MLA A;  4ZOH B;  1HSK A;  3S1D A;  3FW8 A;  2IPI A;  3AMZ A;  3I99 A;  2VFS A;  4PYT A;  2UUV A;  2GQU A;  5AE3 A;  5HMR A;  2Q85 A;  2WDW A;  3NVY B;  3VTE A;  3AN1 A;  3S1C A;  4PVH A;  1W1Q A;  2W3R A;  2EXR A;  1WVE A;  3RJA A;  5FXE A;  1N5W C;  3EJE B;  4JAY A;  3NVZ B;  3W8Z A;  3NS1 B;  1W1O A;  2P13 A;  1E8H A;  3NVW B;  3D2H A;  2VFU A;  3BW7 A;  1E8F A;  3S1F A;  4PVE A;  5ADZ A;  5I1V A;  2GQT A;  3B9J B;  5HHZ A;  1JRO A;  1FFU C;  3C0P A;  4PVJ A;  3D2D A;  1VDV A;  1W1S A;  2O3G A;  3S1E A;  3DQ0 A;  1VAO A;  1F0X A;  2Q4W A;  1N62 C;  4ML8 A;  2W3S A;  1MBB A;  3FW7 A;  5AWV A;  2BVH A;  1N63 C;  4BC7 A;  2NQW A;  5L6G A;  2AXR A;  5FXP A;  1E8G A;  1N60 C;  1W1R A;  2VFV A;  4BCA A;  4PZF A;  2R2Z A;  3PQB A;  1AHZ A;  4OAL A;  5L6F A;  1E0Y A;  2UUU A;  3W8W A;  3D2J A;  1MBT A;  5FXD A;  2W55 A;  4PWB A;  4XLO A;  1DZN A;  1I19 A;  2Y3R A;  2VFR A;  3POP A;  3TSJ A;  2YVS A;  2VFT A;  2OAI A;  2P4P A;  3LAE A;  3TSH A;  2BVG A;  1W1M A;  1FIQ B;  4UD8 A;  1FO4 A;  3NRZ B;  1N5X A;  4BC9 A;  3SR6 B;  4PVK A;  1W1K A;  3DED A;  5G5G B;  5I1W A;  2E3T A;  1AHV A;  3RJ8 A;  3PM9 A; 
#chains in the Genus database with same CATH homology
 2R8D A;  2P3H A;  4O95 A;  2PLI A;  1ZXI C;  5G5H B;  2QKN A;  5HQX A;  1RM6 B;  3NVV B;  3EUB 3;  3W8X A;  3JS8 A;  3HRD C;  2PLS A;  3AM9 A;  1FFV C;  3GSY A;  4EC3 A;  1AHU A;  5FXF A;  3TX1 A;  4DNS A;  5D79 A;  2MBR A;  1JRP A;  3KJM A;  3LLB A;  1WVF A;  1W1J A;  1ZR6 A;  1N61 C;  3FW9 A;  2I0K A;  1W1L A;  2QPM A;  1T3Q C;  5AE1 A;  5K8E A;  1QLU A;  1WYG A;  4JB1 A;  3HSU A;  1V97 A;  5AE2 A;  4PWC A;  1DII A;  1UXY A;  2Y4G A;  1QLT A;  2VAO A;  4BBY A;  2Y08 A;  2Y3S A;  2BVF A;  1DIQ A;  4HG0 A;  2RK5 A;  3ETR B;  1SB3 B;  2W54 A;  3FWA A;  4MLA A;  4ZOH B;  1HSK A;  3S1D A;  3FW8 A;  2IPI A;  3AMZ A;  3I99 A;  2VFS A;  4PYT A;  2UUV A;  2GQU A;  5AE3 A;  5HMR A;  2Q85 A;  2WDW A;  3NVY B;  3VTE A;  3AN1 A;  3S1C A;  4PVH A;  1W1Q A;  2W3R A;  2EXR A;  1WVE A;  3RJA A;  5FXE A;  1N5W C;  4JAY A;  3NVZ B;  3W8Z A;  3NS1 B;  1W1O A;  2P13 A;  1E8H A;  3NVW B;  3D2H A;  2VFU A;  3BW7 A;  1E8F A;  3S1F A;  4PVE A;  5ADZ A;  5I1V A;  2GQT A;  3B9J B;  5HHZ A;  1JRO A;  1FFU C;  3C0P A;  4PVJ A;  3D2D A;  1VDV A;  1W1S A;  2O3G A;  3S1E A;  3DQ0 A;  1VAO A;  1F0X A;  2Q4W A;  1N62 C;  4ML8 A;  2W3S A;  1MBB A;  3FW7 A;  5AWV A;  2BVH A;  1N63 C;  4BC7 A;  2NQW A;  5L6G A;  2AXR A;  5FXP A;  1E8G A;  1N60 C;  1W1R A;  2VFV A;  4BCA A;  4PZF A;  2R2Z A;  3PQB A;  1AHZ A;  4OAL A;  5L6F A;  1E0Y A;  2UUU A;  3W8W A;  3D2J A;  1MBT A;  5FXD A;  2W55 A;  4PWB A;  4XLO A;  1DZN A;  1I19 A;  2Y3R A;  2VFR A;  3POP A;  3TSJ A;  2YVS A;  2VFT A;  2OAI A;  2P4P A;  3LAE A;  3TSH A;  2BVG A;  1W1M A;  1FIQ B;  4UD8 A;  1FO4 A;  3NRZ B;  1N5X A;  4BC9 A;  3SR6 B;  4PVK A;  1W1K A;  3DED A;  5G5G B;  5I1W A;  2E3T A;  1AHV A;  3RJ8 A;  3PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...