4PVEA

Wild-type phl p 4.0202, a glucose dehydrogenase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
490
structure length
490
Chain Sequence
b'EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Oxidoreductase
total genus 162
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pveA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pveA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pveA03
1AHZA 1W1JA 1F0XA 1UXYA 1AHUA 2AXRA 5D79A 3TSJA 4UD8A 3FW8A 3W8ZA 5HQXA 3PQBA 5ADZA 4ZOHB 2Y3RA 1V97A 4PVHA 2EXRA 1MBBA 3POPA 5FXPA 1ZR6A 2BVFA 3S1EA 2WDWA 1DIQA 2MBRA 4PWCA 3TX1A 1N63C 3PM9A 1JROA 4BC7A 4PYTA 3EUB3 3I99A 2W55A 3S1FA 1QLUA 3FWAA 1W1LA 1I19A 1W1RA 5L6FA 2Q85A 1E0YA 4MLAA 4PVJA 5FXFA 3B9JB 1T3QC 4PWBA 1W1QA 3W8XA 1ZXIC 2BVHA 4BCAA 2VFTA 4PVEA 1W1OA 2QPMA 1WVEA 2BVGA 3DQ0A 4JB1A 1DIIA 4XLOA 1DZNA 3RJAA 3VTEA 2Y3SA 4EC3A 1HSKA 1FFUC 2VFRA 1FFVC 3GSYA 2Y08A 1E8HA 1FO4A 1VAOA 2VFVA 4BC9A 5L6GA 3HSUA 1W1MA 3ETRB 5AWVA 3C0PA 1W1KA 3FW9A 4JAYA 4ML8A 5I1WA 3FW7A 2GQTA 3RJ8A 5I1VA 3JS8A 1N62C 3W8WA 3S1DA 5AE2A 3SR6B 1E8GA 1FIQB 1N60C 5HHZA 1WVFA 1WYGA 2VFSA 1QLTA 1N61C 2QKNA 3NVZB 2GQUA 3NS1B 2E3TA 4DNSA 1N5WC 3NRZB 4BBYA 5K8EA 1W1SA 4OALA 1E8FA 5AE3A 1AHVA 2W3RA 3AN1A 3KJMA 3TSHA 1N5XA 5AE1A 3AMZA 2I0KA 1MBTA 4O95A 2Y4GA 4PZFA 3S1CA 3D2HA 5HMRA 2VFUA 3D2DA 2W54A 1VDVA 2Q4WA 5FXDA 3AM9A 3BW7A 3D2JA 2W3SA 4PVKA 5FXEA 2IPIA 2VAOA
chains in the Genus database with same CATH superfamily
1AHZA 1W1JA 1F0XA 1UXYA 3EJDB 1AHUA 2AXRA 5D79A 3TSJA 4UD8A 3FW8A 3W8ZA 5HQXA 3PQBA 5ADZA 4ZOHB 5G5GB 2NQWA 2Y3RA 1V97A 4PVHA 2EXRA 1MBBA 3POPA 5FXPA 1ZR6A 2O3GA 2BVFA 3S1EA 2WDWA 1DIQA 2MBRA 4PWCA 3TX1A 1N63C 3PM9A 1JROA 4BC7A 4PYTA 3EUB3 1RM6B 3I99A 2W55A 2P13A 3S1FA 1QLUA 3FWAA 1W1LA 1I19A 2YVSA 1W1RA 2PLIA 5L6FA 2Q85A 1E0YA 3EJEB 4MLAA 2UUUA 4PVJA 5FXFA 3DEDA 3B9JB 1T3QC 4PWBA 1JRPA 1W1QA 3NVYB 1ZXIC 2BVHA 3W8XA 4BCAA 2VFTA 4PVEA 1W1OA 2QPMA 3LLBA 1WVEA 2BVGA 3DQ0A 4JB1A 1DIIA 4XLOA 1DZNA 3RJAA 3VTEA 2Y3SA 4EC3A 2R8DA 1HSKA 1FFUC 4HG0A 2VFRA 1FFVC 3GSYA 2Y08A 1E8HA 1FO4A 1VAOA 2VFVA 4BC9A 5L6GA 2P4PA 3HSUA 1W1MA 3ETRB 5AWVA 3C0PA 1W1KA 3FW9A 4JAYA 4ML8A 5I1WA 3FW7A 3HRDC 2GQTA 3RJ8A 5G5HB 3JS8A 5I1VA 1N62C 3W8WA 3S1DA 5AE2A 3SR6B 3NVWB 1E8GA 1FIQB 1N60C 5HHZA 1WVFA 1WYGA 2VFSA 1QLTA 1N61C 2QKNA 3NVZB 2GQUA 3NS1B 2E3TA 4DNSA 2OAIA 1N5WC 3NRZB 2PLSA 4BBYA 3EJBB 5K8EA 2P3HA 1W1SA 4OALA 1E8FA 3LAEA 1SB3B 5AE3A 1AHVA 2W3RA 3AN1A 3KJMA 3TSHA 1N5XA 5AE1A 3AMZA 2I0KA 1MBTA 4O95A 2Y4GA 4PZFA 3S1CA 3D2HA 5HMRA 2RK5A 2VFUA 3D2DA 2UUVA 2W54A 1VDVA 2Q4WA 5FXDA 3AM9A 3BW7A 3D2JA 3NVVB 2W3SA 4PVKA 5FXEA 2IPIA 2R2ZA 2VAOA
chains in the Genus database with same CATH topology
1AHZA 1W1JA 1F0XA 1UXYA 1AHUA 2AXRA 5D79A 3TSJA 4UD8A 3FW8A 3W8ZA 5HQXA 3PQBA 5ADZA 4ZOHB 5G5GB 2NQWA 2Y3RA 1V97A 4PVHA 2EXRA 1MBBA 3POPA 5FXPA 1ZR6A 2O3GA 2BVFA 3S1EA 2WDWA 1DIQA 2MBRA 4PWCA 3TX1A 1N63C 3PM9A 1JROA 4BC7A 4PYTA 3EUB3 1RM6B 3I99A 2W55A 2P13A 3S1FA 1QLUA 3FWAA 1W1LA 1I19A 2YVSA 1W1RA 2PLIA 5L6FA 2Q85A 1E0YA 4MLAA 2UUUA 4PVJA 5FXFA 3DEDA 3B9JB 1T3QC 4PWBA 1JRPA 1W1QA 3W8XA 1ZXIC 2BVHA 4BCAA 3NVYB 2VFTA 4PVEA 1W1OA 2QPMA 3LLBA 1WVEA 2BVGA 3DQ0A 4JB1A 1DIIA 4XLOA 1DZNA 3RJAA 3VTEA 2Y3SA 4EC3A 2R8DA 1HSKA 1FFUC 4HG0A 2VFRA 1FFVC 3GSYA 2Y08A 1E8HA 1FO4A 1VAOA 2VFVA 4BC9A 5L6GA 2P4PA 3HSUA 1W1MA 3ETRB 5AWVA 3C0PA 1W1KA 3FW9A 4JAYA 4ML8A 5I1WA 3FW7A 3HRDC 2GQTA 3RJ8A 5G5HB 3JS8A 5I1VA 1N62C 3W8WA 3S1DA 5AE2A 3SR6B 3NVWB 1E8GA 1FIQB 1N60C 5HHZA 1WVFA 1WYGA 2VFSA 1QLTA 1N61C 2QKNA 3NVZB 2GQUA 3NS1B 2E3TA 4DNSA 2OAIA 1N5WC 3NRZB 2PLSA 4BBYA 5K8EA 2P3HA 1W1SA 4OALA 1E8FA 3LAEA 1SB3B 5AE3A 1AHVA 2W3RA 3AN1A 3KJMA 3TSHA 1N5XA 5AE1A 3AMZA 2I0KA 1MBTA 4O95A 2Y4GA 4PZFA 3S1CA 3D2HA 5HMRA 2RK5A 2VFUA 3D2DA 2UUVA 2W54A 1VDVA 2Q4WA 5FXDA 3AM9A 3BW7A 3D2JA 3NVVB 2W3SA 4PVKA 5FXEA 2IPIA 2R2ZA 2VAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHZ A;  1W1J A;  1F0X A;  1UXY A;  1AHU A;  2AXR A;  5D79 A;  3TSJ A;  4UD8 A;  3FW8 A;  3W8Z A;  5HQX A;  3PQB A;  5ADZ A;  4ZOH B;  2Y3R A;  1V97 A;  4PVH A;  2EXR A;  1MBB A;  3POP A;  5FXP A;  1ZR6 A;  2BVF A;  3S1E A;  2WDW A;  1DIQ A;  2MBR A;  4PWC A;  3TX1 A;  1N63 C;  3PM9 A;  1JRO A;  4BC7 A;  4PYT A;  3EUB 3;  3I99 A;  2W55 A;  3S1F A;  1QLU A;  3FWA A;  1W1L A;  1I19 A;  1W1R A;  5L6F A;  2Q85 A;  1E0Y A;  4MLA A;  4PVJ A;  5FXF A;  3B9J B;  1T3Q C;  4PWB A;  1W1Q A;  3W8X A;  1ZXI C;  2BVH A;  4BCA A;  2VFT A;  4PVE A;  1W1O A;  2QPM A;  1WVE A;  2BVG A;  3DQ0 A;  4JB1 A;  1DII A;  4XLO A;  1DZN A;  3RJA A;  3VTE A;  2Y3S A;  4EC3 A;  1HSK A;  1FFU C;  2VFR A;  1FFV C;  3GSY A;  2Y08 A;  1E8H A;  1FO4 A;  1VAO A;  2VFV A;  4BC9 A;  5L6G A;  3HSU A;  1W1M A;  3ETR B;  5AWV A;  3C0P A;  1W1K A;  3FW9 A;  4JAY A;  4ML8 A;  5I1W A;  3FW7 A;  2GQT A;  3RJ8 A;  5I1V A;  3JS8 A;  1N62 C;  3W8W A;  3S1D A;  5AE2 A;  3SR6 B;  1E8G A;  1FIQ B;  1N60 C;  5HHZ A;  1WVF A;  1WYG A;  2VFS A;  1QLT A;  1N61 C;  2QKN A;  3NVZ B;  2GQU A;  3NS1 B;  2E3T A;  4DNS A;  1N5W C;  3NRZ B;  4BBY A;  5K8E A;  1W1S A;  4OAL A;  1E8F A;  5AE3 A;  1AHV A;  2W3R A;  3AN1 A;  3KJM A;  3TSH A;  1N5X A;  5AE1 A;  3AMZ A;  2I0K A;  1MBT A;  4O95 A;  2Y4G A;  4PZF A;  3S1C A;  3D2H A;  5HMR A;  2VFU A;  3D2D A;  2W54 A;  1VDV A;  2Q4W A;  5FXD A;  3AM9 A;  3BW7 A;  3D2J A;  2W3S A;  4PVK A;  5FXE A;  2IPI A;  2VAO A; 
#chains in the Genus database with same CATH topology
 1AHZ A;  1W1J A;  1F0X A;  1UXY A;  3EJD B;  1AHU A;  2AXR A;  5D79 A;  3TSJ A;  4UD8 A;  3FW8 A;  3W8Z A;  5HQX A;  3PQB A;  5ADZ A;  4ZOH B;  5G5G B;  2NQW A;  2Y3R A;  1V97 A;  4PVH A;  2EXR A;  1MBB A;  3POP A;  5FXP A;  1ZR6 A;  2O3G A;  2BVF A;  3S1E A;  2WDW A;  1DIQ A;  2MBR A;  4PWC A;  3TX1 A;  1N63 C;  3PM9 A;  1JRO A;  4BC7 A;  4PYT A;  3EUB 3;  1RM6 B;  3I99 A;  2W55 A;  2P13 A;  3S1F A;  1QLU A;  3FWA A;  1W1L A;  1I19 A;  2YVS A;  1W1R A;  2PLI A;  5L6F A;  2Q85 A;  1E0Y A;  3EJE B;  4MLA A;  2UUU A;  4PVJ A;  5FXF A;  3DED A;  3B9J B;  1T3Q C;  4PWB A;  1JRP A;  1W1Q A;  3NVY B;  1ZXI C;  2BVH A;  3W8X A;  4BCA A;  2VFT A;  4PVE A;  1W1O A;  2QPM A;  3LLB A;  1WVE A;  2BVG A;  3DQ0 A;  4JB1 A;  1DII A;  4XLO A;  1DZN A;  3RJA A;  3VTE A;  2Y3S A;  4EC3 A;  2R8D A;  1HSK A;  1FFU C;  4HG0 A;  2VFR A;  1FFV C;  3GSY A;  2Y08 A;  1E8H A;  1FO4 A;  1VAO A;  2VFV A;  4BC9 A;  5L6G A;  2P4P A;  3HSU A;  1W1M A;  3ETR B;  5AWV A;  3C0P A;  1W1K A;  3FW9 A;  4JAY A;  4ML8 A;  5I1W A;  3FW7 A;  3HRD C;  2GQT A;  3RJ8 A;  5G5H B;  3JS8 A;  5I1V A;  1N62 C;  3W8W A;  3S1D A;  5AE2 A;  3SR6 B;  3NVW B;  1E8G A;  1FIQ B;  1N60 C;  5HHZ A;  1WVF A;  1WYG A;  2VFS A;  1QLT A;  1N61 C;  2QKN A;  3NVZ B;  2GQU A;  3NS1 B;  2E3T A;  4DNS A;  2OAI A;  1N5W C;  3NRZ B;  2PLS A;  4BBY A;  3EJB B;  5K8E A;  2P3H A;  1W1S A;  4OAL A;  1E8F A;  3LAE A;  1SB3 B;  5AE3 A;  1AHV A;  2W3R A;  3AN1 A;  3KJM A;  3TSH A;  1N5X A;  5AE1 A;  3AMZ A;  2I0K A;  1MBT A;  4O95 A;  2Y4G A;  4PZF A;  3S1C A;  3D2H A;  5HMR A;  2RK5 A;  2VFU A;  3D2D A;  2UUV A;  2W54 A;  1VDV A;  2Q4W A;  5FXD A;  3AM9 A;  3BW7 A;  3D2J A;  3NVV B;  2W3S A;  4PVK A;  5FXE A;  2IPI A;  2R2Z A;  2VAO A; 
#chains in the Genus database with same CATH homology
 1AHZ A;  1W1J A;  1F0X A;  1UXY A;  1AHU A;  2AXR A;  5D79 A;  3TSJ A;  4UD8 A;  3FW8 A;  3W8Z A;  5HQX A;  3PQB A;  5ADZ A;  4ZOH B;  5G5G B;  2NQW A;  2Y3R A;  1V97 A;  4PVH A;  2EXR A;  1MBB A;  3POP A;  5FXP A;  1ZR6 A;  2O3G A;  2BVF A;  3S1E A;  2WDW A;  1DIQ A;  2MBR A;  4PWC A;  3TX1 A;  1N63 C;  3PM9 A;  1JRO A;  4BC7 A;  4PYT A;  3EUB 3;  1RM6 B;  3I99 A;  2W55 A;  2P13 A;  3S1F A;  1QLU A;  3FWA A;  1W1L A;  1I19 A;  2YVS A;  1W1R A;  2PLI A;  5L6F A;  2Q85 A;  1E0Y A;  4MLA A;  2UUU A;  4PVJ A;  5FXF A;  3DED A;  3B9J B;  1T3Q C;  4PWB A;  1JRP A;  1W1Q A;  3W8X A;  1ZXI C;  2BVH A;  4BCA A;  3NVY B;  2VFT A;  4PVE A;  1W1O A;  2QPM A;  3LLB A;  1WVE A;  2BVG A;  3DQ0 A;  4JB1 A;  1DII A;  4XLO A;  1DZN A;  3RJA A;  3VTE A;  2Y3S A;  4EC3 A;  2R8D A;  1HSK A;  1FFU C;  4HG0 A;  2VFR A;  1FFV C;  3GSY A;  2Y08 A;  1E8H A;  1FO4 A;  1VAO A;  2VFV A;  4BC9 A;  5L6G A;  2P4P A;  3HSU A;  1W1M A;  3ETR B;  5AWV A;  3C0P A;  1W1K A;  3FW9 A;  4JAY A;  4ML8 A;  5I1W A;  3FW7 A;  3HRD C;  2GQT A;  3RJ8 A;  5G5H B;  3JS8 A;  5I1V A;  1N62 C;  3W8W A;  3S1D A;  5AE2 A;  3SR6 B;  3NVW B;  1E8G A;  1FIQ B;  1N60 C;  5HHZ A;  1WVF A;  1WYG A;  2VFS A;  1QLT A;  1N61 C;  2QKN A;  3NVZ B;  2GQU A;  3NS1 B;  2E3T A;  4DNS A;  2OAI A;  1N5W C;  3NRZ B;  2PLS A;  4BBY A;  5K8E A;  2P3H A;  1W1S A;  4OAL A;  1E8F A;  3LAE A;  1SB3 B;  5AE3 A;  1AHV A;  2W3R A;  3AN1 A;  3KJM A;  3TSH A;  1N5X A;  5AE1 A;  3AMZ A;  2I0K A;  1MBT A;  4O95 A;  2Y4G A;  4PZF A;  3S1C A;  3D2H A;  5HMR A;  2RK5 A;  2VFU A;  3D2D A;  2UUV A;  2W54 A;  1VDV A;  2Q4W A;  5FXD A;  3AM9 A;  3BW7 A;  3D2J A;  3NVV B;  2W3S A;  4PVK A;  5FXE A;  2IPI A;  2R2Z A;  2VAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...