4PVEA

Wild-type phl p 4.0202, a glucose dehydrogenase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
490
structure length
490
Chain Sequence
EDFLGCLVKEIPPRLLYAKSSPAYPSVLGQTIRNSRWSSPDNVKPLYIITPTQVSHIQSAVVCGRRHTVRIRVRSGGHDYEGLSYRSLQPETFAVVDLNKMRAVWVDGKARTAWVDSGAQLGELYYAIYKASPTLAFPAGVCPTIGVGGNFAGGGFGMLLRKYGIAAENVIDVKLVDANGKLHDKKSMGDDHFWAVRGGGGESFGIVVAWQVKLLPVPPTVTIFKISKTVSEGAVDIINKWQVVAPQLPADLMIRIIAQGPKATFEAMYLGTCKTLTPLMSSKFPELGMNPSHCNEMSWIQSIPFVHLGHRDALEDDLLNRQNSFKPFAEYKSDYVYQPFPKTVWEQILNTWLVKPGAGIMIFDPYGATISATPESATPFPHRKGVLFNIQYVNYWFAPGAAAAPLSWSKDIYNYMEPYVSKNPRQAYANYRDIDLGRNEVVNDVSTYASGKVWGQKYFKGNFERLAITKGKVDPTDYFRNEQSIPPLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pollen allergen Phl p 4.0202
publication title Rationally engineered flavin-dependent oxidase reveals steric control of dioxygen reduction.
pubmed doi rcsb
source organism Phleum pratense
total genus 162
structure length 490
sequence length 490
ec nomenclature
pdb deposition date 2014-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 4pveA01
3.30.465.50 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 4pveA02
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 4pveA03
3HSUA 2W55A 1W1OA 2GQUA 2VFSA 5HHZA 2Q4WA 5FXDA 1JROA 1UXYA 1DZNA 3W8WA 3NRZB 4EC3A 4PVJA 2AXRA 3PQBA 1E8GA 4PYTA 5L6FA 1DIIA 3D2DA 2MBRA 1MBTA 4PVKA 3C0PA 4JB1A 1FFUC 4PZFA 5AE3A 2IPIA 1E0YA 2QKNA 3NS1B 1W1LA 5HQXA 1QLUA 4DNSA 1HSKA 4XLOA 1N63C 5AWVA 2VAOA 1FO4A 3S1DA 3FW8A 1V97A 1VDVA 3FW9A 1QLTA 5FXFA 1E8HA 1W1SA 3TX1A 3D2HA 2I0KA 3KJMA 1F0XA 4BC7A 2GQTA 1W1JA 5K8EA 3I99A 1FFVC 3PM9A 1WVFA 3RJAA 3W8XA 4PVEA 3AM9A 3S1FA 3JS8A 3FWAA 2Y3RA 3D2JA 1AHUA 4O95A 5D79A 1E8FA 3S1EA 2W54A 3AN1A 1I19A 3SR6B 4ML8A 2W3RA 3BW7A 5AE2A 1ZR6A 1N62C 4PWCA 4PWBA 2BVHA 1WYGA 1ZXIC 3W8ZA 3NVZB 1DIQA 4MLAA 1FIQB 2E3TA 3DQ0A 2VFUA 1N5WC 3TSJA 2BVFA 3GSYA 4UD8A 3VTEA 4BBYA 1AHVA 4JAYA 2Y4GA 2VFTA 5I1VA 2VFRA 2EXRA 3RJ8A 1VAOA 5FXEA 1MBBA 1W1KA 1W1QA 2Q85A 3AMZA 1WVEA 4PVHA 1N61C 1N5XA 4OALA 3ETRB 4BC9A 3FW7A 5L6GA 3S1CA 5AE1A 1T3QC 3B9JB 1W1RA 5ADZA 5HMRA 3EUB3 5I1WA 3TSHA 2Y3SA 2BVGA 1N60C 4BCAA 2WDWA 3POPA 2QPMA 1AHZA 1W1MA 5FXPA 2W3SA 2VFVA 2Y08A 4ZOHB
chains in the Genus database with same CATH superfamily
3HSUA 2W55A 1W1OA 2GQUA 2VFSA 5HHZA 3EJDB 2Q4WA 5FXDA 1JRPA 2O3GA 1JROA 1UXYA 1DZNA 3W8WA 3LLBA 3NRZB 4EC3A 4PVJA 2AXRA 2YVSA 3PQBA 1E8GA 4PYTA 5L6FA 1DIIA 3D2DA 3DEDA 2MBRA 1MBTA 4PVKA 5G5GB 3C0PA 4JB1A 1FFUC 2UUVA 4PZFA 5AE3A 2PLSA 2IPIA 1E0YA 2QKNA 3NS1B 1W1LA 5HQXA 2R8DA 3NVWB 1QLUA 4DNSA 1HSKA 4XLOA 1N63C 5AWVA 2VAOA 1FO4A 3S1DA 3FW8A 1V97A 1VDVA 3FW9A 1QLTA 5FXFA 1E8HA 1W1SA 3TX1A 2OAIA 3D2HA 3EJEB 2I0KA 3KJMA 1F0XA 4BC7A 2GQTA 1W1JA 5K8EA 3I99A 1FFVC 3PM9A 1WVFA 3RJAA 3W8XA 4PVEA 3AM9A 3S1FA 3JS8A 3FWAA 2Y3RA 3EJBB 3D2JA 1AHUA 2UUUA 4O95A 5D79A 1E8FA 4HG0A 3S1EA 2W54A 3AN1A 3NVVB 1I19A 3SR6B 4ML8A 3LAEA 2PLIA 2W3RA 2RK5A 3BW7A 2NQWA 5AE2A 5G5HB 1ZR6A 1N62C 4PWCA 2P13A 4PWBA 2BVHA 1WYGA 1ZXIC 3W8ZA 3NVZB 1DIQA 4MLAA 1FIQB 2E3TA 3DQ0A 2VFUA 1N5WC 3TSJA 2BVFA 3GSYA 4UD8A 3VTEA 4BBYA 1AHVA 4JAYA 2Y4GA 2VFTA 5I1VA 2VFRA 2EXRA 1RM6B 3RJ8A 1VAOA 5FXEA 1MBBA 1W1KA 1W1QA 2Q85A 3AMZA 1WVEA 4PVHA 1N61C 1N5XA 4OALA 3ETRB 2P3HA 4BC9A 3FW7A 3HRDC 3NVYB 3S1CA 5L6GA 2R2ZA 5AE1A 1T3QC 3B9JB 1W1RA 5ADZA 5HMRA 3EUB3 5I1WA 3TSHA 2Y3SA 2BVGA 1N60C 4BCAA 2WDWA 3POPA 2QPMA 1AHZA 1SB3B 1W1MA 5FXPA 2P4PA 2W3SA 2VFVA 2Y08A 4ZOHB
chains in the Genus database with same CATH topology
3HSUA 2W55A 1W1OA 2GQUA 2VFSA 5HHZA 1JRPA 2Q4WA 5FXDA 2O3GA 1JROA 1UXYA 1DZNA 3W8WA 3LLBA 3NRZB 4EC3A 4PVJA 2AXRA 2YVSA 3PQBA 1E8GA 4PYTA 5L6FA 1DIIA 3D2DA 3DEDA 2MBRA 1MBTA 4PVKA 5G5GB 3C0PA 4JB1A 1FFUC 2UUVA 4PZFA 5AE3A 2PLSA 2IPIA 1E0YA 2QKNA 3NS1B 1W1LA 5HQXA 2R8DA 3NVWB 1QLUA 4DNSA 1HSKA 4XLOA 1N63C 5AWVA 2VAOA 1FO4A 3S1DA 3FW8A 1V97A 1VDVA 3FW9A 1QLTA 5FXFA 1E8HA 1W1SA 3TX1A 2OAIA 3D2HA 2I0KA 3KJMA 1F0XA 4BC7A 2GQTA 1W1JA 5K8EA 3I99A 1FFVC 3PM9A 1WVFA 3RJAA 3W8XA 4PVEA 3AM9A 3S1FA 3JS8A 3FWAA 2Y3RA 3D2JA 1AHUA 2UUUA 4O95A 5D79A 1E8FA 4HG0A 3S1EA 2W54A 3AN1A 3NVVB 1I19A 3SR6B 4ML8A 3LAEA 2PLIA 2W3RA 2RK5A 3BW7A 2NQWA 5AE2A 5G5HB 1ZR6A 1N62C 4PWCA 2P13A 4PWBA 2BVHA 1WYGA 1ZXIC 3W8ZA 3NVZB 1DIQA 4MLAA 1FIQB 2E3TA 3DQ0A 2VFUA 1N5WC 3TSJA 2BVFA 3GSYA 4UD8A 3VTEA 4BBYA 1AHVA 4JAYA 2Y4GA 2VFTA 5I1VA 2VFRA 2EXRA 1RM6B 3RJ8A 1VAOA 5FXEA 1MBBA 1W1KA 1W1QA 2Q85A 3AMZA 1WVEA 4PVHA 1N61C 1N5XA 4OALA 3ETRB 2P3HA 4BC9A 3FW7A 3HRDC 3NVYB 3S1CA 5L6GA 2R2ZA 5AE1A 1T3QC 3B9JB 1W1RA 5ADZA 5HMRA 3EUB3 5I1WA 3TSHA 2Y3SA 2BVGA 1N60C 4BCAA 2WDWA 3POPA 2QPMA 1AHZA 1SB3B 1W1MA 5FXPA 2P4PA 2W3SA 2VFVA 2Y08A 4ZOHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSU A;  2W55 A;  1W1O A;  2GQU A;  2VFS A;  5HHZ A;  2Q4W A;  5FXD A;  1JRO A;  1UXY A;  1DZN A;  3W8W A;  3NRZ B;  4EC3 A;  4PVJ A;  2AXR A;  3PQB A;  1E8G A;  4PYT A;  5L6F A;  1DII A;  3D2D A;  2MBR A;  1MBT A;  4PVK A;  3C0P A;  4JB1 A;  1FFU C;  4PZF A;  5AE3 A;  2IPI A;  1E0Y A;  2QKN A;  3NS1 B;  1W1L A;  5HQX A;  1QLU A;  4DNS A;  1HSK A;  4XLO A;  1N63 C;  5AWV A;  2VAO A;  1FO4 A;  3S1D A;  3FW8 A;  1V97 A;  1VDV A;  3FW9 A;  1QLT A;  5FXF A;  1E8H A;  1W1S A;  3TX1 A;  3D2H A;  2I0K A;  3KJM A;  1F0X A;  4BC7 A;  2GQT A;  1W1J A;  5K8E A;  3I99 A;  1FFV C;  3PM9 A;  1WVF A;  3RJA A;  3W8X A;  4PVE A;  3AM9 A;  3S1F A;  3JS8 A;  3FWA A;  2Y3R A;  3D2J A;  1AHU A;  4O95 A;  5D79 A;  1E8F A;  3S1E A;  2W54 A;  3AN1 A;  1I19 A;  3SR6 B;  4ML8 A;  2W3R A;  3BW7 A;  5AE2 A;  1ZR6 A;  1N62 C;  4PWC A;  4PWB A;  2BVH A;  1WYG A;  1ZXI C;  3W8Z A;  3NVZ B;  1DIQ A;  4MLA A;  1FIQ B;  2E3T A;  3DQ0 A;  2VFU A;  1N5W C;  3TSJ A;  2BVF A;  3GSY A;  4UD8 A;  3VTE A;  4BBY A;  1AHV A;  4JAY A;  2Y4G A;  2VFT A;  5I1V A;  2VFR A;  2EXR A;  3RJ8 A;  1VAO A;  5FXE A;  1MBB A;  1W1K A;  1W1Q A;  2Q85 A;  3AMZ A;  1WVE A;  4PVH A;  1N61 C;  1N5X A;  4OAL A;  3ETR B;  4BC9 A;  3FW7 A;  5L6G A;  3S1C A;  5AE1 A;  1T3Q C;  3B9J B;  1W1R A;  5ADZ A;  5HMR A;  3EUB 3;  5I1W A;  3TSH A;  2Y3S A;  2BVG A;  1N60 C;  4BCA A;  2WDW A;  3POP A;  2QPM A;  1AHZ A;  1W1M A;  5FXP A;  2W3S A;  2VFV A;  2Y08 A;  4ZOH B; 
#chains in the Genus database with same CATH topology
 3HSU A;  2W55 A;  1W1O A;  2GQU A;  2VFS A;  5HHZ A;  3EJD B;  2Q4W A;  5FXD A;  1JRP A;  2O3G A;  1JRO A;  1UXY A;  1DZN A;  3W8W A;  3LLB A;  3NRZ B;  4EC3 A;  4PVJ A;  2AXR A;  2YVS A;  3PQB A;  1E8G A;  4PYT A;  5L6F A;  1DII A;  3D2D A;  3DED A;  2MBR A;  1MBT A;  4PVK A;  5G5G B;  3C0P A;  4JB1 A;  1FFU C;  2UUV A;  4PZF A;  5AE3 A;  2PLS A;  2IPI A;  1E0Y A;  2QKN A;  3NS1 B;  1W1L A;  5HQX A;  2R8D A;  3NVW B;  1QLU A;  4DNS A;  1HSK A;  4XLO A;  1N63 C;  5AWV A;  2VAO A;  1FO4 A;  3S1D A;  3FW8 A;  1V97 A;  1VDV A;  3FW9 A;  1QLT A;  5FXF A;  1E8H A;  1W1S A;  3TX1 A;  2OAI A;  3D2H A;  3EJE B;  2I0K A;  3KJM A;  1F0X A;  4BC7 A;  2GQT A;  1W1J A;  5K8E A;  3I99 A;  1FFV C;  3PM9 A;  1WVF A;  3RJA A;  3W8X A;  4PVE A;  3AM9 A;  3S1F A;  3JS8 A;  3FWA A;  2Y3R A;  3EJB B;  3D2J A;  1AHU A;  2UUU A;  4O95 A;  5D79 A;  1E8F A;  4HG0 A;  3S1E A;  2W54 A;  3AN1 A;  3NVV B;  1I19 A;  3SR6 B;  4ML8 A;  3LAE A;  2PLI A;  2W3R A;  2RK5 A;  3BW7 A;  2NQW A;  5AE2 A;  5G5H B;  1ZR6 A;  1N62 C;  4PWC A;  2P13 A;  4PWB A;  2BVH A;  1WYG A;  1ZXI C;  3W8Z A;  3NVZ B;  1DIQ A;  4MLA A;  1FIQ B;  2E3T A;  3DQ0 A;  2VFU A;  1N5W C;  3TSJ A;  2BVF A;  3GSY A;  4UD8 A;  3VTE A;  4BBY A;  1AHV A;  4JAY A;  2Y4G A;  2VFT A;  5I1V A;  2VFR A;  2EXR A;  1RM6 B;  3RJ8 A;  1VAO A;  5FXE A;  1MBB A;  1W1K A;  1W1Q A;  2Q85 A;  3AMZ A;  1WVE A;  4PVH A;  1N61 C;  1N5X A;  4OAL A;  3ETR B;  2P3H A;  4BC9 A;  3FW7 A;  3HRD C;  3NVY B;  3S1C A;  5L6G A;  2R2Z A;  5AE1 A;  1T3Q C;  3B9J B;  1W1R A;  5ADZ A;  5HMR A;  3EUB 3;  5I1W A;  3TSH A;  2Y3S A;  2BVG A;  1N60 C;  4BCA A;  2WDW A;  3POP A;  2QPM A;  1AHZ A;  1SB3 B;  1W1M A;  5FXP A;  2P4P A;  2W3S A;  2VFV A;  2Y08 A;  4ZOH B; 
#chains in the Genus database with same CATH homology
 3HSU A;  2W55 A;  1W1O A;  2GQU A;  2VFS A;  5HHZ A;  1JRP A;  2Q4W A;  5FXD A;  2O3G A;  1JRO A;  1UXY A;  1DZN A;  3W8W A;  3LLB A;  3NRZ B;  4EC3 A;  4PVJ A;  2AXR A;  2YVS A;  3PQB A;  1E8G A;  4PYT A;  5L6F A;  1DII A;  3D2D A;  3DED A;  2MBR A;  1MBT A;  4PVK A;  5G5G B;  3C0P A;  4JB1 A;  1FFU C;  2UUV A;  4PZF A;  5AE3 A;  2PLS A;  2IPI A;  1E0Y A;  2QKN A;  3NS1 B;  1W1L A;  5HQX A;  2R8D A;  3NVW B;  1QLU A;  4DNS A;  1HSK A;  4XLO A;  1N63 C;  5AWV A;  2VAO A;  1FO4 A;  3S1D A;  3FW8 A;  1V97 A;  1VDV A;  3FW9 A;  1QLT A;  5FXF A;  1E8H A;  1W1S A;  3TX1 A;  2OAI A;  3D2H A;  2I0K A;  3KJM A;  1F0X A;  4BC7 A;  2GQT A;  1W1J A;  5K8E A;  3I99 A;  1FFV C;  3PM9 A;  1WVF A;  3RJA A;  3W8X A;  4PVE A;  3AM9 A;  3S1F A;  3JS8 A;  3FWA A;  2Y3R A;  3D2J A;  1AHU A;  2UUU A;  4O95 A;  5D79 A;  1E8F A;  4HG0 A;  3S1E A;  2W54 A;  3AN1 A;  3NVV B;  1I19 A;  3SR6 B;  4ML8 A;  3LAE A;  2PLI A;  2W3R A;  2RK5 A;  3BW7 A;  2NQW A;  5AE2 A;  5G5H B;  1ZR6 A;  1N62 C;  4PWC A;  2P13 A;  4PWB A;  2BVH A;  1WYG A;  1ZXI C;  3W8Z A;  3NVZ B;  1DIQ A;  4MLA A;  1FIQ B;  2E3T A;  3DQ0 A;  2VFU A;  1N5W C;  3TSJ A;  2BVF A;  3GSY A;  4UD8 A;  3VTE A;  4BBY A;  1AHV A;  4JAY A;  2Y4G A;  2VFT A;  5I1V A;  2VFR A;  2EXR A;  1RM6 B;  3RJ8 A;  1VAO A;  5FXE A;  1MBB A;  1W1K A;  1W1Q A;  2Q85 A;  3AMZ A;  1WVE A;  4PVH A;  1N61 C;  1N5X A;  4OAL A;  3ETR B;  2P3H A;  4BC9 A;  3FW7 A;  3HRD C;  3NVY B;  3S1C A;  5L6G A;  2R2Z A;  5AE1 A;  1T3Q C;  3B9J B;  1W1R A;  5ADZ A;  5HMR A;  3EUB 3;  5I1W A;  3TSH A;  2Y3S A;  2BVG A;  1N60 C;  4BCA A;  2WDW A;  3POP A;  2QPM A;  1AHZ A;  1SB3 B;  1W1M A;  5FXP A;  2P4P A;  2W3S A;  2VFV A;  2Y08 A;  4ZOH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...