5HMRA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
492
structure length
447
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
total genus 146
structure length 447
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hmrA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hmrA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hmrA03
1N60C 2VAOA 4DNSA 4OALA 1FFVC 1ZR6A 4BC7A 3W8WA 3KJMA 1WVEA 2MBRA 2OAIA 2W54A 5FXFA 2I0KA 1VAOA 2R2ZA 1WYGA 4PVKA 1W1JA 4BC9A 1N63C 2YVSA 1N5XA 4XLOA 3FW8A 3AM9A 3NS1B 4PVHA 3FWAA 2W55A 3VTEA 4BBYA 3D2JA 1F0XA 2Q85A 4PWCA 1MBTA 1W1OA 3S1DA 3SR6B 3TSJA 3NVVB 1AHUA 5D79A 1E8FA 3W8XA 4PYTA 5FXPA 1JRPA 4ML8A 3S1EA 3D2HA 2W3RA 3EUB3 2GQUA 1N62C 2VFVA 1N61C 2P4PA 4BCAA 5HQXA 1AHZA 1WVFA 2PLSA 3LAEA 2QPMA 2Q4WA 4JB1A 3TSHA 5HHZA 1T3QC 3HRDC 4UD8A 3FW9A 2VFTA 2VFSA 1QLTA 1N5WC 3TX1A 5HMRA 3PM9A 1FFUC 3AMZA 2O3GA 2P13A 1W1QA 1W1LA 1ZXIC 2EXRA 1DIIA 1W1KA 1V97A 1I19A 1E0YA 3NVYB 1E8HA 1SB3B 2R8DA 1HSKA 4PVEA 2BVGA 3BW7A 5FXDA 3DEDA 4PWBA 5G5HB 1W1SA 4ZOHB 4O95A 2PLIA 3W8ZA 1FIQB 1DIQA 4MLAA 5AE1A 2P3HA 2BVHA 3NVWB 1DZNA 3AN1A 1E8GA 5ADZA 2AXRA 3D2DA 3ETRB 1RM6B 2E3TA 5FXEA 5AE2A 1JROA 2VFRA 3NVZB 2NQWA 2VFUA 4JAYA 3C0PA 3I99A 1W1MA 1MBBA 2BVFA 4PVJA 2RK5A 3FW7A 3NRZB 3B9JB 5AE3A 2GQTA 2QKNA 1FO4A 5G5GB 3S1CA 4HG0A 1W1RA 3JS8A 3S1FA 2W3SA 3GSYA 4PZFA 1QLUA 1UXYA 3DQ0A 4EC3A 1VDVA 3LLBA 1AHVA
chains in the Genus database with same CATH superfamily
1N60C 2VAOA 4DNSA 4OALA 1FFVC 5L6FA 1ZR6A 4BC7A 3W8WA 3KJMA 1WVEA 5L6GA 2MBRA 3EJEB 2W54A 5FXFA 2OAIA 2I0KA 1VAOA 2R2ZA 1WYGA 4PVKA 1W1JA 4BC9A 1N63C 2YVSA 1N5XA 4XLOA 3FW8A 3AM9A 3NS1B 4PVHA 3FWAA 2W55A 3VTEA 3EJDB 4BBYA 3D2JA 1F0XA 2Q85A 4PWCA 1MBTA 1W1OA 3NVVB 3S1DA 3SR6B 3TSJA 1AHUA 5D79A 1E8FA 3W8XA 4PYTA 5FXPA 1JRPA 4ML8A 3S1EA 3D2HA 2W3RA 3EUB3 2GQUA 1N62C 2VFVA 2IPIA 1N61C 2P4PA 3EJBB 4BCAA 5HQXA 1AHZA 1WVFA 2PLSA 2Y08A 3LAEA 2QPMA 2Q4WA 4JB1A 3TSHA 5HHZA 2Y3SA 1T3QC 3HRDC 2WDWA 4UD8A 3FW9A 3RJ8A 2VFTA 2VFSA 1QLTA 1N5WC 3TX1A 5HMRA 3PM9A 1FFUC 3AMZA 2O3GA 2P13A 1W1QA 1W1LA 1ZXIC 2EXRA 1DIIA 1W1KA 1V97A 1I19A 3RJAA 1E0YA 3NVYB 1E8HA 1SB3B 2R8DA 1HSKA 4PVEA 2BVGA 3BW7A 5FXDA 3DEDA 4PWBA 5G5HB 1W1SA 5K8EA 2UUVA 4ZOHB 4O95A 2PLIA 3W8ZA 1FIQB 1DIQA 4MLAA 2Y4GA 5AE1A 2P3HA 2BVHA 3NVWB 1DZNA 3AN1A 1E8GA 5ADZA 2AXRA 5AWVA 3D2DA 3HSUA 3ETRB 1RM6B 2E3TA 5FXEA 5AE2A 5I1WA 1JROA 2VFRA 3NVZB 2NQWA 2VFUA 2UUUA 4JAYA 3C0PA 3I99A 1W1MA 1MBBA 3PQBA 2BVFA 4PVJA 2RK5A 3FW7A 3NRZB 2Y3RA 3B9JB 5AE3A 2GQTA 2QKNA 1FO4A 5G5GB 3S1CA 4HG0A 1W1RA 3JS8A 3S1FA 2W3SA 3GSYA 4PZFA 1QLUA 1UXYA 3DQ0A 4EC3A 3POPA 1VDVA 3LLBA 1AHVA 5I1VA
chains in the Genus database with same CATH topology
1N60C 2VAOA 4DNSA 4OALA 1FFVC 5L6FA 1ZR6A 4BC7A 3W8WA 3KJMA 1WVEA 5L6GA 2MBRA 2OAIA 2W54A 5FXFA 2I0KA 1VAOA 2R2ZA 1WYGA 4PVKA 1W1JA 4BC9A 1N63C 2YVSA 1N5XA 4XLOA 3FW8A 3AM9A 3NS1B 4PVHA 3FWAA 2W55A 3VTEA 4BBYA 3D2JA 1F0XA 2Q85A 4PWCA 1MBTA 1W1OA 3S1DA 3SR6B 3TSJA 3NVVB 1AHUA 5D79A 1E8FA 3W8XA 4PYTA 5FXPA 1JRPA 4ML8A 3S1EA 3D2HA 2W3RA 3EUB3 2GQUA 1N62C 2VFVA 2IPIA 1N61C 2P4PA 4BCAA 5HQXA 1AHZA 1WVFA 2PLSA 2Y08A 3LAEA 2QPMA 2Q4WA 4JB1A 3TSHA 5HHZA 2Y3SA 1T3QC 3HRDC 2WDWA 4UD8A 3FW9A 3RJ8A 2VFTA 2VFSA 1QLTA 1N5WC 3TX1A 5HMRA 3PM9A 1FFUC 3AMZA 2O3GA 2P13A 1W1QA 1W1LA 1ZXIC 2EXRA 1DIIA 1W1KA 1V97A 1I19A 3RJAA 1E0YA 3NVYB 1E8HA 1SB3B 2R8DA 1HSKA 4PVEA 2BVGA 3BW7A 5FXDA 3DEDA 4PWBA 5G5HB 1W1SA 5K8EA 2UUVA 4ZOHB 4O95A 2PLIA 3W8ZA 1FIQB 1DIQA 4MLAA 2Y4GA 5AE1A 2P3HA 2BVHA 3NVWB 1DZNA 3AN1A 1E8GA 5ADZA 2AXRA 5AWVA 3D2DA 3HSUA 3ETRB 1RM6B 2E3TA 5FXEA 5AE2A 5I1WA 1JROA 2VFRA 3NVZB 2NQWA 2VFUA 2UUUA 4JAYA 3C0PA 3I99A 1W1MA 1MBBA 3PQBA 2BVFA 4PVJA 2RK5A 3FW7A 3NRZB 2Y3RA 3B9JB 5AE3A 2GQTA 2QKNA 1FO4A 5G5GB 3S1CA 4HG0A 1W1RA 3JS8A 3S1FA 2W3SA 3GSYA 4PZFA 1QLUA 1UXYA 3DQ0A 4EC3A 3POPA 1VDVA 3LLBA 1AHVA 5I1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N60 C;  2VAO A;  4DNS A;  4OAL A;  1FFV C;  1ZR6 A;  4BC7 A;  3W8W A;  3KJM A;  1WVE A;  2MBR A;  2OAI A;  2W54 A;  5FXF A;  2I0K A;  1VAO A;  2R2Z A;  1WYG A;  4PVK A;  1W1J A;  4BC9 A;  1N63 C;  2YVS A;  1N5X A;  4XLO A;  3FW8 A;  3AM9 A;  3NS1 B;  4PVH A;  3FWA A;  2W55 A;  3VTE A;  4BBY A;  3D2J A;  1F0X A;  2Q85 A;  4PWC A;  1MBT A;  1W1O A;  3S1D A;  3SR6 B;  3TSJ A;  3NVV B;  1AHU A;  5D79 A;  1E8F A;  3W8X A;  4PYT A;  5FXP A;  1JRP A;  4ML8 A;  3S1E A;  3D2H A;  2W3R A;  3EUB 3;  2GQU A;  1N62 C;  2VFV A;  1N61 C;  2P4P A;  4BCA A;  5HQX A;  1AHZ A;  1WVF A;  2PLS A;  3LAE A;  2QPM A;  2Q4W A;  4JB1 A;  3TSH A;  5HHZ A;  1T3Q C;  3HRD C;  4UD8 A;  3FW9 A;  2VFT A;  2VFS A;  1QLT A;  1N5W C;  3TX1 A;  5HMR A;  3PM9 A;  1FFU C;  3AMZ A;  2O3G A;  2P13 A;  1W1Q A;  1W1L A;  1ZXI C;  2EXR A;  1DII A;  1W1K A;  1V97 A;  1I19 A;  1E0Y A;  3NVY B;  1E8H A;  1SB3 B;  2R8D A;  1HSK A;  4PVE A;  2BVG A;  3BW7 A;  5FXD A;  3DED A;  4PWB A;  5G5H B;  1W1S A;  4ZOH B;  4O95 A;  2PLI A;  3W8Z A;  1FIQ B;  1DIQ A;  4MLA A;  5AE1 A;  2P3H A;  2BVH A;  3NVW B;  1DZN A;  3AN1 A;  1E8G A;  5ADZ A;  2AXR A;  3D2D A;  3ETR B;  1RM6 B;  2E3T A;  5FXE A;  5AE2 A;  1JRO A;  2VFR A;  3NVZ B;  2NQW A;  2VFU A;  4JAY A;  3C0P A;  3I99 A;  1W1M A;  1MBB A;  2BVF A;  4PVJ A;  2RK5 A;  3FW7 A;  3NRZ B;  3B9J B;  5AE3 A;  2GQT A;  2QKN A;  1FO4 A;  5G5G B;  3S1C A;  4HG0 A;  1W1R A;  3JS8 A;  3S1F A;  2W3S A;  3GSY A;  4PZF A;  1QLU A;  1UXY A;  3DQ0 A;  4EC3 A;  1VDV A;  3LLB A;  1AHV A; 
#chains in the Genus database with same CATH topology
 1N60 C;  2VAO A;  4DNS A;  4OAL A;  1FFV C;  5L6F A;  1ZR6 A;  4BC7 A;  3W8W A;  3KJM A;  1WVE A;  5L6G A;  2MBR A;  3EJE B;  2W54 A;  5FXF A;  2OAI A;  2I0K A;  1VAO A;  2R2Z A;  1WYG A;  4PVK A;  1W1J A;  4BC9 A;  1N63 C;  2YVS A;  1N5X A;  4XLO A;  3FW8 A;  3AM9 A;  3NS1 B;  4PVH A;  3FWA A;  2W55 A;  3VTE A;  3EJD B;  4BBY A;  3D2J A;  1F0X A;  2Q85 A;  4PWC A;  1MBT A;  1W1O A;  3NVV B;  3S1D A;  3SR6 B;  3TSJ A;  1AHU A;  5D79 A;  1E8F A;  3W8X A;  4PYT A;  5FXP A;  1JRP A;  4ML8 A;  3S1E A;  3D2H A;  2W3R A;  3EUB 3;  2GQU A;  1N62 C;  2VFV A;  2IPI A;  1N61 C;  2P4P A;  3EJB B;  4BCA A;  5HQX A;  1AHZ A;  1WVF A;  2PLS A;  2Y08 A;  3LAE A;  2QPM A;  2Q4W A;  4JB1 A;  3TSH A;  5HHZ A;  2Y3S A;  1T3Q C;  3HRD C;  2WDW A;  4UD8 A;  3FW9 A;  3RJ8 A;  2VFT A;  2VFS A;  1QLT A;  1N5W C;  3TX1 A;  5HMR A;  3PM9 A;  1FFU C;  3AMZ A;  2O3G A;  2P13 A;  1W1Q A;  1W1L A;  1ZXI C;  2EXR A;  1DII A;  1W1K A;  1V97 A;  1I19 A;  3RJA A;  1E0Y A;  3NVY B;  1E8H A;  1SB3 B;  2R8D A;  1HSK A;  4PVE A;  2BVG A;  3BW7 A;  5FXD A;  3DED A;  4PWB A;  5G5H B;  1W1S A;  5K8E A;  2UUV A;  4ZOH B;  4O95 A;  2PLI A;  3W8Z A;  1FIQ B;  1DIQ A;  4MLA A;  2Y4G A;  5AE1 A;  2P3H A;  2BVH A;  3NVW B;  1DZN A;  3AN1 A;  1E8G A;  5ADZ A;  2AXR A;  5AWV A;  3D2D A;  3HSU A;  3ETR B;  1RM6 B;  2E3T A;  5FXE A;  5AE2 A;  5I1W A;  1JRO A;  2VFR A;  3NVZ B;  2NQW A;  2VFU A;  2UUU A;  4JAY A;  3C0P A;  3I99 A;  1W1M A;  1MBB A;  3PQB A;  2BVF A;  4PVJ A;  2RK5 A;  3FW7 A;  3NRZ B;  2Y3R A;  3B9J B;  5AE3 A;  2GQT A;  2QKN A;  1FO4 A;  5G5G B;  3S1C A;  4HG0 A;  1W1R A;  3JS8 A;  3S1F A;  2W3S A;  3GSY A;  4PZF A;  1QLU A;  1UXY A;  3DQ0 A;  4EC3 A;  3POP A;  1VDV A;  3LLB A;  1AHV A;  5I1V A; 
#chains in the Genus database with same CATH homology
 1N60 C;  2VAO A;  4DNS A;  4OAL A;  1FFV C;  5L6F A;  1ZR6 A;  4BC7 A;  3W8W A;  3KJM A;  1WVE A;  5L6G A;  2MBR A;  2OAI A;  2W54 A;  5FXF A;  2I0K A;  1VAO A;  2R2Z A;  1WYG A;  4PVK A;  1W1J A;  4BC9 A;  1N63 C;  2YVS A;  1N5X A;  4XLO A;  3FW8 A;  3AM9 A;  3NS1 B;  4PVH A;  3FWA A;  2W55 A;  3VTE A;  4BBY A;  3D2J A;  1F0X A;  2Q85 A;  4PWC A;  1MBT A;  1W1O A;  3S1D A;  3SR6 B;  3TSJ A;  3NVV B;  1AHU A;  5D79 A;  1E8F A;  3W8X A;  4PYT A;  5FXP A;  1JRP A;  4ML8 A;  3S1E A;  3D2H A;  2W3R A;  3EUB 3;  2GQU A;  1N62 C;  2VFV A;  2IPI A;  1N61 C;  2P4P A;  4BCA A;  5HQX A;  1AHZ A;  1WVF A;  2PLS A;  2Y08 A;  3LAE A;  2QPM A;  2Q4W A;  4JB1 A;  3TSH A;  5HHZ A;  2Y3S A;  1T3Q C;  3HRD C;  2WDW A;  4UD8 A;  3FW9 A;  3RJ8 A;  2VFT A;  2VFS A;  1QLT A;  1N5W C;  3TX1 A;  5HMR A;  3PM9 A;  1FFU C;  3AMZ A;  2O3G A;  2P13 A;  1W1Q A;  1W1L A;  1ZXI C;  2EXR A;  1DII A;  1W1K A;  1V97 A;  1I19 A;  3RJA A;  1E0Y A;  3NVY B;  1E8H A;  1SB3 B;  2R8D A;  1HSK A;  4PVE A;  2BVG A;  3BW7 A;  5FXD A;  3DED A;  4PWB A;  5G5H B;  1W1S A;  5K8E A;  2UUV A;  4ZOH B;  4O95 A;  2PLI A;  3W8Z A;  1FIQ B;  1DIQ A;  4MLA A;  2Y4G A;  5AE1 A;  2P3H A;  2BVH A;  3NVW B;  1DZN A;  3AN1 A;  1E8G A;  5ADZ A;  2AXR A;  5AWV A;  3D2D A;  3HSU A;  3ETR B;  1RM6 B;  2E3T A;  5FXE A;  5AE2 A;  5I1W A;  1JRO A;  2VFR A;  3NVZ B;  2NQW A;  2VFU A;  2UUU A;  4JAY A;  3C0P A;  3I99 A;  1W1M A;  1MBB A;  3PQB A;  2BVF A;  4PVJ A;  2RK5 A;  3FW7 A;  3NRZ B;  2Y3R A;  3B9J B;  5AE3 A;  2GQT A;  2QKN A;  1FO4 A;  5G5G B;  3S1C A;  4HG0 A;  1W1R A;  3JS8 A;  3S1F A;  2W3S A;  3GSY A;  4PZF A;  1QLU A;  1UXY A;  3DQ0 A;  4EC3 A;  3POP A;  1VDV A;  3LLB A;  1AHV A;  5I1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...