5HMRA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
492
structure length
447
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 146
structure length 447
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hmrA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hmrA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hmrA03
1W1LA 2W54A 2BVHA 3W8ZA 1AHVA 3NVZB 1QLTA 4ZOHB 2E3TA 3AMZA 1E8HA 4ML8A 4PVEA 2W55A 3DEDA 4O95A 4PVJA 1N62C 5FXDA 2I0KA 1I19A 2VAOA 1JRPA 4XLOA 1T3QC 3AN1A 3D2JA 4BC9A 4JB1A 2QPMA 3NVWB 4PZFA 5FXFA 2Q85A 3NVYB 5AE3A 2O3GA 3SR6B 1E0YA 2AXRA 2W3SA 2P3HA 4HG0A 4BC7A 4JAYA 1W1MA 1WYGA 3S1EA 1N5XA 4PWBA 5FXPA 5D79A 2VFVA 4DNSA 2PLIA 1FO4A 1WVEA 4PWCA 2OAIA 2NQWA 3NVVB 1UXYA 5ADZA 3LLBA 1HSKA 5HMRA 5G5HB 1ZR6A 2EXRA 5HQXA 1N63C 3DQ0A 3FW9A 3W8WA 3B9JB 4BCAA 1N5WC 3TSHA 2RK5A 1E8FA 3JS8A 2PLSA 2R2ZA 4OALA 5G5GB 2QKNA 1QLUA 2BVGA 2Q4WA 3LAEA 4UD8A 3TSJA 2P13A 1V97A 3FW8A 5FXEA 1WVFA 2VFUA 2YVSA 1W1QA 4PVHA 4EC3A 3GSYA 1W1JA 3AM9A 1DZNA 1W1OA 5AE2A 1MBTA 1AHUA 3FW7A 3PM9A 3C0PA 2GQTA 1N61C 1JROA 3FWAA 3HRDC 3VTEA 1W1RA 3D2HA 3BW7A 3W8XA 1VDVA 4BBYA 2R8DA 3KJMA 3S1FA 1FIQB 1SB3B 3D2DA 1N60C 1VAOA 4PVKA 3EUB3 4PYTA 2MBRA 1W1SA 1FFVC 2VFRA 4MLAA 1FFUC 1F0XA 3ETRB 3I99A 1E8GA 2VFTA 2W3RA 1W1KA 1ZXIC 3NRZB 5AE1A 3NS1B 5HHZA 1RM6B 1AHZA 1DIQA 1MBBA 1DIIA 2P4PA 3TX1A 2VFSA 2GQUA 3S1DA 2BVFA 3S1CA
chains in the Genus database with same CATH superfamily
2Y3RA 1W1LA 2W54A 2BVHA 3W8ZA 1AHVA 3NVZB 1QLTA 4ZOHB 2E3TA 3AMZA 1E8HA 4ML8A 3EJBB 4PVEA 2W55A 3DEDA 4O95A 4PVJA 1N62C 5FXDA 3PQBA 2I0KA 1I19A 2VAOA 1JRPA 2Y08A 4XLOA 1T3QC 3AN1A 3D2JA 4BC9A 4JB1A 2QPMA 2WDWA 3NVWB 4PZFA 5I1WA 5FXFA 2Q85A 3NVYB 5AE3A 2O3GA 3SR6B 3RJAA 2Y4GA 1E0YA 2AXRA 2UUVA 2UUUA 5I1VA 2W3SA 2IPIA 2P3HA 4HG0A 4BC7A 4JAYA 1W1MA 1WYGA 3S1EA 1N5XA 4PWBA 5FXPA 5D79A 2VFVA 4DNSA 2PLIA 1FO4A 1WVEA 4PWCA 2OAIA 2NQWA 3NVVB 1UXYA 5ADZA 3LLBA 1HSKA 5HMRA 5L6FA 5G5HB 1ZR6A 2EXRA 5HQXA 1N63C 3EJDB 3DQ0A 3FW9A 3W8WA 3B9JB 4BCAA 1N5WC 3TSHA 2RK5A 1E8FA 3JS8A 2PLSA 2R2ZA 4OALA 5G5GB 2QKNA 1QLUA 2BVGA 2Q4WA 3HSUA 3LAEA 4UD8A 3TSJA 2P13A 1V97A 3FW8A 5FXEA 1WVFA 2VFUA 2YVSA 1W1QA 4PVHA 3POPA 4EC3A 3GSYA 1W1JA 3AM9A 1DZNA 1W1OA 5AE2A 1MBTA 1AHUA 3FW7A 5L6GA 3PM9A 3C0PA 2GQTA 1N61C 1JROA 3FWAA 3HRDC 3VTEA 1W1RA 3D2HA 3BW7A 3W8XA 1VDVA 4BBYA 2R8DA 5AWVA 3RJ8A 3KJMA 3S1FA 1FIQB 1SB3B 3D2DA 1N60C 1VAOA 4PVKA 3EUB3 4PYTA 2MBRA 1W1SA 1FFVC 5K8EA 2VFRA 4MLAA 1FFUC 1F0XA 3ETRB 3I99A 2Y3SA 1E8GA 2VFTA 2W3RA 1W1KA 1ZXIC 3EJEB 3NRZB 5AE1A 3NS1B 5HHZA 1RM6B 1AHZA 1DIQA 1MBBA 1DIIA 2P4PA 3TX1A 2VFSA 2GQUA 3S1DA 2BVFA 3S1CA
chains in the Genus database with same CATH topology
2Y3RA 1W1LA 2W54A 2BVHA 3W8ZA 1AHVA 3NVZB 1QLTA 4ZOHB 2E3TA 3AMZA 1E8HA 4ML8A 4PVEA 2W55A 3DEDA 4O95A 4PVJA 1N62C 5FXDA 3PQBA 2I0KA 1I19A 2VAOA 1JRPA 2Y08A 4XLOA 1T3QC 3AN1A 3D2JA 4BC9A 4JB1A 2QPMA 2WDWA 3NVWB 4PZFA 5I1WA 5FXFA 2Q85A 3NVYB 5AE3A 2O3GA 3SR6B 3RJAA 2Y4GA 1E0YA 2AXRA 2UUVA 2UUUA 5I1VA 2W3SA 2IPIA 2P3HA 4HG0A 4BC7A 4JAYA 1W1MA 1WYGA 3S1EA 1N5XA 4PWBA 5FXPA 5D79A 2VFVA 4DNSA 2PLIA 1FO4A 1WVEA 4PWCA 2OAIA 2NQWA 3NVVB 1UXYA 5ADZA 3LLBA 1HSKA 5HMRA 5L6FA 5G5HB 1ZR6A 2EXRA 5HQXA 1N63C 3DQ0A 3FW9A 3W8WA 3B9JB 4BCAA 1N5WC 3TSHA 2RK5A 1E8FA 3JS8A 2PLSA 2R2ZA 4OALA 5G5GB 2QKNA 1QLUA 2BVGA 2Q4WA 3HSUA 3LAEA 4UD8A 3TSJA 2P13A 1V97A 3FW8A 5FXEA 1WVFA 2VFUA 2YVSA 1W1QA 4PVHA 3POPA 4EC3A 3GSYA 1W1JA 3AM9A 1DZNA 1W1OA 5AE2A 1MBTA 1AHUA 3FW7A 5L6GA 3PM9A 3C0PA 2GQTA 1N61C 1JROA 3FWAA 3HRDC 3VTEA 1W1RA 3D2HA 3BW7A 3W8XA 1VDVA 4BBYA 2R8DA 5AWVA 3RJ8A 3KJMA 3S1FA 1FIQB 1SB3B 3D2DA 1N60C 1VAOA 4PVKA 3EUB3 4PYTA 2MBRA 1W1SA 1FFVC 5K8EA 2VFRA 4MLAA 1FFUC 1F0XA 3ETRB 3I99A 2Y3SA 1E8GA 2VFTA 2W3RA 1W1KA 1ZXIC 3NRZB 5AE1A 3NS1B 5HHZA 1RM6B 1AHZA 1DIQA 1MBBA 1DIIA 2P4PA 3TX1A 2VFSA 2GQUA 3S1DA 2BVFA 3S1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1L A;  2W54 A;  2BVH A;  3W8Z A;  1AHV A;  3NVZ B;  1QLT A;  4ZOH B;  2E3T A;  3AMZ A;  1E8H A;  4ML8 A;  4PVE A;  2W55 A;  3DED A;  4O95 A;  4PVJ A;  1N62 C;  5FXD A;  2I0K A;  1I19 A;  2VAO A;  1JRP A;  4XLO A;  1T3Q C;  3AN1 A;  3D2J A;  4BC9 A;  4JB1 A;  2QPM A;  3NVW B;  4PZF A;  5FXF A;  2Q85 A;  3NVY B;  5AE3 A;  2O3G A;  3SR6 B;  1E0Y A;  2AXR A;  2W3S A;  2P3H A;  4HG0 A;  4BC7 A;  4JAY A;  1W1M A;  1WYG A;  3S1E A;  1N5X A;  4PWB A;  5FXP A;  5D79 A;  2VFV A;  4DNS A;  2PLI A;  1FO4 A;  1WVE A;  4PWC A;  2OAI A;  2NQW A;  3NVV B;  1UXY A;  5ADZ A;  3LLB A;  1HSK A;  5HMR A;  5G5H B;  1ZR6 A;  2EXR A;  5HQX A;  1N63 C;  3DQ0 A;  3FW9 A;  3W8W A;  3B9J B;  4BCA A;  1N5W C;  3TSH A;  2RK5 A;  1E8F A;  3JS8 A;  2PLS A;  2R2Z A;  4OAL A;  5G5G B;  2QKN A;  1QLU A;  2BVG A;  2Q4W A;  3LAE A;  4UD8 A;  3TSJ A;  2P13 A;  1V97 A;  3FW8 A;  5FXE A;  1WVF A;  2VFU A;  2YVS A;  1W1Q A;  4PVH A;  4EC3 A;  3GSY A;  1W1J A;  3AM9 A;  1DZN A;  1W1O A;  5AE2 A;  1MBT A;  1AHU A;  3FW7 A;  3PM9 A;  3C0P A;  2GQT A;  1N61 C;  1JRO A;  3FWA A;  3HRD C;  3VTE A;  1W1R A;  3D2H A;  3BW7 A;  3W8X A;  1VDV A;  4BBY A;  2R8D A;  3KJM A;  3S1F A;  1FIQ B;  1SB3 B;  3D2D A;  1N60 C;  1VAO A;  4PVK A;  3EUB 3;  4PYT A;  2MBR A;  1W1S A;  1FFV C;  2VFR A;  4MLA A;  1FFU C;  1F0X A;  3ETR B;  3I99 A;  1E8G A;  2VFT A;  2W3R A;  1W1K A;  1ZXI C;  3NRZ B;  5AE1 A;  3NS1 B;  5HHZ A;  1RM6 B;  1AHZ A;  1DIQ A;  1MBB A;  1DII A;  2P4P A;  3TX1 A;  2VFS A;  2GQU A;  3S1D A;  2BVF A;  3S1C A; 
#chains in the Genus database with same CATH topology
 2Y3R A;  1W1L A;  2W54 A;  2BVH A;  3W8Z A;  1AHV A;  3NVZ B;  1QLT A;  4ZOH B;  2E3T A;  3AMZ A;  1E8H A;  4ML8 A;  3EJB B;  4PVE A;  2W55 A;  3DED A;  4O95 A;  4PVJ A;  1N62 C;  5FXD A;  3PQB A;  2I0K A;  1I19 A;  2VAO A;  1JRP A;  2Y08 A;  4XLO A;  1T3Q C;  3AN1 A;  3D2J A;  4BC9 A;  4JB1 A;  2QPM A;  2WDW A;  3NVW B;  4PZF A;  5I1W A;  5FXF A;  2Q85 A;  3NVY B;  5AE3 A;  2O3G A;  3SR6 B;  3RJA A;  2Y4G A;  1E0Y A;  2AXR A;  2UUV A;  2UUU A;  5I1V A;  2W3S A;  2IPI A;  2P3H A;  4HG0 A;  4BC7 A;  4JAY A;  1W1M A;  1WYG A;  3S1E A;  1N5X A;  4PWB A;  5FXP A;  5D79 A;  2VFV A;  4DNS A;  2PLI A;  1FO4 A;  1WVE A;  4PWC A;  2OAI A;  2NQW A;  3NVV B;  1UXY A;  5ADZ A;  3LLB A;  1HSK A;  5HMR A;  5L6F A;  5G5H B;  1ZR6 A;  2EXR A;  5HQX A;  1N63 C;  3EJD B;  3DQ0 A;  3FW9 A;  3W8W A;  3B9J B;  4BCA A;  1N5W C;  3TSH A;  2RK5 A;  1E8F A;  3JS8 A;  2PLS A;  2R2Z A;  4OAL A;  5G5G B;  2QKN A;  1QLU A;  2BVG A;  2Q4W A;  3HSU A;  3LAE A;  4UD8 A;  3TSJ A;  2P13 A;  1V97 A;  3FW8 A;  5FXE A;  1WVF A;  2VFU A;  2YVS A;  1W1Q A;  4PVH A;  3POP A;  4EC3 A;  3GSY A;  1W1J A;  3AM9 A;  1DZN A;  1W1O A;  5AE2 A;  1MBT A;  1AHU A;  3FW7 A;  5L6G A;  3PM9 A;  3C0P A;  2GQT A;  1N61 C;  1JRO A;  3FWA A;  3HRD C;  3VTE A;  1W1R A;  3D2H A;  3BW7 A;  3W8X A;  1VDV A;  4BBY A;  2R8D A;  5AWV A;  3RJ8 A;  3KJM A;  3S1F A;  1FIQ B;  1SB3 B;  3D2D A;  1N60 C;  1VAO A;  4PVK A;  3EUB 3;  4PYT A;  2MBR A;  1W1S A;  1FFV C;  5K8E A;  2VFR A;  4MLA A;  1FFU C;  1F0X A;  3ETR B;  3I99 A;  2Y3S A;  1E8G A;  2VFT A;  2W3R A;  1W1K A;  1ZXI C;  3EJE B;  3NRZ B;  5AE1 A;  3NS1 B;  5HHZ A;  1RM6 B;  1AHZ A;  1DIQ A;  1MBB A;  1DII A;  2P4P A;  3TX1 A;  2VFS A;  2GQU A;  3S1D A;  2BVF A;  3S1C A; 
#chains in the Genus database with same CATH homology
 2Y3R A;  1W1L A;  2W54 A;  2BVH A;  3W8Z A;  1AHV A;  3NVZ B;  1QLT A;  4ZOH B;  2E3T A;  3AMZ A;  1E8H A;  4ML8 A;  4PVE A;  2W55 A;  3DED A;  4O95 A;  4PVJ A;  1N62 C;  5FXD A;  3PQB A;  2I0K A;  1I19 A;  2VAO A;  1JRP A;  2Y08 A;  4XLO A;  1T3Q C;  3AN1 A;  3D2J A;  4BC9 A;  4JB1 A;  2QPM A;  2WDW A;  3NVW B;  4PZF A;  5I1W A;  5FXF A;  2Q85 A;  3NVY B;  5AE3 A;  2O3G A;  3SR6 B;  3RJA A;  2Y4G A;  1E0Y A;  2AXR A;  2UUV A;  2UUU A;  5I1V A;  2W3S A;  2IPI A;  2P3H A;  4HG0 A;  4BC7 A;  4JAY A;  1W1M A;  1WYG A;  3S1E A;  1N5X A;  4PWB A;  5FXP A;  5D79 A;  2VFV A;  4DNS A;  2PLI A;  1FO4 A;  1WVE A;  4PWC A;  2OAI A;  2NQW A;  3NVV B;  1UXY A;  5ADZ A;  3LLB A;  1HSK A;  5HMR A;  5L6F A;  5G5H B;  1ZR6 A;  2EXR A;  5HQX A;  1N63 C;  3DQ0 A;  3FW9 A;  3W8W A;  3B9J B;  4BCA A;  1N5W C;  3TSH A;  2RK5 A;  1E8F A;  3JS8 A;  2PLS A;  2R2Z A;  4OAL A;  5G5G B;  2QKN A;  1QLU A;  2BVG A;  2Q4W A;  3HSU A;  3LAE A;  4UD8 A;  3TSJ A;  2P13 A;  1V97 A;  3FW8 A;  5FXE A;  1WVF A;  2VFU A;  2YVS A;  1W1Q A;  4PVH A;  3POP A;  4EC3 A;  3GSY A;  1W1J A;  3AM9 A;  1DZN A;  1W1O A;  5AE2 A;  1MBT A;  1AHU A;  3FW7 A;  5L6G A;  3PM9 A;  3C0P A;  2GQT A;  1N61 C;  1JRO A;  3FWA A;  3HRD C;  3VTE A;  1W1R A;  3D2H A;  3BW7 A;  3W8X A;  1VDV A;  4BBY A;  2R8D A;  5AWV A;  3RJ8 A;  3KJM A;  3S1F A;  1FIQ B;  1SB3 B;  3D2D A;  1N60 C;  1VAO A;  4PVK A;  3EUB 3;  4PYT A;  2MBR A;  1W1S A;  1FFV C;  5K8E A;  2VFR A;  4MLA A;  1FFU C;  1F0X A;  3ETR B;  3I99 A;  2Y3S A;  1E8G A;  2VFT A;  2W3R A;  1W1K A;  1ZXI C;  3NRZ B;  5AE1 A;  3NS1 B;  5HHZ A;  1RM6 B;  1AHZ A;  1DIQ A;  1MBB A;  1DII A;  2P4P A;  3TX1 A;  2VFS A;  2GQU A;  3S1D A;  2BVF A;  3S1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...