5HMRA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
492
structure length
447
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
total genus 146
structure length 447
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hmrA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hmrA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hmrA03
1W1OA 1MBTA 1N5XA 3BW7A 2AXRA 1E0YA 2Q4WA 1WVEA 3C0PA 3FW8A 1N63C 1JRPA 3DQ0A 3FWAA 3TSJA 4JAYA 2QKNA 3D2HA 3NVYB 1N60C 1FFUC 1F0XA 4PYTA 1FO4A 1JROA 1HSKA 1W1SA 2VFRA 2VFVA 3ETRB 2W55A 1QLUA 3B9JB 4PVEA 5D79A 3D2JA 2GQTA 5FXEA 3AM9A 4DNSA 1I19A 2VFSA 3W8WA 3S1FA 3TX1A 5HHZA 1RM6B 2BVHA 3JS8A 1W1LA 3D2DA 2P13A 4HG0A 5HMRA 1DIIA 1N62C 2YVSA 3FW7A 1AHVA 1T3QC 3AMZA 1FFVC 3LLBA 4UD8A 4PVHA 5G5HB 3W8XA 2P4PA 4BC9A 3NVVB 2W3SA 3EUB3 3S1CA 2R2ZA 2PLIA 5ADZA 4BC7A 1SB3B 1W1JA 1W1MA 1UXYA 3TSHA 3S1DA 1DIQA 4PWBA 2VFUA 3NVZB 2Q85A 5FXDA 2EXRA 2OAIA 4BCAA 3PM9A 4BBYA 2RK5A 2W3RA 4XLOA 1MBBA 3AN1A 5AE2A 5FXPA 1VAOA 2I0KA 4O95A 1E8GA 1FIQB 2P3HA 2R8DA 2BVGA 5HQXA 3NS1B 3VTEA 1ZR6A 5AE3A 3S1EA 4JB1A 1E8FA 4OALA 4PZFA 1W1KA 5FXFA 3W8ZA 4EC3A 1WVFA 4PVKA 3I99A 1V97A 3DEDA 1DZNA 2MBRA 4PWCA 4ZOHB 3LAEA 1ZXIC 2GQUA 1AHZA 5G5GB 1N5WC 2O3GA 3GSYA 4ML8A 1WYGA 2VFTA 3KJMA 3HRDC 2E3TA 2W54A 3SR6B 1W1QA 1W1RA 4MLAA 3NRZB 2VAOA 1QLTA 3FW9A 1N61C 2BVFA 1VDVA 2PLSA 2QPMA 1E8HA 1AHUA 2NQWA 5AE1A 3NVWB 4PVJA
chains in the Genus database with same CATH superfamily
2UUUA 3RJAA 1W1OA 5L6FA 1MBTA 1N5XA 3BW7A 2AXRA 1E0YA 2Q4WA 1WVEA 3C0PA 3FW8A 1N63C 1JRPA 3DQ0A 3FWAA 3TSJA 4JAYA 2QKNA 3D2HA 3NVYB 1N60C 1FFUC 3HSUA 1F0XA 4PYTA 1FO4A 1JROA 1HSKA 1W1SA 2VFRA 2VFVA 3ETRB 5L6GA 2W55A 1QLUA 3B9JB 4PVEA 5D79A 3D2JA 2GQTA 5FXEA 3AM9A 4DNSA 1I19A 2VFSA 3W8WA 3S1FA 3TX1A 3RJ8A 5HHZA 1RM6B 2UUVA 2BVHA 3JS8A 1W1LA 3D2DA 5I1VA 5I1WA 2P13A 4HG0A 5HMRA 1DIIA 2Y3SA 1N62C 2YVSA 3FW7A 1AHVA 3POPA 1T3QC 3AMZA 1FFVC 3LLBA 4UD8A 4PVHA 5G5HB 3W8XA 2P4PA 4BC9A 3NVVB 2W3SA 3EUB3 3S1CA 2R2ZA 2PLIA 5ADZA 4BC7A 1SB3B 1W1JA 1W1MA 1UXYA 3TSHA 3S1DA 1DIQA 4PWBA 2Y4GA 2VFUA 3NVZB 2Q85A 5FXDA 2EXRA 2OAIA 5AWVA 4BCAA 3PM9A 4BBYA 2RK5A 2W3RA 4XLOA 1MBBA 3AN1A 5AE2A 5FXPA 1VAOA 2I0KA 4O95A 1E8GA 1FIQB 2P3HA 2R8DA 2BVGA 3EJDB 5HQXA 3NS1B 3VTEA 2IPIA 1ZR6A 5AE3A 3S1EA 4JB1A 5K8EA 1E8FA 4OALA 4PZFA 1W1KA 5FXFA 3W8ZA 4EC3A 1WVFA 4PVKA 3I99A 1V97A 3DEDA 1DZNA 3EJEB 2MBRA 4PWCA 4ZOHB 3LAEA 1ZXIC 2GQUA 1AHZA 5G5GB 2WDWA 1N5WC 3EJBB 3GSYA 2O3GA 4ML8A 1WYGA 2VFTA 3KJMA 3HRDC 2E3TA 2W54A 3SR6B 1W1QA 1W1RA 4MLAA 2Y3RA 3NRZB 2VAOA 1QLTA 3FW9A 1N61C 2BVFA 1VDVA 2PLSA 3PQBA 2QPMA 1E8HA 2Y08A 1AHUA 2NQWA 5AE1A 3NVWB 4PVJA
chains in the Genus database with same CATH topology
2UUUA 3RJAA 1W1OA 5L6FA 1MBTA 1N5XA 3BW7A 2AXRA 1E0YA 2Q4WA 1WVEA 3C0PA 3FW8A 1N63C 1JRPA 3DQ0A 3FWAA 3TSJA 4JAYA 2QKNA 3D2HA 3NVYB 1N60C 1FFUC 3HSUA 1F0XA 4PYTA 1FO4A 1JROA 1HSKA 1W1SA 2VFRA 2VFVA 3ETRB 5L6GA 2W55A 1QLUA 3B9JB 4PVEA 5D79A 3D2JA 2GQTA 5FXEA 3AM9A 4DNSA 1I19A 2VFSA 3W8WA 3S1FA 3TX1A 3RJ8A 5HHZA 1RM6B 2UUVA 2BVHA 3JS8A 1W1LA 3D2DA 5I1VA 5I1WA 2P13A 4HG0A 5HMRA 1DIIA 2Y3SA 1N62C 2YVSA 3FW7A 1AHVA 3POPA 1T3QC 3AMZA 1FFVC 3LLBA 4UD8A 4PVHA 5G5HB 3W8XA 2P4PA 4BC9A 3NVVB 2W3SA 3EUB3 3S1CA 2R2ZA 2PLIA 5ADZA 4BC7A 1SB3B 1W1JA 1W1MA 1UXYA 3TSHA 3S1DA 1DIQA 4PWBA 2Y4GA 2VFUA 3NVZB 2Q85A 5FXDA 2EXRA 2OAIA 5AWVA 4BCAA 3PM9A 4BBYA 2RK5A 2W3RA 4XLOA 1MBBA 3AN1A 5AE2A 5FXPA 1VAOA 2I0KA 4O95A 1E8GA 1FIQB 2P3HA 2R8DA 2BVGA 5HQXA 3NS1B 3VTEA 2IPIA 1ZR6A 5AE3A 3S1EA 4JB1A 5K8EA 1E8FA 4OALA 4PZFA 1W1KA 5FXFA 3W8ZA 4EC3A 1WVFA 4PVKA 3I99A 1V97A 3DEDA 1DZNA 2MBRA 4PWCA 4ZOHB 3LAEA 1ZXIC 2GQUA 1AHZA 5G5GB 2WDWA 1N5WC 2O3GA 3GSYA 4ML8A 1WYGA 2VFTA 3KJMA 3HRDC 2E3TA 2W54A 3SR6B 1W1QA 1W1RA 4MLAA 2Y3RA 3NRZB 2VAOA 1QLTA 3FW9A 1N61C 2BVFA 1VDVA 2PLSA 3PQBA 2QPMA 1E8HA 2Y08A 1AHUA 2NQWA 5AE1A 3NVWB 4PVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1O A;  1MBT A;  1N5X A;  3BW7 A;  2AXR A;  1E0Y A;  2Q4W A;  1WVE A;  3C0P A;  3FW8 A;  1N63 C;  1JRP A;  3DQ0 A;  3FWA A;  3TSJ A;  4JAY A;  2QKN A;  3D2H A;  3NVY B;  1N60 C;  1FFU C;  1F0X A;  4PYT A;  1FO4 A;  1JRO A;  1HSK A;  1W1S A;  2VFR A;  2VFV A;  3ETR B;  2W55 A;  1QLU A;  3B9J B;  4PVE A;  5D79 A;  3D2J A;  2GQT A;  5FXE A;  3AM9 A;  4DNS A;  1I19 A;  2VFS A;  3W8W A;  3S1F A;  3TX1 A;  5HHZ A;  1RM6 B;  2BVH A;  3JS8 A;  1W1L A;  3D2D A;  2P13 A;  4HG0 A;  5HMR A;  1DII A;  1N62 C;  2YVS A;  3FW7 A;  1AHV A;  1T3Q C;  3AMZ A;  1FFV C;  3LLB A;  4UD8 A;  4PVH A;  5G5H B;  3W8X A;  2P4P A;  4BC9 A;  3NVV B;  2W3S A;  3EUB 3;  3S1C A;  2R2Z A;  2PLI A;  5ADZ A;  4BC7 A;  1SB3 B;  1W1J A;  1W1M A;  1UXY A;  3TSH A;  3S1D A;  1DIQ A;  4PWB A;  2VFU A;  3NVZ B;  2Q85 A;  5FXD A;  2EXR A;  2OAI A;  4BCA A;  3PM9 A;  4BBY A;  2RK5 A;  2W3R A;  4XLO A;  1MBB A;  3AN1 A;  5AE2 A;  5FXP A;  1VAO A;  2I0K A;  4O95 A;  1E8G A;  1FIQ B;  2P3H A;  2R8D A;  2BVG A;  5HQX A;  3NS1 B;  3VTE A;  1ZR6 A;  5AE3 A;  3S1E A;  4JB1 A;  1E8F A;  4OAL A;  4PZF A;  1W1K A;  5FXF A;  3W8Z A;  4EC3 A;  1WVF A;  4PVK A;  3I99 A;  1V97 A;  3DED A;  1DZN A;  2MBR A;  4PWC A;  4ZOH B;  3LAE A;  1ZXI C;  2GQU A;  1AHZ A;  5G5G B;  1N5W C;  2O3G A;  3GSY A;  4ML8 A;  1WYG A;  2VFT A;  3KJM A;  3HRD C;  2E3T A;  2W54 A;  3SR6 B;  1W1Q A;  1W1R A;  4MLA A;  3NRZ B;  2VAO A;  1QLT A;  3FW9 A;  1N61 C;  2BVF A;  1VDV A;  2PLS A;  2QPM A;  1E8H A;  1AHU A;  2NQW A;  5AE1 A;  3NVW B;  4PVJ A; 
#chains in the Genus database with same CATH topology
 2UUU A;  3RJA A;  1W1O A;  5L6F A;  1MBT A;  1N5X A;  3BW7 A;  2AXR A;  1E0Y A;  2Q4W A;  1WVE A;  3C0P A;  3FW8 A;  1N63 C;  1JRP A;  3DQ0 A;  3FWA A;  3TSJ A;  4JAY A;  2QKN A;  3D2H A;  3NVY B;  1N60 C;  1FFU C;  3HSU A;  1F0X A;  4PYT A;  1FO4 A;  1JRO A;  1HSK A;  1W1S A;  2VFR A;  2VFV A;  3ETR B;  5L6G A;  2W55 A;  1QLU A;  3B9J B;  4PVE A;  5D79 A;  3D2J A;  2GQT A;  5FXE A;  3AM9 A;  4DNS A;  1I19 A;  2VFS A;  3W8W A;  3S1F A;  3TX1 A;  3RJ8 A;  5HHZ A;  1RM6 B;  2UUV A;  2BVH A;  3JS8 A;  1W1L A;  3D2D A;  5I1V A;  5I1W A;  2P13 A;  4HG0 A;  5HMR A;  1DII A;  2Y3S A;  1N62 C;  2YVS A;  3FW7 A;  1AHV A;  3POP A;  1T3Q C;  3AMZ A;  1FFV C;  3LLB A;  4UD8 A;  4PVH A;  5G5H B;  3W8X A;  2P4P A;  4BC9 A;  3NVV B;  2W3S A;  3EUB 3;  3S1C A;  2R2Z A;  2PLI A;  5ADZ A;  4BC7 A;  1SB3 B;  1W1J A;  1W1M A;  1UXY A;  3TSH A;  3S1D A;  1DIQ A;  4PWB A;  2Y4G A;  2VFU A;  3NVZ B;  2Q85 A;  5FXD A;  2EXR A;  2OAI A;  5AWV A;  4BCA A;  3PM9 A;  4BBY A;  2RK5 A;  2W3R A;  4XLO A;  1MBB A;  3AN1 A;  5AE2 A;  5FXP A;  1VAO A;  2I0K A;  4O95 A;  1E8G A;  1FIQ B;  2P3H A;  2R8D A;  2BVG A;  3EJD B;  5HQX A;  3NS1 B;  3VTE A;  2IPI A;  1ZR6 A;  5AE3 A;  3S1E A;  4JB1 A;  5K8E A;  1E8F A;  4OAL A;  4PZF A;  1W1K A;  5FXF A;  3W8Z A;  4EC3 A;  1WVF A;  4PVK A;  3I99 A;  1V97 A;  3DED A;  1DZN A;  3EJE B;  2MBR A;  4PWC A;  4ZOH B;  3LAE A;  1ZXI C;  2GQU A;  1AHZ A;  5G5G B;  2WDW A;  1N5W C;  3EJB B;  3GSY A;  2O3G A;  4ML8 A;  1WYG A;  2VFT A;  3KJM A;  3HRD C;  2E3T A;  2W54 A;  3SR6 B;  1W1Q A;  1W1R A;  4MLA A;  2Y3R A;  3NRZ B;  2VAO A;  1QLT A;  3FW9 A;  1N61 C;  2BVF A;  1VDV A;  2PLS A;  3PQB A;  2QPM A;  1E8H A;  2Y08 A;  1AHU A;  2NQW A;  5AE1 A;  3NVW B;  4PVJ A; 
#chains in the Genus database with same CATH homology
 2UUU A;  3RJA A;  1W1O A;  5L6F A;  1MBT A;  1N5X A;  3BW7 A;  2AXR A;  1E0Y A;  2Q4W A;  1WVE A;  3C0P A;  3FW8 A;  1N63 C;  1JRP A;  3DQ0 A;  3FWA A;  3TSJ A;  4JAY A;  2QKN A;  3D2H A;  3NVY B;  1N60 C;  1FFU C;  3HSU A;  1F0X A;  4PYT A;  1FO4 A;  1JRO A;  1HSK A;  1W1S A;  2VFR A;  2VFV A;  3ETR B;  5L6G A;  2W55 A;  1QLU A;  3B9J B;  4PVE A;  5D79 A;  3D2J A;  2GQT A;  5FXE A;  3AM9 A;  4DNS A;  1I19 A;  2VFS A;  3W8W A;  3S1F A;  3TX1 A;  3RJ8 A;  5HHZ A;  1RM6 B;  2UUV A;  2BVH A;  3JS8 A;  1W1L A;  3D2D A;  5I1V A;  5I1W A;  2P13 A;  4HG0 A;  5HMR A;  1DII A;  2Y3S A;  1N62 C;  2YVS A;  3FW7 A;  1AHV A;  3POP A;  1T3Q C;  3AMZ A;  1FFV C;  3LLB A;  4UD8 A;  4PVH A;  5G5H B;  3W8X A;  2P4P A;  4BC9 A;  3NVV B;  2W3S A;  3EUB 3;  3S1C A;  2R2Z A;  2PLI A;  5ADZ A;  4BC7 A;  1SB3 B;  1W1J A;  1W1M A;  1UXY A;  3TSH A;  3S1D A;  1DIQ A;  4PWB A;  2Y4G A;  2VFU A;  3NVZ B;  2Q85 A;  5FXD A;  2EXR A;  2OAI A;  5AWV A;  4BCA A;  3PM9 A;  4BBY A;  2RK5 A;  2W3R A;  4XLO A;  1MBB A;  3AN1 A;  5AE2 A;  5FXP A;  1VAO A;  2I0K A;  4O95 A;  1E8G A;  1FIQ B;  2P3H A;  2R8D A;  2BVG A;  5HQX A;  3NS1 B;  3VTE A;  2IPI A;  1ZR6 A;  5AE3 A;  3S1E A;  4JB1 A;  5K8E A;  1E8F A;  4OAL A;  4PZF A;  1W1K A;  5FXF A;  3W8Z A;  4EC3 A;  1WVF A;  4PVK A;  3I99 A;  1V97 A;  3DED A;  1DZN A;  2MBR A;  4PWC A;  4ZOH B;  3LAE A;  1ZXI C;  2GQU A;  1AHZ A;  5G5G B;  2WDW A;  1N5W C;  2O3G A;  3GSY A;  4ML8 A;  1WYG A;  2VFT A;  3KJM A;  3HRD C;  2E3T A;  2W54 A;  3SR6 B;  1W1Q A;  1W1R A;  4MLA A;  2Y3R A;  3NRZ B;  2VAO A;  1QLT A;  3FW9 A;  1N61 C;  2BVF A;  1VDV A;  2PLS A;  3PQB A;  2QPM A;  1E8H A;  2Y08 A;  1AHU A;  2NQW A;  5AE1 A;  3NVW B;  4PVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...