5HMRA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
492
structure length
447
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytokinin dehydrogenase 4
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 146
structure length 447
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hmrA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hmrA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hmrA03
3FW9A 3DEDA 4O95A 3VTEA 1I19A 1AHZA 2W3RA 3D2HA 1N61C 3AN1A 4BBYA 1WVEA 2QPMA 1DZNA 1VAOA 3JS8A 2BVGA 2P4PA 4PWBA 1E8GA 3FW8A 1FO4A 2W54A 4PVKA 3W8XA 3NVWB 2R8DA 2GQTA 2RK5A 4UD8A 3C0PA 2W3SA 4PVEA 4EC3A 5AE2A 2QKNA 3B9JB 2E3TA 4PZFA 4JB1A 3W8WA 5HMRA 1E8HA 1W1RA 1ZR6A 3EUB3 4MLAA 1WVFA 3ETRB 4OALA 5FXEA 2Q4WA 2GQUA 2P3HA 1N60C 1FIQB 1ZXIC 1QLTA 1FFUC 3NVYB 3KJMA 2MBRA 4BC9A 1V97A 1T3QC 3TSJA 1W1MA 3NS1B 3AMZA 4JAYA 5HHZA 2PLIA 1SB3B 3D2DA 5AE1A 1MBTA 1W1JA 3BW7A 4PYTA 3S1EA 5HQXA 2VFRA 2VFVA 1WYGA 2VFSA 3TSHA 4BC7A 3S1FA 2W55A 2PLSA 1QLUA 2VFTA 3SR6B 5AE3A 3W8ZA 1DIQA 1FFVC 3NVZB 2Q85A 5ADZA 3AM9A 5G5HB 3FW7A 3D2JA 1N63C 1W1KA 2AXRA 3PM9A 3TX1A 1W1SA 2R2ZA 1N5XA 4BCAA 1VDVA 4HG0A 1F0XA 2YVSA 1N5WC 3DQ0A 4ML8A 4ZOHB 3LLBA 1JROA 4DNSA 3NVVB 2OAIA 2P13A 1UXYA 4PVJA 1W1QA 3S1DA 1W1LA 5FXDA 1E8FA 2BVFA 3NRZB 3FWAA 1JRPA 1AHVA 1DIIA 5FXPA 2VFUA 3LAEA 5G5GB 1AHUA 1W1OA 3HRDC 1RM6B 1E0YA 1N62C 4XLOA 3I99A 1MBBA 2I0KA 2NQWA 4PWCA 5FXFA 3GSYA 2VAOA 5D79A 2EXRA 3S1CA 2O3GA 1HSKA 2BVHA 4PVHA
chains in the Genus database with same CATH superfamily
3FW9A 3DEDA 4O95A 3VTEA 1I19A 1AHZA 2W3RA 3D2HA 1N61C 3AN1A 4BBYA 1WVEA 2QPMA 1DZNA 5L6FA 1VAOA 3JS8A 2BVGA 2P4PA 4PWBA 1E8GA 3FW8A 3NVWB 2W54A 4PVKA 3W8XA 1FO4A 2R8DA 2UUUA 2GQTA 2RK5A 4UD8A 3C0PA 2W3SA 4PVEA 4EC3A 5AE2A 5I1WA 5L6GA 2QKNA 3B9JB 2E3TA 4PZFA 4JB1A 3W8WA 5HMRA 1E8HA 1W1RA 1ZR6A 3EUB3 4MLAA 1WVFA 3ETRB 4OALA 5FXEA 2Q4WA 2GQUA 2IPIA 3EJDB 1N60C 1FIQB 1ZXIC 1QLTA 1FFUC 3NVYB 3KJMA 2MBRA 4BC9A 1V97A 1T3QC 3TSJA 2Y08A 1W1MA 3HSUA 3NS1B 3AMZA 4JAYA 5AWVA 5HHZA 2PLIA 1SB3B 3D2DA 5AE1A 1MBTA 1W1JA 3BW7A 4PYTA 3S1EA 5K8EA 5HQXA 2VFRA 2VFVA 1WYGA 2VFSA 3TSHA 4BC7A 3PQBA 3S1FA 3RJAA 2W55A 2PLSA 1QLUA 2VFTA 3SR6B 5AE3A 3W8ZA 1DIQA 1FFVC 3NVZB 2Q85A 5ADZA 3AM9A 5G5HB 5I1VA 3FW7A 3D2JA 1N63C 1W1KA 2AXRA 3PM9A 2UUVA 3TX1A 1W1SA 2R2ZA 2Y3RA 1N5XA 4BCAA 1VDVA 4HG0A 1F0XA 3RJ8A 2YVSA 1N5WC 3DQ0A 3EJEB 4ML8A 4ZOHB 2P3HA 3LLBA 1JROA 3NVVB 4DNSA 2OAIA 2P13A 1UXYA 3EJBB 4PVJA 1W1QA 3S1DA 1W1LA 5FXDA 1E8FA 2BVFA 3NRZB 3FWAA 1JRPA 1AHVA 1DIIA 5FXPA 2VFUA 3LAEA 5G5GB 2Y3SA 1AHUA 1W1OA 3HRDC 2WDWA 1RM6B 2Y4GA 1E0YA 1N62C 4XLOA 3I99A 1MBBA 2I0KA 2NQWA 4PWCA 5FXFA 3GSYA 2VAOA 5D79A 2EXRA 3S1CA 3POPA 2O3GA 1HSKA 2BVHA 4PVHA
chains in the Genus database with same CATH topology
3FW9A 3DEDA 4O95A 3VTEA 1I19A 1AHZA 2W3RA 3D2HA 1N61C 3AN1A 4BBYA 1WVEA 2QPMA 1DZNA 5L6FA 1VAOA 3JS8A 2BVGA 2P4PA 4PWBA 1E8GA 3FW8A 1FO4A 2W54A 4PVKA 3W8XA 3NVWB 2R8DA 2UUUA 2GQTA 2RK5A 4UD8A 3C0PA 2W3SA 4PVEA 4EC3A 5AE2A 5I1WA 5L6GA 2QKNA 3B9JB 2E3TA 4PZFA 4JB1A 3W8WA 5HMRA 1E8HA 1W1RA 1ZR6A 3EUB3 4MLAA 1WVFA 3ETRB 4OALA 5FXEA 2Q4WA 2GQUA 2IPIA 2P3HA 1N60C 1FIQB 1ZXIC 1QLTA 1FFUC 3NVYB 3KJMA 2MBRA 4BC9A 1V97A 1T3QC 3TSJA 2Y08A 1W1MA 3HSUA 3NS1B 3AMZA 4JAYA 5AWVA 5HHZA 2PLIA 1SB3B 3D2DA 5AE1A 1MBTA 1W1JA 3BW7A 4PYTA 3S1EA 5K8EA 5HQXA 2VFRA 2VFVA 1WYGA 2VFSA 3TSHA 4BC7A 3PQBA 3S1FA 3RJAA 2W55A 2PLSA 1QLUA 2VFTA 3SR6B 5AE3A 3W8ZA 1DIQA 1FFVC 3NVZB 2Q85A 5ADZA 3AM9A 5G5HB 5I1VA 3FW7A 3D2JA 1N63C 1W1KA 2AXRA 3PM9A 2UUVA 3TX1A 1W1SA 2R2ZA 2Y3RA 1N5XA 4BCAA 1VDVA 4HG0A 1F0XA 3RJ8A 2YVSA 1N5WC 3DQ0A 4ML8A 4ZOHB 3LLBA 1JROA 4DNSA 3NVVB 2OAIA 2P13A 1UXYA 4PVJA 1W1QA 3S1DA 1W1LA 5FXDA 1E8FA 2BVFA 3NRZB 3FWAA 1JRPA 1AHVA 1DIIA 5FXPA 2VFUA 3LAEA 5G5GB 2Y3SA 1AHUA 1W1OA 3HRDC 2WDWA 1RM6B 2Y4GA 1E0YA 1N62C 4XLOA 3I99A 1MBBA 2I0KA 2NQWA 4PWCA 5FXFA 3GSYA 2VAOA 5D79A 2EXRA 3S1CA 3POPA 2O3GA 1HSKA 2BVHA 4PVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW9 A;  3DED A;  4O95 A;  3VTE A;  1I19 A;  1AHZ A;  2W3R A;  3D2H A;  1N61 C;  3AN1 A;  4BBY A;  1WVE A;  2QPM A;  1DZN A;  1VAO A;  3JS8 A;  2BVG A;  2P4P A;  4PWB A;  1E8G A;  3FW8 A;  1FO4 A;  2W54 A;  4PVK A;  3W8X A;  3NVW B;  2R8D A;  2GQT A;  2RK5 A;  4UD8 A;  3C0P A;  2W3S A;  4PVE A;  4EC3 A;  5AE2 A;  2QKN A;  3B9J B;  2E3T A;  4PZF A;  4JB1 A;  3W8W A;  5HMR A;  1E8H A;  1W1R A;  1ZR6 A;  3EUB 3;  4MLA A;  1WVF A;  3ETR B;  4OAL A;  5FXE A;  2Q4W A;  2GQU A;  2P3H A;  1N60 C;  1FIQ B;  1ZXI C;  1QLT A;  1FFU C;  3NVY B;  3KJM A;  2MBR A;  4BC9 A;  1V97 A;  1T3Q C;  3TSJ A;  1W1M A;  3NS1 B;  3AMZ A;  4JAY A;  5HHZ A;  2PLI A;  1SB3 B;  3D2D A;  5AE1 A;  1MBT A;  1W1J A;  3BW7 A;  4PYT A;  3S1E A;  5HQX A;  2VFR A;  2VFV A;  1WYG A;  2VFS A;  3TSH A;  4BC7 A;  3S1F A;  2W55 A;  2PLS A;  1QLU A;  2VFT A;  3SR6 B;  5AE3 A;  3W8Z A;  1DIQ A;  1FFV C;  3NVZ B;  2Q85 A;  5ADZ A;  3AM9 A;  5G5H B;  3FW7 A;  3D2J A;  1N63 C;  1W1K A;  2AXR A;  3PM9 A;  3TX1 A;  1W1S A;  2R2Z A;  1N5X A;  4BCA A;  1VDV A;  4HG0 A;  1F0X A;  2YVS A;  1N5W C;  3DQ0 A;  4ML8 A;  4ZOH B;  3LLB A;  1JRO A;  4DNS A;  3NVV B;  2OAI A;  2P13 A;  1UXY A;  4PVJ A;  1W1Q A;  3S1D A;  1W1L A;  5FXD A;  1E8F A;  2BVF A;  3NRZ B;  3FWA A;  1JRP A;  1AHV A;  1DII A;  5FXP A;  2VFU A;  3LAE A;  5G5G B;  1AHU A;  1W1O A;  3HRD C;  1RM6 B;  1E0Y A;  1N62 C;  4XLO A;  3I99 A;  1MBB A;  2I0K A;  2NQW A;  4PWC A;  5FXF A;  3GSY A;  2VAO A;  5D79 A;  2EXR A;  3S1C A;  2O3G A;  1HSK A;  2BVH A;  4PVH A; 
#chains in the Genus database with same CATH topology
 3FW9 A;  3DED A;  4O95 A;  3VTE A;  1I19 A;  1AHZ A;  2W3R A;  3D2H A;  1N61 C;  3AN1 A;  4BBY A;  1WVE A;  2QPM A;  1DZN A;  5L6F A;  1VAO A;  3JS8 A;  2BVG A;  2P4P A;  4PWB A;  1E8G A;  3FW8 A;  3NVW B;  2W54 A;  4PVK A;  3W8X A;  1FO4 A;  2R8D A;  2UUU A;  2GQT A;  2RK5 A;  4UD8 A;  3C0P A;  2W3S A;  4PVE A;  4EC3 A;  5AE2 A;  5I1W A;  5L6G A;  2QKN A;  3B9J B;  2E3T A;  4PZF A;  4JB1 A;  3W8W A;  5HMR A;  1E8H A;  1W1R A;  1ZR6 A;  3EUB 3;  4MLA A;  1WVF A;  3ETR B;  4OAL A;  5FXE A;  2Q4W A;  2GQU A;  2IPI A;  3EJD B;  1N60 C;  1FIQ B;  1ZXI C;  1QLT A;  1FFU C;  3NVY B;  3KJM A;  2MBR A;  4BC9 A;  1V97 A;  1T3Q C;  3TSJ A;  2Y08 A;  1W1M A;  3HSU A;  3NS1 B;  3AMZ A;  4JAY A;  5AWV A;  5HHZ A;  2PLI A;  1SB3 B;  3D2D A;  5AE1 A;  1MBT A;  1W1J A;  3BW7 A;  4PYT A;  3S1E A;  5K8E A;  5HQX A;  2VFR A;  2VFV A;  1WYG A;  2VFS A;  3TSH A;  4BC7 A;  3PQB A;  3S1F A;  3RJA A;  2W55 A;  2PLS A;  1QLU A;  2VFT A;  3SR6 B;  5AE3 A;  3W8Z A;  1DIQ A;  1FFV C;  3NVZ B;  2Q85 A;  5ADZ A;  3AM9 A;  5G5H B;  5I1V A;  3FW7 A;  3D2J A;  1N63 C;  1W1K A;  2AXR A;  3PM9 A;  2UUV A;  3TX1 A;  1W1S A;  2R2Z A;  2Y3R A;  1N5X A;  4BCA A;  1VDV A;  4HG0 A;  1F0X A;  3RJ8 A;  2YVS A;  1N5W C;  3DQ0 A;  3EJE B;  4ML8 A;  4ZOH B;  2P3H A;  3LLB A;  1JRO A;  3NVV B;  4DNS A;  2OAI A;  2P13 A;  1UXY A;  3EJB B;  4PVJ A;  1W1Q A;  3S1D A;  1W1L A;  5FXD A;  1E8F A;  2BVF A;  3NRZ B;  3FWA A;  1JRP A;  1AHV A;  1DII A;  5FXP A;  2VFU A;  3LAE A;  5G5G B;  2Y3S A;  1AHU A;  1W1O A;  3HRD C;  2WDW A;  1RM6 B;  2Y4G A;  1E0Y A;  1N62 C;  4XLO A;  3I99 A;  1MBB A;  2I0K A;  2NQW A;  4PWC A;  5FXF A;  3GSY A;  2VAO A;  5D79 A;  2EXR A;  3S1C A;  3POP A;  2O3G A;  1HSK A;  2BVH A;  4PVH A; 
#chains in the Genus database with same CATH homology
 3FW9 A;  3DED A;  4O95 A;  3VTE A;  1I19 A;  1AHZ A;  2W3R A;  3D2H A;  1N61 C;  3AN1 A;  4BBY A;  1WVE A;  2QPM A;  1DZN A;  5L6F A;  1VAO A;  3JS8 A;  2BVG A;  2P4P A;  4PWB A;  1E8G A;  3FW8 A;  1FO4 A;  2W54 A;  4PVK A;  3W8X A;  3NVW B;  2R8D A;  2UUU A;  2GQT A;  2RK5 A;  4UD8 A;  3C0P A;  2W3S A;  4PVE A;  4EC3 A;  5AE2 A;  5I1W A;  5L6G A;  2QKN A;  3B9J B;  2E3T A;  4PZF A;  4JB1 A;  3W8W A;  5HMR A;  1E8H A;  1W1R A;  1ZR6 A;  3EUB 3;  4MLA A;  1WVF A;  3ETR B;  4OAL A;  5FXE A;  2Q4W A;  2GQU A;  2IPI A;  2P3H A;  1N60 C;  1FIQ B;  1ZXI C;  1QLT A;  1FFU C;  3NVY B;  3KJM A;  2MBR A;  4BC9 A;  1V97 A;  1T3Q C;  3TSJ A;  2Y08 A;  1W1M A;  3HSU A;  3NS1 B;  3AMZ A;  4JAY A;  5AWV A;  5HHZ A;  2PLI A;  1SB3 B;  3D2D A;  5AE1 A;  1MBT A;  1W1J A;  3BW7 A;  4PYT A;  3S1E A;  5K8E A;  5HQX A;  2VFR A;  2VFV A;  1WYG A;  2VFS A;  3TSH A;  4BC7 A;  3PQB A;  3S1F A;  3RJA A;  2W55 A;  2PLS A;  1QLU A;  2VFT A;  3SR6 B;  5AE3 A;  3W8Z A;  1DIQ A;  1FFV C;  3NVZ B;  2Q85 A;  5ADZ A;  3AM9 A;  5G5H B;  5I1V A;  3FW7 A;  3D2J A;  1N63 C;  1W1K A;  2AXR A;  3PM9 A;  2UUV A;  3TX1 A;  1W1S A;  2R2Z A;  2Y3R A;  1N5X A;  4BCA A;  1VDV A;  4HG0 A;  1F0X A;  3RJ8 A;  2YVS A;  1N5W C;  3DQ0 A;  4ML8 A;  4ZOH B;  3LLB A;  1JRO A;  4DNS A;  3NVV B;  2OAI A;  2P13 A;  1UXY A;  4PVJ A;  1W1Q A;  3S1D A;  1W1L A;  5FXD A;  1E8F A;  2BVF A;  3NRZ B;  3FWA A;  1JRP A;  1AHV A;  1DII A;  5FXP A;  2VFU A;  3LAE A;  5G5G B;  2Y3S A;  1AHU A;  1W1O A;  3HRD C;  2WDW A;  1RM6 B;  2Y4G A;  1E0Y A;  1N62 C;  4XLO A;  3I99 A;  1MBB A;  2I0K A;  2NQW A;  4PWC A;  5FXF A;  3GSY A;  2VAO A;  5D79 A;  2EXR A;  3S1C A;  3POP A;  2O3G A;  1HSK A;  2BVH A;  4PVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...