5HMRA

Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (zmcko4) in complex with phenylurea inhibitor 3fmtdz
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
492
structure length
447
Chain Sequence
GGRLSVDASDIAEASRDFGGVARAEPMAVFHPRAAGDVAGLVGAAFRSARGFRVSARGHGHSISGQAQAAGGVVVDMSRVARALPVHSAALGGHYVDVWGGELWVDVLNWTLSHGGLAPRSWTDYLYLSVGGTLSNAGISGQAFHHGPQISNVYELDVVTGKGEVVTCSETENPDLFFGVLGGLGQFGIITRARIALERAPKRVRWIRALYSNFSEFTADQERLISLGRRFDYVEGFVVAASVLYCLEVTKNYDDETAGSVDQDVDTLLGELNFLPGTVFTTDLPYVDFLDRVHKAELKLRAKGMWEVPHPWLNLFVPASRIADFDRGVFRGVLGGPVLIYPMNKHKWDPRSSAVTPDEEVFYLVAFLRSALPGAPESLEALARQNQRILDFCAGTGIGAKQYLPGHKARHEWAEHFGAARWDRFARLKAEFDPRAILAAGQGIFRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel thidiazuron-derived inhibitors of cytokinin oxidase/dehydrogenase.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
molecule keywords Cytokinin dehydrogenase 4
total genus 146
structure length 447
sequence length 492
ec nomenclature ec 1.5.99.12: Cytokinin dehydrogenase.
pdb deposition date 2016-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF09265 Cytokin-bind Cytokinin dehydrogenase 1, FAD and cytokinin binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.43.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 2 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase, domain 2 5hmrA01
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5hmrA02
3.40.462.10 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 FAD-linked oxidases, C-terminal domain 5hmrA03
1V97A 1WVFA 4PZFA 3FWAA 1W1RA 4JB1A 1N61C 1FO4A 2VFUA 3B9JB 3W8WA 2I0KA 2NQWA 3KJMA 2W54A 1FFVC 3W8XA 1DIQA 2PLSA 2MBRA 1FFUC 3SR6B 5FXDA 1HSKA 5G5HB 4BC9A 1VAOA 3EUB3 3FW9A 1JRPA 3HRDC 1I19A 3LLBA 1E8FA 2R8DA 1N63C 4PVHA 4PVEA 1W1LA 2AXRA 4DNSA 3FW7A 2Q4WA 2QPMA 4ML8A 4XLOA 3W8ZA 2W3RA 1SB3B 1WYGA 3AMZA 3D2HA 2RK5A 4JAYA 4PVKA 3NRZB 2VAOA 3S1FA 3TSJA 1W1QA 2R2ZA 3BW7A 2BVGA 5HQXA 5FXEA 2W55A 4OALA 3S1DA 2GQTA 2P4PA 1W1KA 3DEDA 1DIIA 3I99A 3S1EA 1AHUA 2W3SA 4BBYA 2PLIA 3GSYA 1ZR6A 1W1OA 3D2JA 4BC7A 3TSHA 1WVEA 1F0XA 3C0PA 5AE2A 3NVVB 1AHZA 1AHVA 4PVJA 5HMRA 4EC3A 5FXPA 2EXRA 1N5WC 1W1SA 4ZOHB 2BVFA 3TX1A 2QKNA 4MLAA 1FIQB 2Q85A 3PM9A 5ADZA 1ZXIC 1JROA 2VFTA 3DQ0A 1N5XA 1W1MA 3D2DA 1N62C 2BVHA 5AE3A 3NVYB 5G5GB 2YVSA 1MBTA 4BCAA 1MBBA 1UXYA 5AE1A 4UD8A 2E3TA 2OAIA 4PWBA 1E8HA 1DZNA 3JS8A 2P13A 3VTEA 5HHZA 1E0YA 3ETRB 4PYTA 1N60C 1VDVA 3S1CA 2GQUA 1RM6B 2P3HA 4HG0A 5FXFA 1W1JA 3NVWB 2VFVA 1QLUA 1E8GA 1QLTA 5D79A 2VFSA 3NS1B 3FW8A 4PWCA 3NVZB 3AN1A 2O3GA 1T3QC 4O95A 3LAEA 3AM9A 2VFRA
chains in the Genus database with same CATH superfamily
1V97A 3RJAA 1WVFA 4PZFA 3FWAA 1W1RA 4JB1A 1N61C 1FO4A 2VFUA 3B9JB 3W8WA 2I0KA 2NQWA 3KJMA 2W54A 1FFVC 3W8XA 2UUVA 1DIQA 2UUUA 2Y3RA 2PLSA 2MBRA 1FFUC 3SR6B 5FXDA 1HSKA 5G5HB 5I1VA 4BC9A 1VAOA 3EUB3 3FW9A 1JRPA 3HRDC 1I19A 3LLBA 1E8FA 2R8DA 1N63C 4PVHA 4PVEA 3EJEB 1W1LA 2AXRA 4DNSA 3FW7A 2Q4WA 2QPMA 4ML8A 4XLOA 3W8ZA 2W3RA 1SB3B 1WYGA 3AMZA 3D2HA 2RK5A 4JAYA 5L6GA 4PVKA 3NRZB 2VAOA 3S1FA 3TSJA 1W1QA 2R2ZA 3BW7A 2BVGA 5AWVA 5HQXA 5FXEA 3PQBA 2W55A 4OALA 3S1DA 2GQTA 2P4PA 3RJ8A 1W1KA 3DEDA 1DIIA 3I99A 3S1EA 1AHUA 2W3SA 4BBYA 2PLIA 3GSYA 1ZR6A 1W1OA 3D2JA 4BC7A 3TSHA 1WVEA 1F0XA 3C0PA 5AE2A 3NVVB 1AHZA 1AHVA 4PVJA 5HMRA 4EC3A 5FXPA 2EXRA 1N5WC 1W1SA 4ZOHB 2BVFA 3TX1A 2QKNA 4MLAA 1FIQB 2Q85A 3PM9A 5ADZA 1ZXIC 1JROA 2VFTA 3DQ0A 1N5XA 1W1MA 3D2DA 1N62C 2BVHA 3NVYB 5AE3A 5G5GB 3EJBB 2YVSA 1MBTA 4BCAA 1MBBA 1UXYA 5K8EA 5I1WA 5AE1A 4UD8A 2E3TA 2OAIA 2Y4GA 2Y08A 4PWBA 1E8HA 1DZNA 3EJDB 3JS8A 2P13A 3VTEA 5HHZA 1E0YA 3ETRB 4PYTA 1N60C 1VDVA 2Y3SA 3S1CA 3POPA 2GQUA 1RM6B 2P3HA 4HG0A 3NVWB 1W1JA 5FXFA 2WDWA 2VFVA 1QLUA 3HSUA 1E8GA 1QLTA 5D79A 2VFSA 3NS1B 3FW8A 4PWCA 3NVZB 3AN1A 2IPIA 1T3QC 4O95A 2O3GA 3AM9A 3LAEA 5L6FA 2VFRA
chains in the Genus database with same CATH topology
1V97A 3RJAA 1WVFA 4PZFA 3FWAA 1W1RA 4JB1A 1N61C 1FO4A 2VFUA 3B9JB 3W8WA 2I0KA 2NQWA 3KJMA 2W54A 1FFVC 3W8XA 2UUVA 1DIQA 2UUUA 2Y3RA 2PLSA 2MBRA 1FFUC 3SR6B 5FXDA 1HSKA 5G5HB 5I1VA 4BC9A 1VAOA 3EUB3 3FW9A 1JRPA 3HRDC 1I19A 3LLBA 1E8FA 2R8DA 1N63C 4PVHA 4PVEA 1W1LA 2AXRA 4DNSA 3FW7A 2Q4WA 2QPMA 4ML8A 4XLOA 3W8ZA 2W3RA 1SB3B 1WYGA 3AMZA 3D2HA 2RK5A 4JAYA 5L6GA 4PVKA 3NRZB 2VAOA 3S1FA 3TSJA 1W1QA 2R2ZA 3BW7A 2BVGA 5AWVA 5HQXA 5FXEA 3PQBA 2W55A 4OALA 3S1DA 2GQTA 2P4PA 3RJ8A 1W1KA 3DEDA 1DIIA 3I99A 3S1EA 1AHUA 2W3SA 4BBYA 2PLIA 3GSYA 1ZR6A 1W1OA 3D2JA 4BC7A 3TSHA 1WVEA 1F0XA 3C0PA 5AE2A 3NVVB 1AHZA 1AHVA 4PVJA 5HMRA 4EC3A 5FXPA 2EXRA 1N5WC 1W1SA 4ZOHB 2BVFA 3TX1A 2QKNA 4MLAA 1FIQB 2Q85A 3PM9A 5ADZA 1ZXIC 1JROA 2VFTA 3DQ0A 1N5XA 1W1MA 3D2DA 1N62C 2BVHA 5AE3A 3NVYB 5G5GB 2YVSA 1MBTA 4BCAA 1MBBA 1UXYA 5K8EA 5I1WA 5AE1A 4UD8A 2E3TA 2OAIA 2Y4GA 2Y08A 4PWBA 1E8HA 1DZNA 3JS8A 2P13A 3VTEA 5HHZA 1E0YA 3ETRB 4PYTA 1N60C 1VDVA 2Y3SA 3S1CA 3POPA 2GQUA 1RM6B 2P3HA 4HG0A 5FXFA 1W1JA 3NVWB 2WDWA 2VFVA 1QLUA 3HSUA 1E8GA 1QLTA 5D79A 2VFSA 3NS1B 3FW8A 4PWCA 3NVZB 3AN1A 2IPIA 1T3QC 4O95A 2O3GA 3AM9A 3LAEA 5L6FA 2VFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V97 A;  1WVF A;  4PZF A;  3FWA A;  1W1R A;  4JB1 A;  1N61 C;  1FO4 A;  2VFU A;  3B9J B;  3W8W A;  2I0K A;  2NQW A;  3KJM A;  2W54 A;  1FFV C;  3W8X A;  1DIQ A;  2PLS A;  2MBR A;  1FFU C;  3SR6 B;  5FXD A;  1HSK A;  5G5H B;  4BC9 A;  1VAO A;  3EUB 3;  3FW9 A;  1JRP A;  3HRD C;  1I19 A;  3LLB A;  1E8F A;  2R8D A;  1N63 C;  4PVH A;  4PVE A;  1W1L A;  2AXR A;  4DNS A;  3FW7 A;  2Q4W A;  2QPM A;  4ML8 A;  4XLO A;  3W8Z A;  2W3R A;  1SB3 B;  1WYG A;  3AMZ A;  3D2H A;  2RK5 A;  4JAY A;  4PVK A;  3NRZ B;  2VAO A;  3S1F A;  3TSJ A;  1W1Q A;  2R2Z A;  3BW7 A;  2BVG A;  5HQX A;  5FXE A;  2W55 A;  4OAL A;  3S1D A;  2GQT A;  2P4P A;  1W1K A;  3DED A;  1DII A;  3I99 A;  3S1E A;  1AHU A;  2W3S A;  4BBY A;  2PLI A;  3GSY A;  1ZR6 A;  1W1O A;  3D2J A;  4BC7 A;  3TSH A;  1WVE A;  1F0X A;  3C0P A;  5AE2 A;  3NVV B;  1AHZ A;  1AHV A;  4PVJ A;  5HMR A;  4EC3 A;  5FXP A;  2EXR A;  1N5W C;  1W1S A;  4ZOH B;  2BVF A;  3TX1 A;  2QKN A;  4MLA A;  1FIQ B;  2Q85 A;  3PM9 A;  5ADZ A;  1ZXI C;  1JRO A;  2VFT A;  3DQ0 A;  1N5X A;  1W1M A;  3D2D A;  1N62 C;  2BVH A;  5AE3 A;  3NVY B;  5G5G B;  2YVS A;  1MBT A;  4BCA A;  1MBB A;  1UXY A;  5AE1 A;  4UD8 A;  2E3T A;  2OAI A;  4PWB A;  1E8H A;  1DZN A;  3JS8 A;  2P13 A;  3VTE A;  5HHZ A;  1E0Y A;  3ETR B;  4PYT A;  1N60 C;  1VDV A;  3S1C A;  2GQU A;  1RM6 B;  2P3H A;  4HG0 A;  5FXF A;  1W1J A;  3NVW B;  2VFV A;  1QLU A;  1E8G A;  1QLT A;  5D79 A;  2VFS A;  3NS1 B;  3FW8 A;  4PWC A;  3NVZ B;  3AN1 A;  2O3G A;  1T3Q C;  4O95 A;  3LAE A;  3AM9 A;  2VFR A; 
#chains in the Genus database with same CATH topology
 1V97 A;  3RJA A;  1WVF A;  4PZF A;  3FWA A;  1W1R A;  4JB1 A;  1N61 C;  1FO4 A;  2VFU A;  3B9J B;  3W8W A;  2I0K A;  2NQW A;  3KJM A;  2W54 A;  1FFV C;  3W8X A;  2UUV A;  1DIQ A;  2UUU A;  2Y3R A;  2PLS A;  2MBR A;  1FFU C;  3SR6 B;  5FXD A;  1HSK A;  5G5H B;  5I1V A;  4BC9 A;  1VAO A;  3EUB 3;  3FW9 A;  1JRP A;  3HRD C;  1I19 A;  3LLB A;  1E8F A;  2R8D A;  1N63 C;  4PVH A;  4PVE A;  3EJE B;  1W1L A;  2AXR A;  4DNS A;  3FW7 A;  2Q4W A;  2QPM A;  4ML8 A;  4XLO A;  3W8Z A;  2W3R A;  1SB3 B;  1WYG A;  3AMZ A;  3D2H A;  2RK5 A;  4JAY A;  5L6G A;  4PVK A;  3NRZ B;  2VAO A;  3S1F A;  3TSJ A;  1W1Q A;  2R2Z A;  3BW7 A;  2BVG A;  5AWV A;  5HQX A;  5FXE A;  3PQB A;  2W55 A;  4OAL A;  3S1D A;  2GQT A;  2P4P A;  3RJ8 A;  1W1K A;  3DED A;  1DII A;  3I99 A;  3S1E A;  1AHU A;  2W3S A;  4BBY A;  2PLI A;  3GSY A;  1ZR6 A;  1W1O A;  3D2J A;  4BC7 A;  3TSH A;  1WVE A;  1F0X A;  3C0P A;  5AE2 A;  3NVV B;  1AHZ A;  1AHV A;  4PVJ A;  5HMR A;  4EC3 A;  5FXP A;  2EXR A;  1N5W C;  1W1S A;  4ZOH B;  2BVF A;  3TX1 A;  2QKN A;  4MLA A;  1FIQ B;  2Q85 A;  3PM9 A;  5ADZ A;  1ZXI C;  1JRO A;  2VFT A;  3DQ0 A;  1N5X A;  1W1M A;  3D2D A;  1N62 C;  2BVH A;  3NVY B;  5AE3 A;  5G5G B;  3EJB B;  2YVS A;  1MBT A;  4BCA A;  1MBB A;  1UXY A;  5K8E A;  5I1W A;  5AE1 A;  4UD8 A;  2E3T A;  2OAI A;  2Y4G A;  2Y08 A;  4PWB A;  1E8H A;  1DZN A;  3EJD B;  3JS8 A;  2P13 A;  3VTE A;  5HHZ A;  1E0Y A;  3ETR B;  4PYT A;  1N60 C;  1VDV A;  2Y3S A;  3S1C A;  3POP A;  2GQU A;  1RM6 B;  2P3H A;  4HG0 A;  3NVW B;  1W1J A;  5FXF A;  2WDW A;  2VFV A;  1QLU A;  3HSU A;  1E8G A;  1QLT A;  5D79 A;  2VFS A;  3NS1 B;  3FW8 A;  4PWC A;  3NVZ B;  3AN1 A;  2IPI A;  1T3Q C;  4O95 A;  2O3G A;  3AM9 A;  3LAE A;  5L6F A;  2VFR A; 
#chains in the Genus database with same CATH homology
 1V97 A;  3RJA A;  1WVF A;  4PZF A;  3FWA A;  1W1R A;  4JB1 A;  1N61 C;  1FO4 A;  2VFU A;  3B9J B;  3W8W A;  2I0K A;  2NQW A;  3KJM A;  2W54 A;  1FFV C;  3W8X A;  2UUV A;  1DIQ A;  2UUU A;  2Y3R A;  2PLS A;  2MBR A;  1FFU C;  3SR6 B;  5FXD A;  1HSK A;  5G5H B;  5I1V A;  4BC9 A;  1VAO A;  3EUB 3;  3FW9 A;  1JRP A;  3HRD C;  1I19 A;  3LLB A;  1E8F A;  2R8D A;  1N63 C;  4PVH A;  4PVE A;  1W1L A;  2AXR A;  4DNS A;  3FW7 A;  2Q4W A;  2QPM A;  4ML8 A;  4XLO A;  3W8Z A;  2W3R A;  1SB3 B;  1WYG A;  3AMZ A;  3D2H A;  2RK5 A;  4JAY A;  5L6G A;  4PVK A;  3NRZ B;  2VAO A;  3S1F A;  3TSJ A;  1W1Q A;  2R2Z A;  3BW7 A;  2BVG A;  5AWV A;  5HQX A;  5FXE A;  3PQB A;  2W55 A;  4OAL A;  3S1D A;  2GQT A;  2P4P A;  3RJ8 A;  1W1K A;  3DED A;  1DII A;  3I99 A;  3S1E A;  1AHU A;  2W3S A;  4BBY A;  2PLI A;  3GSY A;  1ZR6 A;  1W1O A;  3D2J A;  4BC7 A;  3TSH A;  1WVE A;  1F0X A;  3C0P A;  5AE2 A;  3NVV B;  1AHZ A;  1AHV A;  4PVJ A;  5HMR A;  4EC3 A;  5FXP A;  2EXR A;  1N5W C;  1W1S A;  4ZOH B;  2BVF A;  3TX1 A;  2QKN A;  4MLA A;  1FIQ B;  2Q85 A;  3PM9 A;  5ADZ A;  1ZXI C;  1JRO A;  2VFT A;  3DQ0 A;  1N5X A;  1W1M A;  3D2D A;  1N62 C;  2BVH A;  5AE3 A;  3NVY B;  5G5G B;  2YVS A;  1MBT A;  4BCA A;  1MBB A;  1UXY A;  5K8E A;  5I1W A;  5AE1 A;  4UD8 A;  2E3T A;  2OAI A;  2Y4G A;  2Y08 A;  4PWB A;  1E8H A;  1DZN A;  3JS8 A;  2P13 A;  3VTE A;  5HHZ A;  1E0Y A;  3ETR B;  4PYT A;  1N60 C;  1VDV A;  2Y3S A;  3S1C A;  3POP A;  2GQU A;  1RM6 B;  2P3H A;  4HG0 A;  5FXF A;  1W1J A;  3NVW B;  2WDW A;  2VFV A;  1QLU A;  3HSU A;  1E8G A;  1QLT A;  5D79 A;  2VFS A;  3NS1 B;  3FW8 A;  4PWC A;  3NVZ B;  3AN1 A;  2IPI A;  1T3Q C;  4O95 A;  2O3G A;  3AM9 A;  3LAE A;  5L6F A;  2VFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...