2NQWA

Structure of the transporter associated domain from pg_0272, a cbs domain protein from porphyromonas gingivalis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
LPFKVLGDGSYLFEGKTSLSDVRHYLDLPENAFGELGDEVDTLSGLFLEIKQELPHVGDTAVYEPFRFQVTQMDKRRIIEIKIFPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
molecule keywords CBS domain protein
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2nqwA00
1N5XA 2OAIA 1W1QA 2PLIA 2W55A 1F0XA 2P13A 1W1KA 3EUB3 2VFSA 1DIQA 3BW7A 1FO4A 1WYGA 3SR6B 2BVGA 2BVHA 3NS1B 1MBTA 3NVYB 4MLAA 1JRPA 2PLSA 1AHUA 2QKNA 3S1FA 1DIIA 1FFUC 3PM9A 2P3HA 1W1MA 5G5HB 1FFVC 4OALA 1QLTA 4BCAA 4BBYA 1ZR6A 1FIQB 1W1OA 1W1JA 5HHZA 3TX1A 5FXEA 1W1RA 5AE1A 3W8WA 1W1SA 2I0KA 3NVWB 5HMRA 3S1DA 2RK5A 2W3RA 2BVFA 1E0YA 4JAYA 3NRZB 4XLOA 4BC7A 4BC9A 5AE2A 1SB3B 1N63C 1AHZA 1AHVA 3I99A 2W54A 4JB1A 2VFRA 3LLBA 4ML8A 1E8HA 3S1EA 1N62C 3NVZB 2VAOA 3B9JB 2P4PA 1E8GA 1DZNA 1V97A 3W8XA 1WVFA 3S1CA 1I19A 3AM9A 3NVVB 3DEDA 2AXRA 2VFVA 2GQTA 2YVSA 1VDVA 4ZOHB 1ZXIC 3ETRB 1QLUA 1UXYA 2VFUA 2Q85A 1WVEA 1HSKA 1W1LA 4O95A 3AMZA 1N5WC 2Q4WA 2NQWA 2E3TA 3W8ZA 1N61C 5FXFA 2O3GA 5ADZA 2GQUA 4HG0A 5AE3A 3AN1A 3HRDC 2EXRA 2R8DA 5HQXA 3KJMA 2MBRA 1T3QC 1VAOA 1MBBA 2VFTA 3DQ0A 5FXDA 1JROA 1RM6B 2W3SA 3C0PA 5G5GB 5FXPA 1N60C 2R2ZA 2QPMA 4PYTA 3JS8A 1E8FA 3LAEA
chains in the Genus database with same CATH superfamily
1N5XA 2OAIA 1W1QA 2PLIA 2W55A 3FW7A 3HSUA 1F0XA 2P13A 5AWVA 1W1KA 3EUB3 2VFSA 1DIQA 3BW7A 1FO4A 1WYGA 3SR6B 2BVGA 2BVHA 3NS1B 1MBTA 3FW8A 3NVYB 4MLAA 1JRPA 2PLSA 1AHUA 2QKNA 3S1FA 1DIIA 2IPIA 1FFUC 2WDWA 3PM9A 2Y4GA 2P3HA 1W1MA 3PQBA 5G5HB 1FFVC 4OALA 3VTEA 1QLTA 4BCAA 4BBYA 1ZR6A 1FIQB 1W1OA 1W1JA 3POPA 5HHZA 3TX1A 5FXEA 1W1RA 5AE1A 3W8WA 3FW9A 2UUUA 1W1SA 2I0KA 3NVWB 5HMRA 3S1DA 3RJAA 2RK5A 2W3RA 2BVFA 4DNSA 1E0YA 3D2HA 3NRZB 4JAYA 4XLOA 4BC7A 4BC9A 5AE2A 4PVHA 1SB3B 1N63C 1AHZA 3D2DA 4EC3A 1AHVA 3I99A 2Y08A 2W54A 4JB1A 2VFRA 2Y3SA 3LLBA 4ML8A 1E8HA 4PVEA 3S1EA 2Y3RA 1N62C 3NVZB 2VAOA 3B9JB 2P4PA 1E8GA 1DZNA 3RJ8A 1V97A 3W8XA 5I1WA 1WVFA 3S1CA 5D79A 1I19A 3AM9A 3NVVB 3DEDA 2AXRA 2VFVA 5L6GA 2GQTA 2UUVA 4PVKA 2YVSA 1VDVA 5I1VA 4ZOHB 1ZXIC 4PWBA 3ETRB 1QLUA 1UXYA 5L6FA 2VFUA 2Q85A 1WVEA 1HSKA 3TSHA 4PWCA 1W1LA 4O95A 3AMZA 3GSYA 1N5WC 2Q4WA 2NQWA 2E3TA 3W8ZA 4PZFA 1N61C 4UD8A 2O3GA 5FXFA 5ADZA 2GQUA 4HG0A 3D2JA 5AE3A 3AN1A 3HRDC 2EXRA 2R8DA 5HQXA 3KJMA 3TSJA 2MBRA 1T3QC 1VAOA 1MBBA 2VFTA 3DQ0A 5FXDA 1JROA 1RM6B 2W3SA 3FWAA 4PVJA 3C0PA 5K8EA 5G5GB 5FXPA 1N60C 2R2ZA 2QPMA 4PYTA 3JS8A 1E8FA 3LAEA
chains in the Genus database with same CATH topology
1N5XA 2OAIA 1W1QA 2PLIA 2W55A 3FW7A 3HSUA 1F0XA 2P13A 5AWVA 1W1KA 3EUB3 2VFSA 1DIQA 3BW7A 1FO4A 1WYGA 3SR6B 2BVGA 2BVHA 3NS1B 1MBTA 3FW8A 3NVYB 4MLAA 1JRPA 2PLSA 1AHUA 2QKNA 3S1FA 1DIIA 2IPIA 1FFUC 2WDWA 3PM9A 2Y4GA 2P3HA 1W1MA 3PQBA 5G5HB 1FFVC 4OALA 3VTEA 1QLTA 4BCAA 4BBYA 1ZR6A 1FIQB 1W1OA 1W1JA 3POPA 5HHZA 3TX1A 5FXEA 1W1RA 5AE1A 3W8WA 3FW9A 2UUUA 1W1SA 2I0KA 3NVWB 5HMRA 3S1DA 3RJAA 2RK5A 2W3RA 2BVFA 4DNSA 1E0YA 3D2HA 3NRZB 4JAYA 4XLOA 4BC7A 4BC9A 5AE2A 4PVHA 1SB3B 1N63C 1AHZA 3D2DA 4EC3A 1AHVA 3I99A 2Y08A 2W54A 4JB1A 2VFRA 2Y3SA 3LLBA 4ML8A 1E8HA 4PVEA 3S1EA 2Y3RA 1N62C 3NVZB 2VAOA 3B9JB 2P4PA 1E8GA 1DZNA 3RJ8A 1V97A 3W8XA 5I1WA 1WVFA 3S1CA 5D79A 1I19A 3AM9A 3NVVB 3DEDA 2AXRA 2VFVA 5L6GA 2GQTA 2UUVA 4PVKA 2YVSA 1VDVA 5I1VA 4ZOHB 1ZXIC 4PWBA 3ETRB 1QLUA 1UXYA 5L6FA 2VFUA 2Q85A 1WVEA 1HSKA 3TSHA 4PWCA 1W1LA 4O95A 3AMZA 3GSYA 1N5WC 2Q4WA 2NQWA 2E3TA 3W8ZA 4PZFA 1N61C 4UD8A 2O3GA 5FXFA 5ADZA 2GQUA 4HG0A 3D2JA 5AE3A 3AN1A 3HRDC 2EXRA 2R8DA 5HQXA 3KJMA 3TSJA 2MBRA 1T3QC 1VAOA 1MBBA 2VFTA 3DQ0A 5FXDA 1JROA 1RM6B 2W3SA 3FWAA 4PVJA 3C0PA 5K8EA 5G5GB 5FXPA 1N60C 2R2ZA 2QPMA 4PYTA 3JS8A 1E8FA 3LAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5X A;  2OAI A;  1W1Q A;  2PLI A;  2W55 A;  1F0X A;  2P13 A;  1W1K A;  3EUB 3;  2VFS A;  1DIQ A;  3BW7 A;  1FO4 A;  1WYG A;  3SR6 B;  2BVG A;  2BVH A;  3NS1 B;  1MBT A;  3NVY B;  4MLA A;  1JRP A;  2PLS A;  1AHU A;  2QKN A;  3S1F A;  1DII A;  1FFU C;  3PM9 A;  2P3H A;  1W1M A;  5G5H B;  1FFV C;  4OAL A;  1QLT A;  4BCA A;  4BBY A;  1ZR6 A;  1FIQ B;  1W1O A;  1W1J A;  5HHZ A;  3TX1 A;  5FXE A;  1W1R A;  5AE1 A;  3W8W A;  1W1S A;  2I0K A;  3NVW B;  5HMR A;  3S1D A;  2RK5 A;  2W3R A;  2BVF A;  1E0Y A;  4JAY A;  3NRZ B;  4XLO A;  4BC7 A;  4BC9 A;  5AE2 A;  1SB3 B;  1N63 C;  1AHZ A;  1AHV A;  3I99 A;  2W54 A;  4JB1 A;  2VFR A;  3LLB A;  4ML8 A;  1E8H A;  3S1E A;  1N62 C;  3NVZ B;  2VAO A;  3B9J B;  2P4P A;  1E8G A;  1DZN A;  1V97 A;  3W8X A;  1WVF A;  3S1C A;  1I19 A;  3AM9 A;  3NVV B;  3DED A;  2AXR A;  2VFV A;  2GQT A;  2YVS A;  1VDV A;  4ZOH B;  1ZXI C;  3ETR B;  1QLU A;  1UXY A;  2VFU A;  2Q85 A;  1WVE A;  1HSK A;  1W1L A;  4O95 A;  3AMZ A;  1N5W C;  2Q4W A;  2NQW A;  2E3T A;  3W8Z A;  1N61 C;  5FXF A;  2O3G A;  5ADZ A;  2GQU A;  4HG0 A;  5AE3 A;  3AN1 A;  3HRD C;  2EXR A;  2R8D A;  5HQX A;  3KJM A;  2MBR A;  1T3Q C;  1VAO A;  1MBB A;  2VFT A;  3DQ0 A;  5FXD A;  1JRO A;  1RM6 B;  2W3S A;  3C0P A;  5G5G B;  5FXP A;  1N60 C;  2R2Z A;  2QPM A;  4PYT A;  3JS8 A;  1E8F A;  3LAE A; 
#chains in the Genus database with same CATH topology
 1N5X A;  2OAI A;  1W1Q A;  2PLI A;  2W55 A;  3FW7 A;  3HSU A;  1F0X A;  2P13 A;  5AWV A;  1W1K A;  3EUB 3;  2VFS A;  1DIQ A;  3BW7 A;  1FO4 A;  1WYG A;  3SR6 B;  2BVG A;  2BVH A;  3NS1 B;  1MBT A;  3FW8 A;  3NVY B;  4MLA A;  1JRP A;  2PLS A;  1AHU A;  2QKN A;  3S1F A;  1DII A;  2IPI A;  1FFU C;  2WDW A;  3PM9 A;  2Y4G A;  2P3H A;  1W1M A;  3PQB A;  5G5H B;  1FFV C;  4OAL A;  3VTE A;  1QLT A;  4BCA A;  4BBY A;  1ZR6 A;  1FIQ B;  1W1O A;  1W1J A;  3POP A;  5HHZ A;  3TX1 A;  5FXE A;  1W1R A;  5AE1 A;  3W8W A;  3FW9 A;  2UUU A;  1W1S A;  2I0K A;  3NVW B;  5HMR A;  3S1D A;  3RJA A;  2RK5 A;  2W3R A;  2BVF A;  4DNS A;  1E0Y A;  3D2H A;  3NRZ B;  4JAY A;  4XLO A;  4BC7 A;  4BC9 A;  5AE2 A;  4PVH A;  1SB3 B;  1N63 C;  1AHZ A;  3D2D A;  4EC3 A;  1AHV A;  3I99 A;  2Y08 A;  2W54 A;  4JB1 A;  2VFR A;  2Y3S A;  3LLB A;  4ML8 A;  1E8H A;  4PVE A;  3S1E A;  2Y3R A;  1N62 C;  3NVZ B;  2VAO A;  3B9J B;  2P4P A;  1E8G A;  1DZN A;  3RJ8 A;  1V97 A;  3W8X A;  5I1W A;  1WVF A;  3S1C A;  5D79 A;  1I19 A;  3AM9 A;  3NVV B;  3DED A;  2AXR A;  2VFV A;  5L6G A;  2GQT A;  2UUV A;  4PVK A;  2YVS A;  1VDV A;  5I1V A;  4ZOH B;  1ZXI C;  4PWB A;  3ETR B;  1QLU A;  1UXY A;  5L6F A;  2VFU A;  2Q85 A;  1WVE A;  1HSK A;  3TSH A;  4PWC A;  1W1L A;  4O95 A;  3AMZ A;  3GSY A;  1N5W C;  2Q4W A;  2NQW A;  2E3T A;  3W8Z A;  4PZF A;  1N61 C;  4UD8 A;  2O3G A;  5FXF A;  5ADZ A;  2GQU A;  4HG0 A;  3D2J A;  5AE3 A;  3AN1 A;  3HRD C;  2EXR A;  2R8D A;  5HQX A;  3KJM A;  3TSJ A;  2MBR A;  1T3Q C;  1VAO A;  1MBB A;  2VFT A;  3DQ0 A;  5FXD A;  1JRO A;  1RM6 B;  2W3S A;  3FWA A;  4PVJ A;  3C0P A;  5K8E A;  5G5G B;  5FXP A;  1N60 C;  2R2Z A;  2QPM A;  4PYT A;  3JS8 A;  1E8F A;  3LAE A; 
#chains in the Genus database with same CATH homology
 1N5X A;  2OAI A;  1W1Q A;  2PLI A;  2W55 A;  3FW7 A;  3HSU A;  1F0X A;  2P13 A;  5AWV A;  1W1K A;  3EUB 3;  2VFS A;  1DIQ A;  3BW7 A;  1FO4 A;  1WYG A;  3SR6 B;  2BVG A;  2BVH A;  3NS1 B;  1MBT A;  3FW8 A;  3NVY B;  4MLA A;  1JRP A;  2PLS A;  1AHU A;  2QKN A;  3S1F A;  1DII A;  2IPI A;  1FFU C;  2WDW A;  3PM9 A;  2Y4G A;  2P3H A;  1W1M A;  3PQB A;  5G5H B;  1FFV C;  4OAL A;  3VTE A;  1QLT A;  4BCA A;  4BBY A;  1ZR6 A;  1FIQ B;  1W1O A;  1W1J A;  3POP A;  5HHZ A;  3TX1 A;  5FXE A;  1W1R A;  5AE1 A;  3W8W A;  3FW9 A;  2UUU A;  1W1S A;  2I0K A;  3NVW B;  5HMR A;  3S1D A;  3RJA A;  2RK5 A;  2W3R A;  2BVF A;  4DNS A;  1E0Y A;  3D2H A;  3NRZ B;  4JAY A;  4XLO A;  4BC7 A;  4BC9 A;  5AE2 A;  4PVH A;  1SB3 B;  1N63 C;  1AHZ A;  3D2D A;  4EC3 A;  1AHV A;  3I99 A;  2Y08 A;  2W54 A;  4JB1 A;  2VFR A;  2Y3S A;  3LLB A;  4ML8 A;  1E8H A;  4PVE A;  3S1E A;  2Y3R A;  1N62 C;  3NVZ B;  2VAO A;  3B9J B;  2P4P A;  1E8G A;  1DZN A;  3RJ8 A;  1V97 A;  3W8X A;  5I1W A;  1WVF A;  3S1C A;  5D79 A;  1I19 A;  3AM9 A;  3NVV B;  3DED A;  2AXR A;  2VFV A;  5L6G A;  2GQT A;  2UUV A;  4PVK A;  2YVS A;  1VDV A;  5I1V A;  4ZOH B;  1ZXI C;  4PWB A;  3ETR B;  1QLU A;  1UXY A;  5L6F A;  2VFU A;  2Q85 A;  1WVE A;  1HSK A;  3TSH A;  4PWC A;  1W1L A;  4O95 A;  3AMZ A;  3GSY A;  1N5W C;  2Q4W A;  2NQW A;  2E3T A;  3W8Z A;  4PZF A;  1N61 C;  4UD8 A;  2O3G A;  5FXF A;  5ADZ A;  2GQU A;  4HG0 A;  3D2J A;  5AE3 A;  3AN1 A;  3HRD C;  2EXR A;  2R8D A;  5HQX A;  3KJM A;  3TSJ A;  2MBR A;  1T3Q C;  1VAO A;  1MBB A;  2VFT A;  3DQ0 A;  5FXD A;  1JRO A;  1RM6 B;  2W3S A;  3FWA A;  4PVJ A;  3C0P A;  5K8E A;  5G5G B;  5FXP A;  1N60 C;  2R2Z A;  2QPM A;  4PYT A;  3JS8 A;  1E8F A;  3LAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...