2NQWA

Structure of the transporter associated domain from pg_0272, a cbs domain protein from porphyromonas gingivalis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
b'LPFKVLGDGSYLFEGKTSLSDVRHYLDLPENAFGELGDEVDTLSGLFLEIKQELPHVGDTAVYEPFRFQVTQMDKRRIIEIKIFPFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CBS domain protein
publication title Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2nqwA00
1VDVA 1W1LA 1N63C 2BVGA 1DIIA 1W1OA 3SR6B 2Q4WA 3HRDC 1VAOA 4MLAA 1ZXIC 1N62C 1W1SA 1ZR6A 1W1KA 1MBBA 1I19A 3NVVB 1E8FA 1T3QC 3LAEA 3S1FA 1AHZA 2YVSA 1E8GA 1E8HA 1QLUA 2QKNA 2P4PA 2W3RA 3DQ0A 3LLBA 1W1JA 2PLIA 5G5GB 2E3TA 1FIQB 3I99A 5FXFA 2VFUA 1N60C 2BVHA 2RK5A 3DEDA 5HHZA 1WYGA 4BC9A 1WVEA 1AHVA 1W1MA 1DIQA 4BC7A 5FXPA 3TX1A 5FXEA 4XLOA 3W8ZA 2VAOA 2QPMA 5AE3A 2VFRA 1AHUA 4HG0A 4ML8A 3NVZB 1W1RA 3NS1B 4OALA 4JAYA 4BBYA 2MBRA 1FO4A 2P3HA 2W54A 2I0KA 1N5WC 3PM9A 3S1DA 3NVYB 2P13A 2VFVA 5G5HB 1N61C 2GQTA 3W8WA 1W1QA 1V97A 4JB1A 1JRPA 2PLSA 2EXRA 5HMRA 1RM6B 2VFSA 1HSKA 2O3GA 3KJMA 3S1CA 3B9JB 5HQXA 2BVFA 1WVFA 3AMZA 1N5XA 4PYTA 1UXYA 2GQUA 3S1EA 5AE2A 1FFVC 1FFUC 3NVWB 2NQWA 3AN1A 1JROA 4O95A 4BCAA 3C0PA 2W3SA 3ETRB 5FXDA 1DZNA 2OAIA 4ZOHB 3NRZB 2VFTA 1SB3B 3W8XA 2W55A 2Q85A 3BW7A 2R8DA 5ADZA 2AXRA 3EUB3 2R2ZA 1F0XA 1E0YA 3JS8A 1QLTA 1MBTA 5AE1A 3AM9A
chains in the Genus database with same CATH superfamily
1VDVA 1W1LA 3FWAA 1N63C 2BVGA 1DIIA 1W1OA 3POPA 3SR6B 2Q4WA 3HRDC 2UUUA 1VAOA 2Y3RA 3D2JA 4MLAA 1ZXIC 1N62C 1W1SA 1ZR6A 1W1KA 1MBBA 1I19A 3NVVB 1E8FA 3FW8A 1T3QC 3LAEA 3S1FA 1AHZA 2YVSA 1E8GA 1E8HA 1QLUA 2QKNA 4PVJA 2P4PA 2W3RA 3DQ0A 3LLBA 1W1JA 2PLIA 3FW7A 5G5GB 2E3TA 1FIQB 3I99A 5FXFA 2WDWA 2VFUA 1N60C 2BVHA 2RK5A 3DEDA 3VTEA 5HHZA 2UUVA 1WYGA 4BC9A 1WVEA 1AHVA 1W1MA 1DIQA 4BC7A 5FXPA 3TX1A 5FXEA 3RJ8A 4XLOA 3W8ZA 2VAOA 3GSYA 2QPMA 5AE3A 2VFRA 1AHUA 4HG0A 5K8EA 4ML8A 2IPIA 3NVZB 1W1RA 3NS1B 3HSUA 4OALA 4JAYA 4BBYA 2MBRA 4PWBA 1FO4A 2P3HA 2W54A 2I0KA 1N5WC 3PM9A 3S1DA 3NVYB 2P13A 2VFVA 5G5HB 1N61C 2GQTA 3W8WA 1W1QA 1V97A 4JB1A 1JRPA 2PLSA 2EXRA 5HMRA 1RM6B 2Y3SA 4UD8A 4PWCA 2VFSA 1HSKA 2O3GA 5L6GA 3KJMA 3S1CA 4EC3A 3B9JB 2Y4GA 5I1WA 4PVKA 5HQXA 2BVFA 1WVFA 3AMZA 3RJAA 3TSJA 1N5XA 4PYTA 1UXYA 2GQUA 3S1EA 5AE2A 5AWVA 1FFVC 1FFUC 3FW9A 3NVWB 2NQWA 5I1VA 3AN1A 1JROA 2Y08A 4O95A 4BCAA 3C0PA 2W3SA 3ETRB 5FXDA 1DZNA 5L6FA 4PVEA 2OAIA 3PQBA 4DNSA 4ZOHB 3NRZB 4PVHA 2VFTA 1SB3B 5D79A 3W8XA 2W55A 2Q85A 3BW7A 2R8DA 5ADZA 2AXRA 3TSHA 3D2DA 3EUB3 2R2ZA 1F0XA 1E0YA 3JS8A 1QLTA 1MBTA 3D2HA 5AE1A 3AM9A 4PZFA
chains in the Genus database with same CATH topology
1VDVA 1W1LA 3FWAA 1N63C 2BVGA 1DIIA 1W1OA 3POPA 3SR6B 2Q4WA 3HRDC 2UUUA 1VAOA 2Y3RA 3D2JA 4MLAA 1ZXIC 1N62C 1W1SA 1ZR6A 1W1KA 1MBBA 1I19A 3NVVB 1E8FA 3FW8A 1T3QC 3LAEA 3S1FA 1AHZA 2YVSA 1E8GA 1E8HA 1QLUA 2QKNA 4PVJA 2P4PA 2W3RA 3DQ0A 3LLBA 1W1JA 2PLIA 3FW7A 5G5GB 2E3TA 1FIQB 3I99A 5FXFA 2WDWA 2VFUA 1N60C 2BVHA 2RK5A 3DEDA 3VTEA 5HHZA 2UUVA 1WYGA 4BC9A 1WVEA 1AHVA 1W1MA 1DIQA 4BC7A 5FXPA 3TX1A 5FXEA 3RJ8A 4XLOA 3W8ZA 2VAOA 3GSYA 2QPMA 5AE3A 2VFRA 1AHUA 4HG0A 5K8EA 4ML8A 2IPIA 3NVZB 1W1RA 3NS1B 3HSUA 4OALA 4JAYA 4BBYA 2MBRA 4PWBA 1FO4A 2P3HA 2W54A 2I0KA 1N5WC 3PM9A 3S1DA 3NVYB 2P13A 2VFVA 5G5HB 1N61C 2GQTA 3W8WA 1W1QA 1V97A 4JB1A 1JRPA 2PLSA 2EXRA 5HMRA 1RM6B 2Y3SA 4UD8A 4PWCA 2VFSA 1HSKA 2O3GA 5L6GA 3KJMA 3S1CA 4EC3A 3B9JB 2Y4GA 5I1WA 4PVKA 5HQXA 2BVFA 1WVFA 3AMZA 3RJAA 3TSJA 1N5XA 4PYTA 1UXYA 2GQUA 3S1EA 5AE2A 5AWVA 1FFVC 1FFUC 3FW9A 3NVWB 2NQWA 5I1VA 3AN1A 1JROA 2Y08A 4O95A 4BCAA 3C0PA 2W3SA 3ETRB 5FXDA 1DZNA 5L6FA 4PVEA 2OAIA 3PQBA 4DNSA 4ZOHB 3NRZB 4PVHA 2VFTA 1SB3B 5D79A 3W8XA 2W55A 2Q85A 3BW7A 2R8DA 5ADZA 2AXRA 3TSHA 3D2DA 3EUB3 2R2ZA 1F0XA 1E0YA 3JS8A 1QLTA 1MBTA 3D2HA 5AE1A 3AM9A 4PZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDV A;  1W1L A;  1N63 C;  2BVG A;  1DII A;  1W1O A;  3SR6 B;  2Q4W A;  3HRD C;  1VAO A;  4MLA A;  1ZXI C;  1N62 C;  1W1S A;  1ZR6 A;  1W1K A;  1MBB A;  1I19 A;  3NVV B;  1E8F A;  1T3Q C;  3LAE A;  3S1F A;  1AHZ A;  2YVS A;  1E8G A;  1E8H A;  1QLU A;  2QKN A;  2P4P A;  2W3R A;  3DQ0 A;  3LLB A;  1W1J A;  2PLI A;  5G5G B;  2E3T A;  1FIQ B;  3I99 A;  5FXF A;  2VFU A;  1N60 C;  2BVH A;  2RK5 A;  3DED A;  5HHZ A;  1WYG A;  4BC9 A;  1WVE A;  1AHV A;  1W1M A;  1DIQ A;  4BC7 A;  5FXP A;  3TX1 A;  5FXE A;  4XLO A;  3W8Z A;  2VAO A;  2QPM A;  5AE3 A;  2VFR A;  1AHU A;  4HG0 A;  4ML8 A;  3NVZ B;  1W1R A;  3NS1 B;  4OAL A;  4JAY A;  4BBY A;  2MBR A;  1FO4 A;  2P3H A;  2W54 A;  2I0K A;  1N5W C;  3PM9 A;  3S1D A;  3NVY B;  2P13 A;  2VFV A;  5G5H B;  1N61 C;  2GQT A;  3W8W A;  1W1Q A;  1V97 A;  4JB1 A;  1JRP A;  2PLS A;  2EXR A;  5HMR A;  1RM6 B;  2VFS A;  1HSK A;  2O3G A;  3KJM A;  3S1C A;  3B9J B;  5HQX A;  2BVF A;  1WVF A;  3AMZ A;  1N5X A;  4PYT A;  1UXY A;  2GQU A;  3S1E A;  5AE2 A;  1FFV C;  1FFU C;  3NVW B;  2NQW A;  3AN1 A;  1JRO A;  4O95 A;  4BCA A;  3C0P A;  2W3S A;  3ETR B;  5FXD A;  1DZN A;  2OAI A;  4ZOH B;  3NRZ B;  2VFT A;  1SB3 B;  3W8X A;  2W55 A;  2Q85 A;  3BW7 A;  2R8D A;  5ADZ A;  2AXR A;  3EUB 3;  2R2Z A;  1F0X A;  1E0Y A;  3JS8 A;  1QLT A;  1MBT A;  5AE1 A;  3AM9 A; 
#chains in the Genus database with same CATH topology
 1VDV A;  1W1L A;  3FWA A;  1N63 C;  2BVG A;  1DII A;  1W1O A;  3POP A;  3SR6 B;  2Q4W A;  3HRD C;  2UUU A;  1VAO A;  2Y3R A;  3D2J A;  4MLA A;  1ZXI C;  1N62 C;  1W1S A;  1ZR6 A;  1W1K A;  1MBB A;  1I19 A;  3NVV B;  1E8F A;  3FW8 A;  1T3Q C;  3LAE A;  3S1F A;  1AHZ A;  2YVS A;  1E8G A;  1E8H A;  1QLU A;  2QKN A;  4PVJ A;  2P4P A;  2W3R A;  3DQ0 A;  3LLB A;  1W1J A;  2PLI A;  3FW7 A;  5G5G B;  2E3T A;  1FIQ B;  3I99 A;  5FXF A;  2WDW A;  2VFU A;  1N60 C;  2BVH A;  2RK5 A;  3DED A;  3VTE A;  5HHZ A;  2UUV A;  1WYG A;  4BC9 A;  1WVE A;  1AHV A;  1W1M A;  1DIQ A;  4BC7 A;  5FXP A;  3TX1 A;  5FXE A;  3RJ8 A;  4XLO A;  3W8Z A;  2VAO A;  3GSY A;  2QPM A;  5AE3 A;  2VFR A;  1AHU A;  4HG0 A;  5K8E A;  4ML8 A;  2IPI A;  3NVZ B;  1W1R A;  3NS1 B;  3HSU A;  4OAL A;  4JAY A;  4BBY A;  2MBR A;  4PWB A;  1FO4 A;  2P3H A;  2W54 A;  2I0K A;  1N5W C;  3PM9 A;  3S1D A;  3NVY B;  2P13 A;  2VFV A;  5G5H B;  1N61 C;  2GQT A;  3W8W A;  1W1Q A;  1V97 A;  4JB1 A;  1JRP A;  2PLS A;  2EXR A;  5HMR A;  1RM6 B;  2Y3S A;  4UD8 A;  4PWC A;  2VFS A;  1HSK A;  2O3G A;  5L6G A;  3KJM A;  3S1C A;  4EC3 A;  3B9J B;  2Y4G A;  5I1W A;  4PVK A;  5HQX A;  2BVF A;  1WVF A;  3AMZ A;  3RJA A;  3TSJ A;  1N5X A;  4PYT A;  1UXY A;  2GQU A;  3S1E A;  5AE2 A;  5AWV A;  1FFV C;  1FFU C;  3FW9 A;  3NVW B;  2NQW A;  5I1V A;  3AN1 A;  1JRO A;  2Y08 A;  4O95 A;  4BCA A;  3C0P A;  2W3S A;  3ETR B;  5FXD A;  1DZN A;  5L6F A;  4PVE A;  2OAI A;  3PQB A;  4DNS A;  4ZOH B;  3NRZ B;  4PVH A;  2VFT A;  1SB3 B;  5D79 A;  3W8X A;  2W55 A;  2Q85 A;  3BW7 A;  2R8D A;  5ADZ A;  2AXR A;  3TSH A;  3D2D A;  3EUB 3;  2R2Z A;  1F0X A;  1E0Y A;  3JS8 A;  1QLT A;  1MBT A;  3D2H A;  5AE1 A;  3AM9 A;  4PZF A; 
#chains in the Genus database with same CATH homology
 1VDV A;  1W1L A;  3FWA A;  1N63 C;  2BVG A;  1DII A;  1W1O A;  3POP A;  3SR6 B;  2Q4W A;  3HRD C;  2UUU A;  1VAO A;  2Y3R A;  3D2J A;  4MLA A;  1ZXI C;  1N62 C;  1W1S A;  1ZR6 A;  1W1K A;  1MBB A;  1I19 A;  3NVV B;  1E8F A;  3FW8 A;  1T3Q C;  3LAE A;  3S1F A;  1AHZ A;  2YVS A;  1E8G A;  1E8H A;  1QLU A;  2QKN A;  4PVJ A;  2P4P A;  2W3R A;  3DQ0 A;  3LLB A;  1W1J A;  2PLI A;  3FW7 A;  5G5G B;  2E3T A;  1FIQ B;  3I99 A;  5FXF A;  2WDW A;  2VFU A;  1N60 C;  2BVH A;  2RK5 A;  3DED A;  3VTE A;  5HHZ A;  2UUV A;  1WYG A;  4BC9 A;  1WVE A;  1AHV A;  1W1M A;  1DIQ A;  4BC7 A;  5FXP A;  3TX1 A;  5FXE A;  3RJ8 A;  4XLO A;  3W8Z A;  2VAO A;  3GSY A;  2QPM A;  5AE3 A;  2VFR A;  1AHU A;  4HG0 A;  5K8E A;  4ML8 A;  2IPI A;  3NVZ B;  1W1R A;  3NS1 B;  3HSU A;  4OAL A;  4JAY A;  4BBY A;  2MBR A;  4PWB A;  1FO4 A;  2P3H A;  2W54 A;  2I0K A;  1N5W C;  3PM9 A;  3S1D A;  3NVY B;  2P13 A;  2VFV A;  5G5H B;  1N61 C;  2GQT A;  3W8W A;  1W1Q A;  1V97 A;  4JB1 A;  1JRP A;  2PLS A;  2EXR A;  5HMR A;  1RM6 B;  2Y3S A;  4UD8 A;  4PWC A;  2VFS A;  1HSK A;  2O3G A;  5L6G A;  3KJM A;  3S1C A;  4EC3 A;  3B9J B;  2Y4G A;  5I1W A;  4PVK A;  5HQX A;  2BVF A;  1WVF A;  3AMZ A;  3RJA A;  3TSJ A;  1N5X A;  4PYT A;  1UXY A;  2GQU A;  3S1E A;  5AE2 A;  5AWV A;  1FFV C;  1FFU C;  3FW9 A;  3NVW B;  2NQW A;  5I1V A;  3AN1 A;  1JRO A;  2Y08 A;  4O95 A;  4BCA A;  3C0P A;  2W3S A;  3ETR B;  5FXD A;  1DZN A;  5L6F A;  4PVE A;  2OAI A;  3PQB A;  4DNS A;  4ZOH B;  3NRZ B;  4PVH A;  2VFT A;  1SB3 B;  5D79 A;  3W8X A;  2W55 A;  2Q85 A;  3BW7 A;  2R8D A;  5ADZ A;  2AXR A;  3TSH A;  3D2D A;  3EUB 3;  2R2Z A;  1F0X A;  1E0Y A;  3JS8 A;  1QLT A;  1MBT A;  3D2H A;  5AE1 A;  3AM9 A;  4PZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...