2NQWA

Structure of the transporter associated domain from pg_0272, a cbs domain protein from porphyromonas gingivalis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
LPFKVLGDGSYLFEGKTSLSDVRHYLDLPENAFGELGDEVDTLSGLFLEIKQELPHVGDTAVYEPFRFQVTQMDKRRIIEIKIFPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CBS domain protein
publication title Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2nqwA00
1DZNA 1JRPA 1W1OA 3LAEA 3KJMA 3PM9A 1W1SA 1N5WC 2VAOA 4XLOA 3NRZB 4O95A 1ZXIC 2R8DA 4PYTA 5FXPA 3NVZB 2AXRA 1VDVA 4ML8A 1W1KA 1DIIA 2R2ZA 1N62C 1I19A 2BVHA 5FXEA 3W8XA 1RM6B 2W54A 3HRDC 1MBTA 1E8GA 1ZR6A 1AHUA 1JROA 1UXYA 2P3HA 3B9JB 3NVYB 3AN1A 2W3SA 2NQWA 2OAIA 1AHVA 2E3TA 3ETRB 1F0XA 2W3RA 4JB1A 1W1MA 3NVWB 1VAOA 2VFUA 1W1QA 2Q85A 5HMRA 1WYGA 1QLTA 2Q4WA 3BW7A 4BC7A 1E8FA 2QKNA 1FFUC 2MBRA 1T3QC 2P13A 3S1DA 1E8HA 3LLBA 5G5GB 5ADZA 2BVFA 1W1RA 3S1EA 2YVSA 2PLIA 2VFTA 5AE1A 3EUB3 1W1LA 3DEDA 1DIQA 2PLSA 1FFVC 1AHZA 2I0KA 2GQTA 3NVVB 2VFVA 1SB3B 4BBYA 5G5HB 1N63C 2BVGA 3AM9A 1WVEA 3W8WA 2RK5A 5HHZA 1FO4A 1N60C 1N5XA 4BC9A 3I99A 5FXFA 2EXRA 2QPMA 3S1FA 1MBBA 4MLAA 1QLUA 4ZOHB 5AE3A 2GQUA 2W55A 1HSKA 1N61C 4BCAA 5HQXA 3JS8A 3AMZA 1E0YA 2VFSA 2P4PA 1FIQB 3DQ0A 4HG0A 5FXDA 1WVFA 1W1JA 5AE2A 3S1CA 3TX1A 4JAYA 4OALA 3SR6B 3NS1B 1V97A 3C0PA 2VFRA 3W8ZA 2O3GA
chains in the Genus database with same CATH superfamily
3RJ8A 1DZNA 1JRPA 2Y08A 1W1OA 3LAEA 3KJMA 3PM9A 1W1SA 1N5WC 2VAOA 4XLOA 3NRZB 4O95A 3POPA 3D2JA 5I1VA 1ZXIC 2R8DA 3FW8A 3HSUA 4PYTA 3TSHA 5FXPA 3NVZB 2AXRA 1VDVA 4ML8A 1W1KA 4PWCA 1DIIA 3TSJA 2R2ZA 1N62C 1I19A 2BVHA 3FW9A 5L6GA 5FXEA 2UUVA 3W8XA 1RM6B 5K8EA 2W54A 3HRDC 1MBTA 1E8GA 1ZR6A 1AHUA 1JROA 1UXYA 2P3HA 3B9JB 3FWAA 3NVYB 3AN1A 2W3SA 2NQWA 2OAIA 1AHVA 2E3TA 2UUUA 3ETRB 1F0XA 2W3RA 4JB1A 1W1MA 3NVWB 1VAOA 2VFUA 1W1QA 2Q85A 3VTEA 5HMRA 1WYGA 1QLTA 2Q4WA 3BW7A 4BC7A 1E8FA 2QKNA 1FFUC 2MBRA 1T3QC 2P13A 3GSYA 3S1DA 1E8HA 3RJAA 3LLBA 4DNSA 5G5GB 3D2DA 5ADZA 2BVFA 1W1RA 3S1EA 2YVSA 4PWBA 2Y4GA 3D2HA 2PLIA 3FW7A 2VFTA 5AE1A 3EUB3 1W1LA 3DEDA 1DIQA 2PLSA 1FFVC 1AHZA 2I0KA 2GQTA 3NVVB 2VFVA 1SB3B 4PVEA 4BBYA 2WDWA 5G5HB 1N63C 2BVGA 3AM9A 1WVEA 3W8WA 2RK5A 5HHZA 1FO4A 1N60C 1N5XA 4BC9A 4PVHA 3I99A 5FXFA 3PQBA 5AWVA 2EXRA 5I1WA 2QPMA 3S1FA 1MBBA 2IPIA 4MLAA 1QLUA 4ZOHB 5L6FA 4UD8A 5AE3A 2GQUA 2W55A 1HSKA 1N61C 4BCAA 5HQXA 4PZFA 3JS8A 3AMZA 1E0YA 2VFSA 5D79A 2P4PA 1FIQB 3DQ0A 4HG0A 2Y3RA 4PVKA 5FXDA 1WVFA 1W1JA 4EC3A 4PVJA 5AE2A 3S1CA 3TX1A 4JAYA 4OALA 3SR6B 2Y3SA 3NS1B 1V97A 3C0PA 2VFRA 3W8ZA 2O3GA
chains in the Genus database with same CATH topology
3RJ8A 1DZNA 1JRPA 2Y08A 1W1OA 3LAEA 3KJMA 3PM9A 1W1SA 1N5WC 2VAOA 4XLOA 3NRZB 4O95A 3POPA 3D2JA 5I1VA 1ZXIC 2R8DA 3FW8A 3HSUA 4PYTA 3TSHA 5FXPA 3NVZB 2AXRA 1VDVA 4ML8A 1W1KA 4PWCA 1DIIA 3TSJA 2R2ZA 1N62C 1I19A 2BVHA 3FW9A 5L6GA 5FXEA 2UUVA 3W8XA 1RM6B 5K8EA 2W54A 3HRDC 1MBTA 1E8GA 1ZR6A 1AHUA 1JROA 1UXYA 2P3HA 3B9JB 3FWAA 3NVYB 3AN1A 2W3SA 2NQWA 2OAIA 1AHVA 2E3TA 2UUUA 3ETRB 1F0XA 2W3RA 4JB1A 1W1MA 3NVWB 1VAOA 2VFUA 1W1QA 2Q85A 3VTEA 5HMRA 1WYGA 1QLTA 2Q4WA 3BW7A 4BC7A 1E8FA 2QKNA 1FFUC 2MBRA 1T3QC 2P13A 3GSYA 3S1DA 1E8HA 3RJAA 3LLBA 4DNSA 5G5GB 3D2DA 5ADZA 2BVFA 1W1RA 3S1EA 2YVSA 4PWBA 2Y4GA 3D2HA 2PLIA 3FW7A 2VFTA 5AE1A 3EUB3 1W1LA 3DEDA 1DIQA 2PLSA 1FFVC 1AHZA 2I0KA 2GQTA 3NVVB 2VFVA 1SB3B 4PVEA 4BBYA 2WDWA 5G5HB 1N63C 2BVGA 3AM9A 1WVEA 3W8WA 2RK5A 5HHZA 1FO4A 1N60C 1N5XA 4BC9A 4PVHA 3I99A 5FXFA 3PQBA 5AWVA 2EXRA 5I1WA 2QPMA 3S1FA 1MBBA 2IPIA 4MLAA 1QLUA 4ZOHB 5L6FA 4UD8A 5AE3A 2GQUA 2W55A 1HSKA 1N61C 4BCAA 5HQXA 4PZFA 3JS8A 3AMZA 1E0YA 2VFSA 5D79A 2P4PA 1FIQB 3DQ0A 4HG0A 2Y3RA 4PVKA 5FXDA 1WVFA 1W1JA 4EC3A 4PVJA 5AE2A 3S1CA 3TX1A 4JAYA 4OALA 3SR6B 2Y3SA 3NS1B 1V97A 3C0PA 2VFRA 3W8ZA 2O3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZN A;  1JRP A;  1W1O A;  3LAE A;  3KJM A;  3PM9 A;  1W1S A;  1N5W C;  2VAO A;  4XLO A;  3NRZ B;  4O95 A;  1ZXI C;  2R8D A;  4PYT A;  5FXP A;  3NVZ B;  2AXR A;  1VDV A;  4ML8 A;  1W1K A;  1DII A;  2R2Z A;  1N62 C;  1I19 A;  2BVH A;  5FXE A;  3W8X A;  1RM6 B;  2W54 A;  3HRD C;  1MBT A;  1E8G A;  1ZR6 A;  1AHU A;  1JRO A;  1UXY A;  2P3H A;  3B9J B;  3NVY B;  3AN1 A;  2W3S A;  2NQW A;  2OAI A;  1AHV A;  2E3T A;  3ETR B;  1F0X A;  2W3R A;  4JB1 A;  1W1M A;  3NVW B;  1VAO A;  2VFU A;  1W1Q A;  2Q85 A;  5HMR A;  1WYG A;  1QLT A;  2Q4W A;  3BW7 A;  4BC7 A;  1E8F A;  2QKN A;  1FFU C;  2MBR A;  1T3Q C;  2P13 A;  3S1D A;  1E8H A;  3LLB A;  5G5G B;  5ADZ A;  2BVF A;  1W1R A;  3S1E A;  2YVS A;  2PLI A;  2VFT A;  5AE1 A;  3EUB 3;  1W1L A;  3DED A;  1DIQ A;  2PLS A;  1FFV C;  1AHZ A;  2I0K A;  2GQT A;  3NVV B;  2VFV A;  1SB3 B;  4BBY A;  5G5H B;  1N63 C;  2BVG A;  3AM9 A;  1WVE A;  3W8W A;  2RK5 A;  5HHZ A;  1FO4 A;  1N60 C;  1N5X A;  4BC9 A;  3I99 A;  5FXF A;  2EXR A;  2QPM A;  3S1F A;  1MBB A;  4MLA A;  1QLU A;  4ZOH B;  5AE3 A;  2GQU A;  2W55 A;  1HSK A;  1N61 C;  4BCA A;  5HQX A;  3JS8 A;  3AMZ A;  1E0Y A;  2VFS A;  2P4P A;  1FIQ B;  3DQ0 A;  4HG0 A;  5FXD A;  1WVF A;  1W1J A;  5AE2 A;  3S1C A;  3TX1 A;  4JAY A;  4OAL A;  3SR6 B;  3NS1 B;  1V97 A;  3C0P A;  2VFR A;  3W8Z A;  2O3G A; 
#chains in the Genus database with same CATH topology
 3RJ8 A;  1DZN A;  1JRP A;  2Y08 A;  1W1O A;  3LAE A;  3KJM A;  3PM9 A;  1W1S A;  1N5W C;  2VAO A;  4XLO A;  3NRZ B;  4O95 A;  3POP A;  3D2J A;  5I1V A;  1ZXI C;  2R8D A;  3FW8 A;  3HSU A;  4PYT A;  3TSH A;  5FXP A;  3NVZ B;  2AXR A;  1VDV A;  4ML8 A;  1W1K A;  4PWC A;  1DII A;  3TSJ A;  2R2Z A;  1N62 C;  1I19 A;  2BVH A;  3FW9 A;  5L6G A;  5FXE A;  2UUV A;  3W8X A;  1RM6 B;  5K8E A;  2W54 A;  3HRD C;  1MBT A;  1E8G A;  1ZR6 A;  1AHU A;  1JRO A;  1UXY A;  2P3H A;  3B9J B;  3FWA A;  3NVY B;  3AN1 A;  2W3S A;  2NQW A;  2OAI A;  1AHV A;  2E3T A;  2UUU A;  3ETR B;  1F0X A;  2W3R A;  4JB1 A;  1W1M A;  3NVW B;  1VAO A;  2VFU A;  1W1Q A;  2Q85 A;  3VTE A;  5HMR A;  1WYG A;  1QLT A;  2Q4W A;  3BW7 A;  4BC7 A;  1E8F A;  2QKN A;  1FFU C;  2MBR A;  1T3Q C;  2P13 A;  3GSY A;  3S1D A;  1E8H A;  3RJA A;  3LLB A;  4DNS A;  5G5G B;  3D2D A;  5ADZ A;  2BVF A;  1W1R A;  3S1E A;  2YVS A;  4PWB A;  2Y4G A;  3D2H A;  2PLI A;  3FW7 A;  2VFT A;  5AE1 A;  3EUB 3;  1W1L A;  3DED A;  1DIQ A;  2PLS A;  1FFV C;  1AHZ A;  2I0K A;  2GQT A;  3NVV B;  2VFV A;  1SB3 B;  4PVE A;  4BBY A;  2WDW A;  5G5H B;  1N63 C;  2BVG A;  3AM9 A;  1WVE A;  3W8W A;  2RK5 A;  5HHZ A;  1FO4 A;  1N60 C;  1N5X A;  4BC9 A;  4PVH A;  3I99 A;  5FXF A;  3PQB A;  5AWV A;  2EXR A;  5I1W A;  2QPM A;  3S1F A;  1MBB A;  2IPI A;  4MLA A;  1QLU A;  4ZOH B;  5L6F A;  4UD8 A;  5AE3 A;  2GQU A;  2W55 A;  1HSK A;  1N61 C;  4BCA A;  5HQX A;  4PZF A;  3JS8 A;  3AMZ A;  1E0Y A;  2VFS A;  5D79 A;  2P4P A;  1FIQ B;  3DQ0 A;  4HG0 A;  2Y3R A;  4PVK A;  5FXD A;  1WVF A;  1W1J A;  4EC3 A;  4PVJ A;  5AE2 A;  3S1C A;  3TX1 A;  4JAY A;  4OAL A;  3SR6 B;  2Y3S A;  3NS1 B;  1V97 A;  3C0P A;  2VFR A;  3W8Z A;  2O3G A; 
#chains in the Genus database with same CATH homology
 3RJ8 A;  1DZN A;  1JRP A;  2Y08 A;  1W1O A;  3LAE A;  3KJM A;  3PM9 A;  1W1S A;  1N5W C;  2VAO A;  4XLO A;  3NRZ B;  4O95 A;  3POP A;  3D2J A;  5I1V A;  1ZXI C;  2R8D A;  3FW8 A;  3HSU A;  4PYT A;  3TSH A;  5FXP A;  3NVZ B;  2AXR A;  1VDV A;  4ML8 A;  1W1K A;  4PWC A;  1DII A;  3TSJ A;  2R2Z A;  1N62 C;  1I19 A;  2BVH A;  3FW9 A;  5L6G A;  5FXE A;  2UUV A;  3W8X A;  1RM6 B;  5K8E A;  2W54 A;  3HRD C;  1MBT A;  1E8G A;  1ZR6 A;  1AHU A;  1JRO A;  1UXY A;  2P3H A;  3B9J B;  3FWA A;  3NVY B;  3AN1 A;  2W3S A;  2NQW A;  2OAI A;  1AHV A;  2E3T A;  2UUU A;  3ETR B;  1F0X A;  2W3R A;  4JB1 A;  1W1M A;  3NVW B;  1VAO A;  2VFU A;  1W1Q A;  2Q85 A;  3VTE A;  5HMR A;  1WYG A;  1QLT A;  2Q4W A;  3BW7 A;  4BC7 A;  1E8F A;  2QKN A;  1FFU C;  2MBR A;  1T3Q C;  2P13 A;  3GSY A;  3S1D A;  1E8H A;  3RJA A;  3LLB A;  4DNS A;  5G5G B;  3D2D A;  5ADZ A;  2BVF A;  1W1R A;  3S1E A;  2YVS A;  4PWB A;  2Y4G A;  3D2H A;  2PLI A;  3FW7 A;  2VFT A;  5AE1 A;  3EUB 3;  1W1L A;  3DED A;  1DIQ A;  2PLS A;  1FFV C;  1AHZ A;  2I0K A;  2GQT A;  3NVV B;  2VFV A;  1SB3 B;  4PVE A;  4BBY A;  2WDW A;  5G5H B;  1N63 C;  2BVG A;  3AM9 A;  1WVE A;  3W8W A;  2RK5 A;  5HHZ A;  1FO4 A;  1N60 C;  1N5X A;  4BC9 A;  4PVH A;  3I99 A;  5FXF A;  3PQB A;  5AWV A;  2EXR A;  5I1W A;  2QPM A;  3S1F A;  1MBB A;  2IPI A;  4MLA A;  1QLU A;  4ZOH B;  5L6F A;  4UD8 A;  5AE3 A;  2GQU A;  2W55 A;  1HSK A;  1N61 C;  4BCA A;  5HQX A;  4PZF A;  3JS8 A;  3AMZ A;  1E0Y A;  2VFS A;  5D79 A;  2P4P A;  1FIQ B;  3DQ0 A;  4HG0 A;  2Y3R A;  4PVK A;  5FXD A;  1WVF A;  1W1J A;  4EC3 A;  4PVJ A;  5AE2 A;  3S1C A;  3TX1 A;  4JAY A;  4OAL A;  3SR6 B;  2Y3S A;  3NS1 B;  1V97 A;  3C0P A;  2VFR A;  3W8Z A;  2O3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...