2NQWA

Structure of the transporter associated domain from pg_0272, a cbs domain protein from porphyromonas gingivalis
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
LPFKVLGDGSYLFEGKTSLSDVRHYLDLPENAFGELGDEVDTLSGLFLEIKQELPHVGDTAVYEPFRFQVTQMDKRRIIEIKIFPFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the transporter associated domain from PG_0272, a CBS domain protein from Porphyromonas gingivalis.
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
molecule keywords CBS domain protein
total genus 20
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2006-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03471 CorC_HlyC Transporter associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.10 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 2nqwA00
1FO4A 5FXFA 3LAEA 1DIQA 1FIQB 4HG0A 1DZNA 3AMZA 2W3RA 2W3SA 4MLAA 1WVFA 1RM6B 2P3HA 1AHUA 2BVGA 5AE3A 1W1JA 2VFUA 2O3GA 4ZOHB 3NVWB 1E0YA 3NVVB 1MBBA 3I99A 2R8DA 1JRPA 1E8GA 1UXYA 1T3QC 3B9JB 2P4PA 1W1KA 4BCAA 1VDVA 2Q85A 1F0XA 5HMRA 3S1FA 5FXDA 3ETRB 2GQTA 2BVHA 3S1EA 1N62C 5HHZA 3LLBA 1ZR6A 2YVSA 1WYGA 1QLTA 3W8ZA 1MBTA 3BW7A 2VFVA 3NS1B 3TX1A 3NVYB 1AHZA 2Q4WA 2EXRA 4JB1A 1W1QA 3AN1A 1WVEA 2E3TA 2VAOA 1QLUA 1W1LA 5FXEA 2BVFA 4OALA 3EUB3 3W8XA 4BBYA 2MBRA 3AM9A 3C0PA 3DEDA 4O95A 2QKNA 1W1OA 1W1SA 2PLIA 2VFTA 1DIIA 1FFUC 3HRDC 5AE2A 1W1MA 2VFSA 1ZXIC 3JS8A 2W55A 1N5WC 3W8WA 1E8HA 1N61C 5ADZA 1N63C 3NRZB 1N5XA 3S1CA 4ML8A 1N60C 2VFRA 4PYTA 3DQ0A 5FXPA 2R2ZA 2OAIA 1JROA 1I19A 3SR6B 3NVZB 4BC9A 2I0KA 3PM9A 1FFVC 2W54A 4XLOA 5G5HB 5HQXA 2NQWA 1SB3B 5AE1A 1AHVA 1HSKA 3KJMA 4BC7A 1VAOA 1E8FA 2QPMA 5G5GB 2GQUA 1V97A 2AXRA 2PLSA 2P13A 2RK5A 4JAYA 3S1DA 1W1RA
chains in the Genus database with same CATH superfamily
1FO4A 3FW8A 5FXFA 3D2HA 1DIQA 3LAEA 1FIQB 2Y3RA 4PWCA 4PWBA 3HSUA 4HG0A 1DZNA 3AMZA 2W3RA 3POPA 2W3SA 4MLAA 1WVFA 1RM6B 2P3HA 1AHUA 2BVGA 5AE3A 1W1JA 2UUVA 2VFUA 2O3GA 4ZOHB 3NVWB 1E0YA 3NVVB 1MBBA 3FW9A 3I99A 2R8DA 1JRPA 1E8GA 1UXYA 1T3QC 2Y4GA 3B9JB 2P4PA 1W1KA 4PZFA 4BCAA 1VDVA 2Q85A 1F0XA 5HMRA 3S1FA 5FXDA 3ETRB 2GQTA 4UD8A 2BVHA 5I1WA 3S1EA 1N62C 5HHZA 5I1VA 3LLBA 1ZR6A 2Y3SA 2YVSA 1WYGA 1QLTA 3W8ZA 1MBTA 5AWVA 3BW7A 2VFVA 3NS1B 5L6FA 3TSJA 3TX1A 3NVYB 1AHZA 2Q4WA 2EXRA 4JB1A 3FWAA 1W1QA 3AN1A 1WVEA 2E3TA 2VAOA 1QLUA 1W1LA 5FXEA 3RJ8A 2BVFA 2IPIA 4OALA 3EUB3 3TSHA 3W8XA 4BBYA 2MBRA 3AM9A 3C0PA 3DEDA 4O95A 2QKNA 3D2JA 5D79A 1W1OA 5L6GA 1W1SA 2PLIA 2VFTA 1DIIA 1FFUC 2Y08A 3HRDC 3RJAA 1W1MA 5AE2A 2VFSA 4EC3A 1ZXIC 3JS8A 2W55A 1N5WC 4PVHA 3W8WA 1E8HA 1N61C 5ADZA 1N63C 3NRZB 1N5XA 3FW7A 2WDWA 3S1CA 4ML8A 1N60C 2VFRA 4PYTA 3D2DA 3DQ0A 5FXPA 3VTEA 2R2ZA 4DNSA 5K8EA 2OAIA 1JROA 1I19A 3GSYA 3SR6B 3NVZB 3PQBA 4BC9A 2I0KA 3PM9A 1FFVC 2W54A 4XLOA 5G5HB 4PVKA 5HQXA 2NQWA 1SB3B 5AE1A 1AHVA 1HSKA 3KJMA 4PVJA 4BC7A 1VAOA 1E8FA 2QPMA 2UUUA 5G5GB 2GQUA 4PVEA 1V97A 2AXRA 2PLSA 2P13A 2RK5A 4JAYA 3S1DA 1W1RA
chains in the Genus database with same CATH topology
1FO4A 3FW8A 5FXFA 3D2HA 1DIQA 3LAEA 1FIQB 2Y3RA 4PWCA 4PWBA 3HSUA 4HG0A 1DZNA 3AMZA 2W3RA 3POPA 2W3SA 4MLAA 1WVFA 1RM6B 2P3HA 1AHUA 2BVGA 5AE3A 1W1JA 2UUVA 2VFUA 2O3GA 4ZOHB 3NVWB 1E0YA 3NVVB 1MBBA 3FW9A 3I99A 2R8DA 1JRPA 1E8GA 1UXYA 1T3QC 2Y4GA 3B9JB 2P4PA 1W1KA 4PZFA 4BCAA 1VDVA 2Q85A 1F0XA 5HMRA 3S1FA 5FXDA 3ETRB 2GQTA 4UD8A 2BVHA 5I1WA 3S1EA 1N62C 5HHZA 5I1VA 3LLBA 1ZR6A 2Y3SA 2YVSA 1WYGA 1QLTA 3W8ZA 1MBTA 5AWVA 3BW7A 2VFVA 3NS1B 5L6FA 3TSJA 3TX1A 3NVYB 1AHZA 2Q4WA 2EXRA 4JB1A 3FWAA 1W1QA 3AN1A 1WVEA 2E3TA 2VAOA 1QLUA 1W1LA 5FXEA 3RJ8A 2BVFA 2IPIA 4OALA 3EUB3 3TSHA 3W8XA 4BBYA 2MBRA 3AM9A 3C0PA 3DEDA 4O95A 2QKNA 3D2JA 5D79A 1W1OA 5L6GA 1W1SA 2PLIA 2VFTA 1DIIA 1FFUC 2Y08A 3HRDC 3RJAA 1W1MA 5AE2A 2VFSA 4EC3A 1ZXIC 3JS8A 2W55A 1N5WC 4PVHA 3W8WA 1E8HA 1N61C 5ADZA 1N63C 3NRZB 1N5XA 3FW7A 2WDWA 3S1CA 4ML8A 1N60C 2VFRA 4PYTA 3D2DA 3DQ0A 5FXPA 3VTEA 2R2ZA 4DNSA 5K8EA 2OAIA 1JROA 1I19A 3GSYA 3SR6B 3NVZB 3PQBA 4BC9A 2I0KA 3PM9A 1FFVC 2W54A 4XLOA 5G5HB 4PVKA 5HQXA 2NQWA 1SB3B 5AE1A 1AHVA 1HSKA 3KJMA 4PVJA 4BC7A 1VAOA 1E8FA 2QPMA 2UUUA 5G5GB 2GQUA 4PVEA 1V97A 2AXRA 2PLSA 2P13A 2RK5A 4JAYA 3S1DA 1W1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO4 A;  5FXF A;  3LAE A;  1DIQ A;  1FIQ B;  4HG0 A;  1DZN A;  3AMZ A;  2W3R A;  2W3S A;  4MLA A;  1WVF A;  1RM6 B;  2P3H A;  1AHU A;  2BVG A;  5AE3 A;  1W1J A;  2VFU A;  2O3G A;  4ZOH B;  3NVW B;  1E0Y A;  3NVV B;  1MBB A;  3I99 A;  2R8D A;  1JRP A;  1E8G A;  1UXY A;  1T3Q C;  3B9J B;  2P4P A;  1W1K A;  4BCA A;  1VDV A;  2Q85 A;  1F0X A;  5HMR A;  3S1F A;  5FXD A;  3ETR B;  2GQT A;  2BVH A;  3S1E A;  1N62 C;  5HHZ A;  3LLB A;  1ZR6 A;  2YVS A;  1WYG A;  1QLT A;  3W8Z A;  1MBT A;  3BW7 A;  2VFV A;  3NS1 B;  3TX1 A;  3NVY B;  1AHZ A;  2Q4W A;  2EXR A;  4JB1 A;  1W1Q A;  3AN1 A;  1WVE A;  2E3T A;  2VAO A;  1QLU A;  1W1L A;  5FXE A;  2BVF A;  4OAL A;  3EUB 3;  3W8X A;  4BBY A;  2MBR A;  3AM9 A;  3C0P A;  3DED A;  4O95 A;  2QKN A;  1W1O A;  1W1S A;  2PLI A;  2VFT A;  1DII A;  1FFU C;  3HRD C;  5AE2 A;  1W1M A;  2VFS A;  1ZXI C;  3JS8 A;  2W55 A;  1N5W C;  3W8W A;  1E8H A;  1N61 C;  5ADZ A;  1N63 C;  3NRZ B;  1N5X A;  3S1C A;  4ML8 A;  1N60 C;  2VFR A;  4PYT A;  3DQ0 A;  5FXP A;  2R2Z A;  2OAI A;  1JRO A;  1I19 A;  3SR6 B;  3NVZ B;  4BC9 A;  2I0K A;  3PM9 A;  1FFV C;  2W54 A;  4XLO A;  5G5H B;  5HQX A;  2NQW A;  1SB3 B;  5AE1 A;  1AHV A;  1HSK A;  3KJM A;  4BC7 A;  1VAO A;  1E8F A;  2QPM A;  5G5G B;  2GQU A;  1V97 A;  2AXR A;  2PLS A;  2P13 A;  2RK5 A;  4JAY A;  3S1D A;  1W1R A; 
#chains in the Genus database with same CATH topology
 1FO4 A;  3FW8 A;  5FXF A;  3D2H A;  1DIQ A;  3LAE A;  1FIQ B;  2Y3R A;  4PWC A;  4PWB A;  3HSU A;  4HG0 A;  1DZN A;  3AMZ A;  2W3R A;  3POP A;  2W3S A;  4MLA A;  1WVF A;  1RM6 B;  2P3H A;  1AHU A;  2BVG A;  5AE3 A;  1W1J A;  2UUV A;  2VFU A;  2O3G A;  4ZOH B;  3NVW B;  1E0Y A;  3NVV B;  1MBB A;  3FW9 A;  3I99 A;  2R8D A;  1JRP A;  1E8G A;  1UXY A;  1T3Q C;  2Y4G A;  3B9J B;  2P4P A;  1W1K A;  4PZF A;  4BCA A;  1VDV A;  2Q85 A;  1F0X A;  5HMR A;  3S1F A;  5FXD A;  3ETR B;  2GQT A;  4UD8 A;  2BVH A;  5I1W A;  3S1E A;  1N62 C;  5HHZ A;  5I1V A;  3LLB A;  1ZR6 A;  2Y3S A;  2YVS A;  1WYG A;  1QLT A;  3W8Z A;  1MBT A;  5AWV A;  3BW7 A;  2VFV A;  3NS1 B;  5L6F A;  3TSJ A;  3TX1 A;  3NVY B;  1AHZ A;  2Q4W A;  2EXR A;  4JB1 A;  3FWA A;  1W1Q A;  3AN1 A;  1WVE A;  2E3T A;  2VAO A;  1QLU A;  1W1L A;  5FXE A;  3RJ8 A;  2BVF A;  2IPI A;  4OAL A;  3EUB 3;  3TSH A;  3W8X A;  4BBY A;  2MBR A;  3AM9 A;  3C0P A;  3DED A;  4O95 A;  2QKN A;  3D2J A;  5D79 A;  1W1O A;  5L6G A;  1W1S A;  2PLI A;  2VFT A;  1DII A;  1FFU C;  2Y08 A;  3HRD C;  3RJA A;  1W1M A;  5AE2 A;  2VFS A;  4EC3 A;  1ZXI C;  3JS8 A;  2W55 A;  1N5W C;  4PVH A;  3W8W A;  1E8H A;  1N61 C;  5ADZ A;  1N63 C;  3NRZ B;  1N5X A;  3FW7 A;  2WDW A;  3S1C A;  4ML8 A;  1N60 C;  2VFR A;  4PYT A;  3D2D A;  3DQ0 A;  5FXP A;  3VTE A;  2R2Z A;  4DNS A;  5K8E A;  2OAI A;  1JRO A;  1I19 A;  3GSY A;  3SR6 B;  3NVZ B;  3PQB A;  4BC9 A;  2I0K A;  3PM9 A;  1FFV C;  2W54 A;  4XLO A;  5G5H B;  4PVK A;  5HQX A;  2NQW A;  1SB3 B;  5AE1 A;  1AHV A;  1HSK A;  3KJM A;  4PVJ A;  4BC7 A;  1VAO A;  1E8F A;  2QPM A;  2UUU A;  5G5G B;  2GQU A;  4PVE A;  1V97 A;  2AXR A;  2PLS A;  2P13 A;  2RK5 A;  4JAY A;  3S1D A;  1W1R A; 
#chains in the Genus database with same CATH homology
 1FO4 A;  3FW8 A;  5FXF A;  3D2H A;  1DIQ A;  3LAE A;  1FIQ B;  2Y3R A;  4PWC A;  4PWB A;  3HSU A;  4HG0 A;  1DZN A;  3AMZ A;  2W3R A;  3POP A;  2W3S A;  4MLA A;  1WVF A;  1RM6 B;  2P3H A;  1AHU A;  2BVG A;  5AE3 A;  1W1J A;  2UUV A;  2VFU A;  2O3G A;  4ZOH B;  3NVW B;  1E0Y A;  3NVV B;  1MBB A;  3FW9 A;  3I99 A;  2R8D A;  1JRP A;  1E8G A;  1UXY A;  1T3Q C;  2Y4G A;  3B9J B;  2P4P A;  1W1K A;  4PZF A;  4BCA A;  1VDV A;  2Q85 A;  1F0X A;  5HMR A;  3S1F A;  5FXD A;  3ETR B;  2GQT A;  4UD8 A;  2BVH A;  5I1W A;  3S1E A;  1N62 C;  5HHZ A;  5I1V A;  3LLB A;  1ZR6 A;  2Y3S A;  2YVS A;  1WYG A;  1QLT A;  3W8Z A;  1MBT A;  5AWV A;  3BW7 A;  2VFV A;  3NS1 B;  5L6F A;  3TSJ A;  3TX1 A;  3NVY B;  1AHZ A;  2Q4W A;  2EXR A;  4JB1 A;  3FWA A;  1W1Q A;  3AN1 A;  1WVE A;  2E3T A;  2VAO A;  1QLU A;  1W1L A;  5FXE A;  3RJ8 A;  2BVF A;  2IPI A;  4OAL A;  3EUB 3;  3TSH A;  3W8X A;  4BBY A;  2MBR A;  3AM9 A;  3C0P A;  3DED A;  4O95 A;  2QKN A;  3D2J A;  5D79 A;  1W1O A;  5L6G A;  1W1S A;  2PLI A;  2VFT A;  1DII A;  1FFU C;  2Y08 A;  3HRD C;  3RJA A;  1W1M A;  5AE2 A;  2VFS A;  4EC3 A;  1ZXI C;  3JS8 A;  2W55 A;  1N5W C;  4PVH A;  3W8W A;  1E8H A;  1N61 C;  5ADZ A;  1N63 C;  3NRZ B;  1N5X A;  3FW7 A;  2WDW A;  3S1C A;  4ML8 A;  1N60 C;  2VFR A;  4PYT A;  3D2D A;  3DQ0 A;  5FXP A;  3VTE A;  2R2Z A;  4DNS A;  5K8E A;  2OAI A;  1JRO A;  1I19 A;  3GSY A;  3SR6 B;  3NVZ B;  3PQB A;  4BC9 A;  2I0K A;  3PM9 A;  1FFV C;  2W54 A;  4XLO A;  5G5H B;  4PVK A;  5HQX A;  2NQW A;  1SB3 B;  5AE1 A;  1AHV A;  1HSK A;  3KJM A;  4PVJ A;  4BC7 A;  1VAO A;  1E8F A;  2QPM A;  2UUU A;  5G5G B;  2GQU A;  4PVE A;  1V97 A;  2AXR A;  2PLS A;  2P13 A;  2RK5 A;  4JAY A;  3S1D A;  1W1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...