5AWVA

Crystal structure of glycopeptide hexose oxidase dbv29 complexed with teicoplanin
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative hexose oxidase
publication title Interception of teicoplanin oxidation intermediates yields new antimicrobial scaffolds.
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
molecule tags Oxidoreductase/antibiotic
total genus 159
structure length 498
sequence length 498
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5awvA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5awvA02
2AXRA 3PQBA 5I1WA 3GSYA 4PVHA 2BVGA 3W8WA 3RJ8A 5L6FA 2BVHA 3HSUA 3FW9A 4PVJA 4PZFA 4UD8A 4PWBA 3D2JA 4DNSA 4PWCA 3W8ZA 3POPA 3FW7A 3D2DA 1ZR6A 3TSHA 4XLOA 3D2HA 5K8EA 3FW8A 3TSJA 4PVEA 4EC3A 5AWVA 2IPIA 2Y3SA 2Y4GA 3RJAA 3VTEA 3W8XA 5L6GA 2UUVA 5I1VA 2Y08A 2BVFA 2UUUA 5D79A 2Y3RA 4PVKA 3FWAA 2WDWA
chains in the Genus database with same CATH superfamily
3AM9A 5I1WA 4PVHA 1AHVA 3W8WA 2VFSA 3HSUA 3FW9A 5G5HB 2W54A 2QPMA 1N62C 5ADZA 1VDVA 2I0KA 5HQXA 1W1QA 1N5XA 3D2DA 3LLBA 1DIQA 4XLOA 1RM6B 3FW8A 1ZXIC 4PVEA 3TSJA 4EC3A 2EXRA 2IPIA 3NVZB 4ZOHB 3AMZA 1QLTA 3C0PA 4BBYA 3BW7A 5I1VA 1JRPA 1W1RA 4BC9A 5D79A 5HMRA 2MBRA 3PM9A 4BCAA 4BC7A 2WDWA 2AXRA 2W55A 2VAOA 3GSYA 3PQBA 2E3TA 4JB1A 1HSKA 1N5WC 5FXDA 2W3SA 2O3GA 4PZFA 2OAIA 1N60C 3S1FA 4UD8A 1WYGA 4ML8A 1V97A 3ETRB 1VAOA 5HHZA 3POPA 3NVWB 3HRDC 1W1JA 3TSHA 2QKNA 5FXPA 2P13A 4O95A 1E0YA 1DZNA 2Q85A 2NQWA 3NS1B 5L6GA 2P4PA 2VFVA 2Y08A 5G5GB 1FFVC 2BVFA 2Y3RA 3S1DA 5FXFA 3FWAA 1N61C 5FXEA 2BVGA 4OALA 5L6FA 2BVHA 2VFRA 4HG0A 3NVYB 1W1KA 2PLSA 3NVVB 2RK5A 2PLIA 4PWBA 4DNSA 4PWCA 1W1SA 1E8FA 3TX1A 1UXYA 3W8ZA 1AHUA 3NRZB 2VFUA 3LAEA 1AHZA 3D2HA 1E8HA 4MLAA 1JROA 1FFUC 2Y4GA 2R8DA 3RJAA 3VTEA 1FIQB 2GQUA 2R2ZA 1SB3B 2W3RA 2VFTA 3B9JB 1W1LA 3DQ0A 2GQTA 1FO4A 2Q4WA 1MBTA 3SR6B 1DIIA 3RJ8A 4PVJA 3JS8A 4JAYA 3D2JA 5AE3A 1T3QC 1F0XA 3FW7A 5AE2A 1ZR6A 3S1EA 1W1MA 1W1OA 5K8EA 3EUB3 1WVEA 1QLUA 5AWVA 3DEDA 2Y3SA 3KJMA 3W8XA 3I99A 1N63C 2UUVA 4PYTA 5AE1A 1WVFA 1E8GA 1I19A 3S1CA 2UUUA 1MBBA 4PVKA 2YVSA 3AN1A 2P3HA
chains in the Genus database with same CATH topology
3AM9A 5I1WA 4PVHA 1AHVA 3W8WA 2VFSA 3HSUA 3FW9A 5G5HB 2W54A 2QPMA 1N62C 5ADZA 1VDVA 2I0KA 5HQXA 1W1QA 1N5XA 3D2DA 3LLBA 1DIQA 4XLOA 1RM6B 3FW8A 1ZXIC 4PVEA 3TSJA 4EC3A 2EXRA 2IPIA 3NVZB 4ZOHB 3AMZA 1QLTA 3C0PA 4BBYA 3BW7A 5I1VA 1JRPA 1W1RA 4BC9A 5D79A 5HMRA 2MBRA 3PM9A 4BCAA 4BC7A 2WDWA 2AXRA 2W55A 2VAOA 3GSYA 3PQBA 2E3TA 4JB1A 1HSKA 1N5WC 5FXDA 2W3SA 2O3GA 4PZFA 2OAIA 1N60C 3S1FA 4UD8A 1WYGA 4ML8A 1V97A 3ETRB 1VAOA 5HHZA 3POPA 3NVWB 3HRDC 1W1JA 3TSHA 2QKNA 5FXPA 2P13A 4O95A 1E0YA 1DZNA 2Q85A 2NQWA 3NS1B 5L6GA 2P4PA 2VFVA 2Y08A 5G5GB 1FFVC 2BVFA 2Y3RA 3S1DA 5FXFA 3FWAA 1N61C 5FXEA 2BVGA 4OALA 5L6FA 2BVHA 2VFRA 4HG0A 3NVYB 1W1KA 2PLSA 3NVVB 2RK5A 2PLIA 4PWBA 4DNSA 4PWCA 1W1SA 1E8FA 3TX1A 1UXYA 3W8ZA 1AHUA 3NRZB 2VFUA 3LAEA 1AHZA 3D2HA 1E8HA 4MLAA 1JROA 1FFUC 2Y4GA 2R8DA 3RJAA 3VTEA 1FIQB 2GQUA 2R2ZA 1SB3B 2W3RA 2VFTA 3B9JB 1W1LA 3DQ0A 2GQTA 1FO4A 2Q4WA 1MBTA 3SR6B 1DIIA 3RJ8A 4PVJA 3JS8A 4JAYA 3D2JA 5AE3A 1T3QC 1F0XA 3FW7A 5AE2A 1ZR6A 3S1EA 1W1MA 1W1OA 5K8EA 3EUB3 1WVEA 1QLUA 5AWVA 3DEDA 2Y3SA 3KJMA 3W8XA 3I99A 1N63C 2UUVA 4PYTA 5AE1A 1WVFA 1E8GA 1I19A 3S1CA 2UUUA 1MBBA 4PVKA 2YVSA 3AN1A 2P3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXR A;  3PQB A;  5I1W A;  3GSY A;  4PVH A;  2BVG A;  3W8W A;  3RJ8 A;  5L6F A;  2BVH A;  3HSU A;  3FW9 A;  4PVJ A;  4PZF A;  4UD8 A;  4PWB A;  3D2J A;  4DNS A;  4PWC A;  3W8Z A;  3POP A;  3FW7 A;  3D2D A;  1ZR6 A;  3TSH A;  4XLO A;  3D2H A;  5K8E A;  3FW8 A;  3TSJ A;  4PVE A;  4EC3 A;  5AWV A;  2IPI A;  2Y3S A;  2Y4G A;  3RJA A;  3VTE A;  3W8X A;  5L6G A;  2UUV A;  5I1V A;  2Y08 A;  2BVF A;  2UUU A;  5D79 A;  2Y3R A;  4PVK A;  3FWA A;  2WDW A; 
#chains in the Genus database with same CATH topology
 3AM9 A;  5I1W A;  4PVH A;  1AHV A;  3W8W A;  2VFS A;  3HSU A;  3FW9 A;  5G5H B;  2W54 A;  2QPM A;  1N62 C;  5ADZ A;  1VDV A;  2I0K A;  5HQX A;  1W1Q A;  1N5X A;  3D2D A;  3LLB A;  1DIQ A;  4XLO A;  1RM6 B;  3FW8 A;  1ZXI C;  4PVE A;  3TSJ A;  4EC3 A;  2EXR A;  2IPI A;  3NVZ B;  4ZOH B;  3AMZ A;  1QLT A;  3C0P A;  4BBY A;  3BW7 A;  5I1V A;  1JRP A;  1W1R A;  4BC9 A;  5D79 A;  5HMR A;  2MBR A;  3PM9 A;  4BCA A;  4BC7 A;  2WDW A;  2AXR A;  2W55 A;  2VAO A;  3GSY A;  3PQB A;  2E3T A;  4JB1 A;  1HSK A;  1N5W C;  5FXD A;  2W3S A;  2O3G A;  4PZF A;  2OAI A;  1N60 C;  3S1F A;  4UD8 A;  1WYG A;  4ML8 A;  1V97 A;  3ETR B;  1VAO A;  5HHZ A;  3POP A;  3NVW B;  3HRD C;  1W1J A;  3TSH A;  2QKN A;  5FXP A;  2P13 A;  4O95 A;  1E0Y A;  1DZN A;  2Q85 A;  2NQW A;  3NS1 B;  5L6G A;  2P4P A;  2VFV A;  2Y08 A;  5G5G B;  1FFV C;  2BVF A;  2Y3R A;  3S1D A;  5FXF A;  3FWA A;  1N61 C;  5FXE A;  2BVG A;  4OAL A;  5L6F A;  2BVH A;  2VFR A;  4HG0 A;  3NVY B;  1W1K A;  2PLS A;  3NVV B;  2RK5 A;  2PLI A;  4PWB A;  4DNS A;  4PWC A;  1W1S A;  1E8F A;  3TX1 A;  1UXY A;  3W8Z A;  1AHU A;  3NRZ B;  2VFU A;  3LAE A;  1AHZ A;  3D2H A;  1E8H A;  4MLA A;  1JRO A;  1FFU C;  2Y4G A;  2R8D A;  3RJA A;  3VTE A;  1FIQ B;  2GQU A;  2R2Z A;  1SB3 B;  2W3R A;  2VFT A;  3B9J B;  1W1L A;  3DQ0 A;  2GQT A;  1FO4 A;  2Q4W A;  1MBT A;  3SR6 B;  1DII A;  3RJ8 A;  4PVJ A;  3JS8 A;  4JAY A;  3D2J A;  5AE3 A;  1T3Q C;  1F0X A;  3FW7 A;  5AE2 A;  1ZR6 A;  3S1E A;  1W1M A;  1W1O A;  5K8E A;  3EUB 3;  1WVE A;  1QLU A;  5AWV A;  3DED A;  2Y3S A;  3KJM A;  3W8X A;  3I99 A;  1N63 C;  2UUV A;  4PYT A;  5AE1 A;  1WVF A;  1E8G A;  1I19 A;  3S1C A;  2UUU A;  1MBB A;  4PVK A;  2YVS A;  3AN1 A;  2P3H A; 
#chains in the Genus database with same CATH homology
 3AM9 A;  5I1W A;  4PVH A;  1AHV A;  3W8W A;  2VFS A;  3HSU A;  3FW9 A;  5G5H B;  2W54 A;  2QPM A;  1N62 C;  5ADZ A;  1VDV A;  2I0K A;  5HQX A;  1W1Q A;  1N5X A;  3D2D A;  3LLB A;  1DIQ A;  4XLO A;  1RM6 B;  3FW8 A;  1ZXI C;  4PVE A;  3TSJ A;  4EC3 A;  2EXR A;  2IPI A;  3NVZ B;  4ZOH B;  3AMZ A;  1QLT A;  3C0P A;  4BBY A;  3BW7 A;  5I1V A;  1JRP A;  1W1R A;  4BC9 A;  5D79 A;  5HMR A;  2MBR A;  3PM9 A;  4BCA A;  4BC7 A;  2WDW A;  2AXR A;  2W55 A;  2VAO A;  3GSY A;  3PQB A;  2E3T A;  4JB1 A;  1HSK A;  1N5W C;  5FXD A;  2W3S A;  2O3G A;  4PZF A;  2OAI A;  1N60 C;  3S1F A;  4UD8 A;  1WYG A;  4ML8 A;  1V97 A;  3ETR B;  1VAO A;  5HHZ A;  3POP A;  3NVW B;  3HRD C;  1W1J A;  3TSH A;  2QKN A;  5FXP A;  2P13 A;  4O95 A;  1E0Y A;  1DZN A;  2Q85 A;  2NQW A;  3NS1 B;  5L6G A;  2P4P A;  2VFV A;  2Y08 A;  5G5G B;  1FFV C;  2BVF A;  2Y3R A;  3S1D A;  5FXF A;  3FWA A;  1N61 C;  5FXE A;  2BVG A;  4OAL A;  5L6F A;  2BVH A;  2VFR A;  4HG0 A;  3NVY B;  1W1K A;  2PLS A;  3NVV B;  2RK5 A;  2PLI A;  4PWB A;  4DNS A;  4PWC A;  1W1S A;  1E8F A;  3TX1 A;  1UXY A;  3W8Z A;  1AHU A;  3NRZ B;  2VFU A;  3LAE A;  1AHZ A;  3D2H A;  1E8H A;  4MLA A;  1JRO A;  1FFU C;  2Y4G A;  2R8D A;  3RJA A;  3VTE A;  1FIQ B;  2GQU A;  2R2Z A;  1SB3 B;  2W3R A;  2VFT A;  3B9J B;  1W1L A;  3DQ0 A;  2GQT A;  1FO4 A;  2Q4W A;  1MBT A;  3SR6 B;  1DII A;  3RJ8 A;  4PVJ A;  3JS8 A;  4JAY A;  3D2J A;  5AE3 A;  1T3Q C;  1F0X A;  3FW7 A;  5AE2 A;  1ZR6 A;  3S1E A;  1W1M A;  1W1O A;  5K8E A;  3EUB 3;  1WVE A;  1QLU A;  5AWV A;  3DED A;  2Y3S A;  3KJM A;  3W8X A;  3I99 A;  1N63 C;  2UUV A;  4PYT A;  5AE1 A;  1WVF A;  1E8G A;  1I19 A;  3S1C A;  2UUU A;  1MBB A;  4PVK A;  2YVS A;  3AN1 A;  2P3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...