5AWVA

Crystal structure of glycopeptide hexose oxidase dbv29 complexed with teicoplanin
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
498
structure length
498
Chain Sequence
CLPPAGPVKVTPDDPRYLNLKLRGANSRFNGEPDYIHLVGSTQQVADAVEETVRTGKRVAVRSGGHCFEDFVDNPDVKVIIDMSLLTEIAYDPSMNAFLIEPGNTLSEVYEKLYLGWNVTIPGGVCGGVGVGGHICGGGYGPLSRQFGSVVDYLYAVEVVVVNKQGKARVIVATRERDDPHHDLWWAHTGGGGGNFGVVTKYWMRVPEDVGRNPERLLPKPPATLLTSTVTFDWAGMTEAAFSRLLRNHGEWYERNSGPDSPYTGLWSQLMIGNEVPGMGESGFMMPIQVDATRPDARRLLDAHIEAVIDGVPPAEVPEPIEQRWLASTPGRGGRGPASKTKAGYLRKRLTDRQIQAVYENMTHMDGIDYGAVWLIGYGGKVNTVDPAATALPQRDAILKVNYITGWANPGNEAKHLTWVRKLYADVYAETGGVPVPNDVSDGAYINYPDSDLADPGLNTSGVPWHDLYYKGNHPRLRKVKAAYDPRNHFHHALSIRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative hexose oxidase
publication title Interception of teicoplanin oxidation intermediates yields new antimicrobial scaffolds.
pubmed doi rcsb
source organism Nonomuraea sp. atcc 39727
molecule tags Oxidoreductase/antibiotic
total genus 159
structure length 498
sequence length 498
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01565 FAD_binding_4 FAD binding domain
A PF08031 BBE Berberine and berberine like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.465.40 Alpha Beta 2-Layer Sandwich Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3 5awvA01
3.40.462.20 Alpha Beta 3-Layer(aba) Sandwich Vanillyl-alcohol Oxidase; Chain A, domain 3 Vanillyl-alcohol Oxidase; Chain A, domain 3 5awvA02
1ZR6A 3FW8A 3D2JA 4PVHA 2Y4GA 3FW9A 2Y3RA 4EC3A 3FW7A 2Y08A 5L6FA 3PQBA 2WDWA 2UUVA 3POPA 5I1VA 3HSUA 5AWVA 4XLOA 3RJ8A 3VTEA 2BVFA 3TSJA 3TSHA 2AXRA 2Y3SA 2BVGA 4PVJA 4PWBA 4UD8A 4DNSA 2IPIA 5K8EA 5I1WA 2UUUA 3D2HA 5D79A 3W8ZA 5L6GA 4PVKA 3RJAA 3GSYA 4PVEA 4PWCA 3D2DA 4PZFA 3W8WA 3W8XA 2BVHA 3FWAA
chains in the Genus database with same CATH superfamily
1ZR6A 3FW8A 1MBTA 3D2JA 2QPMA 5FXEA 4PVHA 2P13A 2Y4GA 2E3TA 3FW9A 1E8GA 1AHZA 2GQUA 4MLAA 1WVEA 1FO4A 3NVVB 1DZNA 2VFVA 1T3QC 2UUVA 3BW7A 3JS8A 3POPA 5I1VA 3LAEA 5AE2A 2QKNA 3RJ8A 3HRDC 1WYGA 1FIQB 1HSKA 2Y3SA 3NRZB 5FXPA 1W1KA 4BBYA 3LLBA 1ZXIC 3W8ZA 5I1WA 4BCAA 1FFVC 1W1SA 4PVEA 2PLSA 1N60C 4BC9A 2Q4WA 2BVHA 3NS1B 2MBRA 5FXDA 2VFUA 1VDVA 5HMRA 1QLTA 3FW7A 1AHVA 1DIIA 5HHZA 1W1OA 4O95A 4JAYA 2VFTA 5ADZA 4XLOA 1RM6B 2BVFA 5HQXA 3TSJA 3NVYB 2GQTA 1E8HA 1JROA 4PVJA 2VFSA 2EXRA 1W1RA 5G5GB 3D2HA 1W1JA 5D79A 5L6GA 4PVKA 3GSYA 1JRPA 1SB3B 2W3RA 4PYTA 4ZOHB 2O3GA 2NQWA 3SR6B 4ML8A 1I19A 1UXYA 3ETRB 4EC3A 4JB1A 4HG0A 2R8DA 4BC7A 3PQBA 2VAOA 2WDWA 2Q85A 2W55A 1QLUA 2I0KA 2P3HA 1E8FA 5AWVA 3VTEA 3TSHA 2AXRA 3TX1A 2BVGA 3S1DA 1AHUA 2W3SA 5K8EA 2OAIA 3RJAA 3B9JB 2RK5A 1V97A 4PZFA 3PM9A 3W8WA 1FFUC 3FWAA 5AE1A 1N61C 3NVZB 1DIQA 1N63C 2Y3RA 5G5HB 4OALA 2Y08A 2W54A 3C0PA 5L6FA 5FXFA 2VFRA 1E0YA 3DEDA 3KJMA 1F0XA 1VAOA 3I99A 2YVSA 3AN1A 3AM9A 3HSUA 3DQ0A 3NVWB 1N62C 1N5XA 1MBBA 3S1CA 3AMZA 2R2ZA 4PWBA 4UD8A 4DNSA 2IPIA 1W1LA 1W1MA 1WVFA 2UUUA 3EUB3 1N5WC 5AE3A 2P4PA 4PWCA 3D2DA 2PLIA 3S1EA 3W8XA 3S1FA 1W1QA
chains in the Genus database with same CATH topology
1ZR6A 3FW8A 1MBTA 3D2JA 2QPMA 5FXEA 4PVHA 2P13A 2Y4GA 2E3TA 3FW9A 1E8GA 1AHZA 2GQUA 4MLAA 1WVEA 1FO4A 3NVVB 1DZNA 2VFVA 1T3QC 2UUVA 3BW7A 3JS8A 3POPA 5I1VA 3LAEA 5AE2A 2QKNA 3RJ8A 3HRDC 1WYGA 1FIQB 1HSKA 2Y3SA 3NRZB 5FXPA 1W1KA 4BBYA 3LLBA 1ZXIC 3W8ZA 5I1WA 4BCAA 1FFVC 1W1SA 4PVEA 2PLSA 1N60C 4BC9A 2Q4WA 2BVHA 3NS1B 2MBRA 5FXDA 2VFUA 1VDVA 5HMRA 1QLTA 3FW7A 1AHVA 1DIIA 5HHZA 1W1OA 4O95A 4JAYA 2VFTA 5ADZA 4XLOA 1RM6B 2BVFA 5HQXA 3TSJA 3NVYB 2GQTA 1E8HA 1JROA 4PVJA 2VFSA 2EXRA 1W1RA 5G5GB 3D2HA 1W1JA 5D79A 5L6GA 4PVKA 3GSYA 1JRPA 1SB3B 2W3RA 4PYTA 4ZOHB 2O3GA 2NQWA 3SR6B 4ML8A 1I19A 1UXYA 3ETRB 4EC3A 4JB1A 4HG0A 2R8DA 4BC7A 3PQBA 2VAOA 2WDWA 2Q85A 2W55A 1QLUA 2I0KA 2P3HA 1E8FA 5AWVA 3VTEA 3TSHA 2AXRA 3TX1A 2BVGA 3S1DA 1AHUA 2W3SA 5K8EA 2OAIA 3RJAA 3B9JB 2RK5A 1V97A 4PZFA 3PM9A 3W8WA 1FFUC 3FWAA 5AE1A 1N61C 3NVZB 1DIQA 1N63C 2Y3RA 5G5HB 4OALA 2Y08A 2W54A 3C0PA 5L6FA 5FXFA 2VFRA 1E0YA 3DEDA 3KJMA 1F0XA 1VAOA 3I99A 2YVSA 3AN1A 3AM9A 3HSUA 3DQ0A 3NVWB 1N62C 1N5XA 1MBBA 3S1CA 3AMZA 2R2ZA 4PWBA 4UD8A 4DNSA 2IPIA 1W1LA 1W1MA 1WVFA 2UUUA 3EUB3 1N5WC 5AE3A 2P4PA 4PWCA 3D2DA 2PLIA 3S1EA 3W8XA 3S1FA 1W1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR6 A;  3FW8 A;  3D2J A;  4PVH A;  2Y4G A;  3FW9 A;  2Y3R A;  4EC3 A;  3FW7 A;  2Y08 A;  5L6F A;  3PQB A;  2WDW A;  2UUV A;  3POP A;  5I1V A;  3HSU A;  5AWV A;  4XLO A;  3RJ8 A;  3VTE A;  2BVF A;  3TSJ A;  3TSH A;  2AXR A;  2Y3S A;  2BVG A;  4PVJ A;  4PWB A;  4UD8 A;  4DNS A;  2IPI A;  5K8E A;  5I1W A;  2UUU A;  3D2H A;  5D79 A;  3W8Z A;  5L6G A;  4PVK A;  3RJA A;  3GSY A;  4PVE A;  4PWC A;  3D2D A;  4PZF A;  3W8W A;  3W8X A;  2BVH A;  3FWA A; 
#chains in the Genus database with same CATH topology
 1ZR6 A;  3FW8 A;  1MBT A;  3D2J A;  2QPM A;  5FXE A;  4PVH A;  2P13 A;  2Y4G A;  2E3T A;  3FW9 A;  1E8G A;  1AHZ A;  2GQU A;  4MLA A;  1WVE A;  1FO4 A;  3NVV B;  1DZN A;  2VFV A;  1T3Q C;  2UUV A;  3BW7 A;  3JS8 A;  3POP A;  5I1V A;  3LAE A;  5AE2 A;  2QKN A;  3RJ8 A;  3HRD C;  1WYG A;  1FIQ B;  1HSK A;  2Y3S A;  3NRZ B;  5FXP A;  1W1K A;  4BBY A;  3LLB A;  1ZXI C;  3W8Z A;  5I1W A;  4BCA A;  1FFV C;  1W1S A;  4PVE A;  2PLS A;  1N60 C;  4BC9 A;  2Q4W A;  2BVH A;  3NS1 B;  2MBR A;  5FXD A;  2VFU A;  1VDV A;  5HMR A;  1QLT A;  3FW7 A;  1AHV A;  1DII A;  5HHZ A;  1W1O A;  4O95 A;  4JAY A;  2VFT A;  5ADZ A;  4XLO A;  1RM6 B;  2BVF A;  5HQX A;  3TSJ A;  3NVY B;  2GQT A;  1E8H A;  1JRO A;  4PVJ A;  2VFS A;  2EXR A;  1W1R A;  5G5G B;  3D2H A;  1W1J A;  5D79 A;  5L6G A;  4PVK A;  3GSY A;  1JRP A;  1SB3 B;  2W3R A;  4PYT A;  4ZOH B;  2O3G A;  2NQW A;  3SR6 B;  4ML8 A;  1I19 A;  1UXY A;  3ETR B;  4EC3 A;  4JB1 A;  4HG0 A;  2R8D A;  4BC7 A;  3PQB A;  2VAO A;  2WDW A;  2Q85 A;  2W55 A;  1QLU A;  2I0K A;  2P3H A;  1E8F A;  5AWV A;  3VTE A;  3TSH A;  2AXR A;  3TX1 A;  2BVG A;  3S1D A;  1AHU A;  2W3S A;  5K8E A;  2OAI A;  3RJA A;  3B9J B;  2RK5 A;  1V97 A;  4PZF A;  3PM9 A;  3W8W A;  1FFU C;  3FWA A;  5AE1 A;  1N61 C;  3NVZ B;  1DIQ A;  1N63 C;  2Y3R A;  5G5H B;  4OAL A;  2Y08 A;  2W54 A;  3C0P A;  5L6F A;  5FXF A;  2VFR A;  1E0Y A;  3DED A;  3KJM A;  1F0X A;  1VAO A;  3I99 A;  2YVS A;  3AN1 A;  3AM9 A;  3HSU A;  3DQ0 A;  3NVW B;  1N62 C;  1N5X A;  1MBB A;  3S1C A;  3AMZ A;  2R2Z A;  4PWB A;  4UD8 A;  4DNS A;  2IPI A;  1W1L A;  1W1M A;  1WVF A;  2UUU A;  3EUB 3;  1N5W C;  5AE3 A;  2P4P A;  4PWC A;  3D2D A;  2PLI A;  3S1E A;  3W8X A;  3S1F A;  1W1Q A; 
#chains in the Genus database with same CATH homology
 1ZR6 A;  3FW8 A;  1MBT A;  3D2J A;  2QPM A;  5FXE A;  4PVH A;  2P13 A;  2Y4G A;  2E3T A;  3FW9 A;  1E8G A;  1AHZ A;  2GQU A;  4MLA A;  1WVE A;  1FO4 A;  3NVV B;  1DZN A;  2VFV A;  1T3Q C;  2UUV A;  3BW7 A;  3JS8 A;  3POP A;  5I1V A;  3LAE A;  5AE2 A;  2QKN A;  3RJ8 A;  3HRD C;  1WYG A;  1FIQ B;  1HSK A;  2Y3S A;  3NRZ B;  5FXP A;  1W1K A;  4BBY A;  3LLB A;  1ZXI C;  3W8Z A;  5I1W A;  4BCA A;  1FFV C;  1W1S A;  4PVE A;  2PLS A;  1N60 C;  4BC9 A;  2Q4W A;  2BVH A;  3NS1 B;  2MBR A;  5FXD A;  2VFU A;  1VDV A;  5HMR A;  1QLT A;  3FW7 A;  1AHV A;  1DII A;  5HHZ A;  1W1O A;  4O95 A;  4JAY A;  2VFT A;  5ADZ A;  4XLO A;  1RM6 B;  2BVF A;  5HQX A;  3TSJ A;  3NVY B;  2GQT A;  1E8H A;  1JRO A;  4PVJ A;  2VFS A;  2EXR A;  1W1R A;  5G5G B;  3D2H A;  1W1J A;  5D79 A;  5L6G A;  4PVK A;  3GSY A;  1JRP A;  1SB3 B;  2W3R A;  4PYT A;  4ZOH B;  2O3G A;  2NQW A;  3SR6 B;  4ML8 A;  1I19 A;  1UXY A;  3ETR B;  4EC3 A;  4JB1 A;  4HG0 A;  2R8D A;  4BC7 A;  3PQB A;  2VAO A;  2WDW A;  2Q85 A;  2W55 A;  1QLU A;  2I0K A;  2P3H A;  1E8F A;  5AWV A;  3VTE A;  3TSH A;  2AXR A;  3TX1 A;  2BVG A;  3S1D A;  1AHU A;  2W3S A;  5K8E A;  2OAI A;  3RJA A;  3B9J B;  2RK5 A;  1V97 A;  4PZF A;  3PM9 A;  3W8W A;  1FFU C;  3FWA A;  5AE1 A;  1N61 C;  3NVZ B;  1DIQ A;  1N63 C;  2Y3R A;  5G5H B;  4OAL A;  2Y08 A;  2W54 A;  3C0P A;  5L6F A;  5FXF A;  2VFR A;  1E0Y A;  3DED A;  3KJM A;  1F0X A;  1VAO A;  3I99 A;  2YVS A;  3AN1 A;  3AM9 A;  3HSU A;  3DQ0 A;  3NVW B;  1N62 C;  1N5X A;  1MBB A;  3S1C A;  3AMZ A;  2R2Z A;  4PWB A;  4UD8 A;  4DNS A;  2IPI A;  1W1L A;  1W1M A;  1WVF A;  2UUU A;  3EUB 3;  1N5W C;  5AE3 A;  2P4P A;  4PWC A;  3D2D A;  2PLI A;  3S1E A;  3W8X A;  3S1F A;  1W1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...