1DCEB

Crystal structure of rab geranylgeranyltransferase from rat brain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
329
Chain Sequence
TQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT)
publication title Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
pubmed doi rcsb
total genus 108
structure length 329
sequence length 329
chains with identical sequence D
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1dceB00
4D4CA 5AGDA 2GOXA 3DSUB 4KKIA 1GHQA 1FT1B 4L9PB 1SQCA 4D94A 2V8JA 3Q7FB 3CU7A 1S64B 4D4BA 1GSZA 1C3DA 1FT2B 1NL4B 1TNZB 2H6HB 4GTVB 4MBGB 4ONTA 3D5SA 1TN7B 1H3CA 1LTXB 1O6QA 1N4SB 5FOBB 1O6RA 1N94B 3DSSB 3HXDB 1TNYB 4GTTB 1JCQB 1FPPB 4LNVA 1N95B 3KSLB 3SFXB 4D4AA 4GTQB 4V1RA 4BOJA 4GTRB 4LNGB 1GXMA 3Q78B 4ZRQA 1JCRB 1D8EB 2PMVA 2R2LB 3Q73B 2H6GB 1JCSB 1S63B 3PZ2B 2V3NA 3KQ4A 1QBQB 1TN8B 3PZ4B 1MZCB 3KSQB 1H39A 3K7XA 1TN6B 2SQCA 2G0DA 4GTPB 3Q75B 1W6KA 1GXOA 4ZRPA 3Q79B 1R76A 3OXUA 4FXKB 4GTOB 4C1SA 4D4DA 1O1TB 2BEDB 3Q7AB 2WINB 2PN5A 1NI1B 2F0YB 1SA4B 2BB6A 1O1RB 3DSTB 3EUVB 3DSVB 1HZFA 4FXGB 5JPMB 3E33B 1GXNA 3OEDA 2BBCA 3E32B 3HXCB 3RJ3A 1TNUB 3HXFB 1D8DB 2WIIB 1X81B 1N4PB 2XWBB 1DCEB 4GTSB 3DPYB 4MU9A 2B39A 1TNOB 1H3AA 2G02A 2V8IA 4KKJA 2ZIRB 3DRAB 3DSXB 2IEJB 4GTMB 4ZH1A 1TNBB 2XWJB 3E30B 2I07B 2NOJA 1KZOB 2H6FB 3HXEB 3SFYB 1N9AB 2WY8A 2XQWA 5FO9B 1O1SB 3KLSA 4BOKA 1KZPB 3PZ3B 2A73B 2ZISB 2V8KA 3C72B 4YDOB 4EHMB 1H3BA 2WY7A 4YDEB 1LD8B 5JPNB 1H35A 2BB5A 3DSWB 3EU5B 1W6JA 3E34B 3G6JB 1LD7B 1N4QB 4V1SA 1O5MB 1O6HA 5FO7B 3HXBB 1H36A 3PZ1B 1UMPA 1QQFA 4LNBB 2H6IB 2V3PA 1SA5B 3SQCA 3E37B 1O79A 4M76A 1N4RB 1QSJA 1H37A 3D5RA 5FO8B
chains in the Genus database with same CATH superfamily
4FNVA 3M02A 1HV6A 1HCUA 3S4CA 3S9VA 1KS8A 3SDVA 5M7YA 4WU0A 3PYBA 1FT2B 1RQ5A 1N22A 3S4AA 1GA2A 2NVPA 3EU8A 1O6QA 1N4SB 5FOBB 1XWQA 5IK6A 1FPPB 4LNVA 3KSLB 2X03A 3SFXB 4GTQB 1N7QA 4LNGB 4CE7A 1N23A 3Q73B 2PMVA 2R2LB 2DRQA 5KKBA 1IA6A 3KSQB 2JJBA 2G0DA 1DL2A 3GT5A 3Q79B 4GTOB 4C1SA 3M7CA 1N21A 3WC3A 2WINB 4JJJA 2BRWA 1OJMA 1SA4B 4ZG8A 4J5TA 2BB6A 3NFVA 3WIWA 5CZLA 4KTRA 1HZFA 5JPMB 1GXNA 2BBCA 3E32B 3RJ3A 1V5DA 2DROA 3SDRA 1D8DB 1KSCA 2WIIB 1N4PB 4GTSB 2J5CA 1H3AA 1F9OA 4GTMB 2IEJB 2XWJB 5ILYA 1HX9A 3QSPA 1N9AB 1L1YA 2JF4A 3H3KA 1F1SA 1FBWA 3M75A 3PMMA 3H2WA 2ZISB 2V8KA 3QDEA 3QG0A 3P5PA 3W5MA 1H3BA 1KFGA 4YDEB 2GZ6A 1X9DA 1UG9A 5ILKA 1W6JA 4CJ1A 4OZVA 4Z4LA 3M76A 1N4QB 4V1SA 2WYNA 1G87A 1K72A 4Z4JA 1WU6A 1QQFA 5IKHA 4DOEA 5IL3A 1SA5B 3P2CA 3QWTA 1X1JA 1XWTA 2FUQA 5MEHA 1O79A 4AYOA 1N4RB 3WIRA 5ILIA 4YCRA 3VSMA 5FO8B 5ILDA 4D4CA 3G4FA 4L9PB 1GLMA 1SQCA 2D8LA 1NC5A 4D4BA 4WVBA 1NL4B 3M77A 2JG0A 1HN0A 3TF4A 3H7LA 4GTVB 1HM2A 4ONTA 2Q1FA 3E73A 1O6RA 1N94B 3SDQA 1TNYB 2RI8A 5DGQA 3QPFA 3W7WA 2FV0A 3M74A 2P0VA 4BOJA 4GTRB 2VN4A 4Q88A 3Q78B 2FUZA 1JCRB 3PZ2B 1J0MA 2V3NA 3M7LA 1NXCA 1KSDA 1MZCB 3N0GA 3K7XA 1FMIA 1N1ZA 1TN6B 1W6KA 3M00A 4ZRPA 2EACA 5CD2A 1R76A 2CQSA 4AYRA 3RX5A 3Q7AB 3EQAA 1IA7A 1TF4A 3ACTA 3W7SA 1RWGA 1KWFA 1O1RB 3EUVB 4FXGB 3RENA 1H14A 1FAEA 3QFZA 4F10A 3OEDA 2D5JA 1FO3A 3HXCB 1N7RA 4F13A 1OJNA 3P5RA 5ILJA 2XWBB 4MU9A 1LOHA 4KKJA 2AHGA 3DSXB 3WIQA 1V5CA 1LF6A 4DI5A 1H54A 5DHIA 1V7WA 5IK9A 1KZOB 1N7PA 1G6IA 3SDUA 1O1SB 3KLSA 3ON6A 1KZPB 3PZ3B 1OJPA 1KKTA 1FCEA 3C72B 4EHMB 4L0GA 2WY7A 5IK0A 2BB5A 3DSWB 3EU5B 1HXCA 3W7UA 3E34B 3G6JB 3EZ8A 3K11A 4WVAA 2ONGA 5EAUA 1O6HA 4E1YA 3HXBB 1H36A 5IM1A 2V3PA 1HMUA 1N7NA 1LXMA 3M72A 2QNOA 3SQCA 2EABA 1CEMA 4M76A 3D5RA 4NEIA 2AHFA 5IKAA 2YIKA 1HXGA 5IL8A 3DSUB 4KKIA 3A3VA 1J0NA 1GHQA 3GLYA 2V8JA 3Q7FB 3GZKA 1S64B 4OK4A 1GSZA 1C3DA 3WKGA 5M7IA 1L2AA 3W5NA 4ZH5A 1TNZB 2B4FA 1WZZA 1IS9A 4LIXA 3WUXA 1OJOA 1H3CA 1LTXB 3M78A 2Z07A 1F9GA 4RNQA 5ILHA 4AYPA 1N95B 1FBOA 4D4AA 1G9JA 1CB8A 3LZ9A 2RGKA 5EATA 2ZZRA 4ZRQA 1D8EB 3A0OA 4Q2BA 1I8QA 4DODA 1RWFA 3ANJA 3PZ4B 1QBQB 2AFAA 1H39A 1EGUA 2SQCA 4MMHA 3WKIA 3VSNA 3M71A 3QFYA 4FXKB 1CLCA 1O1TB 3S4DA 2EADA 2BEDB 4WVCA 2VN7A 1NI1B 2XFGA 3ANKA 3NNBA 3E80A 2RI9A 4FJQA 2F6DA 2FV1A 3DSVB 5EASA 1LXKA 1QAZA 4FUSA 3W7TA 3HXFB 1FP3A 1DCEB 2G02A 2ZIRB 5E2JA 4CJ0A 3E30B 1GAIA 2I07B 2BRPA 1RWAA 2NOJA 2H6FB 1RWCA 2WY8A 5FO9B 5JMFA 3M73A 3SAEA 3WKFA 2A73B 3M7BA 2EAEA 1UT9A 1V7XA 2BRVX 3AFLA 2FUTA 3ACSA 3D3IA 5GY3A 4AYQA 4XUVA 1LD7B 1WU4A 5DGRA 1XW2A 4GAXA 1N1BA 2ONHA 1GAHA 1JS4A 3QT9A 3G4DA 3E37B 3VW5A 5GZKA 5JMDA 1HMWA 1QSJA 1H37A 5JPNB 3RX7A 1HM3A 1V7VA 1ULVA 2E24A 5AGDA 3VXDA 2GOXA 3QXQA 2FBAA 1N7OA 1FT1B 4D94A 3CU7A 4OK2A 3AFJA 5DHKA 2E22A 3RX8A 3QRYA 2H6HB 1AGMA 1HXAA 4MBGB 3N0FA 3RRSA 3D5SA 1TN7B 1H13A 1H12A 1VD5A 4TXTA 3HXDB 3DSSB 4GTTB 1JCQB 1W3YA 1FO2A 4V1RA 4QT9A 1GXMA 3ANIA 3X17A 2H6GB 1AYXA 1F9DA 1JCSB 1DOGA 1S63B 4OJZA 3E6UA 3KQ4A 1TN8B 1LF9A 1C82A 1X1IA 5GW7A 2OKXA 1KRFA 4GTPB 3CIHA 3Q75B 5C05A 1GXOA 3WKHA 3OXUA 4D4DA 3M7EA 1X1HA 4GL3A 2PN5A 3PYAA 2F0YB 2CQTA 3S4BA 3DSTB 1KREA 3E33B 1WU5A 1TNUB 4MMIA 3T33A 2WDAA 1X81B 1N20A 1RWHA 3DPYB 1TNOB 2B39A 2V8IA 4ZH1A 3DRAB 2ZBLA 1TNBB 3M01A 3HXEB 3SFYB 2XQWA 2DRRA 4BOKA 3QXFA 4KTPA 4L6XA 4YDOB 1N24A 1LD8B 1RW9A 4OZWA 1H35A 3W7XA 2DRSA 1O5MB 4EL8A 5FO7B 3RSYA 3PZ1B 3E7JA 1UMPA 5ILZA 4LNBB 2H6IB 2A8ZA 4TF4A 2WCOA 3QT3A 1G9GA 3SDTA 2GH4A 5CA3A
chains in the Genus database with same CATH topology
1HCUA 3S4CA 3S9VA 1KS8A 3SDVA 5M7YA 4WU0A 3PYBA 1FT2B 1RQ5A 3S4AA 1GA2A 2NVPA 3EU8A 1O6QA 1N4SB 5FOBB 1XWQA 1FPPB 4LNVA 3KSLB 3SFXB 4GTQB 4LNGB 4CE7A 3Q73B 2PMVA 2R2LB 2DRQA 5KKBA 1IA6A 3KSQB 2JJBA 2G0DA 1DL2A 3GT5A 3Q79B 4GTOB 4C1SA 3M7CA 3WC3A 2WINB 4JJJA 1SA4B 4ZG8A 4J5TA 2BB6A 3WIWA 5CZLA 4KTRA 1HZFA 5JPMB 1GXNA 2BBCA 3E32B 3RJ3A 1V5DA 2DROA 3SDRA 1D8DB 1KSCA 2WIIB 1N4PB 4GTSB 1H3AA 1F9OA 4GTMB 2IEJB 2XWJB 3QSPA 1N9AB 1L1YA 2JF4A 3H3KA 1FBWA 3M75A 3PMMA 3H2WA 2ZISB 2V8KA 3QDEA 3QG0A 3P5PA 3W5MA 1H3BA 1KFGA 4YDEB 2GZ6A 1X9DA 1UG9A 1W6JA 4CJ1A 4Z4LA 3M76A 1N4QB 4V1SA 2WYNA 1G87A 1K72A 4Z4JA 1WU6A 1QQFA 4DOEA 1SA5B 3P2CA 3QWTA 1XWTA 5MEHA 1O79A 4AYOA 1N4RB 3WIRA 4YCRA 5FO8B 4D4CA 4L9PB 1GLMA 1SQCA 2D8LA 1NC5A 4D4BA 4WVBA 1NL4B 3M77A 2JG0A 3TF4A 3H7LA 4GTVB 4ONTA 3E73A 1O6RA 1N94B 3SDQA 1TNYB 2RI8A 5DGQA 3QPFA 3W7WA 2FV0A 3M74A 2P0VA 4BOJA 4GTRB 2VN4A 4Q88A 3Q78B 2FUZA 1JCRB 3PZ2B 2V3NA 3M7LA 1NXCA 1KSDA 1MZCB 3K7XA 1FMIA 1TN6B 1W6KA 4ZRPA 2EACA 5CD2A 1R76A 2CQSA 4AYRA 3RX5A 3Q7AB 3EQAA 1IA7A 1TF4A 3ACTA 3W7SA 1KWFA 1O1RB 3EUVB 4FXGB 3RENA 1H14A 1FAEA 3QFZA 3OEDA 2D5JA 1FO3A 3HXCB 3P5RA 2XWBB 4MU9A 4KKJA 2AHGA 3DSXB 3WIQA 1V5CA 1LF6A 1H54A 1V7WA 1KZOB 1G6IA 3SDUA 1O1SB 3KLSA 3ON6A 1KZPB 3PZ3B 1KKTA 1FCEA 3C72B 4EHMB 4L0GA 2WY7A 2BB5A 3DSWB 3EU5B 3W7UA 3E34B 3G6JB 3EZ8A 3K11A 4WVAA 1O6HA 3HXBB 1H36A 2V3PA 3M72A 2QNOA 3SQCA 2EABA 1CEMA 4M76A 3D5RA 2AHFA 2YIKA 3DSUB 4KKIA 3A3VA 1GHQA 3GLYA 2V8JA 3Q7FB 3GZKA 1S64B 3WKGA 1GSZA 1C3DA 5M7IA 1L2AA 3W5NA 4ZH5A 1TNZB 2B4FA 1WZZA 1IS9A 4LIXA 3WUXA 1H3CA 3M78A 1LTXB 2Z07A 4AYPA 1N95B 1FBOA 4D4AA 1G9JA 2RGKA 2ZZRA 4ZRQA 1D8EB 4Q2BA 4DODA 3ANJA 3PZ4B 1QBQB 2AFAA 1H39A 2SQCA 3WKIA 3M71A 3QFYA 4FXKB 1CLCA 1O1TB 3S4DA 2EADA 2BEDB 4WVCA 2VN7A 1NI1B 2XFGA 3ANKA 2RI9A 2F6DA 2FV1A 3DSVB 4FUSA 3W7TA 3HXFB 1FP3A 1DCEB 2G02A 2ZIRB 5E2JA 4CJ0A 3E30B 1GAIA 2I07B 2NOJA 2H6FB 5FO9B 2WY8A 3M73A 3SAEA 3WKFA 2A73B 3M7BA 2EAEA 1UT9A 1V7XA 3ACSA 5GY3A 3D3IA 4AYQA 4XUVA 1LD7B 1WU4A 5DGRA 1XW2A 1GAHA 1JS4A 3QT9A 3E37B 3VW5A 5GZKA 1QSJA 1H37A 5JPNB 3RX7A 1V7VA 1ULVA 5AGDA 3VXDA 2GOXA 3QXQA 2FBAA 1FT1B 4D94A 3CU7A 3AFJA 3RX8A 3QRYA 2H6HB 1AGMA 4MBGB 3RRSA 3D5SA 1TN7B 1H13A 1H12A 1VD5A 4TXTA 3HXDB 3DSSB 4GTTB 1JCQB 1FO2A 4V1RA 4QT9A 1GXMA 3ANIA 3X17A 2H6GB 1AYXA 1F9DA 1JCSB 1DOGA 1S63B 3E6UA 3KQ4A 1TN8B 1LF9A 2OKXA 5GW7A 1KRFA 4GTPB 3CIHA 3Q75B 1GXOA 3WKHA 3OXUA 4D4DA 3M7EA 4GL3A 2PN5A 3PYAA 2F0YB 2CQTA 3S4BA 3DSTB 1KREA 3E33B 1WU5A 1TNUB 3T33A 1X81B 3DPYB 1TNOB 2B39A 2V8IA 4ZH1A 3DRAB 2ZBLA 1TNBB 3HXEB 3SFYB 2XQWA 2DRRA 4BOKA 3QXFA 4KTPA 4L6XA 4YDOB 1LD8B 3W7XA 1H35A 2DRSA 1O5MB 4EL8A 5FO7B 3RSYA 3PZ1B 1UMPA 4LNBB 2H6IB 2A8ZA 4TF4A 3QT3A 1G9GA 3SDTA 2GH4A 5CA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4C A;  5AGD A;  2GOX A;  3DSU B;  4KKI A;  1GHQ A;  1FT1 B;  4L9P B;  1SQC A;  4D94 A;  2V8J A;  3Q7F B;  3CU7 A;  1S64 B;  4D4B A;  1GSZ A;  1C3D A;  1FT2 B;  1NL4 B;  1TNZ B;  2H6H B;  4GTV B;  4MBG B;  4ONT A;  3D5S A;  1TN7 B;  1H3C A;  1LTX B;  1O6Q A;  1N4S B;  5FOB B;  1O6R A;  1N94 B;  3DSS B;  3HXD B;  1TNY B;  4GTT B;  1JCQ B;  1FPP B;  4LNV A;  1N95 B;  3KSL B;  3SFX B;  4D4A A;  4GTQ B;  4V1R A;  4BOJ A;  4GTR B;  4LNG B;  1GXM A;  3Q78 B;  4ZRQ A;  1JCR B;  1D8E B;  2PMV A;  2R2L B;  3Q73 B;  2H6G B;  1JCS B;  1S63 B;  3PZ2 B;  2V3N A;  3KQ4 A;  1QBQ B;  1TN8 B;  3PZ4 B;  1MZC B;  3KSQ B;  1H39 A;  3K7X A;  1TN6 B;  2SQC A;  2G0D A;  4GTP B;  3Q75 B;  1W6K A;  1GXO A;  4ZRP A;  3Q79 B;  1R76 A;  3OXU A;  4FXK B;  4GTO B;  4C1S A;  4D4D A;  1O1T B;  2BED B;  3Q7A B;  2WIN B;  2PN5 A;  1NI1 B;  2F0Y B;  1SA4 B;  2BB6 A;  1O1R B;  3DST B;  3EUV B;  3DSV B;  1HZF A;  4FXG B;  5JPM B;  3E33 B;  1GXN A;  3OED A;  2BBC A;  3E32 B;  3HXC B;  3RJ3 A;  1TNU B;  3HXF B;  1D8D B;  2WII B;  1X81 B;  1N4P B;  2XWB B;  1DCE B;  4GTS B;  3DPY B;  4MU9 A;  2B39 A;  1TNO B;  1H3A A;  2G02 A;  2V8I A;  4KKJ A;  2ZIR B;  3DRA B;  3DSX B;  2IEJ B;  4GTM B;  4ZH1 A;  1TNB B;  2XWJ B;  3E30 B;  2I07 B;  2NOJ A;  1KZO B;  2H6F B;  3HXE B;  3SFY B;  1N9A B;  2WY8 A;  2XQW A;  5FO9 B;  1O1S B;  3KLS A;  4BOK A;  1KZP B;  3PZ3 B;  2A73 B;  2ZIS B;  2V8K A;  3C72 B;  4YDO B;  4EHM B;  1H3B A;  2WY7 A;  4YDE B;  1LD8 B;  5JPN B;  1H35 A;  2BB5 A;  3DSW B;  3EU5 B;  1W6J A;  3E34 B;  3G6J B;  1LD7 B;  1N4Q B;  4V1S A;  1O5M B;  1O6H A;  5FO7 B;  3HXB B;  1H36 A;  3PZ1 B;  1UMP A;  1QQF A;  4LNB B;  2H6I B;  2V3P A;  1SA5 B;  3SQC A;  3E37 B;  1O79 A;  4M76 A;  1N4R B;  1QSJ A;  1H37 A;  3D5R A;  5FO8 B; 
#chains in the Genus database with same CATH topology
 4FNV A;  3M02 A;  1HV6 A;  1HCU A;  3S4C A;  3S9V A;  1KS8 A;  3SDV A;  5M7Y A;  4WU0 A;  3PYB A;  1FT2 B;  1RQ5 A;  1N22 A;  3S4A A;  1GA2 A;  2NVP A;  3EU8 A;  1O6Q A;  1N4S B;  5FOB B;  1XWQ A;  5IK6 A;  1FPP B;  4LNV A;  3KSL B;  2X03 A;  3SFX B;  4GTQ B;  1N7Q A;  4LNG B;  4CE7 A;  1N23 A;  3Q73 B;  2PMV A;  2R2L B;  2DRQ A;  5KKB A;  1IA6 A;  3KSQ B;  2JJB A;  2G0D A;  1DL2 A;  3GT5 A;  3Q79 B;  4GTO B;  4C1S A;  3M7C A;  1N21 A;  3WC3 A;  2WIN B;  4JJJ A;  2BRW A;  1OJM A;  1SA4 B;  4ZG8 A;  4J5T A;  2BB6 A;  3NFV A;  3WIW A;  5CZL A;  4KTR A;  1HZF A;  5JPM B;  1GXN A;  2BBC A;  3E32 B;  3RJ3 A;  1V5D A;  2DRO A;  3SDR A;  1D8D B;  1KSC A;  2WII B;  1N4P B;  4GTS B;  2J5C A;  1H3A A;  1F9O A;  4GTM B;  2IEJ B;  2XWJ B;  5ILY A;  1HX9 A;  3QSP A;  1N9A B;  1L1Y A;  2JF4 A;  3H3K A;  1F1S A;  1FBW A;  3M75 A;  3PMM A;  3H2W A;  2ZIS B;  2V8K A;  3QDE A;  3QG0 A;  3P5P A;  3W5M A;  1H3B A;  1KFG A;  4YDE B;  2GZ6 A;  1X9D A;  1UG9 A;  5ILK A;  1W6J A;  4CJ1 A;  4OZV A;  4Z4L A;  3M76 A;  1N4Q B;  4V1S A;  2WYN A;  1G87 A;  1K72 A;  4Z4J A;  1WU6 A;  1QQF A;  5IKH A;  4DOE A;  5IL3 A;  1SA5 B;  3P2C A;  3QWT A;  1X1J A;  1XWT A;  2FUQ A;  5MEH A;  1O79 A;  4AYO A;  1N4R B;  3WIR A;  5ILI A;  4YCR A;  3VSM A;  5FO8 B;  5ILD A;  4D4C A;  3G4F A;  4L9P B;  1GLM A;  1SQC A;  2D8L A;  1NC5 A;  4D4B A;  4WVB A;  1NL4 B;  3M77 A;  2JG0 A;  1HN0 A;  3TF4 A;  3H7L A;  4GTV B;  1HM2 A;  4ONT A;  2Q1F A;  3E73 A;  1O6R A;  1N94 B;  3SDQ A;  1TNY B;  2RI8 A;  5DGQ A;  3QPF A;  3W7W A;  2FV0 A;  3M74 A;  2P0V A;  4BOJ A;  4GTR B;  2VN4 A;  4Q88 A;  3Q78 B;  2FUZ A;  1JCR B;  3PZ2 B;  1J0M A;  2V3N A;  3M7L A;  1NXC A;  1KSD A;  1MZC B;  3N0G A;  3K7X A;  1FMI A;  1N1Z A;  1TN6 B;  1W6K A;  3M00 A;  4ZRP A;  2EAC A;  5CD2 A;  1R76 A;  2CQS A;  4AYR A;  3RX5 A;  3Q7A B;  3EQA A;  1IA7 A;  1TF4 A;  3ACT A;  3W7S A;  1RWG A;  1KWF A;  1O1R B;  3EUV B;  4FXG B;  3REN A;  1H14 A;  1FAE A;  3QFZ A;  4F10 A;  3OED A;  2D5J A;  1FO3 A;  3HXC B;  1N7R A;  4F13 A;  1OJN A;  3P5R A;  5ILJ A;  2XWB B;  4MU9 A;  1LOH A;  4KKJ A;  2AHG A;  3DSX B;  3WIQ A;  1V5C A;  1LF6 A;  4DI5 A;  1H54 A;  5DHI A;  1V7W A;  5IK9 A;  1KZO B;  1N7P A;  1G6I A;  3SDU A;  1O1S B;  3KLS A;  3ON6 A;  1KZP B;  3PZ3 B;  1OJP A;  1KKT A;  1FCE A;  3C72 B;  4EHM B;  4L0G A;  2WY7 A;  5IK0 A;  2BB5 A;  3DSW B;  3EU5 B;  1HXC A;  3W7U A;  3E34 B;  3G6J B;  3EZ8 A;  3K11 A;  4WVA A;  2ONG A;  5EAU A;  1O6H A;  4E1Y A;  3HXB B;  1H36 A;  5IM1 A;  2V3P A;  1HMU A;  1N7N A;  1LXM A;  3M72 A;  2QNO A;  3SQC A;  2EAB A;  1CEM A;  4M76 A;  3D5R A;  4NEI A;  2AHF A;  5IKA A;  2YIK A;  1HXG A;  5IL8 A;  3DSU B;  4KKI A;  3A3V A;  1J0N A;  1GHQ A;  3GLY A;  2V8J A;  3Q7F B;  3GZK A;  1S64 B;  4OK4 A;  1GSZ A;  1C3D A;  3WKG A;  5M7I A;  1L2A A;  3W5N A;  4ZH5 A;  1TNZ B;  2B4F A;  1WZZ A;  1IS9 A;  4LIX A;  3WUX A;  1OJO A;  1H3C A;  1LTX B;  3M78 A;  2Z07 A;  1F9G A;  4RNQ A;  5ILH A;  4AYP A;  1N95 B;  1FBO A;  4D4A A;  1G9J A;  1CB8 A;  3LZ9 A;  2RGK A;  5EAT A;  2ZZR A;  4ZRQ A;  1D8E B;  3A0O A;  4Q2B A;  1I8Q A;  4DOD A;  1RWF A;  3ANJ A;  3PZ4 B;  1QBQ B;  2AFA A;  1H39 A;  1EGU A;  2SQC A;  4MMH A;  3WKI A;  3VSN A;  3M71 A;  3QFY A;  4FXK B;  1CLC A;  1O1T B;  3S4D A;  2EAD A;  2BED B;  4WVC A;  2VN7 A;  1NI1 B;  2XFG A;  3ANK A;  3NNB A;  3E80 A;  2RI9 A;  4FJQ A;  2F6D A;  2FV1 A;  3DSV B;  5EAS A;  1LXK A;  1QAZ A;  4FUS A;  3W7T A;  3HXF B;  1FP3 A;  1DCE B;  2G02 A;  2ZIR B;  5E2J A;  4CJ0 A;  3E30 B;  1GAI A;  2I07 B;  2BRP A;  1RWA A;  2NOJ A;  2H6F B;  1RWC A;  2WY8 A;  5FO9 B;  5JMF A;  3M73 A;  3SAE A;  3WKF A;  2A73 B;  3M7B A;  2EAE A;  1UT9 A;  1V7X A;  2BRV X;  3AFL A;  2FUT A;  3ACS A;  3D3I A;  5GY3 A;  4AYQ A;  4XUV A;  1LD7 B;  1WU4 A;  5DGR A;  1XW2 A;  4GAX A;  1N1B A;  2ONH A;  1GAH A;  1JS4 A;  3QT9 A;  3G4D A;  3E37 B;  3VW5 A;  5GZK A;  5JMD A;  1HMW A;  1QSJ A;  1H37 A;  5JPN B;  3RX7 A;  1HM3 A;  1V7V A;  1ULV A;  2E24 A;  5AGD A;  3VXD A;  2GOX A;  3QXQ A;  2FBA A;  1N7O A;  1FT1 B;  4D94 A;  3CU7 A;  4OK2 A;  3AFJ A;  5DHK A;  2E22 A;  3RX8 A;  3QRY A;  2H6H B;  1AGM A;  1HXA A;  4MBG B;  3N0F A;  3RRS A;  3D5S A;  1TN7 B;  1H13 A;  1H12 A;  1VD5 A;  4TXT A;  3HXD B;  3DSS B;  4GTT B;  1JCQ B;  1W3Y A;  1FO2 A;  4V1R A;  4QT9 A;  1GXM A;  3ANI A;  3X17 A;  2H6G B;  1AYX A;  1F9D A;  1JCS B;  1DOG A;  1S63 B;  4OJZ A;  3E6U A;  3KQ4 A;  1TN8 B;  1LF9 A;  1C82 A;  1X1I A;  5GW7 A;  2OKX A;  1KRF A;  4GTP B;  3CIH A;  3Q75 B;  5C05 A;  1GXO A;  3WKH A;  3OXU A;  4D4D A;  3M7E A;  1X1H A;  4GL3 A;  2PN5 A;  3PYA A;  2F0Y B;  2CQT A;  3S4B A;  3DST B;  1KRE A;  3E33 B;  1WU5 A;  1TNU B;  4MMI A;  3T33 A;  2WDA A;  1X81 B;  1N20 A;  1RWH A;  3DPY B;  1TNO B;  2B39 A;  2V8I A;  4ZH1 A;  3DRA B;  2ZBL A;  1TNB B;  3M01 A;  3HXE B;  3SFY B;  2XQW A;  2DRR A;  4BOK A;  3QXF A;  4KTP A;  4L6X A;  4YDO B;  1N24 A;  1LD8 B;  1RW9 A;  4OZW A;  1H35 A;  3W7X A;  2DRS A;  1O5M B;  4EL8 A;  5FO7 B;  3RSY A;  3PZ1 B;  3E7J A;  1UMP A;  5ILZ A;  4LNB B;  2H6I B;  2A8Z A;  4TF4 A;  2WCO A;  3QT3 A;  1G9G A;  3SDT A;  2GH4 A;  5CA3 A; 
#chains in the Genus database with same CATH homology
 1HCU A;  3S4C A;  3S9V A;  1KS8 A;  3SDV A;  5M7Y A;  4WU0 A;  3PYB A;  1FT2 B;  1RQ5 A;  3S4A A;  1GA2 A;  2NVP A;  3EU8 A;  1O6Q A;  1N4S B;  5FOB B;  1XWQ A;  1FPP B;  4LNV A;  3KSL B;  3SFX B;  4GTQ B;  4LNG B;  4CE7 A;  3Q73 B;  2PMV A;  2R2L B;  2DRQ A;  5KKB A;  1IA6 A;  3KSQ B;  2JJB A;  2G0D A;  1DL2 A;  3GT5 A;  3Q79 B;  4GTO B;  4C1S A;  3M7C A;  3WC3 A;  2WIN B;  4JJJ A;  1SA4 B;  4ZG8 A;  4J5T A;  2BB6 A;  3WIW A;  5CZL A;  4KTR A;  1HZF A;  5JPM B;  1GXN A;  2BBC A;  3E32 B;  3RJ3 A;  1V5D A;  2DRO A;  3SDR A;  1D8D B;  1KSC A;  2WII B;  1N4P B;  4GTS B;  1H3A A;  1F9O A;  4GTM B;  2IEJ B;  2XWJ B;  3QSP A;  1N9A B;  1L1Y A;  2JF4 A;  3H3K A;  1FBW A;  3M75 A;  3PMM A;  3H2W A;  2ZIS B;  2V8K A;  3QDE A;  3QG0 A;  3P5P A;  3W5M A;  1H3B A;  1KFG A;  4YDE B;  2GZ6 A;  1X9D A;  1UG9 A;  1W6J A;  4CJ1 A;  4Z4L A;  3M76 A;  1N4Q B;  4V1S A;  2WYN A;  1G87 A;  1K72 A;  4Z4J A;  1WU6 A;  1QQF A;  4DOE A;  1SA5 B;  3P2C A;  3QWT A;  1XWT A;  5MEH A;  1O79 A;  4AYO A;  1N4R B;  3WIR A;  4YCR A;  5FO8 B;  4D4C A;  4L9P B;  1GLM A;  1SQC A;  2D8L A;  1NC5 A;  4D4B A;  4WVB A;  1NL4 B;  3M77 A;  2JG0 A;  3TF4 A;  3H7L A;  4GTV B;  4ONT A;  3E73 A;  1O6R A;  1N94 B;  3SDQ A;  1TNY B;  2RI8 A;  5DGQ A;  3QPF A;  3W7W A;  2FV0 A;  3M74 A;  2P0V A;  4BOJ A;  4GTR B;  2VN4 A;  4Q88 A;  3Q78 B;  2FUZ A;  1JCR B;  3PZ2 B;  2V3N A;  3M7L A;  1NXC A;  1KSD A;  1MZC B;  3K7X A;  1FMI A;  1TN6 B;  1W6K A;  4ZRP A;  2EAC A;  5CD2 A;  1R76 A;  2CQS A;  4AYR A;  3RX5 A;  3Q7A B;  3EQA A;  1IA7 A;  1TF4 A;  3ACT A;  3W7S A;  1KWF A;  1O1R B;  3EUV B;  4FXG B;  3REN A;  1H14 A;  1FAE A;  3QFZ A;  3OED A;  2D5J A;  1FO3 A;  3HXC B;  3P5R A;  2XWB B;  4MU9 A;  4KKJ A;  2AHG A;  3DSX B;  3WIQ A;  1V5C A;  1LF6 A;  1H54 A;  1V7W A;  1KZO B;  1G6I A;  3SDU A;  1O1S B;  3KLS A;  3ON6 A;  1KZP B;  3PZ3 B;  1KKT A;  1FCE A;  3C72 B;  4EHM B;  4L0G A;  2WY7 A;  2BB5 A;  3DSW B;  3EU5 B;  3W7U A;  3E34 B;  3G6J B;  3EZ8 A;  3K11 A;  4WVA A;  1O6H A;  3HXB B;  1H36 A;  2V3P A;  3M72 A;  2QNO A;  3SQC A;  2EAB A;  1CEM A;  4M76 A;  3D5R A;  2AHF A;  2YIK A;  3DSU B;  4KKI A;  3A3V A;  1GHQ A;  3GLY A;  2V8J A;  3Q7F B;  3GZK A;  1S64 B;  3WKG A;  1GSZ A;  1C3D A;  5M7I A;  1L2A A;  3W5N A;  4ZH5 A;  1TNZ B;  2B4F A;  1WZZ A;  1IS9 A;  4LIX A;  3WUX A;  1H3C A;  3M78 A;  1LTX B;  2Z07 A;  4AYP A;  1N95 B;  1FBO A;  4D4A A;  1G9J A;  2RGK A;  2ZZR A;  4ZRQ A;  1D8E B;  4Q2B A;  4DOD A;  3ANJ A;  3PZ4 B;  1QBQ B;  2AFA A;  1H39 A;  2SQC A;  3WKI A;  3M71 A;  3QFY A;  4FXK B;  1CLC A;  1O1T B;  3S4D A;  2EAD A;  2BED B;  4WVC A;  2VN7 A;  1NI1 B;  2XFG A;  3ANK A;  2RI9 A;  2F6D A;  2FV1 A;  3DSV B;  4FUS A;  3W7T A;  3HXF B;  1FP3 A;  1DCE B;  2G02 A;  2ZIR B;  5E2J A;  4CJ0 A;  3E30 B;  1GAI A;  2I07 B;  2NOJ A;  2H6F B;  5FO9 B;  2WY8 A;  3M73 A;  3SAE A;  3WKF A;  2A73 B;  3M7B A;  2EAE A;  1UT9 A;  1V7X A;  3ACS A;  5GY3 A;  3D3I A;  4AYQ A;  4XUV A;  1LD7 B;  1WU4 A;  5DGR A;  1XW2 A;  1GAH A;  1JS4 A;  3QT9 A;  3E37 B;  3VW5 A;  5GZK A;  1QSJ A;  1H37 A;  5JPN B;  3RX7 A;  1V7V A;  1ULV A;  5AGD A;  3VXD A;  2GOX A;  3QXQ A;  2FBA A;  1FT1 B;  4D94 A;  3CU7 A;  3AFJ A;  3RX8 A;  3QRY A;  2H6H B;  1AGM A;  4MBG B;  3RRS A;  3D5S A;  1TN7 B;  1H13 A;  1H12 A;  1VD5 A;  4TXT A;  3HXD B;  3DSS B;  4GTT B;  1JCQ B;  1FO2 A;  4V1R A;  4QT9 A;  1GXM A;  3ANI A;  3X17 A;  2H6G B;  1AYX A;  1F9D A;  1JCS B;  1DOG A;  1S63 B;  3E6U A;  3KQ4 A;  1TN8 B;  1LF9 A;  2OKX A;  5GW7 A;  1KRF A;  4GTP B;  3CIH A;  3Q75 B;  1GXO A;  3WKH A;  3OXU A;  4D4D A;  3M7E A;  4GL3 A;  2PN5 A;  3PYA A;  2F0Y B;  2CQT A;  3S4B A;  3DST B;  1KRE A;  3E33 B;  1WU5 A;  1TNU B;  3T33 A;  1X81 B;  3DPY B;  1TNO B;  2B39 A;  2V8I A;  4ZH1 A;  3DRA B;  2ZBL A;  1TNB B;  3HXE B;  3SFY B;  2XQW A;  2DRR A;  4BOK A;  3QXF A;  4KTP A;  4L6X A;  4YDO B;  1LD8 B;  3W7X A;  1H35 A;  2DRS A;  1O5M B;  4EL8 A;  5FO7 B;  3RSY A;  3PZ1 B;  1UMP A;  4LNB B;  2H6I B;  2A8Z A;  4TF4 A;  3QT3 A;  1G9G A;  3SDT A;  2GH4 A;  5CA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...