1DCEB

Crystal structure of rab geranylgeranyltransferase from rat brain
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
329
structure length
329
Chain Sequence
TQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT)
publication title Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
pubmed doi rcsb
molecule tags Transferase
total genus 108
structure length 329
sequence length 329
chains with identical sequence D
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1dceB00
1NL4B 1GXOA 3DSVB 4D4AA 2G0DA 1JCRB 3D5SA 2ZIRB 2BBCA 3DSUB 1H37A 4D4BA 1H39A 2V8JA 1X81B 2IEJB 2WY7A 1GHQA 4LNBB 3C72B 4FXGB 3HXFB 2BB5A 2V3PA 1O6RA 2F0YB 3HXCB 1TNZB 1LD8B 3G6JB 3KSLB 4GTRB 4GTQB 4KKIA 3SFYB 1TNOB 2G02A 3PZ4B 3HXEB 1SA4B 3PZ1B 3Q79B 3EU5B 4GTOB 1D8EB 4BOJA 1O5MB 3RJ3A 2H6GB 1UMPA 3KQ4A 1LTXB 4KKJA 1QSJA 1TN7B 4V1RA 3PZ2B 1W6JA 1O1TB 1NI1B 1TNYB 1R76A 2V8KA 1C3DA 3DRAB 2H6FB 1HZFA 4V1SA 4D94A 2XWBB 1TNUB 4GTMB 4M76A 1JCSB 5FO9B 3OXUA 1GXNA 4MBGB 2R2LB 4ZRQA 1FT1B 4EHMB 2SQCA 2XQWA 1N4RB 2BEDB 2V8IA 5JPNB 1DCEB 1S63B 1KZOB 1TN8B 3E30B 3Q7FB 1O6HA 4GTPB 4LNVA 3HXBB 1MZCB 3DSWB 1O1RB 3E37B 2NOJA 1O6QA 2I07B 5FOBB 3Q7AB 1QQFA 3PZ3B 3DSTB 1O1SB 1TNBB 4C1SA 1O79A 3CU7A 1H3BA 1SQCA 1FPPB 1QBQB 1H36A 2H6IB 3E34B 1GSZA 1H3CA 1GXMA 1N4SB 1N4QB 4MU9A 5FO7B 5FO8B 1JCQB 5AGDA 1N95B 2ZISB 3D5RA 2WINB 3OEDA 2XWJB 4YDEB 4ONTA 3Q73B 3Q75B 1N94B 3K7XA 1H35A 3KLSA 2A73B 5JPMB 4FXKB 4ZH1A 4GTTB 3EUVB 1LD7B 4L9PB 2H6HB 3E32B 4ZRPA 3DSXB 2WIIB 4YDOB 1TN6B 1N4PB 3SQCA 4GTSB 3SFXB 4D4CA 1S64B 1KZPB 3DPYB 2V3NA 3Q78B 1W6KA 1H3AA 2PMVA 1D8DB 1SA5B 2B39A 3DSSB 2GOXA 4D4DA 1N9AB 1FT2B 2BB6A 3KSQB 4BOKA 2PN5A 2WY8A 4GTVB 3E33B 3HXDB 4LNGB
chains in the Genus database with same CATH superfamily
1NL4B 5GY3A 3DSUB 5ILDA 1N7QA 1HMWA 1WU5A 3C72B 4OK2A 3WKGA 2BB5A 2F0YB 2JF4A 1TNZB 2AHFA 4OJZA 3PZ4B 1G9JA 1RQ5A 1AYXA 1RWHA 3M00A 2DRRA 3ANJA 3RSYA 4TXTA 3RJ3A 3S9VA 1AGMA 2D8LA 2EACA 1LTXB 3A0OA 1W3YA 3KQ4A 3SDVA 4OK4A 3PZ2B 1O1TB 1TNYB 1W6JA 3QFYA 5IL8A 5KKBA 1C3DA 1HZFA 2XWBB 3M71A 3D3IA 1JCSB 1KKTA 5FO9B 1GXNA 4F13A 3QRYA 4EHMB 3W7TA 1RW9A 5JPNB 1S63B 1JS4A 1KZOB 3WKFA 2FUQA 1MZCB 3DSWB 1H54A 2NOJA 1HM2A 3SDTA 3NNBA 3PZ3B 5GW7A 5CA3A 4CE7A 1H3BA 3E73A 1FPPB 1FBWA 1FP3A 2D5JA 2FV0A 4MU9A 1JCQB 1N7OA 5AGDA 1L1YA 1EGUA 3D5RA 3RRSA 2XWJB 5JMFA 3M7LA 5JPMB 4ZH1A 3EUVB 4CJ1A 1RWAA 1C82A 2H6HB 4MMIA 3E32B 1HV6A 3DSXB 2WIIB 1OJPA 2EABA 4WVCA 1LXKA 1X1IA 3VSMA 1FO2A 4YCRA 4D4CA 1V5CA 2E22A 5DHKA 1LOHA 3S4CA 3W7UA 3DPYB 3Q78B 1FBOA 2PMVA 1D8DB 2B39A 1HXCA 3G4FA 1GLMA 1F9GA 2GOXA 2VN4A 4L0GA 2PN5A 3ACTA 1N7PA 2YIKA 3G6JB 3HXDB 2WCOA 4LNGB 5EATA 2G0DA 1JCRB 1IA7A 5DGQA 4ZG8A 1H39A 1NC5A 2IEJB 1GHQA 1V7XA 1O6RA 2FUTA 2GZ6A 3HXCB 3SFYB 3W7SA 1GA2A 2G02A 1N7RA 3HXEB 1F9DA 2Z07A 2ONHA 3PZ1B 1L2AA 1KSDA 3QWTA 2VN7A 2ZBLA 2H6GB 1N23A 1UMPA 4DOEA 2DRQA 3RX5A 4MMHA 1NI1B 3K11A 4D94A 1R76A 3EZ8A 2H6FB 4V1SA 1G6IA 1FCEA 1CB8A 4CJ0A 2XQWA 5IKAA 2BEDB 2V8IA 1DCEB 2X03A 3ACSA 1H13A 1O6HA 2ONGA 4F10A 4LNVA 3M75A 3E37B 1KS8A 2AHGA 4GAXA 4FJQA 1G9GA 1QQFA 4DI5A 4WU0A 4C1SA 1TNBB 3QFZA 4TF4A 1N21A 3M01A 1V7VA 1DOGA 5ILJA 1GSZA 4OZVA 5ILKA 1GXMA 1HXAA 1N4SB 1N4QB 3GZKA 5FO7B 3WIQA 5GZKA 2WINB 2BRWA 4Z4LA 4FUSA 3EQAA 2DROA 1HM3A 4J5TA 1IA6A 2WYNA 4GTTB 3PMMA 1ULVA 3SDQA 1WU4A 1V5DA 3M78A 3H3KA 2JG0A 4LIXA 4EL8A 2ZZRA 3RX8A 3P2CA 3TF4A 1KZPB 3W5MA 2JJBA 3VSNA 1H3AA 2AFAA 1SA5B 1I8QA 3M77A 4DODA 1V7WA 2BB6A 1FT2B 2RGKA 3KSQB 4WVBA 4BOKA 3WKHA 1HCUA 3GLYA 1GXOA 3DSVB 4D4AA 3WIRA 4Z4JA 1N7NA 2V8JA 1X81B 2B4FA 5E2JA 1GAHA 4LNBB 2BRPA 2V3PA 1LD8B 4GTRB 5DHIA 1SA4B 2NVPA 3M73A 3Q79B 3EU5B 4GTOB 4KTPA 4BOJA 3ANKA 3QPFA 1IS9A 1K72A 1QSJA 1TN7B 3SDRA 4V1RA 1RWFA 3DRAB 1X1HA 1TNUB 4GTMB 2E24A 4MBGB 4ZRQA 4Q88A 1N4RB 3LZ9A 1DL2A 3E30B 5M7IA 3AFLA 4GTPB 2WDAA 3A3VA 3WIWA 2P0VA 3HXBB 3PYBA 2XFGA 5CD2A 3ON6A 3M76A 3E80A 5FOBB 1N22A 1TF4A 3Q7AB 3PYAA 4XUVA 3DSTB 1O1SB 3M02A 1OJNA 5CZLA 1O79A 2CQTA 3CU7A 4FNVA 3W7WA 4ZH5A 2RI9A 1H36A 2H6IB 3E34B 1KREA 1H3CA 4Q2BA 5FO8B 3AFJA 2QNOA 3QT3A 1QAZA 3EU8A 3OEDA 3Q73B 3Q75B 3K7XA 1H35A 2A73B 1GAIA 1H12A 4L9PB 5ILYA 3SDUA 3WUXA 4YDOB 3QDEA 1TN6B 3S4AA 1CEMA 3N0GA 2RI8A 3NFVA 1N4PB 3SQCA 1X9DA 4GTSB 1UG9A 1UT9A 3SFXB 3VW5A 1S64B 1N1BA 4AYRA 1WZZA 1HXGA 1OJMA 3H2WA 3GT5A 4D4DA 5DGRA 5M7YA 1OJOA 4RNQA 1F1SA 2WY8A 4GTVB 4L6XA 3E33B 3WKIA 3QG0A 3D5SA 2ZIRB 2BBCA 5IKHA 5IM1A 1H37A 4D4BA 1CLCA 1NXCA 2WY7A 4AYQA 1LXMA 3M72A 4FXGB 3HXFB 1LF6A 3KSLB 4KKIA 4GTQB 5JMDA 1KWFA 1TNOB 5EASA 1RWCA 3QSPA 4JJJA 3S4DA 5IK0A 1J0NA 1X1JA 1D8EB 2F6DA 1O5MB 3M7EA 2Q1FA 4KKJA 3RENA 1LF9A 1FMIA 2A8ZA 1H14A 1KRFA 2V8KA 4M76A 2EAEA 1XW2A 3OXUA 3T33A 1RWGA 2R2LB 1FT1B 2SQCA 3X17A 1TN8B 3Q7FB 2DRSA 4QT9A 1N1ZA 3QT9A 1O1RB 3P5PA 3CIHA 1O6QA 2FBAA 2I07B 1G87A 5C05A 5ILHA 1FAEA 2BRVX 4OZWA 3WC3A 4E1YA 1SQCA 3W5NA 2EADA 1QBQB 3H7LA 4AYOA 4WVAA 3G4DA 3QXFA 3SAEA 3M7CA 1F9OA 1N95B 1HN0A 2ZISB 1J0MA 5IL3A 4YDEB 1WU6A 4ONTA 3QXQA 4NEIA 1N94B 5EAUA 1N24A 3KLSA 5IK6A 5ILZA 4FXKB 2FUZA 5MEHA 1N20A 1LD7B 3W7XA 4ZRPA 1XWTA 2OKXA 2FV1A 3M74A 3S4BA 3M7BA 3ANIA 1KSCA 4AYPA 5IK9A 2V3NA 5ILIA 1W6KA 3RX7A 2J5CA 1HMUA 3E7JA 4KTRA 2CQSA 1FO3A 3DSSB 1N9AB 1XWQA 2GH4A 1VD5A 3N0FA 3P5RA 3VXDA 1KFGA 3E6UA 1HX9A 4GL3A
chains in the Genus database with same CATH topology
1NL4B 5GY3A 3DSUB 1WU5A 3C72B 3WKGA 2BB5A 2F0YB 2JF4A 1TNZB 2AHFA 3PZ4B 1G9JA 1RQ5A 1AYXA 2DRRA 3ANJA 3RSYA 4TXTA 3RJ3A 3S9VA 1AGMA 2D8LA 2EACA 1LTXB 3KQ4A 3SDVA 3PZ2B 1O1TB 1TNYB 1W6JA 3QFYA 5KKBA 1C3DA 1HZFA 2XWBB 3M71A 3D3IA 1JCSB 1KKTA 5FO9B 1GXNA 3QRYA 4EHMB 3W7TA 5JPNB 1S63B 1JS4A 1KZOB 3WKFA 1MZCB 3DSWB 1H54A 2NOJA 3SDTA 3PZ3B 5GW7A 5CA3A 4CE7A 1H3BA 3E73A 1FPPB 1FBWA 1FP3A 2D5JA 2FV0A 4MU9A 1JCQB 5AGDA 1L1YA 3D5RA 3RRSA 2XWJB 3M7LA 5JPMB 4ZH1A 3EUVB 4CJ1A 2H6HB 3E32B 3DSXB 2WIIB 2EABA 4WVCA 1FO2A 4YCRA 4D4CA 1V5CA 3S4CA 3W7UA 3DPYB 3Q78B 1FBOA 2PMVA 1D8DB 2B39A 1GLMA 2GOXA 2VN4A 4L0GA 2PN5A 3ACTA 2YIKA 3G6JB 3HXDB 4LNGB 2G0DA 1JCRB 1IA7A 5DGQA 4ZG8A 1H39A 1NC5A 2IEJB 1GHQA 1V7XA 1O6RA 2GZ6A 3HXCB 3SFYB 3W7SA 1GA2A 2G02A 3HXEB 1F9DA 2Z07A 3PZ1B 1L2AA 1KSDA 3QWTA 2VN7A 2ZBLA 2H6GB 1UMPA 4DOEA 2DRQA 3RX5A 1NI1B 3K11A 4D94A 1R76A 3EZ8A 2H6FB 4V1SA 1G6IA 1FCEA 4CJ0A 2XQWA 2BEDB 2V8IA 1DCEB 3ACSA 1H13A 1O6HA 4LNVA 3M75A 3E37B 1KS8A 2AHGA 1G9GA 1QQFA 4WU0A 4C1SA 1TNBB 3QFZA 4TF4A 1V7VA 1DOGA 1GSZA 1GXMA 1N4SB 1N4QB 3GZKA 5FO7B 3WIQA 5GZKA 2WINB 4Z4LA 4FUSA 3EQAA 2DROA 4J5TA 1IA6A 2WYNA 4GTTB 3PMMA 1ULVA 3SDQA 1WU4A 1V5DA 3M78A 3H3KA 2JG0A 4LIXA 4EL8A 2ZZRA 3RX8A 3P2CA 3TF4A 1KZPB 3W5MA 2JJBA 1H3AA 2AFAA 1SA5B 3M77A 4DODA 1V7WA 2BB6A 1FT2B 2RGKA 3KSQB 4WVBA 4BOKA 3WKHA 1HCUA 3GLYA 1GXOA 3DSVB 4D4AA 3WIRA 4Z4JA 2V8JA 1X81B 2B4FA 5E2JA 1GAHA 4LNBB 2V3PA 1LD8B 4GTRB 1SA4B 2NVPA 3M73A 3Q79B 3EU5B 4GTOB 4KTPA 4BOJA 3ANKA 3QPFA 1IS9A 1K72A 1QSJA 1TN7B 3SDRA 4V1RA 3DRAB 1TNUB 4GTMB 4MBGB 4ZRQA 4Q88A 1N4RB 1DL2A 3E30B 5M7IA 4GTPB 3A3VA 3WIWA 2P0VA 3HXBB 3PYBA 2XFGA 5CD2A 3ON6A 3M76A 5FOBB 1TF4A 3Q7AB 3PYAA 4XUVA 3DSTB 1O1SB 5CZLA 1O79A 2CQTA 3CU7A 3W7WA 4ZH5A 2RI9A 1H36A 2H6IB 3E34B 1KREA 1H3CA 4Q2BA 5FO8B 3AFJA 2QNOA 3QT3A 3EU8A 3OEDA 3Q73B 3Q75B 3K7XA 1H35A 2A73B 1GAIA 1H12A 4L9PB 3SDUA 3WUXA 4YDOB 3QDEA 1TN6B 3S4AA 1CEMA 2RI8A 1N4PB 3SQCA 1X9DA 4GTSB 1UG9A 1UT9A 3SFXB 3VW5A 1S64B 4AYRA 1WZZA 3H2WA 3GT5A 4D4DA 5DGRA 5M7YA 2WY8A 4GTVB 4L6XA 3E33B 3WKIA 3QG0A 3D5SA 2ZIRB 2BBCA 1H37A 4D4BA 1CLCA 1NXCA 2WY7A 4AYQA 3M72A 4FXGB 3HXFB 1LF6A 3KSLB 4KKIA 4GTQB 1KWFA 1TNOB 3QSPA 4JJJA 3S4DA 1D8EB 2F6DA 1O5MB 3M7EA 4KKJA 3RENA 1LF9A 1FMIA 2A8ZA 1H14A 1KRFA 2V8KA 4M76A 2EAEA 1XW2A 3OXUA 3T33A 2R2LB 1FT1B 2SQCA 3X17A 1TN8B 3Q7FB 2DRSA 4QT9A 3QT9A 1O1RB 3P5PA 3CIHA 1O6QA 2FBAA 2I07B 1G87A 1FAEA 3WC3A 1SQCA 3W5NA 2EADA 1QBQB 3H7LA 4AYOA 4WVAA 3QXFA 3SAEA 3M7CA 1F9OA 1N95B 2ZISB 4YDEB 1WU6A 4ONTA 3QXQA 1N94B 3KLSA 4FXKB 2FUZA 5MEHA 3W7XA 1LD7B 4ZRPA 1XWTA 2OKXA 2FV1A 3M74A 3S4BA 3M7BA 3ANIA 1KSCA 4AYPA 2V3NA 1W6KA 3RX7A 4KTRA 2CQSA 1FO3A 3DSSB 1N9AB 1XWQA 2GH4A 1VD5A 3P5RA 3VXDA 1KFGA 3E6UA 4GL3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NL4 B;  1GXO A;  3DSV B;  4D4A A;  2G0D A;  1JCR B;  3D5S A;  2ZIR B;  2BBC A;  3DSU B;  1H37 A;  4D4B A;  1H39 A;  2V8J A;  1X81 B;  2IEJ B;  2WY7 A;  1GHQ A;  4LNB B;  3C72 B;  4FXG B;  3HXF B;  2BB5 A;  2V3P A;  1O6R A;  2F0Y B;  3HXC B;  1TNZ B;  1LD8 B;  3G6J B;  3KSL B;  4GTR B;  4GTQ B;  4KKI A;  3SFY B;  1TNO B;  2G02 A;  3PZ4 B;  3HXE B;  1SA4 B;  3PZ1 B;  3Q79 B;  3EU5 B;  4GTO B;  1D8E B;  4BOJ A;  1O5M B;  3RJ3 A;  2H6G B;  1UMP A;  3KQ4 A;  1LTX B;  4KKJ A;  1QSJ A;  1TN7 B;  4V1R A;  3PZ2 B;  1W6J A;  1O1T B;  1NI1 B;  1TNY B;  1R76 A;  2V8K A;  1C3D A;  3DRA B;  2H6F B;  1HZF A;  4V1S A;  4D94 A;  2XWB B;  1TNU B;  4GTM B;  4M76 A;  1JCS B;  5FO9 B;  3OXU A;  1GXN A;  4MBG B;  2R2L B;  4ZRQ A;  1FT1 B;  4EHM B;  2SQC A;  2XQW A;  1N4R B;  2BED B;  2V8I A;  5JPN B;  1DCE B;  1S63 B;  1KZO B;  1TN8 B;  3E30 B;  3Q7F B;  1O6H A;  4GTP B;  4LNV A;  3HXB B;  1MZC B;  3DSW B;  1O1R B;  3E37 B;  2NOJ A;  1O6Q A;  2I07 B;  5FOB B;  3Q7A B;  1QQF A;  3PZ3 B;  3DST B;  1O1S B;  1TNB B;  4C1S A;  1O79 A;  3CU7 A;  1H3B A;  1SQC A;  1FPP B;  1QBQ B;  1H36 A;  2H6I B;  3E34 B;  1GSZ A;  1H3C A;  1GXM A;  1N4S B;  1N4Q B;  4MU9 A;  5FO7 B;  5FO8 B;  1JCQ B;  5AGD A;  1N95 B;  2ZIS B;  3D5R A;  2WIN B;  3OED A;  2XWJ B;  4YDE B;  4ONT A;  3Q73 B;  3Q75 B;  1N94 B;  3K7X A;  1H35 A;  3KLS A;  2A73 B;  5JPM B;  4FXK B;  4ZH1 A;  4GTT B;  3EUV B;  1LD7 B;  4L9P B;  2H6H B;  3E32 B;  4ZRP A;  3DSX B;  2WII B;  4YDO B;  1TN6 B;  1N4P B;  3SQC A;  4GTS B;  3SFX B;  4D4C A;  1S64 B;  1KZP B;  3DPY B;  2V3N A;  3Q78 B;  1W6K A;  1H3A A;  2PMV A;  1D8D B;  1SA5 B;  2B39 A;  3DSS B;  2GOX A;  4D4D A;  1N9A B;  1FT2 B;  2BB6 A;  3KSQ B;  4BOK A;  2PN5 A;  2WY8 A;  4GTV B;  3E33 B;  3HXD B;  4LNG B; 
#chains in the Genus database with same CATH topology
 1NL4 B;  5GY3 A;  3DSU B;  5ILD A;  1N7Q A;  1HMW A;  1WU5 A;  3C72 B;  4OK2 A;  3WKG A;  2BB5 A;  2F0Y B;  2JF4 A;  1TNZ B;  2AHF A;  4OJZ A;  3PZ4 B;  1G9J A;  1RQ5 A;  1AYX A;  1RWH A;  3M00 A;  2DRR A;  3ANJ A;  3RSY A;  4TXT A;  3RJ3 A;  3S9V A;  1AGM A;  2D8L A;  2EAC A;  1LTX B;  3A0O A;  1W3Y A;  3KQ4 A;  3SDV A;  4OK4 A;  3PZ2 B;  1O1T B;  1TNY B;  1W6J A;  3QFY A;  5IL8 A;  5KKB A;  1C3D A;  1HZF A;  2XWB B;  3M71 A;  3D3I A;  1JCS B;  1KKT A;  5FO9 B;  1GXN A;  4F13 A;  3QRY A;  4EHM B;  3W7T A;  1RW9 A;  5JPN B;  1S63 B;  1JS4 A;  1KZO B;  3WKF A;  2FUQ A;  1MZC B;  3DSW B;  1H54 A;  2NOJ A;  1HM2 A;  3SDT A;  3NNB A;  3PZ3 B;  5GW7 A;  5CA3 A;  4CE7 A;  1H3B A;  3E73 A;  1FPP B;  1FBW A;  1FP3 A;  2D5J A;  2FV0 A;  4MU9 A;  1JCQ B;  1N7O A;  5AGD A;  1L1Y A;  1EGU A;  3D5R A;  3RRS A;  2XWJ B;  5JMF A;  3M7L A;  5JPM B;  4ZH1 A;  3EUV B;  4CJ1 A;  1RWA A;  1C82 A;  2H6H B;  4MMI A;  3E32 B;  1HV6 A;  3DSX B;  2WII B;  1OJP A;  2EAB A;  4WVC A;  1LXK A;  1X1I A;  3VSM A;  1FO2 A;  4YCR A;  4D4C A;  1V5C A;  2E22 A;  5DHK A;  1LOH A;  3S4C A;  3W7U A;  3DPY B;  3Q78 B;  1FBO A;  2PMV A;  1D8D B;  2B39 A;  1HXC A;  3G4F A;  1GLM A;  1F9G A;  2GOX A;  2VN4 A;  4L0G A;  2PN5 A;  3ACT A;  1N7P A;  2YIK A;  3G6J B;  3HXD B;  2WCO A;  4LNG B;  5EAT A;  2G0D A;  1JCR B;  1IA7 A;  5DGQ A;  4ZG8 A;  1H39 A;  1NC5 A;  2IEJ B;  1GHQ A;  1V7X A;  1O6R A;  2FUT A;  2GZ6 A;  3HXC B;  3SFY B;  3W7S A;  1GA2 A;  2G02 A;  1N7R A;  3HXE B;  1F9D A;  2Z07 A;  2ONH A;  3PZ1 B;  1L2A A;  1KSD A;  3QWT A;  2VN7 A;  2ZBL A;  2H6G B;  1N23 A;  1UMP A;  4DOE A;  2DRQ A;  3RX5 A;  4MMH A;  1NI1 B;  3K11 A;  4D94 A;  1R76 A;  3EZ8 A;  2H6F B;  4V1S A;  1G6I A;  1FCE A;  1CB8 A;  4CJ0 A;  2XQW A;  5IKA A;  2BED B;  2V8I A;  1DCE B;  2X03 A;  3ACS A;  1H13 A;  1O6H A;  2ONG A;  4F10 A;  4LNV A;  3M75 A;  3E37 B;  1KS8 A;  2AHG A;  4GAX A;  4FJQ A;  1G9G A;  1QQF A;  4DI5 A;  4WU0 A;  4C1S A;  1TNB B;  3QFZ A;  4TF4 A;  1N21 A;  3M01 A;  1V7V A;  1DOG A;  5ILJ A;  1GSZ A;  4OZV A;  5ILK A;  1GXM A;  1HXA A;  1N4S B;  1N4Q B;  3GZK A;  5FO7 B;  3WIQ A;  5GZK A;  2WIN B;  2BRW A;  4Z4L A;  4FUS A;  3EQA A;  2DRO A;  1HM3 A;  4J5T A;  1IA6 A;  2WYN A;  4GTT B;  3PMM A;  1ULV A;  3SDQ A;  1WU4 A;  1V5D A;  3M78 A;  3H3K A;  2JG0 A;  4LIX A;  4EL8 A;  2ZZR A;  3RX8 A;  3P2C A;  3TF4 A;  1KZP B;  3W5M A;  2JJB A;  3VSN A;  1H3A A;  2AFA A;  1SA5 B;  1I8Q A;  3M77 A;  4DOD A;  1V7W A;  2BB6 A;  1FT2 B;  2RGK A;  3KSQ B;  4WVB A;  4BOK A;  3WKH A;  1HCU A;  3GLY A;  1GXO A;  3DSV B;  4D4A A;  3WIR A;  4Z4J A;  1N7N A;  2V8J A;  1X81 B;  2B4F A;  5E2J A;  1GAH A;  4LNB B;  2BRP A;  2V3P A;  1LD8 B;  4GTR B;  5DHI A;  1SA4 B;  2NVP A;  3M73 A;  3Q79 B;  3EU5 B;  4GTO B;  4KTP A;  4BOJ A;  3ANK A;  3QPF A;  1IS9 A;  1K72 A;  1QSJ A;  1TN7 B;  3SDR A;  4V1R A;  1RWF A;  3DRA B;  1X1H A;  1TNU B;  4GTM B;  2E24 A;  4MBG B;  4ZRQ A;  4Q88 A;  1N4R B;  3LZ9 A;  1DL2 A;  3E30 B;  5M7I A;  3AFL A;  4GTP B;  2WDA A;  3A3V A;  3WIW A;  2P0V A;  3HXB B;  3PYB A;  2XFG A;  5CD2 A;  3ON6 A;  3M76 A;  3E80 A;  5FOB B;  1N22 A;  1TF4 A;  3Q7A B;  3PYA A;  4XUV A;  3DST B;  1O1S B;  3M02 A;  1OJN A;  5CZL A;  1O79 A;  2CQT A;  3CU7 A;  4FNV A;  3W7W A;  4ZH5 A;  2RI9 A;  1H36 A;  2H6I B;  3E34 B;  1KRE A;  1H3C A;  4Q2B A;  5FO8 B;  3AFJ A;  2QNO A;  3QT3 A;  1QAZ A;  3EU8 A;  3OED A;  3Q73 B;  3Q75 B;  3K7X A;  1H35 A;  2A73 B;  1GAI A;  1H12 A;  4L9P B;  5ILY A;  3SDU A;  3WUX A;  4YDO B;  3QDE A;  1TN6 B;  3S4A A;  1CEM A;  3N0G A;  2RI8 A;  3NFV A;  1N4P B;  3SQC A;  1X9D A;  4GTS B;  1UG9 A;  1UT9 A;  3SFX B;  3VW5 A;  1S64 B;  1N1B A;  4AYR A;  1WZZ A;  1HXG A;  1OJM A;  3H2W A;  3GT5 A;  4D4D A;  5DGR A;  5M7Y A;  1OJO A;  4RNQ A;  1F1S A;  2WY8 A;  4GTV B;  4L6X A;  3E33 B;  3WKI A;  3QG0 A;  3D5S A;  2ZIR B;  2BBC A;  5IKH A;  5IM1 A;  1H37 A;  4D4B A;  1CLC A;  1NXC A;  2WY7 A;  4AYQ A;  1LXM A;  3M72 A;  4FXG B;  3HXF B;  1LF6 A;  3KSL B;  4KKI A;  4GTQ B;  5JMD A;  1KWF A;  1TNO B;  5EAS A;  1RWC A;  3QSP A;  4JJJ A;  3S4D A;  5IK0 A;  1J0N A;  1X1J A;  1D8E B;  2F6D A;  1O5M B;  3M7E A;  2Q1F A;  4KKJ A;  3REN A;  1LF9 A;  1FMI A;  2A8Z A;  1H14 A;  1KRF A;  2V8K A;  4M76 A;  2EAE A;  1XW2 A;  3OXU A;  3T33 A;  1RWG A;  2R2L B;  1FT1 B;  2SQC A;  3X17 A;  1TN8 B;  3Q7F B;  2DRS A;  4QT9 A;  1N1Z A;  3QT9 A;  1O1R B;  3P5P A;  3CIH A;  1O6Q A;  2FBA A;  2I07 B;  1G87 A;  5C05 A;  5ILH A;  1FAE A;  2BRV X;  4OZW A;  3WC3 A;  4E1Y A;  1SQC A;  3W5N A;  2EAD A;  1QBQ B;  3H7L A;  4AYO A;  4WVA A;  3G4D A;  3QXF A;  3SAE A;  3M7C A;  1F9O A;  1N95 B;  1HN0 A;  2ZIS B;  1J0M A;  5IL3 A;  4YDE B;  1WU6 A;  4ONT A;  3QXQ A;  4NEI A;  1N94 B;  5EAU A;  1N24 A;  3KLS A;  5IK6 A;  5ILZ A;  4FXK B;  2FUZ A;  5MEH A;  1N20 A;  1LD7 B;  3W7X A;  4ZRP A;  1XWT A;  2OKX A;  2FV1 A;  3M74 A;  3S4B A;  3M7B A;  3ANI A;  1KSC A;  4AYP A;  5IK9 A;  2V3N A;  5ILI A;  1W6K A;  3RX7 A;  2J5C A;  1HMU A;  3E7J A;  4KTR A;  2CQS A;  1FO3 A;  3DSS B;  1N9A B;  1XWQ A;  2GH4 A;  1VD5 A;  3N0F A;  3P5R A;  3VXD A;  1KFG A;  3E6U A;  1HX9 A;  4GL3 A; 
#chains in the Genus database with same CATH homology
 1NL4 B;  5GY3 A;  3DSU B;  1WU5 A;  3C72 B;  3WKG A;  2BB5 A;  2F0Y B;  2JF4 A;  1TNZ B;  2AHF A;  3PZ4 B;  1G9J A;  1RQ5 A;  1AYX A;  2DRR A;  3ANJ A;  3RSY A;  4TXT A;  3RJ3 A;  3S9V A;  1AGM A;  2D8L A;  2EAC A;  1LTX B;  3KQ4 A;  3SDV A;  3PZ2 B;  1O1T B;  1TNY B;  1W6J A;  3QFY A;  5KKB A;  1C3D A;  1HZF A;  2XWB B;  3M71 A;  3D3I A;  1JCS B;  1KKT A;  5FO9 B;  1GXN A;  3QRY A;  4EHM B;  3W7T A;  5JPN B;  1S63 B;  1JS4 A;  1KZO B;  3WKF A;  1MZC B;  3DSW B;  1H54 A;  2NOJ A;  3SDT A;  3PZ3 B;  5GW7 A;  5CA3 A;  4CE7 A;  1H3B A;  3E73 A;  1FPP B;  1FBW A;  1FP3 A;  2D5J A;  2FV0 A;  4MU9 A;  1JCQ B;  5AGD A;  1L1Y A;  3D5R A;  3RRS A;  2XWJ B;  3M7L A;  5JPM B;  4ZH1 A;  3EUV B;  4CJ1 A;  2H6H B;  3E32 B;  3DSX B;  2WII B;  2EAB A;  4WVC A;  1FO2 A;  4YCR A;  4D4C A;  1V5C A;  3S4C A;  3W7U A;  3DPY B;  3Q78 B;  1FBO A;  2PMV A;  1D8D B;  2B39 A;  1GLM A;  2GOX A;  2VN4 A;  4L0G A;  2PN5 A;  3ACT A;  2YIK A;  3G6J B;  3HXD B;  4LNG B;  2G0D A;  1JCR B;  1IA7 A;  5DGQ A;  4ZG8 A;  1H39 A;  1NC5 A;  2IEJ B;  1GHQ A;  1V7X A;  1O6R A;  2GZ6 A;  3HXC B;  3SFY B;  3W7S A;  1GA2 A;  2G02 A;  3HXE B;  1F9D A;  2Z07 A;  3PZ1 B;  1L2A A;  1KSD A;  3QWT A;  2VN7 A;  2ZBL A;  2H6G B;  1UMP A;  4DOE A;  2DRQ A;  3RX5 A;  1NI1 B;  3K11 A;  4D94 A;  1R76 A;  3EZ8 A;  2H6F B;  4V1S A;  1G6I A;  1FCE A;  4CJ0 A;  2XQW A;  2BED B;  2V8I A;  1DCE B;  3ACS A;  1H13 A;  1O6H A;  4LNV A;  3M75 A;  3E37 B;  1KS8 A;  2AHG A;  1G9G A;  1QQF A;  4WU0 A;  4C1S A;  1TNB B;  3QFZ A;  4TF4 A;  1V7V A;  1DOG A;  1GSZ A;  1GXM A;  1N4S B;  1N4Q B;  3GZK A;  5FO7 B;  3WIQ A;  5GZK A;  2WIN B;  4Z4L A;  4FUS A;  3EQA A;  2DRO A;  4J5T A;  1IA6 A;  2WYN A;  4GTT B;  3PMM A;  1ULV A;  3SDQ A;  1WU4 A;  1V5D A;  3M78 A;  3H3K A;  2JG0 A;  4LIX A;  4EL8 A;  2ZZR A;  3RX8 A;  3P2C A;  3TF4 A;  1KZP B;  3W5M A;  2JJB A;  1H3A A;  2AFA A;  1SA5 B;  3M77 A;  4DOD A;  1V7W A;  2BB6 A;  1FT2 B;  2RGK A;  3KSQ B;  4WVB A;  4BOK A;  3WKH A;  1HCU A;  3GLY A;  1GXO A;  3DSV B;  4D4A A;  3WIR A;  4Z4J A;  2V8J A;  1X81 B;  2B4F A;  5E2J A;  1GAH A;  4LNB B;  2V3P A;  1LD8 B;  4GTR B;  1SA4 B;  2NVP A;  3M73 A;  3Q79 B;  3EU5 B;  4GTO B;  4KTP A;  4BOJ A;  3ANK A;  3QPF A;  1IS9 A;  1K72 A;  1QSJ A;  1TN7 B;  3SDR A;  4V1R A;  3DRA B;  1TNU B;  4GTM B;  4MBG B;  4ZRQ A;  4Q88 A;  1N4R B;  1DL2 A;  3E30 B;  5M7I A;  4GTP B;  3A3V A;  3WIW A;  2P0V A;  3HXB B;  3PYB A;  2XFG A;  5CD2 A;  3ON6 A;  3M76 A;  5FOB B;  1TF4 A;  3Q7A B;  3PYA A;  4XUV A;  3DST B;  1O1S B;  5CZL A;  1O79 A;  2CQT A;  3CU7 A;  3W7W A;  4ZH5 A;  2RI9 A;  1H36 A;  2H6I B;  3E34 B;  1KRE A;  1H3C A;  4Q2B A;  5FO8 B;  3AFJ A;  2QNO A;  3QT3 A;  3EU8 A;  3OED A;  3Q73 B;  3Q75 B;  3K7X A;  1H35 A;  2A73 B;  1GAI A;  1H12 A;  4L9P B;  3SDU A;  3WUX A;  4YDO B;  3QDE A;  1TN6 B;  3S4A A;  1CEM A;  2RI8 A;  1N4P B;  3SQC A;  1X9D A;  4GTS B;  1UG9 A;  1UT9 A;  3SFX B;  3VW5 A;  1S64 B;  4AYR A;  1WZZ A;  3H2W A;  3GT5 A;  4D4D A;  5DGR A;  5M7Y A;  2WY8 A;  4GTV B;  4L6X A;  3E33 B;  3WKI A;  3QG0 A;  3D5S A;  2ZIR B;  2BBC A;  1H37 A;  4D4B A;  1CLC A;  1NXC A;  2WY7 A;  4AYQ A;  3M72 A;  4FXG B;  3HXF B;  1LF6 A;  3KSL B;  4KKI A;  4GTQ B;  1KWF A;  1TNO B;  3QSP A;  4JJJ A;  3S4D A;  1D8E B;  2F6D A;  1O5M B;  3M7E A;  4KKJ A;  3REN A;  1LF9 A;  1FMI A;  2A8Z A;  1H14 A;  1KRF A;  2V8K A;  4M76 A;  2EAE A;  1XW2 A;  3OXU A;  3T33 A;  2R2L B;  1FT1 B;  2SQC A;  3X17 A;  1TN8 B;  3Q7F B;  2DRS A;  4QT9 A;  3QT9 A;  1O1R B;  3P5P A;  3CIH A;  1O6Q A;  2FBA A;  2I07 B;  1G87 A;  1FAE A;  3WC3 A;  1SQC A;  3W5N A;  2EAD A;  1QBQ B;  3H7L A;  4AYO A;  4WVA A;  3QXF A;  3SAE A;  3M7C A;  1F9O A;  1N95 B;  2ZIS B;  4YDE B;  1WU6 A;  4ONT A;  3QXQ A;  1N94 B;  3KLS A;  4FXK B;  2FUZ A;  5MEH A;  3W7X A;  1LD7 B;  4ZRP A;  1XWT A;  2OKX A;  2FV1 A;  3M74 A;  3S4B A;  3M7B A;  3ANI A;  1KSC A;  4AYP A;  2V3N A;  1W6K A;  3RX7 A;  4KTR A;  2CQS A;  1FO3 A;  3DSS B;  1N9A B;  1XWQ A;  2GH4 A;  1VD5 A;  3P5R A;  3VXD A;  1KFG A;  3E6U A;  4GL3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...