4C1SA

Glycoside hydrolase family 76 (mannosidase) bt3792 from bacteroides thetaiotaomicron vpi-5482
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
375
structure length
375
Chain Sequence
SHMADRAHSYMTSVIGYYFGKSSRSCWRSNYPYDGKGYWDGDALVWGQGGGLSAFVAMRDATKESEVENLYGAMDDMMFKGIQYFCQLDRGILAYSCYPAAGNERFYDDNVWIGLDMVDWYTETKEMRYLTQAKVVWRYLIDHGWDETCGGGVHWRELNEHTTSKHSCSTGPTAVMGCKMYLATQEQEYLDWAIKCYDYMLDVLQDKSDHLFYDNVRPNKDDPNLPGDLEKNKYSYNSGQPLQAACLLYKITGEQKYLDEAYAIAESCHKKWFMPYRSKELNLTFNILAPGHAWFNTIMCRGFFELYSIDNDRKYIDDIEKSMIHAWSSSCHQGNNLLNDDDLRGGTTKTGWEILHQGALVELYARLAVLERENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSIDE HYDROLASE FAMILY 76 MANNOSIDASE
publication title Human Gut Bacteroidetes Can Utilize Yeast Mannan Through a Selfish Mechanism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
total genus 150
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4c1sA00
1SA4B 1SQCA 1TN6B 1O5MB 4GTOB 3K7XA 3DSSB 3PZ2B 2H6FB 3Q78B 2BBCA 3D5RA 3HXCB 2V8JA 2V3NA 1GSZA 1NL4B 2XWJB 3SFYB 4YDOB 1H36A 1N4RB 2WY7A 2XQWA 1H39A 1N95B 2A73B 2G0DA 2ZIRB 1LD7B 1H3BA 3E30B 4MBGB 3PZ4B 3KSQB 5FOBB 1H37A 1D8DB 1FPPB 3KSLB 3RJ3A 1QQFA 4FXKB 4D4BA 2F0YB 3DPYB 2XWBB 1N4QB 1QBQB 1GXMA 1TNBB 1LTXB 5JPMB 1JCSB 1KZOB 4GTMB 1C3DA 4EHMB 1D8EB 3DSWB 1TNYB 4GTTB 2R2LB 1MZCB 4V1SA 2H6HB 1O79A 4D4AA 1GHQA 4ONTA 1TN7B 4GTPB 3HXDB 1X81B 1HZFA 1KZPB 1TNUB 4LNVA 1H3CA 3DSXB 3Q79B 4GTSB 3Q7FB 2I07B 2V8IA 2V3PA 4ZH1A 1QSJA 2H6GB 3EUVB 3DSVB 1O6RA 2BEDB 3E33B 1S63B 2WIIB 3D5SA 3DRAB 5FO7B 4BOJA 3Q73B 1N9AB 3OEDA 1N4SB 3E34B 2IEJB 2BB5A 1W6JA 2PN5A 1FT2B 3CU7A 5FO9B 5FO8B 3HXEB 2B39A 1GXNA 4YDEB 1W6KA 1TNZB 1N94B 3SQCA 2BB6A 3PZ3B 4MU9A 2SQCA 2ZISB 1TNOB 4GTQB 4L9PB 1TN8B 2V8KA 3HXFB 1O1TB 4ZRQA 1N4PB 2GOXA 1GXOA 3DSTB 3PZ1B 4GTRB 2WY8A 3E37B 4GTVB 4D4DA 1H3AA 1S64B 3EU5B 3SFXB 4BOKA 4V1RA 4D94A 3HXBB 4C1SA 1JCQB 1JCRB 2H6IB 4LNGB 1O6HA 1DCEB 3G6JB 5AGDA 4D4CA 1NI1B 4M76A 1O1SB 1R76A 3KLSA 3Q75B 1O1RB 2NOJA 3OXUA 3Q7AB 4LNBB 1O6QA 1FT1B 1H35A 1SA5B 3C72B 2WINB 2G02A 3E32B 4FXGB 3DSUB 4KKIA 4ZRPA 1LD8B 5JPNB 1UMPA 2PMVA 3KQ4A 4KKJA
chains in the Genus database with same CATH superfamily
3GZKA 3ON6A 1J0MA 4GTOB 4MMHA 3M73A 4TXTA 3DSSB 3PZ2B 1NL4B 2X03A 5ILJA 3SFYB 4YDOB 4DODA 4WVAA 4QT9A 1H39A 1H54A 3QFZA 3RSYA 3E30B 3PZ4B 2FV0A 1N7OA 1H37A 1D8DB 1FBWA 3N0GA 2ONGA 1QBQB 2JJBA 1LTXB 4F13A 2EAEA 1JCSB 3EZ8A 1KZOB 1XWTA 1C3DA 1D8EB 2FUTA 1TNYB 3QPFA 2ZBLA 5JMFA 3SDVA 2Q1FA 1N7RA 4YCRA 4WVBA 4ONTA 1TN7B 5M7YA 3S9VA 4AYPA 2D8LA 4Z4LA 3P2CA 2FUQA 5EATA 3AFJA 1HN0A 1OJPA 4JJJA 2BEDB 3E33B 1F9OA 1S63B 2BRVX 2F6DA 3DRAB 3NFVA 4BOJA 5IK9A 2CQTA 3OEDA 3AFLA 1IS9A 1LXKA 1NXCA 5FO9B 2GH4A 3SDRA 1HM2A 1N94B 1HXGA 2BRPA 1TNOB 5C05A 1TN8B 2YIKA 5JMDA 1O1TB 4ZRQA 4Z4JA 2WYNA 3E80A 3DSTB 5GW7A 4F10A 4GTRB 5ILYA 3EU5B 2EABA 3QDEA 3S4CA 3SFXB 4ZH5A 3P5RA 1OJOA 3HXBB 2AFAA 2GZ6A 1WU5A 3WIQA 2NVPA 1LOHA 4MMIA 4LNGB 2J5CA 1DCEB 3X17A 4Q88A 1NC5A 3QXQA 1O1SB 1R76A 3KLSA 1H12A 3OXUA 5CD2A 3E32B 1FMIA 1KSCA 4EL8A 3H3KA 3SDUA 5JPNB 2DRQA 4FNVA 4MU9A 3KQ4A 3ACSA 1O5MB 3M71A 2QNOA 3D3IA 4NEIA 4AYOA 3W7TA 5CZLA 2XWJB 1CLCA 3RRSA 1H36A 1DOGA 2WY7A 3QT9A 1W3YA 1JS4A 1KS8A 3QXFA 1N95B 2ZIRB 4MBGB 1LD7B 2DROA 5FOBB 1FPPB 3KSLB 3WIWA 3RX7A 3W7XA 3E6UA 5EAUA 1GXMA 3E7JA 3GT5A 1HMWA 3GLYA 4EHMB 4KTRA 1MZCB 3T33A 5DHIA 3QFYA 4Q2BA 4D4AA 1GHQA 1ULVA 1QAZA 1N21A 1X81B 1HZFA 1H3CA 2RI8A 1G87A 2RGKA 4E1YA 1RWCA 1WU4A 1DL2A 1QSJA 1GA2A 2H6GB 3N0FA 1O6RA 1LXMA 3RX5A 1OJNA 2E24A 5FO7B 1N9AB 5IL3A 1FCEA 3CU7A 1GXNA 4CJ0A 1F9DA 1TNZB 3SQCA 3PZ3B 4OK2A 4XUVA 3SDTA 4GTQB 1HXCA 4L9PB 1HCUA 2P0VA 1GXOA 3M7LA 3VW5A 3PZ1B 2VN7A 3M78A 4L6XA 4V1RA 4OK4A 4WU0A 1IA7A 2E22A 2CQSA 1G9JA 5DGQA 5ILZA 3G6JB 1UG9A 4AYRA 1NI1B 2B4FA 1XW2A 3ANIA 3Q75B 1KWFA 1SA5B 3M7CA 4J5TA 2ZZRA 2WCOA 3M75A 5DGRA 1C82A 3ANKA 5GZKA 4DI5A 3RX8A 5ILKA 2OKXA 1LD8B 4KTPA 3QSPA 3M00A 2DRRA 1IA6A 4KKJA 1X1IA 3TF4A 1SA4B 1SQCA 1V7WA 1TN6B 3E73A 3W7WA 1UT9A 5CA3A 5ILDA 2H6FB 3Q78B 1KSDA 3D5RA 1K72A 2V8JA 2AHFA 4ZG8A 1N7NA 3H7LA 2XQWA 2A73B 1LF6A 1H3BA 3QWTA 1HXAA 2EADA 3KSQB 1KREA 3M7EA 3M76A 3RJ3A 5IM1A 1QQFA 4D4BA 2F0YB 3DPYB 2XWBB 1WZZA 5ILIA 5KKBA 1TNBB 5JPMB 2FV1A 4GTMB 2VN4A 5IL8A 3EQAA 2R2LB 3CIHA 4DOEA 1CB8A 1N24A 1O79A 3G4DA 3WC3A 3WKGA 3S4DA 4RNQA 1F1SA 4CJ1A 2Z07A 3HXDB 4OJZA 1N23A 3DSXB 4GTSB 3Q7FB 3VSNA 3WKFA 1L1YA 4ZH1A 1AYXA 2DRSA 1N22A 1L2AA 3PMMA 3DSVB 5IKAA 3SDQA 2WIIB 1X9DA 3D5SA 1FO2A 1FAEA 3Q73B 2EACA 3M72A 1TF4A 3E34B 2IEJB 2BB5A 3A3VA 1W6JA 1FT2B 5EASA 1FP3A 4YDEB 1W6KA 1KKTA 3M77A 3W7SA 3PYAA 2SQCA 2ZISB 1X1HA 4WVCA 3HXFB 2JG0A 4OZWA 1N4PB 2GOXA 4TF4A 2A8ZA 3E37B 1N1ZA 1H3AA 3NNBA 2XFGA 4C1SA 5ILHA 1F9GA 1G9GA 1RWAA 1V5CA 1GLMA 4FUSA 4D4CA 1O1RB 2NOJA 3QT3A 1WU6A 1FT1B 1H35A 2WINB 2BRWA 2G02A 1AGMA 3M74A 3ACTA 4ZRPA 1UMPA 1N1BA 2JF4A 3QG0A 3ANJA 1HMUA 3K7XA 4LIXA 1XWQA 2BBCA 1CEMA 3HXCB 2V3NA 5GY3A 1GSZA 1KRFA 1N4RB 1GAHA 3M7BA 2G0DA 1FO3A 3S4BA 5E2JA 3WKHA 4FXKB 3P5PA 1N4QB 2FUZA 3LZ9A 1N7QA 3VSMA 1J0NA 3G4FA 3DSWB 4GTTB 1OJMA 5IK6A 1EGUA 4V1SA 2WDAA 4FJQA 4CE7A 2H6HB 3WUXA 1HX9A 3RENA 4GTPB 2FBAA 1KZPB 1TNUB 4LNVA 3Q79B 3W5MA 2I07B 2V8IA 3A0OA 2V3PA 1RW9A 3W7UA 3EUVB 1RWGA 1H13A 3M01A 3H2WA 1V5DA 5IK0A 4GAXA 1N4SB 4AYQA 2AHGA 1RWFA 1V7XA 1H14A 2PN5A 5FO8B 3HXEB 3PYBA 2B39A 1RQ5A 3EU8A 1G6IA 2RI9A 3K11A 1N20A 2BB6A 5DHKA 4GL3A 5M7IA 2V8KA 1HV6A 2D5JA 1VD5A 2WY8A 4GTVB 3SAEA 1X1JA 4D4DA 1S64B 1N7PA 5IKHA 1GAIA 3QRYA 2ONHA 4BOKA 4OZVA 4D94A 1JCQB 1JCRB 1HM3A 2H6IB 5MEHA 1O6HA 3W5NA 5AGDA 1FBOA 4M76A 3VXDA 3Q7AB 4LNBB 1O6QA 3WKIA 3S4AA 3C72B 1V7VA 4FXGB 3DSUB 4L0GA 3WIRA 1RWHA 1I8QA 3M02A 4KKIA 1LF9A 1KFGA 2PMVA
chains in the Genus database with same CATH topology
3GZKA 3ON6A 4GTOB 3M73A 4TXTA 3DSSB 3PZ2B 1NL4B 3SFYB 4YDOB 4DODA 4WVAA 4QT9A 1H39A 1H54A 3QFZA 3RSYA 3E30B 3PZ4B 2FV0A 1H37A 1D8DB 1FBWA 1QBQB 2JJBA 1LTXB 2EAEA 1JCSB 3EZ8A 1KZOB 1XWTA 1C3DA 1D8EB 1TNYB 3QPFA 2ZBLA 3SDVA 4YCRA 4WVBA 4ONTA 1TN7B 5M7YA 3S9VA 4AYPA 2D8LA 4Z4LA 3P2CA 3AFJA 4JJJA 2BEDB 3E33B 1F9OA 1S63B 2F6DA 3DRAB 4BOJA 2CQTA 3OEDA 1IS9A 1NXCA 5FO9B 2GH4A 3SDRA 1N94B 1TNOB 1TN8B 2YIKA 1O1TB 4ZRQA 4Z4JA 2WYNA 3DSTB 5GW7A 4GTRB 3EU5B 2EABA 3QDEA 3S4CA 3SFXB 4ZH5A 3P5RA 3HXBB 2AFAA 2GZ6A 1WU5A 3WIQA 2NVPA 4LNGB 1DCEB 3X17A 4Q88A 1NC5A 3QXQA 1O1SB 1R76A 3KLSA 1H12A 3OXUA 5CD2A 3E32B 1FMIA 1KSCA 4EL8A 3H3KA 3SDUA 5JPNB 2DRQA 4MU9A 3KQ4A 3ACSA 1O5MB 3M71A 2QNOA 3D3IA 4AYOA 3W7TA 5CZLA 2XWJB 1CLCA 3RRSA 1H36A 1DOGA 2WY7A 3QT9A 1JS4A 1KS8A 3QXFA 1N95B 2ZIRB 4MBGB 1LD7B 2DROA 5FOBB 1FPPB 3KSLB 3WIWA 3RX7A 3W7XA 3E6UA 1GXMA 3GT5A 3GLYA 4EHMB 4KTRA 1MZCB 3T33A 3QFYA 4Q2BA 4D4AA 1GHQA 1ULVA 1X81B 1HZFA 1H3CA 2RI8A 1G87A 2RGKA 1WU4A 1DL2A 1QSJA 1GA2A 2H6GB 1O6RA 3RX5A 5FO7B 1N9AB 1FCEA 3CU7A 1GXNA 4CJ0A 1F9DA 1TNZB 3SQCA 3PZ3B 4XUVA 3SDTA 4GTQB 4L9PB 1HCUA 2P0VA 1GXOA 3M7LA 3VW5A 3PZ1B 2VN7A 3M78A 4L6XA 4V1RA 4WU0A 1IA7A 2CQSA 1G9JA 5DGQA 3G6JB 1UG9A 4AYRA 1NI1B 2B4FA 1XW2A 3ANIA 3Q75B 1KWFA 1SA5B 3M7CA 4J5TA 2ZZRA 3M75A 5DGRA 3ANKA 5GZKA 3RX8A 2OKXA 1LD8B 4KTPA 3QSPA 2DRRA 1IA6A 4KKJA 3TF4A 1SA4B 1SQCA 1V7WA 1TN6B 3E73A 3W7WA 1UT9A 5CA3A 2H6FB 3Q78B 1KSDA 3D5RA 1K72A 2V8JA 2AHFA 4ZG8A 3H7LA 2XQWA 2A73B 1LF6A 1H3BA 3QWTA 3KSQB 2EADA 1KREA 3M7EA 3M76A 3RJ3A 1QQFA 4D4BA 2F0YB 3DPYB 2XWBB 1WZZA 5KKBA 1TNBB 5JPMB 2FV1A 4GTMB 2VN4A 3EQAA 2R2LB 3CIHA 4DOEA 1O79A 3WC3A 3WKGA 3S4DA 4CJ1A 2Z07A 3HXDB 3DSXB 4GTSB 3Q7FB 3WKFA 1L1YA 4ZH1A 1AYXA 2DRSA 1L2AA 3PMMA 3DSVB 3SDQA 2WIIB 1X9DA 3D5SA 1FO2A 1FAEA 3Q73B 2EACA 3M72A 1TF4A 3E34B 2IEJB 2BB5A 3A3VA 1W6JA 1FT2B 1FP3A 4YDEB 1W6KA 1KKTA 3M77A 3W7SA 3PYAA 2SQCA 2ZISB 4WVCA 3HXFB 2JG0A 1N4PB 2GOXA 4TF4A 2A8ZA 3E37B 1H3AA 2XFGA 4C1SA 1G9GA 1V5CA 1GLMA 4FUSA 4D4CA 1O1RB 2NOJA 3QT3A 1WU6A 1FT1B 1H35A 2WINB 2G02A 1AGMA 3M74A 3ACTA 4ZRPA 1UMPA 2JF4A 3QG0A 3ANJA 3K7XA 4LIXA 1XWQA 2BBCA 1CEMA 3HXCB 2V3NA 5GY3A 1GSZA 1KRFA 1N4RB 1GAHA 3M7BA 2G0DA 1FO3A 3S4BA 5E2JA 3WKHA 4FXKB 3P5PA 1N4QB 2FUZA 3DSWB 4GTTB 4V1SA 4CE7A 2H6HB 3WUXA 3RENA 4GTPB 2FBAA 1KZPB 1TNUB 4LNVA 3Q79B 3W5MA 2I07B 2V8IA 2V3PA 3W7UA 3EUVB 1H13A 3H2WA 1V5DA 1N4SB 4AYQA 2AHGA 1V7XA 1H14A 2PN5A 5FO8B 3HXEB 3PYBA 2B39A 1RQ5A 3EU8A 1G6IA 2RI9A 3K11A 2BB6A 4GL3A 5M7IA 2V8KA 2D5JA 1VD5A 2WY8A 4GTVB 3SAEA 4D4DA 1S64B 1GAIA 3QRYA 4BOKA 4D94A 1JCQB 1JCRB 2H6IB 5MEHA 1O6HA 3W5NA 5AGDA 1FBOA 4M76A 3VXDA 3Q7AB 4LNBB 1O6QA 3WKIA 3S4AA 3C72B 1V7VA 4FXGB 3DSUB 4L0GA 3WIRA 4KKIA 1LF9A 1KFGA 2PMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SA4 B;  1SQC A;  1TN6 B;  1O5M B;  4GTO B;  3K7X A;  3DSS B;  3PZ2 B;  2H6F B;  3Q78 B;  2BBC A;  3D5R A;  3HXC B;  2V8J A;  2V3N A;  1GSZ A;  1NL4 B;  2XWJ B;  3SFY B;  4YDO B;  1H36 A;  1N4R B;  2WY7 A;  2XQW A;  1H39 A;  1N95 B;  2A73 B;  2G0D A;  2ZIR B;  1LD7 B;  1H3B A;  3E30 B;  4MBG B;  3PZ4 B;  3KSQ B;  5FOB B;  1H37 A;  1D8D B;  1FPP B;  3KSL B;  3RJ3 A;  1QQF A;  4FXK B;  4D4B A;  2F0Y B;  3DPY B;  2XWB B;  1N4Q B;  1QBQ B;  1GXM A;  1TNB B;  1LTX B;  5JPM B;  1JCS B;  1KZO B;  4GTM B;  1C3D A;  4EHM B;  1D8E B;  3DSW B;  1TNY B;  4GTT B;  2R2L B;  1MZC B;  4V1S A;  2H6H B;  1O79 A;  4D4A A;  1GHQ A;  4ONT A;  1TN7 B;  4GTP B;  3HXD B;  1X81 B;  1HZF A;  1KZP B;  1TNU B;  4LNV A;  1H3C A;  3DSX B;  3Q79 B;  4GTS B;  3Q7F B;  2I07 B;  2V8I A;  2V3P A;  4ZH1 A;  1QSJ A;  2H6G B;  3EUV B;  3DSV B;  1O6R A;  2BED B;  3E33 B;  1S63 B;  2WII B;  3D5S A;  3DRA B;  5FO7 B;  4BOJ A;  3Q73 B;  1N9A B;  3OED A;  1N4S B;  3E34 B;  2IEJ B;  2BB5 A;  1W6J A;  2PN5 A;  1FT2 B;  3CU7 A;  5FO9 B;  5FO8 B;  3HXE B;  2B39 A;  1GXN A;  4YDE B;  1W6K A;  1TNZ B;  1N94 B;  3SQC A;  2BB6 A;  3PZ3 B;  4MU9 A;  2SQC A;  2ZIS B;  1TNO B;  4GTQ B;  4L9P B;  1TN8 B;  2V8K A;  3HXF B;  1O1T B;  4ZRQ A;  1N4P B;  2GOX A;  1GXO A;  3DST B;  3PZ1 B;  4GTR B;  2WY8 A;  3E37 B;  4GTV B;  4D4D A;  1H3A A;  1S64 B;  3EU5 B;  3SFX B;  4BOK A;  4V1R A;  4D94 A;  3HXB B;  4C1S A;  1JCQ B;  1JCR B;  2H6I B;  4LNG B;  1O6H A;  1DCE B;  3G6J B;  5AGD A;  4D4C A;  1NI1 B;  4M76 A;  1O1S B;  1R76 A;  3KLS A;  3Q75 B;  1O1R B;  2NOJ A;  3OXU A;  3Q7A B;  4LNB B;  1O6Q A;  1FT1 B;  1H35 A;  1SA5 B;  3C72 B;  2WIN B;  2G02 A;  3E32 B;  4FXG B;  3DSU B;  4KKI A;  4ZRP A;  1LD8 B;  5JPN B;  1UMP A;  2PMV A;  3KQ4 A;  4KKJ A; 
#chains in the Genus database with same CATH topology
 3GZK A;  3ON6 A;  1J0M A;  4GTO B;  4MMH A;  3M73 A;  4TXT A;  3DSS B;  3PZ2 B;  1NL4 B;  2X03 A;  5ILJ A;  3SFY B;  4YDO B;  4DOD A;  4WVA A;  4QT9 A;  1H39 A;  1H54 A;  3QFZ A;  3RSY A;  3E30 B;  3PZ4 B;  2FV0 A;  1N7O A;  1H37 A;  1D8D B;  1FBW A;  3N0G A;  2ONG A;  1QBQ B;  2JJB A;  1LTX B;  4F13 A;  2EAE A;  1JCS B;  3EZ8 A;  1KZO B;  1XWT A;  1C3D A;  1D8E B;  2FUT A;  1TNY B;  3QPF A;  2ZBL A;  5JMF A;  3SDV A;  2Q1F A;  1N7R A;  4YCR A;  4WVB A;  4ONT A;  1TN7 B;  5M7Y A;  3S9V A;  4AYP A;  2D8L A;  4Z4L A;  3P2C A;  2FUQ A;  5EAT A;  3AFJ A;  1HN0 A;  1OJP A;  4JJJ A;  2BED B;  3E33 B;  1F9O A;  1S63 B;  2BRV X;  2F6D A;  3DRA B;  3NFV A;  4BOJ A;  5IK9 A;  2CQT A;  3OED A;  3AFL A;  1IS9 A;  1LXK A;  1NXC A;  5FO9 B;  2GH4 A;  3SDR A;  1HM2 A;  1N94 B;  1HXG A;  2BRP A;  1TNO B;  5C05 A;  1TN8 B;  2YIK A;  5JMD A;  1O1T B;  4ZRQ A;  4Z4J A;  2WYN A;  3E80 A;  3DST B;  5GW7 A;  4F10 A;  4GTR B;  5ILY A;  3EU5 B;  2EAB A;  3QDE A;  3S4C A;  3SFX B;  4ZH5 A;  3P5R A;  1OJO A;  3HXB B;  2AFA A;  2GZ6 A;  1WU5 A;  3WIQ A;  2NVP A;  1LOH A;  4MMI A;  4LNG B;  2J5C A;  1DCE B;  3X17 A;  4Q88 A;  1NC5 A;  3QXQ A;  1O1S B;  1R76 A;  3KLS A;  1H12 A;  3OXU A;  5CD2 A;  3E32 B;  1FMI A;  1KSC A;  4EL8 A;  3H3K A;  3SDU A;  5JPN B;  2DRQ A;  4FNV A;  4MU9 A;  3KQ4 A;  3ACS A;  1O5M B;  3M71 A;  2QNO A;  3D3I A;  4NEI A;  4AYO A;  3W7T A;  5CZL A;  2XWJ B;  1CLC A;  3RRS A;  1H36 A;  1DOG A;  2WY7 A;  3QT9 A;  1W3Y A;  1JS4 A;  1KS8 A;  3QXF A;  1N95 B;  2ZIR B;  4MBG B;  1LD7 B;  2DRO A;  5FOB B;  1FPP B;  3KSL B;  3WIW A;  3RX7 A;  3W7X A;  3E6U A;  5EAU A;  1GXM A;  3E7J A;  3GT5 A;  1HMW A;  3GLY A;  4EHM B;  4KTR A;  1MZC B;  3T33 A;  5DHI A;  3QFY A;  4Q2B A;  4D4A A;  1GHQ A;  1ULV A;  1QAZ A;  1N21 A;  1X81 B;  1HZF A;  1H3C A;  2RI8 A;  1G87 A;  2RGK A;  4E1Y A;  1RWC A;  1WU4 A;  1DL2 A;  1QSJ A;  1GA2 A;  2H6G B;  3N0F A;  1O6R A;  1LXM A;  3RX5 A;  1OJN A;  2E24 A;  5FO7 B;  1N9A B;  5IL3 A;  1FCE A;  3CU7 A;  1GXN A;  4CJ0 A;  1F9D A;  1TNZ B;  3SQC A;  3PZ3 B;  4OK2 A;  4XUV A;  3SDT A;  4GTQ B;  1HXC A;  4L9P B;  1HCU A;  2P0V A;  1GXO A;  3M7L A;  3VW5 A;  3PZ1 B;  2VN7 A;  3M78 A;  4L6X A;  4V1R A;  4OK4 A;  4WU0 A;  1IA7 A;  2E22 A;  2CQS A;  1G9J A;  5DGQ A;  5ILZ A;  3G6J B;  1UG9 A;  4AYR A;  1NI1 B;  2B4F A;  1XW2 A;  3ANI A;  3Q75 B;  1KWF A;  1SA5 B;  3M7C A;  4J5T A;  2ZZR A;  2WCO A;  3M75 A;  5DGR A;  1C82 A;  3ANK A;  5GZK A;  4DI5 A;  3RX8 A;  5ILK A;  2OKX A;  1LD8 B;  4KTP A;  3QSP A;  3M00 A;  2DRR A;  1IA6 A;  4KKJ A;  1X1I A;  3TF4 A;  1SA4 B;  1SQC A;  1V7W A;  1TN6 B;  3E73 A;  3W7W A;  1UT9 A;  5CA3 A;  5ILD A;  2H6F B;  3Q78 B;  1KSD A;  3D5R A;  1K72 A;  2V8J A;  2AHF A;  4ZG8 A;  1N7N A;  3H7L A;  2XQW A;  2A73 B;  1LF6 A;  1H3B A;  3QWT A;  1HXA A;  2EAD A;  3KSQ B;  1KRE A;  3M7E A;  3M76 A;  3RJ3 A;  5IM1 A;  1QQF A;  4D4B A;  2F0Y B;  3DPY B;  2XWB B;  1WZZ A;  5ILI A;  5KKB A;  1TNB B;  5JPM B;  2FV1 A;  4GTM B;  2VN4 A;  5IL8 A;  3EQA A;  2R2L B;  3CIH A;  4DOE A;  1CB8 A;  1N24 A;  1O79 A;  3G4D A;  3WC3 A;  3WKG A;  3S4D A;  4RNQ A;  1F1S A;  4CJ1 A;  2Z07 A;  3HXD B;  4OJZ A;  1N23 A;  3DSX B;  4GTS B;  3Q7F B;  3VSN A;  3WKF A;  1L1Y A;  4ZH1 A;  1AYX A;  2DRS A;  1N22 A;  1L2A A;  3PMM A;  3DSV B;  5IKA A;  3SDQ A;  2WII B;  1X9D A;  3D5S A;  1FO2 A;  1FAE A;  3Q73 B;  2EAC A;  3M72 A;  1TF4 A;  3E34 B;  2IEJ B;  2BB5 A;  3A3V A;  1W6J A;  1FT2 B;  5EAS A;  1FP3 A;  4YDE B;  1W6K A;  1KKT A;  3M77 A;  3W7S A;  3PYA A;  2SQC A;  2ZIS B;  1X1H A;  4WVC A;  3HXF B;  2JG0 A;  4OZW A;  1N4P B;  2GOX A;  4TF4 A;  2A8Z A;  3E37 B;  1N1Z A;  1H3A A;  3NNB A;  2XFG A;  4C1S A;  5ILH A;  1F9G A;  1G9G A;  1RWA A;  1V5C A;  1GLM A;  4FUS A;  4D4C A;  1O1R B;  2NOJ A;  3QT3 A;  1WU6 A;  1FT1 B;  1H35 A;  2WIN B;  2BRW A;  2G02 A;  1AGM A;  3M74 A;  3ACT A;  4ZRP A;  1UMP A;  1N1B A;  2JF4 A;  3QG0 A;  3ANJ A;  1HMU A;  3K7X A;  4LIX A;  1XWQ A;  2BBC A;  1CEM A;  3HXC B;  2V3N A;  5GY3 A;  1GSZ A;  1KRF A;  1N4R B;  1GAH A;  3M7B A;  2G0D A;  1FO3 A;  3S4B A;  5E2J A;  3WKH A;  4FXK B;  3P5P A;  1N4Q B;  2FUZ A;  3LZ9 A;  1N7Q A;  3VSM A;  1J0N A;  3G4F A;  3DSW B;  4GTT B;  1OJM A;  5IK6 A;  1EGU A;  4V1S A;  2WDA A;  4FJQ A;  4CE7 A;  2H6H B;  3WUX A;  1HX9 A;  3REN A;  4GTP B;  2FBA A;  1KZP B;  1TNU B;  4LNV A;  3Q79 B;  3W5M A;  2I07 B;  2V8I A;  3A0O A;  2V3P A;  1RW9 A;  3W7U A;  3EUV B;  1RWG A;  1H13 A;  3M01 A;  3H2W A;  1V5D A;  5IK0 A;  4GAX A;  1N4S B;  4AYQ A;  2AHG A;  1RWF A;  1V7X A;  1H14 A;  2PN5 A;  5FO8 B;  3HXE B;  3PYB A;  2B39 A;  1RQ5 A;  3EU8 A;  1G6I A;  2RI9 A;  3K11 A;  1N20 A;  2BB6 A;  5DHK A;  4GL3 A;  5M7I A;  2V8K A;  1HV6 A;  2D5J A;  1VD5 A;  2WY8 A;  4GTV B;  3SAE A;  1X1J A;  4D4D A;  1S64 B;  1N7P A;  5IKH A;  1GAI A;  3QRY A;  2ONH A;  4BOK A;  4OZV A;  4D94 A;  1JCQ B;  1JCR B;  1HM3 A;  2H6I B;  5MEH A;  1O6H A;  3W5N A;  5AGD A;  1FBO A;  4M76 A;  3VXD A;  3Q7A B;  4LNB B;  1O6Q A;  3WKI A;  3S4A A;  3C72 B;  1V7V A;  4FXG B;  3DSU B;  4L0G A;  3WIR A;  1RWH A;  1I8Q A;  3M02 A;  4KKI A;  1LF9 A;  1KFG A;  2PMV A; 
#chains in the Genus database with same CATH homology
 3GZK A;  3ON6 A;  4GTO B;  3M73 A;  4TXT A;  3DSS B;  3PZ2 B;  1NL4 B;  3SFY B;  4YDO B;  4DOD A;  4WVA A;  4QT9 A;  1H39 A;  1H54 A;  3QFZ A;  3RSY A;  3E30 B;  3PZ4 B;  2FV0 A;  1H37 A;  1D8D B;  1FBW A;  1QBQ B;  2JJB A;  1LTX B;  2EAE A;  1JCS B;  3EZ8 A;  1KZO B;  1XWT A;  1C3D A;  1D8E B;  1TNY B;  3QPF A;  2ZBL A;  3SDV A;  4YCR A;  4WVB A;  4ONT A;  1TN7 B;  5M7Y A;  3S9V A;  4AYP A;  2D8L A;  4Z4L A;  3P2C A;  3AFJ A;  4JJJ A;  2BED B;  3E33 B;  1F9O A;  1S63 B;  2F6D A;  3DRA B;  4BOJ A;  2CQT A;  3OED A;  1IS9 A;  1NXC A;  5FO9 B;  2GH4 A;  3SDR A;  1N94 B;  1TNO B;  1TN8 B;  2YIK A;  1O1T B;  4ZRQ A;  4Z4J A;  2WYN A;  3DST B;  5GW7 A;  4GTR B;  3EU5 B;  2EAB A;  3QDE A;  3S4C A;  3SFX B;  4ZH5 A;  3P5R A;  3HXB B;  2AFA A;  2GZ6 A;  1WU5 A;  3WIQ A;  2NVP A;  4LNG B;  1DCE B;  3X17 A;  4Q88 A;  1NC5 A;  3QXQ A;  1O1S B;  1R76 A;  3KLS A;  1H12 A;  3OXU A;  5CD2 A;  3E32 B;  1FMI A;  1KSC A;  4EL8 A;  3H3K A;  3SDU A;  5JPN B;  2DRQ A;  4MU9 A;  3KQ4 A;  3ACS A;  1O5M B;  3M71 A;  2QNO A;  3D3I A;  4AYO A;  3W7T A;  5CZL A;  2XWJ B;  1CLC A;  3RRS A;  1H36 A;  1DOG A;  2WY7 A;  3QT9 A;  1JS4 A;  1KS8 A;  3QXF A;  1N95 B;  2ZIR B;  4MBG B;  1LD7 B;  2DRO A;  5FOB B;  1FPP B;  3KSL B;  3WIW A;  3RX7 A;  3W7X A;  3E6U A;  1GXM A;  3GT5 A;  3GLY A;  4EHM B;  4KTR A;  1MZC B;  3T33 A;  3QFY A;  4Q2B A;  4D4A A;  1GHQ A;  1ULV A;  1X81 B;  1HZF A;  1H3C A;  2RI8 A;  1G87 A;  2RGK A;  1WU4 A;  1DL2 A;  1QSJ A;  1GA2 A;  2H6G B;  1O6R A;  3RX5 A;  5FO7 B;  1N9A B;  1FCE A;  3CU7 A;  1GXN A;  4CJ0 A;  1F9D A;  1TNZ B;  3SQC A;  3PZ3 B;  4XUV A;  3SDT A;  4GTQ B;  4L9P B;  1HCU A;  2P0V A;  1GXO A;  3M7L A;  3VW5 A;  3PZ1 B;  2VN7 A;  3M78 A;  4L6X A;  4V1R A;  4WU0 A;  1IA7 A;  2CQS A;  1G9J A;  5DGQ A;  3G6J B;  1UG9 A;  4AYR A;  1NI1 B;  2B4F A;  1XW2 A;  3ANI A;  3Q75 B;  1KWF A;  1SA5 B;  3M7C A;  4J5T A;  2ZZR A;  3M75 A;  5DGR A;  3ANK A;  5GZK A;  3RX8 A;  2OKX A;  1LD8 B;  4KTP A;  3QSP A;  2DRR A;  1IA6 A;  4KKJ A;  3TF4 A;  1SA4 B;  1SQC A;  1V7W A;  1TN6 B;  3E73 A;  3W7W A;  1UT9 A;  5CA3 A;  2H6F B;  3Q78 B;  1KSD A;  3D5R A;  1K72 A;  2V8J A;  2AHF A;  4ZG8 A;  3H7L A;  2XQW A;  2A73 B;  1LF6 A;  1H3B A;  3QWT A;  3KSQ B;  2EAD A;  1KRE A;  3M7E A;  3M76 A;  3RJ3 A;  1QQF A;  4D4B A;  2F0Y B;  3DPY B;  2XWB B;  1WZZ A;  5KKB A;  1TNB B;  5JPM B;  2FV1 A;  4GTM B;  2VN4 A;  3EQA A;  2R2L B;  3CIH A;  4DOE A;  1O79 A;  3WC3 A;  3WKG A;  3S4D A;  4CJ1 A;  2Z07 A;  3HXD B;  3DSX B;  4GTS B;  3Q7F B;  3WKF A;  1L1Y A;  4ZH1 A;  1AYX A;  2DRS A;  1L2A A;  3PMM A;  3DSV B;  3SDQ A;  2WII B;  1X9D A;  3D5S A;  1FO2 A;  1FAE A;  3Q73 B;  2EAC A;  3M72 A;  1TF4 A;  3E34 B;  2IEJ B;  2BB5 A;  3A3V A;  1W6J A;  1FT2 B;  1FP3 A;  4YDE B;  1W6K A;  1KKT A;  3M77 A;  3W7S A;  3PYA A;  2SQC A;  2ZIS B;  4WVC A;  3HXF B;  2JG0 A;  1N4P B;  2GOX A;  4TF4 A;  2A8Z A;  3E37 B;  1H3A A;  2XFG A;  4C1S A;  1G9G A;  1V5C A;  1GLM A;  4FUS A;  4D4C A;  1O1R B;  2NOJ A;  3QT3 A;  1WU6 A;  1FT1 B;  1H35 A;  2WIN B;  2G02 A;  1AGM A;  3M74 A;  3ACT A;  4ZRP A;  1UMP A;  2JF4 A;  3QG0 A;  3ANJ A;  3K7X A;  4LIX A;  1XWQ A;  2BBC A;  1CEM A;  3HXC B;  2V3N A;  5GY3 A;  1GSZ A;  1KRF A;  1N4R B;  1GAH A;  3M7B A;  2G0D A;  1FO3 A;  3S4B A;  5E2J A;  3WKH A;  4FXK B;  3P5P A;  1N4Q B;  2FUZ A;  3DSW B;  4GTT B;  4V1S A;  4CE7 A;  2H6H B;  3WUX A;  3REN A;  4GTP B;  2FBA A;  1KZP B;  1TNU B;  4LNV A;  3Q79 B;  3W5M A;  2I07 B;  2V8I A;  2V3P A;  3W7U A;  3EUV B;  1H13 A;  3H2W A;  1V5D A;  1N4S B;  4AYQ A;  2AHG A;  1V7X A;  1H14 A;  2PN5 A;  5FO8 B;  3HXE B;  3PYB A;  2B39 A;  1RQ5 A;  3EU8 A;  1G6I A;  2RI9 A;  3K11 A;  2BB6 A;  4GL3 A;  5M7I A;  2V8K A;  2D5J A;  1VD5 A;  2WY8 A;  4GTV B;  3SAE A;  4D4D A;  1S64 B;  1GAI A;  3QRY A;  4BOK A;  4D94 A;  1JCQ B;  1JCR B;  2H6I B;  5MEH A;  1O6H A;  3W5N A;  5AGD A;  1FBO A;  4M76 A;  3VXD A;  3Q7A B;  4LNB B;  1O6Q A;  3WKI A;  3S4A A;  3C72 B;  1V7V A;  4FXG B;  3DSU B;  4L0G A;  3WIR A;  4KKI A;  1LF9 A;  1KFG A;  2PMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...