4C1SA

Glycoside hydrolase family 76 (mannosidase) bt3792 from bacteroides thetaiotaomicron vpi-5482
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
375
structure length
375
Chain Sequence
SHMADRAHSYMTSVIGYYFGKSSRSCWRSNYPYDGKGYWDGDALVWGQGGGLSAFVAMRDATKESEVENLYGAMDDMMFKGIQYFCQLDRGILAYSCYPAAGNERFYDDNVWIGLDMVDWYTETKEMRYLTQAKVVWRYLIDHGWDETCGGGVHWRELNEHTTSKHSCSTGPTAVMGCKMYLATQEQEYLDWAIKCYDYMLDVLQDKSDHLFYDNVRPNKDDPNLPGDLEKNKYSYNSGQPLQAACLLYKITGEQKYLDEAYAIAESCHKKWFMPYRSKELNLTFNILAPGHAWFNTIMCRGFFELYSIDNDRKYIDDIEKSMIHAWSSSCHQGNNLLNDDDLRGGTTKTGWEILHQGALVELYARLAVLERENR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE FAMILY 76 MANNOSIDASE
publication title Human Gut Bacteroidetes Can Utilize Yeast Mannan Through a Selfish Mechanism.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 150
structure length 375
sequence length 375
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2013-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4c1sA00
4GTOB 1D8EB 1H39A 2ZISB 1W6JA 2R2LB 1N4PB 1D8DB 2IEJB 2BBCA 2G02A 1N4QB 2V8IA 4ZRQA 4D4AA 2BEDB 3RJ3A 3D5RA 4D94A 3KQ4A 4V1RA 3OXUA 4V1SA 2PMVA 3DSUB 3E37B 3PZ2B 1H3BA 3E34B 1DCEB 1N9AB 1TNBB 2SQCA 1SA5B 5FO8B 3PZ4B 3SQCA 1TN8B 2H6IB 1N95B 4ZH1A 4FXGB 3DSXB 2WINB 4YDEB 1NL4B 1KZOB 4LNVA 1R76A 2A73B 1H3CA 3K7XA 3E33B 3EU5B 3PZ1B 1FPPB 3Q75B 2F0YB 1GXOA 3Q7AB 3E30B 1UMPA 3OEDA 1MZCB 2V3PA 1O79A 4BOJA 3D5SA 2XWJB 3HXCB 4L9PB 1QSJA 1O1SB 5FO7B 2H6FB 4LNBB 1TNUB 1O6HA 1QQFA 4MBGB 2WY7A 3EUVB 1O6QA 4C1SA 1KZPB 2WY8A 1JCQB 2XWBB 1SA4B 1JCRB 1GXMA 3HXBB 3E32B 3Q73B 1C3DA 4GTTB 1H3AA 4BOKA 2ZIRB 3G6JB 3Q79B 4KKJA 3DRAB 4M76A 3HXFB 1S63B 4GTVB 1N94B 4D4CA 4EHMB 4D4BA 1TN7B 2H6GB 1SQCA 1NI1B 3DSSB 3KLSA 1FT2B 1FT1B 1O5MB 3HXDB 3DSVB 3C72B 3Q7FB 3DSTB 4LNGB 5FOBB 1TNZB 1TNOB 4GTMB 2H6HB 4ZRPA 3DPYB 1O1RB 1QBQB 2I07B 2V8JA 1LD8B 1HZFA 3CU7A 4KKIA 2V3NA 4D4DA 1GHQA 1O1TB 1JCSB 3KSQB 2G0DA 1H35A 2V8KA 3Q78B 2BB5A 1H36A 4GTRB 2XQWA 1LTXB 1H37A 4GTPB 4GTSB 4GTQB 3HXEB 1LD7B 2NOJA 2WIIB 5AGDA 1TNYB 5JPMB 2GOXA 2B39A 3PZ3B 4MU9A 5JPNB 3SFYB 2PN5A 4ONTA 1GXNA 1N4SB 1TN6B 3DSWB 1W6KA 1N4RB 3SFXB 1GSZA 5FO9B 4FXKB 1S64B 1X81B 3KSLB 2BB6A 1O6RA 4YDOB
chains in the Genus database with same CATH superfamily
3ACTA 1D8EB 1N21A 1W6JA 3G4FA 3NFVA 1D8DB 3GZKA 1V5CA 1EGUA 2V8IA 1N4QB 4ZRQA 1RQ5A 3RJ3A 2B4FA 4D94A 1HXCA 3QWTA 3M7EA 4FJQA 3P2CA 1OJOA 3M72A 1TN8B 1H14A 1XWQA 4ZH1A 3PYAA 1R76A 1KREA 3W7WA 4L6XA 4TXTA 3E80A 1FPPB 3Q75B 1H54A 3S4DA 2F0YB 2VN4A 5ILDA 3G4DA 3ON6A 3M01A 1HMWA 3QFZA 2ZZRA 1MZCB 4BOJA 3HXCB 3S4CA 1G9GA 1QSJA 3E7JA 1O1SB 4L0GA 1GLMA 2Z07A 3M00A 1FBWA 4LNBB 2RGKA 2ZBLA 3PMMA 1O6QA 2F6DA 3WIWA 1SA4B 1VD5A 5IL3A 2NVPA 3E32B 5DGQA 1HXAA 1XW2A 2BRWA 1UG9A 2JJBA 4AYPA 2ONGA 3LZ9A 1N94B 3SDTA 2A8ZA 1X1JA 2RI9A 3GLYA 4OK2A 4TF4A 3DSSB 3KLSA 1FT2B 1HXGA 1O5MB 1OJNA 1N7NA 1WU6A 4OZWA 1TF4A 1HM2A 5FOBB 1CLCA 1TNZB 4WVCA 3DPYB 3TF4A 1QBQB 2FV0A 3M76A 1HZFA 1KWFA 4KKIA 4D4DA 1GHQA 1FO2A 1JCSB 3W5MA 3KSQB 1NC5A 3ACSA 5CA3A 1H13A 1IS9A 1KSDA 3SDRA 2YIKA 1H37A 3H2WA 5AGDA 4Z4JA 5JPMB 5JMFA 1F9OA 2GOXA 3PZ3B 4ONTA 1N4SB 1IA7A 1W6KA 1RWHA 1N4RB 2FUZA 1GSZA 5FO9B 4FXKB 2D5JA 4Q2BA 5MEHA 1C82A 1FBOA 4YDOB 4GTOB 3ANIA 4FUSA 1KKTA 3M77A 1OJMA 1J0NA 1I8QA 3PYBA 1IA6A 2XFGA 2EACA 2BBCA 3WC3A 3WKIA 1G6IA 2G02A 4D4AA 4CJ1A 2BEDB 1N7RA 1FO3A 5IKHA 4XUVA 1FAEA 4AYOA 3E37B 1N20A 2VN7A 1TNBB 1F9DA 3WUXA 3WIQA 5FO8B 2H6IB 4DODA 3DSXB 4AYRA 2WINB 1NL4B 3QXFA 2Q1FA 3P5PA 5ILJA 5ILYA 4MMIA 1N1BA 2JF4A 1GXOA 1W3YA 3W5NA 3Q7AB 3E30B 4JJJA 2WDAA 3M75A 3SDUA 2QNOA 2ONHA 3N0FA 2DRSA 3M7LA 2AHFA 1QQFA 2WCOA 3S4BA 1WU5A 1FP3A 3SDVA 3WKGA 2XWBB 1JCQB 3E6UA 3ANKA 3HXBB 1C3DA 1H3AA 4ZH5A 3P5RA 1F1SA 5C05A 2DRQA 3Q79B 5KKBA 4M76A 1F9GA 3HXFB 1CB8A 1X9DA 4NEIA 1NI1B 3RX7A 3DSVB 3C72B 4DI5A 1L2AA 5CD2A 1L1YA 1DOGA 4ZRPA 3M78A 2I07B 3S9VA 1N24A 3VSNA 3VW5A 1O1TB 1HCUA 3QFYA 5GW7A 1H35A 3RX8A 4RNQA 2BB5A 3WKHA 1H36A 3T33A 1LTXB 4GTPB 3HXEB 1UT9A 2WIIB 1TNYB 2B39A 5GZKA 5IK6A 3SFYB 3W7SA 4AYQA 3EZ8A 4Q88A 5IK0A 4FNVA 1NXCA 1X81B 3WIRA 3KSLB 5ILKA 4E1YA 4GL3A 3QG0A 5E2JA 1H39A 2R2LB 5IL8A 2IEJB 1J0MA 1HM3A 4F13A 1FMIA 3EQAA 3RRSA 2AFAA 3A3VA 1KFGA 1RWFA 2DROA 3KQ4A 4V1RA 4V1SA 5ILZA 2PMVA 3DSUB 3PZ2B 1DL2A 1HV6A 1N9AB 5EAUA 1LXMA 2SQCA 1SA5B 3AFLA 5DHKA 1LF6A 3PZ4B 1N95B 4FXGB 4YDEB 2FBAA 1KZOB 4LNVA 2A73B 1N7OA 1H3CA 3K7XA 3E33B 3EU5B 3PZ1B 5M7IA 3H7LA 3OEDA 1AYXA 2V3PA 3EU8A 1WZZA 4L9PB 3QT3A 2H6FB 2WYNA 4MBGB 1KZPB 3RENA 4CJ0A 3Q73B 4GTTB 4BOKA 3QSPA 2FUTA 1N1ZA 4KKJA 4J5TA 3QRYA 1S63B 1N23A 3E73A 4EHMB 1TN7B 3W7TA 2AHGA 5IM1A 2J5CA 4LNGB 1KSCA 3M7BA 2E22A 2DRRA 4GTMB 1QAZA 1O1RB 2V8JA 1KRFA 3CU7A 2V3NA 1OJPA 4DOEA 2G0DA 3Q78B 3NNBA 4YCRA 1K72A 4GTRB 4OZVA 5EATA 2XQWA 4GTSB 4GTQB 2P0VA 2NOJA 1JS4A 5GY3A 1LOHA 1V5DA 3M02A 4MU9A 1V7XA 4OJZA 2PN5A 1GXNA 5CZLA 5DGRA 4ZG8A 1TN6B 3DSWB 2X03A 4CE7A 1S64B 2BB6A 3SAEA 1O6RA 2ZISB 2EABA 3QPFA 5M7YA 1N4PB 3QXQA 1XWTA 1V7VA 2BRPA 1CEMA 1LXKA 1N7PA 4MMHA 1AGMA 3D5RA 1WU4A 3OXUA 4QT9A 2EADA 1H3BA 3E34B 1DCEB 3SQCA 4WVBA 5IK9A 2D8LA 2CQTA 2GZ6A 3RSYA 3M7CA 4GAXA 1GAHA 3SDQA 3WKFA 3A0OA 2OKXA 3QDEA 1RWAA 3VXDA 3S4AA 1UMPA 4WVAA 5DHIA 1GAIA 1RWGA 3K11A 3W7XA 4EL8A 1O79A 3D5SA 2RI8A 2XWJB 5FO7B 4OK4A 1X1IA 3GT5A 1TNUB 5IKAA 3ANJA 1O6HA 1V7WA 2WY7A 3EUVB 4KTRA 2FUQA 3M74A 4C1SA 3QT9A 1RWCA 2WY8A 1JCRB 1GXMA 1LF9A 4Z4LA 2BRVX 1HX9A 2ZIRB 1ULVA 3G6JB 5ILHA 3W7UA 3N0GA 3DRAB 2E24A 1N7QA 3AFJA 5EASA 4GTVB 2JG0A 1RW9A 4D4CA 3M71A 4D4BA 2H6GB 1SQCA 1FCEA 2FV1A 1FT1B 3HXDB 2GH4A 3Q7FB 3DSTB 1TNOB 2H6HB 1GA2A 1G87A 1KS8A 3M73A 1H12A 1LD8B 3VSMA 3X17A 5ILIA 1G9JA 2V8KA 1X1HA 4LIXA 1LD7B 4WU0A 3CIHA 4F10A 5JPNB 1N22A 5JMDA 3H3KA 2CQSA 3SFXB 2EAEA 4KTPA 3RX5A 3D3IA 1HN0A 1HMUA
chains in the Genus database with same CATH topology
3ACTA 1D8EB 1W6JA 1D8DB 3GZKA 1V5CA 2V8IA 1N4QB 4ZRQA 1RQ5A 3RJ3A 2B4FA 4D94A 3QWTA 3M7EA 3P2CA 3M72A 1TN8B 1H14A 1XWQA 4ZH1A 3PYAA 1R76A 1KREA 3W7WA 4L6XA 4TXTA 1FPPB 3Q75B 1H54A 3S4DA 2F0YB 2VN4A 3ON6A 3QFZA 2ZZRA 1MZCB 4BOJA 3HXCB 3S4CA 1G9GA 1QSJA 1O1SB 4L0GA 1GLMA 2Z07A 4LNBB 1FBWA 2RGKA 2ZBLA 3PMMA 1O6QA 2F6DA 3WIWA 1SA4B 1VD5A 2NVPA 3E32B 5DGQA 1XW2A 1UG9A 2JJBA 4AYPA 1N94B 3SDTA 2A8ZA 2RI9A 3GLYA 4TF4A 3DSSB 3KLSA 1FT2B 1O5MB 1WU6A 1TF4A 5FOBB 1CLCA 1TNZB 4WVCA 3DPYB 3TF4A 1QBQB 2FV0A 3M76A 1HZFA 1KWFA 4KKIA 4D4DA 1GHQA 1FO2A 1JCSB 3W5MA 3KSQB 1NC5A 3ACSA 5CA3A 1H13A 1IS9A 1KSDA 3SDRA 2YIKA 1H37A 3H2WA 5AGDA 4Z4JA 5JPMB 1F9OA 2GOXA 3PZ3B 4ONTA 1N4SB 1IA7A 1W6KA 1N4RB 2FUZA 1GSZA 5FO9B 4FXKB 2D5JA 4Q2BA 5MEHA 1FBOA 4YDOB 4GTOB 3ANIA 4FUSA 1KKTA 3M77A 3PYBA 1IA6A 2XFGA 2EACA 2BBCA 3WC3A 3WKIA 1G6IA 2G02A 4D4AA 4CJ1A 2BEDB 1FO3A 4XUVA 1FAEA 4AYOA 3E37B 2VN7A 1TNBB 1F9DA 3WUXA 3WIQA 5FO8B 2H6IB 4DODA 3DSXB 4AYRA 2WINB 1NL4B 3QXFA 3P5PA 2JF4A 1GXOA 3W5NA 3Q7AB 3E30B 4JJJA 3M75A 3SDUA 2QNOA 2DRSA 3M7LA 2AHFA 1QQFA 3S4BA 1WU5A 1FP3A 3SDVA 3WKGA 2XWBB 1JCQB 3E6UA 3ANKA 3HXBB 1C3DA 1H3AA 4ZH5A 3P5RA 2DRQA 3Q79B 5KKBA 4M76A 3HXFB 1X9DA 1NI1B 3RX7A 3DSVB 3C72B 1L2AA 5CD2A 1L1YA 1DOGA 4ZRPA 3M78A 2I07B 3S9VA 3VW5A 1O1TB 1HCUA 3QFYA 5GW7A 1H35A 3RX8A 2BB5A 3WKHA 1H36A 3T33A 1LTXB 4GTPB 3HXEB 1UT9A 2WIIB 1TNYB 2B39A 5GZKA 3SFYB 3W7SA 4AYQA 3EZ8A 4Q88A 1NXCA 1X81B 3WIRA 3KSLB 4GL3A 3QG0A 5E2JA 1H39A 2R2LB 2IEJB 1FMIA 3EQAA 3RRSA 2AFAA 3A3VA 1KFGA 2DROA 3KQ4A 4V1RA 4V1SA 2PMVA 3DSUB 3PZ2B 1DL2A 1N9AB 2SQCA 1SA5B 1LF6A 3PZ4B 1N95B 4FXGB 4YDEB 2FBAA 1KZOB 4LNVA 2A73B 1H3CA 3K7XA 3E33B 3EU5B 3PZ1B 5M7IA 3H7LA 3OEDA 1AYXA 2V3PA 3EU8A 1WZZA 4L9PB 3QT3A 2H6FB 2WYNA 4MBGB 1KZPB 3RENA 4CJ0A 3Q73B 4GTTB 4BOKA 3QSPA 4KKJA 4J5TA 3QRYA 1S63B 3E73A 4EHMB 1TN7B 3W7TA 2AHGA 4LNGB 1KSCA 3M7BA 2DRRA 4GTMB 1O1RB 2V8JA 1KRFA 3CU7A 2V3NA 4DOEA 2G0DA 3Q78B 4YCRA 1K72A 4GTRB 2XQWA 4GTSB 4GTQB 2P0VA 2NOJA 1JS4A 5GY3A 1V5DA 4MU9A 1V7XA 2PN5A 1GXNA 5CZLA 5DGRA 4ZG8A 1TN6B 3DSWB 4CE7A 1S64B 2BB6A 3SAEA 1O6RA 2ZISB 2EABA 3QPFA 5M7YA 1N4PB 3QXQA 1XWTA 1V7VA 1CEMA 1AGMA 3D5RA 1WU4A 3OXUA 4QT9A 2EADA 1H3BA 3E34B 1DCEB 3SQCA 4WVBA 2D8LA 2CQTA 2GZ6A 3RSYA 3M7CA 1GAHA 3SDQA 3WKFA 2OKXA 3QDEA 3VXDA 3S4AA 1UMPA 4WVAA 1GAIA 3K11A 3W7XA 4EL8A 1O79A 3D5SA 2RI8A 2XWJB 5FO7B 3GT5A 1TNUB 3ANJA 1O6HA 1V7WA 2WY7A 3EUVB 4KTRA 3M74A 4C1SA 3QT9A 2WY8A 1JCRB 1GXMA 1LF9A 4Z4LA 2ZIRB 3G6JB 1ULVA 3W7UA 3DRAB 3AFJA 4GTVB 2JG0A 4D4CA 3M71A 4D4BA 2H6GB 1SQCA 1FCEA 2FV1A 1FT1B 3HXDB 2GH4A 3Q7FB 3DSTB 1TNOB 2H6HB 1GA2A 1G87A 1KS8A 3M73A 1H12A 1LD8B 3X17A 1G9JA 2V8KA 4LIXA 1LD7B 4WU0A 3CIHA 5JPNB 3H3KA 2CQSA 3SFXB 2EAEA 4KTPA 3RX5A 3D3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTO B;  1D8E B;  1H39 A;  2ZIS B;  1W6J A;  2R2L B;  1N4P B;  1D8D B;  2IEJ B;  2BBC A;  2G02 A;  1N4Q B;  2V8I A;  4ZRQ A;  4D4A A;  2BED B;  3RJ3 A;  3D5R A;  4D94 A;  3KQ4 A;  4V1R A;  3OXU A;  4V1S A;  2PMV A;  3DSU B;  3E37 B;  3PZ2 B;  1H3B A;  3E34 B;  1DCE B;  1N9A B;  1TNB B;  2SQC A;  1SA5 B;  5FO8 B;  3PZ4 B;  3SQC A;  1TN8 B;  2H6I B;  1N95 B;  4ZH1 A;  4FXG B;  3DSX B;  2WIN B;  4YDE B;  1NL4 B;  1KZO B;  4LNV A;  1R76 A;  2A73 B;  1H3C A;  3K7X A;  3E33 B;  3EU5 B;  3PZ1 B;  1FPP B;  3Q75 B;  2F0Y B;  1GXO A;  3Q7A B;  3E30 B;  1UMP A;  3OED A;  1MZC B;  2V3P A;  1O79 A;  4BOJ A;  3D5S A;  2XWJ B;  3HXC B;  4L9P B;  1QSJ A;  1O1S B;  5FO7 B;  2H6F B;  4LNB B;  1TNU B;  1O6H A;  1QQF A;  4MBG B;  2WY7 A;  3EUV B;  1O6Q A;  4C1S A;  1KZP B;  2WY8 A;  1JCQ B;  2XWB B;  1SA4 B;  1JCR B;  1GXM A;  3HXB B;  3E32 B;  3Q73 B;  1C3D A;  4GTT B;  1H3A A;  4BOK A;  2ZIR B;  3G6J B;  3Q79 B;  4KKJ A;  3DRA B;  4M76 A;  3HXF B;  1S63 B;  4GTV B;  1N94 B;  4D4C A;  4EHM B;  4D4B A;  1TN7 B;  2H6G B;  1SQC A;  1NI1 B;  3DSS B;  3KLS A;  1FT2 B;  1FT1 B;  1O5M B;  3HXD B;  3DSV B;  3C72 B;  3Q7F B;  3DST B;  4LNG B;  5FOB B;  1TNZ B;  1TNO B;  4GTM B;  2H6H B;  4ZRP A;  3DPY B;  1O1R B;  1QBQ B;  2I07 B;  2V8J A;  1LD8 B;  1HZF A;  3CU7 A;  4KKI A;  2V3N A;  4D4D A;  1GHQ A;  1O1T B;  1JCS B;  3KSQ B;  2G0D A;  1H35 A;  2V8K A;  3Q78 B;  2BB5 A;  1H36 A;  4GTR B;  2XQW A;  1LTX B;  1H37 A;  4GTP B;  4GTS B;  4GTQ B;  3HXE B;  1LD7 B;  2NOJ A;  2WII B;  5AGD A;  1TNY B;  5JPM B;  2GOX A;  2B39 A;  3PZ3 B;  4MU9 A;  5JPN B;  3SFY B;  2PN5 A;  4ONT A;  1GXN A;  1N4S B;  1TN6 B;  3DSW B;  1W6K A;  1N4R B;  3SFX B;  1GSZ A;  5FO9 B;  4FXK B;  1S64 B;  1X81 B;  3KSL B;  2BB6 A;  1O6R A;  4YDO B; 
#chains in the Genus database with same CATH topology
 3ACT A;  1D8E B;  1N21 A;  1W6J A;  3G4F A;  3NFV A;  1D8D B;  3GZK A;  1V5C A;  1EGU A;  2V8I A;  1N4Q B;  4ZRQ A;  1RQ5 A;  3RJ3 A;  2B4F A;  4D94 A;  1HXC A;  3QWT A;  3M7E A;  4FJQ A;  3P2C A;  1OJO A;  3M72 A;  1TN8 B;  1H14 A;  1XWQ A;  4ZH1 A;  3PYA A;  1R76 A;  1KRE A;  3W7W A;  4L6X A;  4TXT A;  3E80 A;  1FPP B;  3Q75 B;  1H54 A;  3S4D A;  2F0Y B;  2VN4 A;  5ILD A;  3G4D A;  3ON6 A;  3M01 A;  1HMW A;  3QFZ A;  2ZZR A;  1MZC B;  4BOJ A;  3HXC B;  3S4C A;  1G9G A;  1QSJ A;  3E7J A;  1O1S B;  4L0G A;  1GLM A;  2Z07 A;  3M00 A;  1FBW A;  4LNB B;  2RGK A;  2ZBL A;  3PMM A;  1O6Q A;  2F6D A;  3WIW A;  1SA4 B;  1VD5 A;  5IL3 A;  2NVP A;  3E32 B;  5DGQ A;  1HXA A;  1XW2 A;  2BRW A;  1UG9 A;  2JJB A;  4AYP A;  2ONG A;  3LZ9 A;  1N94 B;  3SDT A;  2A8Z A;  1X1J A;  2RI9 A;  3GLY A;  4OK2 A;  4TF4 A;  3DSS B;  3KLS A;  1FT2 B;  1HXG A;  1O5M B;  1OJN A;  1N7N A;  1WU6 A;  4OZW A;  1TF4 A;  1HM2 A;  5FOB B;  1CLC A;  1TNZ B;  4WVC A;  3DPY B;  3TF4 A;  1QBQ B;  2FV0 A;  3M76 A;  1HZF A;  1KWF A;  4KKI A;  4D4D A;  1GHQ A;  1FO2 A;  1JCS B;  3W5M A;  3KSQ B;  1NC5 A;  3ACS A;  5CA3 A;  1H13 A;  1IS9 A;  1KSD A;  3SDR A;  2YIK A;  1H37 A;  3H2W A;  5AGD A;  4Z4J A;  5JPM B;  5JMF A;  1F9O A;  2GOX A;  3PZ3 B;  4ONT A;  1N4S B;  1IA7 A;  1W6K A;  1RWH A;  1N4R B;  2FUZ A;  1GSZ A;  5FO9 B;  4FXK B;  2D5J A;  4Q2B A;  5MEH A;  1C82 A;  1FBO A;  4YDO B;  4GTO B;  3ANI A;  4FUS A;  1KKT A;  3M77 A;  1OJM A;  1J0N A;  1I8Q A;  3PYB A;  1IA6 A;  2XFG A;  2EAC A;  2BBC A;  3WC3 A;  3WKI A;  1G6I A;  2G02 A;  4D4A A;  4CJ1 A;  2BED B;  1N7R A;  1FO3 A;  5IKH A;  4XUV A;  1FAE A;  4AYO A;  3E37 B;  1N20 A;  2VN7 A;  1TNB B;  1F9D A;  3WUX A;  3WIQ A;  5FO8 B;  2H6I B;  4DOD A;  3DSX B;  4AYR A;  2WIN B;  1NL4 B;  3QXF A;  2Q1F A;  3P5P A;  5ILJ A;  5ILY A;  4MMI A;  1N1B A;  2JF4 A;  1GXO A;  1W3Y A;  3W5N A;  3Q7A B;  3E30 B;  4JJJ A;  2WDA A;  3M75 A;  3SDU A;  2QNO A;  2ONH A;  3N0F A;  2DRS A;  3M7L A;  2AHF A;  1QQF A;  2WCO A;  3S4B A;  1WU5 A;  1FP3 A;  3SDV A;  3WKG A;  2XWB B;  1JCQ B;  3E6U A;  3ANK A;  3HXB B;  1C3D A;  1H3A A;  4ZH5 A;  3P5R A;  1F1S A;  5C05 A;  2DRQ A;  3Q79 B;  5KKB A;  4M76 A;  1F9G A;  3HXF B;  1CB8 A;  1X9D A;  4NEI A;  1NI1 B;  3RX7 A;  3DSV B;  3C72 B;  4DI5 A;  1L2A A;  5CD2 A;  1L1Y A;  1DOG A;  4ZRP A;  3M78 A;  2I07 B;  3S9V A;  1N24 A;  3VSN A;  3VW5 A;  1O1T B;  1HCU A;  3QFY A;  5GW7 A;  1H35 A;  3RX8 A;  4RNQ A;  2BB5 A;  3WKH A;  1H36 A;  3T33 A;  1LTX B;  4GTP B;  3HXE B;  1UT9 A;  2WII B;  1TNY B;  2B39 A;  5GZK A;  5IK6 A;  3SFY B;  3W7S A;  4AYQ A;  3EZ8 A;  4Q88 A;  5IK0 A;  4FNV A;  1NXC A;  1X81 B;  3WIR A;  3KSL B;  5ILK A;  4E1Y A;  4GL3 A;  3QG0 A;  5E2J A;  1H39 A;  2R2L B;  5IL8 A;  2IEJ B;  1J0M A;  1HM3 A;  4F13 A;  1FMI A;  3EQA A;  3RRS A;  2AFA A;  3A3V A;  1KFG A;  1RWF A;  2DRO A;  3KQ4 A;  4V1R A;  4V1S A;  5ILZ A;  2PMV A;  3DSU B;  3PZ2 B;  1DL2 A;  1HV6 A;  1N9A B;  5EAU A;  1LXM A;  2SQC A;  1SA5 B;  3AFL A;  5DHK A;  1LF6 A;  3PZ4 B;  1N95 B;  4FXG B;  4YDE B;  2FBA A;  1KZO B;  4LNV A;  2A73 B;  1N7O A;  1H3C A;  3K7X A;  3E33 B;  3EU5 B;  3PZ1 B;  5M7I A;  3H7L A;  3OED A;  1AYX A;  2V3P A;  3EU8 A;  1WZZ A;  4L9P B;  3QT3 A;  2H6F B;  2WYN A;  4MBG B;  1KZP B;  3REN A;  4CJ0 A;  3Q73 B;  4GTT B;  4BOK A;  3QSP A;  2FUT A;  1N1Z A;  4KKJ A;  4J5T A;  3QRY A;  1S63 B;  1N23 A;  3E73 A;  4EHM B;  1TN7 B;  3W7T A;  2AHG A;  5IM1 A;  2J5C A;  4LNG B;  1KSC A;  3M7B A;  2E22 A;  2DRR A;  4GTM B;  1QAZ A;  1O1R B;  2V8J A;  1KRF A;  3CU7 A;  2V3N A;  1OJP A;  4DOE A;  2G0D A;  3Q78 B;  3NNB A;  4YCR A;  1K72 A;  4GTR B;  4OZV A;  5EAT A;  2XQW A;  4GTS B;  4GTQ B;  2P0V A;  2NOJ A;  1JS4 A;  5GY3 A;  1LOH A;  1V5D A;  3M02 A;  4MU9 A;  1V7X A;  4OJZ A;  2PN5 A;  1GXN A;  5CZL A;  5DGR A;  4ZG8 A;  1TN6 B;  3DSW B;  2X03 A;  4CE7 A;  1S64 B;  2BB6 A;  3SAE A;  1O6R A;  2ZIS B;  2EAB A;  3QPF A;  5M7Y A;  1N4P B;  3QXQ A;  1XWT A;  1V7V A;  2BRP A;  1CEM A;  1LXK A;  1N7P A;  4MMH A;  1AGM A;  3D5R A;  1WU4 A;  3OXU A;  4QT9 A;  2EAD A;  1H3B A;  3E34 B;  1DCE B;  3SQC A;  4WVB A;  5IK9 A;  2D8L A;  2CQT A;  2GZ6 A;  3RSY A;  3M7C A;  4GAX A;  1GAH A;  3SDQ A;  3WKF A;  3A0O A;  2OKX A;  3QDE A;  1RWA A;  3VXD A;  3S4A A;  1UMP A;  4WVA A;  5DHI A;  1GAI A;  1RWG A;  3K11 A;  3W7X A;  4EL8 A;  1O79 A;  3D5S A;  2RI8 A;  2XWJ B;  5FO7 B;  4OK4 A;  1X1I A;  3GT5 A;  1TNU B;  5IKA A;  3ANJ A;  1O6H A;  1V7W A;  2WY7 A;  3EUV B;  4KTR A;  2FUQ A;  3M74 A;  4C1S A;  3QT9 A;  1RWC A;  2WY8 A;  1JCR B;  1GXM A;  1LF9 A;  4Z4L A;  2BRV X;  1HX9 A;  2ZIR B;  1ULV A;  3G6J B;  5ILH A;  3W7U A;  3N0G A;  3DRA B;  2E24 A;  1N7Q A;  3AFJ A;  5EAS A;  4GTV B;  2JG0 A;  1RW9 A;  4D4C A;  3M71 A;  4D4B A;  2H6G B;  1SQC A;  1FCE A;  2FV1 A;  1FT1 B;  3HXD B;  2GH4 A;  3Q7F B;  3DST B;  1TNO B;  2H6H B;  1GA2 A;  1G87 A;  1KS8 A;  3M73 A;  1H12 A;  1LD8 B;  3VSM A;  3X17 A;  5ILI A;  1G9J A;  2V8K A;  1X1H A;  4LIX A;  1LD7 B;  4WU0 A;  3CIH A;  4F10 A;  5JPN B;  1N22 A;  5JMD A;  3H3K A;  2CQS A;  3SFX B;  2EAE A;  4KTP A;  3RX5 A;  3D3I A;  1HN0 A;  1HMU A; 
#chains in the Genus database with same CATH homology
 3ACT A;  1D8E B;  1W6J A;  1D8D B;  3GZK A;  1V5C A;  2V8I A;  1N4Q B;  4ZRQ A;  1RQ5 A;  3RJ3 A;  2B4F A;  4D94 A;  3QWT A;  3M7E A;  3P2C A;  3M72 A;  1TN8 B;  1H14 A;  1XWQ A;  4ZH1 A;  3PYA A;  1R76 A;  1KRE A;  3W7W A;  4L6X A;  4TXT A;  1FPP B;  3Q75 B;  1H54 A;  3S4D A;  2F0Y B;  2VN4 A;  3ON6 A;  3QFZ A;  2ZZR A;  1MZC B;  4BOJ A;  3HXC B;  3S4C A;  1G9G A;  1QSJ A;  1O1S B;  4L0G A;  1GLM A;  2Z07 A;  4LNB B;  1FBW A;  2RGK A;  2ZBL A;  3PMM A;  1O6Q A;  2F6D A;  3WIW A;  1SA4 B;  1VD5 A;  2NVP A;  3E32 B;  5DGQ A;  1XW2 A;  1UG9 A;  2JJB A;  4AYP A;  1N94 B;  3SDT A;  2A8Z A;  2RI9 A;  3GLY A;  4TF4 A;  3DSS B;  3KLS A;  1FT2 B;  1O5M B;  1WU6 A;  1TF4 A;  5FOB B;  1CLC A;  1TNZ B;  4WVC A;  3DPY B;  3TF4 A;  1QBQ B;  2FV0 A;  3M76 A;  1HZF A;  1KWF A;  4KKI A;  4D4D A;  1GHQ A;  1FO2 A;  1JCS B;  3W5M A;  3KSQ B;  1NC5 A;  3ACS A;  5CA3 A;  1H13 A;  1IS9 A;  1KSD A;  3SDR A;  2YIK A;  1H37 A;  3H2W A;  5AGD A;  4Z4J A;  5JPM B;  1F9O A;  2GOX A;  3PZ3 B;  4ONT A;  1N4S B;  1IA7 A;  1W6K A;  1N4R B;  2FUZ A;  1GSZ A;  5FO9 B;  4FXK B;  2D5J A;  4Q2B A;  5MEH A;  1FBO A;  4YDO B;  4GTO B;  3ANI A;  4FUS A;  1KKT A;  3M77 A;  3PYB A;  1IA6 A;  2XFG A;  2EAC A;  2BBC A;  3WC3 A;  3WKI A;  1G6I A;  2G02 A;  4D4A A;  4CJ1 A;  2BED B;  1FO3 A;  4XUV A;  1FAE A;  4AYO A;  3E37 B;  2VN7 A;  1TNB B;  1F9D A;  3WUX A;  3WIQ A;  5FO8 B;  2H6I B;  4DOD A;  3DSX B;  4AYR A;  2WIN B;  1NL4 B;  3QXF A;  3P5P A;  2JF4 A;  1GXO A;  3W5N A;  3Q7A B;  3E30 B;  4JJJ A;  3M75 A;  3SDU A;  2QNO A;  2DRS A;  3M7L A;  2AHF A;  1QQF A;  3S4B A;  1WU5 A;  1FP3 A;  3SDV A;  3WKG A;  2XWB B;  1JCQ B;  3E6U A;  3ANK A;  3HXB B;  1C3D A;  1H3A A;  4ZH5 A;  3P5R A;  2DRQ A;  3Q79 B;  5KKB A;  4M76 A;  3HXF B;  1X9D A;  1NI1 B;  3RX7 A;  3DSV B;  3C72 B;  1L2A A;  5CD2 A;  1L1Y A;  1DOG A;  4ZRP A;  3M78 A;  2I07 B;  3S9V A;  3VW5 A;  1O1T B;  1HCU A;  3QFY A;  5GW7 A;  1H35 A;  3RX8 A;  2BB5 A;  3WKH A;  1H36 A;  3T33 A;  1LTX B;  4GTP B;  3HXE B;  1UT9 A;  2WII B;  1TNY B;  2B39 A;  5GZK A;  3SFY B;  3W7S A;  4AYQ A;  3EZ8 A;  4Q88 A;  1NXC A;  1X81 B;  3WIR A;  3KSL B;  4GL3 A;  3QG0 A;  5E2J A;  1H39 A;  2R2L B;  2IEJ B;  1FMI A;  3EQA A;  3RRS A;  2AFA A;  3A3V A;  1KFG A;  2DRO A;  3KQ4 A;  4V1R A;  4V1S A;  2PMV A;  3DSU B;  3PZ2 B;  1DL2 A;  1N9A B;  2SQC A;  1SA5 B;  1LF6 A;  3PZ4 B;  1N95 B;  4FXG B;  4YDE B;  2FBA A;  1KZO B;  4LNV A;  2A73 B;  1H3C A;  3K7X A;  3E33 B;  3EU5 B;  3PZ1 B;  5M7I A;  3H7L A;  3OED A;  1AYX A;  2V3P A;  3EU8 A;  1WZZ A;  4L9P B;  3QT3 A;  2H6F B;  2WYN A;  4MBG B;  1KZP B;  3REN A;  4CJ0 A;  3Q73 B;  4GTT B;  4BOK A;  3QSP A;  4KKJ A;  4J5T A;  3QRY A;  1S63 B;  3E73 A;  4EHM B;  1TN7 B;  3W7T A;  2AHG A;  4LNG B;  1KSC A;  3M7B A;  2DRR A;  4GTM B;  1O1R B;  2V8J A;  1KRF A;  3CU7 A;  2V3N A;  4DOE A;  2G0D A;  3Q78 B;  4YCR A;  1K72 A;  4GTR B;  2XQW A;  4GTS B;  4GTQ B;  2P0V A;  2NOJ A;  1JS4 A;  5GY3 A;  1V5D A;  4MU9 A;  1V7X A;  2PN5 A;  1GXN A;  5CZL A;  5DGR A;  4ZG8 A;  1TN6 B;  3DSW B;  4CE7 A;  1S64 B;  2BB6 A;  3SAE A;  1O6R A;  2ZIS B;  2EAB A;  3QPF A;  5M7Y A;  1N4P B;  3QXQ A;  1XWT A;  1V7V A;  1CEM A;  1AGM A;  3D5R A;  1WU4 A;  3OXU A;  4QT9 A;  2EAD A;  1H3B A;  3E34 B;  1DCE B;  3SQC A;  4WVB A;  2D8L A;  2CQT A;  2GZ6 A;  3RSY A;  3M7C A;  1GAH A;  3SDQ A;  3WKF A;  2OKX A;  3QDE A;  3VXD A;  3S4A A;  1UMP A;  4WVA A;  1GAI A;  3K11 A;  3W7X A;  4EL8 A;  1O79 A;  3D5S A;  2RI8 A;  2XWJ B;  5FO7 B;  3GT5 A;  1TNU B;  3ANJ A;  1O6H A;  1V7W A;  2WY7 A;  3EUV B;  4KTR A;  3M74 A;  4C1S A;  3QT9 A;  2WY8 A;  1JCR B;  1GXM A;  1LF9 A;  4Z4L A;  2ZIR B;  3G6J B;  1ULV A;  3W7U A;  3DRA B;  3AFJ A;  4GTV B;  2JG0 A;  4D4C A;  3M71 A;  4D4B A;  2H6G B;  1SQC A;  1FCE A;  2FV1 A;  1FT1 B;  3HXD B;  2GH4 A;  3Q7F B;  3DST B;  1TNO B;  2H6H B;  1GA2 A;  1G87 A;  1KS8 A;  3M73 A;  1H12 A;  1LD8 B;  3X17 A;  1G9J A;  2V8K A;  4LIX A;  1LD7 B;  4WU0 A;  3CIH A;  5JPN B;  3H3K A;  2CQS A;  3SFX B;  2EAE A;  4KTP A;  3RX5 A;  3D3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...