3DSVB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys-ser-cys(gg) derivated from rab7
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dsvB00
4D4DA 4YDEB 4GTRB 2BB6A 2ZISB 2BEDB 3D5SA 1R76A 2ZIRB 4GTQB 1GSZA 3DSUB 4MBGB 1HZFA 3D5RA 1NL4B 3HXBB 1TNZB 3Q73B 1S63B 2XWJB 3Q75B 1GXOA 2PN5A 1LD8B 3C72B 4C1SA 1JCQB 1LTXB 4D4CA 1TNOB 1O1TB 2H6GB 2V8KA 2V3PA 3DRAB 2WY8A 1N4PB 1N9AB 3Q7FB 1O6QA 1SA4B 3KSQB 3G6JB 4V1RA 3Q79B 2GOXA 1H3BA 1TNYB 1FT2B 3KLSA 3HXCB 4KKIA 4ONTA 4D4AA 1KZOB 5FO7B 2H6FB 1TN8B 1W6JA 4M76A 1NI1B 4BOJA 4GTTB 1N94B 3PZ4B 4MU9A 2BBCA 3PZ3B 1O6RA 4D4BA 1TNBB 1TN7B 3EU5B 3HXDB 4YDOB 5JPMB 3DSTB 2NOJA 3E33B 1QBQB 1QQFA 1QSJA 1C3DA 1GXMA 1O79A 4BOKA 3Q78B 4ZH1A 3E34B 1D8DB 3HXEB 2WY7A 3DSSB 3SQCA 3OEDA 1DCEB 1GHQA 1UMPA 2G02A 3HXFB 2PMVA 2F0YB 3RJ3A 1H39A 3KSLB 3DSVB 1GXNA 2BB5A 2A73B 3PZ1B 3SFYB 1D8EB 4LNGB 2IEJB 3DSWB 4FXKB 1SQCA 4LNVA 1S64B 1LD7B 5FO9B 2B39A 2R2LB 3E37B 3K7XA 4EHMB 1O1RB 1O6HA 2V8IA 1N4QB 2WIIB 2I07B 1W6KA 2H6IB 2V8JA 4GTVB 2H6HB 3KQ4A 1JCRB 1TNUB 1X81B 5JPNB 1O5MB 5FO8B 1H3AA 2XQWA 3E32B 1KZPB 4GTOB 4ZRPA 3DSXB 3SFXB 1MZCB 3E30B 3CU7A 1H36A 1JCSB 4GTSB 5AGDA 3Q7AB 4LNBB 2WINB 1N95B 1O1SB 3OXUA 3DPYB 4GTPB 1N4SB 4L9PB 4GTMB 5FOBB 2XWBB 3EUVB 1H3CA 4D94A 1TN6B 1FPPB 4KKJA 3PZ2B 4ZRQA 1H35A 1N4RB 1SA5B 1H37A 4FXGB 2G0DA 2SQCA 1FT1B 2V3NA 4V1SA
chains in the Genus database with same CATH superfamily
3GLYA 1RW9A 4YDEB 2XFGA 3PMMA 2BEDB 3QXQA 1CEMA 2ZIRB 3QSPA 3DSUB 3SAEA 2F6DA 1RWCA 3HXBB 1S63B 1GXOA 5EATA 3QT9A 3C72B 4TXTA 3ACTA 1JCQB 3EZ8A 3M00A 2DRSA 4D4CA 1N7PA 1IA6A 2V8KA 1OJMA 2DRQA 1N4PB 3ANKA 3D3IA 4V1RA 2D5JA 1F9OA 1RQ5A 2NVPA 3RRSA 3M78A 1TN8B 4M76A 1XWQA 5IM1A 1RWGA 2P0VA 4ZG8A 3M7BA 2FUZA 1HV6A 5GZKA 5ILHA 1O6RA 3WC3A 1N7OA 1OJOA 2JJBA 5IK6A 4CJ0A 4YDOB 1W3YA 1GXMA 1O79A 3WKFA 1OJNA 4ZH1A 3TF4A 1D8DB 1GAHA 3HXEB 3DSSB 2WCOA 3M01A 3OEDA 1DCEB 3G4DA 2F0YB 2DROA 2GZ6A 2BRWA 3S4CA 1D8EB 4LNGB 4WVBA 2IEJB 1LOHA 2YIKA 5M7YA 3DSWB 1S64B 5FO9B 2R2LB 2BRVX 5C05A 2BRPA 3ANJA 3NNBA 1O6HA 1N4QB 4XUVA 4AYOA 3T33A 5JMFA 1FP3A 3KQ4A 4QT9A 2X03A 1GAIA 5IL3A 2XQWA 1KZPB 4GTOB 4ZRPA 3DSXB 3CU7A 5EASA 5AGDA 3M72A 5IKHA 1VD5A 3OXUA 3LZ9A 4AYQA 4L0GA 3E80A 4L9PB 3QXFA 4GTMB 5IL8A 2EADA 1TN6B 1G9JA 3W7UA 5DHKA 1H35A 1N4RB 1H37A 2G0DA 2SQCA 1FT1B 4NEIA 4EL8A 1WZZA 4GTRB 1X9DA 2BB6A 4WVCA 1R76A 4GTQB 3Q73B 2RI9A 2XWJB 4C1SA 4CJ1A 3SDUA 1TNOB 1UT9A 3W7TA 3SDVA 4AYRA 2V3PA 2WY8A 3G6JB 2AHGA 1TNYB 1FT2B 3KLSA 4KKIA 4D4AA 1KZOB 1G87A 1L1YA 3M7CA 2VN4A 3SDRA 1LXKA 4E1YA 2H6FB 4GL3A 1W6JA 3P5RA 4BOJA 4MMHA 1RWFA 1TF4A 4MU9A 1XW2A 3M77A 3M76A 1X1HA 2OKXA 1KSCA 5JPMB 3DSTB 2NOJA 3M7LA 1N7QA 3QPFA 3E34B 5IKAA 1CB8A 1WU4A 2WY7A 4Q88A 2WDAA 3SDTA 3M75A 3SQCA 3W5MA 1IS9A 4KTPA 3RJ3A 4F13A 3KSLB 3VSNA 3W7SA 4CE7A 3P5PA 1XWTA 4LNVA 4OZVA 1G9GA 2D8LA 1O1RB 3M7EA 1FAEA 1AGMA 5DGQA 1W6KA 2FV1A 1X81B 5JPNB 5E2JA 1H3AA 3G4FA 4TF4A 3SFXB 3E30B 5GW7A 1H36A 1N20A 1JCSB 1GA2A 3WKIA 2Z07A 5CZLA 2B4FA 2WINB 1N95B 4GTPB 3AFJA 5FOBB 3WIRA 5KKBA 3H7LA 3PZ2B 4FJQA 2V3NA 1HXGA 3RX7A 1HMUA 4D4DA 4WVAA 1HCUA 2ZISB 1I8QA 4Z4JA 1GSZA 2JG0A 1HZFA 4JJJA 3QFZA 1TNZB 4OK4A 2VN7A 1LD8B 1JS4A 4KTRA 3QT3A 1O1TB 2H6GB 1LF9A 4YCRA 1O6QA 1SA4B 2FUTA 2DRRA 3Q79B 1H3BA 2WYNA 4Q2BA 1IA7A 2RGKA 2QNOA 3X17A 1FBOA 1N94B 3W7XA 3EQAA 3PZ3B 2FBAA 1TNBB 1FCEA 1TN7B 2ONHA 2EABA 1RWHA 3RX8A 3WIWA 1AYXA 1KREA 3E33B 1QBQB 1QSJA 3H2WA 5ILZA 1C3DA 5M7IA 1DL2A 1N1ZA 2JF4A 2A8ZA 3QDEA 1GHQA 1H13A 1UMPA 3HXFB 2J5CA 1H39A 2FUQA 1L2AA 3DSVB 1GXNA 2A73B 3PZ1B 3ACSA 5ILIA 1HMWA 1SQCA 1N7RA 1LD7B 1WU5A 2B39A 3E37B 3GZKA 3K7XA 3H3KA 4EHMB 1KWFA 3E7JA 4DODA 3GT5A 2V8IA 3P2CA 1F9DA 2WIIB 2ZBLA 3VSMA 2H6IB 4OZWA 1N1BA 1X1JA 4ZH5A 2H6HB 3ANIA 1TNUB 1X1IA 3E32B 1F9GA 1H12A 3M71A 1MZCB 3EU8A 1UG9A 3PYAA 3ON6A 5MEHA 1N7NA 4L6XA 2RI8A 2E22A 3Q7AB 3QG0A 2FV0A 4LNBB 3WUXA 1V7XA 3N0GA 1N4SB 1N22A 4LIXA 2XWBB 1ULVA 5IK9A 1C82A 4D94A 1WU6A 1FPPB 4KKJA 1N23A 1HM2A 1SA5B 3CIHA 3QWTA 1HN0A 1G6IA 1OJPA 5ILYA 5GY3A 3S4DA 3D5SA 3PYBA 3S9VA 4MBGB 3A0OA 3D5RA 1NL4B 3Q75B 3VW5A 2CQTA 2PN5A 3E73A 1LTXB 1NXCA 3E6UA 3QRYA 1KKTA 3DRAB 1N9AB 3Q7FB 1GLMA 5IK0A 1F1SA 3KSQB 1FBWA 1RWAA 2GOXA 3WKHA 4DOEA 1KSDA 3HXCB 1H54A 4ONTA 1HM3A 1HXAA 5DGRA 4J5TA 5FO7B 1V7VA 5CD2A 2ZZRA 3S4BA 3VXDA 4AYPA 2EAEA 3AFLA 1NI1B 4Z4LA 4GTTB 3PZ4B 1HXCA 5EAUA 2BBCA 2GH4A 4D4BA 3EU5B 3HXDB 1N24A 2AHFA 3M73A 1HX9A 1QQFA 3K11A 4BOKA 3RX5A 3Q78B 4RNQA 2E24A 3SDQA 4MMIA 2G02A 5CA3A 2PMVA 1H14A 3RENA 4WU0A 1V7WA 3W5NA 1KFGA 2BB5A 1KS8A 5DHIA 4GAXA 3SFYB 3WIQA 4OK2A 1LXMA 2CQSA 4FXKB 3M74A 4FNVA 4FUSA 2Q1FA 1FO2A 1DOGA 1V5CA 5ILJA 1FO3A 2EACA 2I07B 1CLCA 2AFAA 3S4AA 2V8JA 4GTVB 3WKGA 1LF6A 5ILKA 2ONGA 1JCRB 3QFYA 1O5MB 5FO8B 1V5DA 3NFVA 3N0FA 4F10A 5JMDA 4DI5A 1K72A 3W7WA 1N21A 1J0MA 4GTSB 3RSYA 1J0NA 1O1SB 5ILDA 1QAZA 3DPYB 1EGUA 1FMIA 1KRFA 1NC5A 3EUVB 1H3CA 4OJZA 3M02A 4ZRQA 3A3VA 4FXGB 4V1SA
chains in the Genus database with same CATH topology
3GLYA 4YDEB 2XFGA 3PMMA 2BEDB 3QXQA 1CEMA 2ZIRB 3QSPA 3DSUB 3SAEA 2F6DA 3HXBB 1S63B 1GXOA 3QT9A 3C72B 4TXTA 3ACTA 1JCQB 3EZ8A 4D4CA 2DRSA 1IA6A 2V8KA 2DRQA 1N4PB 3ANKA 3D3IA 4V1RA 2D5JA 1F9OA 1RQ5A 2NVPA 3RRSA 3M78A 1TN8B 4M76A 1XWQA 2P0VA 4ZG8A 3M7BA 2FUZA 5GZKA 1O6RA 3WC3A 2JJBA 4CJ0A 4YDOB 1GXMA 1O79A 3WKFA 4ZH1A 3TF4A 1D8DB 1GAHA 3HXEB 3DSSB 3OEDA 1DCEB 2F0YB 2DROA 2GZ6A 3S4CA 1D8EB 4LNGB 4WVBA 2IEJB 5M7YA 2YIKA 3DSWB 1S64B 5FO9B 2R2LB 3ANJA 1O6HA 1N4QB 4XUVA 4AYOA 3T33A 1FP3A 3KQ4A 4QT9A 1GAIA 2XQWA 1KZPB 4GTOB 4ZRPA 3DSXB 3CU7A 5AGDA 3M72A 1VD5A 3OXUA 4AYQA 4L0GA 4L9PB 3QXFA 4GTMB 2EADA 1TN6B 1G9JA 3W7UA 1H35A 1N4RB 1H37A 2G0DA 2SQCA 1FT1B 4EL8A 1WZZA 4GTRB 1X9DA 2BB6A 4WVCA 1R76A 4GTQB 3Q73B 2RI9A 2XWJB 4C1SA 4CJ1A 3SDUA 1TNOB 1UT9A 3W7TA 3SDVA 4AYRA 2V3PA 2WY8A 3G6JB 2AHGA 1TNYB 1FT2B 3KLSA 4KKIA 4D4AA 1KZOB 1G87A 1L1YA 3M7CA 2VN4A 3SDRA 2H6FB 4GL3A 1W6JA 3P5RA 4BOJA 1TF4A 4MU9A 1XW2A 3M77A 3M76A 2OKXA 1KSCA 5JPMB 3DSTB 2NOJA 3M7LA 3QPFA 3E34B 2WY7A 1WU4A 4Q88A 3SDTA 3M75A 3SQCA 3W5MA 1IS9A 4KTPA 3RJ3A 3KSLB 3W7SA 4CE7A 3P5PA 1XWTA 4LNVA 1G9GA 2D8LA 1O1RB 3M7EA 1FAEA 1AGMA 5DGQA 1W6KA 2FV1A 1X81B 5JPNB 5E2JA 1H3AA 4TF4A 3SFXB 3E30B 5GW7A 1H36A 1JCSB 1GA2A 3WKIA 2Z07A 5CZLA 2B4FA 2WINB 1N95B 4GTPB 3AFJA 5FOBB 3WIRA 5KKBA 3H7LA 3PZ2B 2V3NA 3RX7A 4D4DA 4WVAA 1HCUA 2ZISB 4Z4JA 1GSZA 2JG0A 1HZFA 4JJJA 3QFZA 1TNZB 2VN7A 1LD8B 1JS4A 4KTRA 3QT3A 1O1TB 2H6GB 1LF9A 4YCRA 1O6QA 1SA4B 2DRRA 3Q79B 1H3BA 2WYNA 4Q2BA 1IA7A 2RGKA 2QNOA 3X17A 1FBOA 1N94B 3W7XA 3EQAA 3PZ3B 2FBAA 1TNBB 1FCEA 1TN7B 2EABA 3RX8A 3WIWA 1AYXA 1KREA 3E33B 1QBQB 1QSJA 3H2WA 1C3DA 5M7IA 1DL2A 2JF4A 2A8ZA 3QDEA 1GHQA 1H13A 1UMPA 3HXFB 1H39A 1L2AA 3DSVB 1GXNA 2A73B 3PZ1B 3ACSA 1SQCA 1LD7B 1WU5A 2B39A 3E37B 3GZKA 3K7XA 3H3KA 4EHMB 1KWFA 4DODA 3GT5A 2V8IA 3P2CA 1F9DA 2WIIB 2ZBLA 2H6IB 4ZH5A 2H6HB 3ANIA 1TNUB 3E32B 1H12A 3M71A 1MZCB 3EU8A 1UG9A 3PYAA 3ON6A 5MEHA 4L6XA 2RI8A 3Q7AB 3QG0A 2FV0A 4LNBB 3WUXA 1V7XA 1N4SB 4LIXA 2XWBB 1ULVA 4D94A 1WU6A 1FPPB 4KKJA 1SA5B 3CIHA 3QWTA 1G6IA 5GY3A 3S4DA 3D5SA 3PYBA 3S9VA 4MBGB 3D5RA 1NL4B 3Q75B 3VW5A 2CQTA 2PN5A 3E73A 1LTXB 1NXCA 3E6UA 3QRYA 1KKTA 3DRAB 1N9AB 3Q7FB 1GLMA 3KSQB 1FBWA 3WKHA 2GOXA 4DOEA 1KSDA 3HXCB 1H54A 4ONTA 5DGRA 4J5TA 5FO7B 1V7VA 5CD2A 2ZZRA 3S4BA 3VXDA 4AYPA 2EAEA 1NI1B 4Z4LA 4GTTB 3PZ4B 2BBCA 2GH4A 4D4BA 3EU5B 3HXDB 2AHFA 3M73A 1QQFA 3K11A 4BOKA 3RX5A 3Q78B 3SDQA 2G02A 5CA3A 2PMVA 1H14A 3RENA 4WU0A 1V7WA 3W5NA 1KFGA 2BB5A 1KS8A 3SFYB 3WIQA 2CQSA 4FXKB 3M74A 4FUSA 1FO2A 1DOGA 1V5CA 1FO3A 2EACA 2I07B 1CLCA 2AFAA 3S4AA 2V8JA 4GTVB 3WKGA 1LF6A 1JCRB 3QFYA 1O5MB 5FO8B 1V5DA 1K72A 3W7WA 4GTSB 3RSYA 1O1SB 3DPYB 1FMIA 1KRFA 1NC5A 3EUVB 1H3CA 4ZRQA 3A3VA 4FXGB 4V1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4D A;  4YDE B;  4GTR B;  2BB6 A;  2ZIS B;  2BED B;  3D5S A;  1R76 A;  2ZIR B;  4GTQ B;  1GSZ A;  3DSU B;  4MBG B;  1HZF A;  3D5R A;  1NL4 B;  3HXB B;  1TNZ B;  3Q73 B;  1S63 B;  2XWJ B;  3Q75 B;  1GXO A;  2PN5 A;  1LD8 B;  3C72 B;  4C1S A;  1JCQ B;  1LTX B;  4D4C A;  1TNO B;  1O1T B;  2H6G B;  2V8K A;  2V3P A;  3DRA B;  2WY8 A;  1N4P B;  1N9A B;  3Q7F B;  1O6Q A;  1SA4 B;  3KSQ B;  3G6J B;  4V1R A;  3Q79 B;  2GOX A;  1H3B A;  1TNY B;  1FT2 B;  3KLS A;  3HXC B;  4KKI A;  4ONT A;  4D4A A;  1KZO B;  5FO7 B;  2H6F B;  1TN8 B;  1W6J A;  4M76 A;  1NI1 B;  4BOJ A;  4GTT B;  1N94 B;  3PZ4 B;  4MU9 A;  2BBC A;  3PZ3 B;  1O6R A;  4D4B A;  1TNB B;  1TN7 B;  3EU5 B;  3HXD B;  4YDO B;  5JPM B;  3DST B;  2NOJ A;  3E33 B;  1QBQ B;  1QQF A;  1QSJ A;  1C3D A;  1GXM A;  1O79 A;  4BOK A;  3Q78 B;  4ZH1 A;  3E34 B;  1D8D B;  3HXE B;  2WY7 A;  3DSS B;  3SQC A;  3OED A;  1DCE B;  1GHQ A;  1UMP A;  2G02 A;  3HXF B;  2PMV A;  2F0Y B;  3RJ3 A;  1H39 A;  3KSL B;  3DSV B;  1GXN A;  2BB5 A;  2A73 B;  3PZ1 B;  3SFY B;  1D8E B;  4LNG B;  2IEJ B;  3DSW B;  4FXK B;  1SQC A;  4LNV A;  1S64 B;  1LD7 B;  5FO9 B;  2B39 A;  2R2L B;  3E37 B;  3K7X A;  4EHM B;  1O1R B;  1O6H A;  2V8I A;  1N4Q B;  2WII B;  2I07 B;  1W6K A;  2H6I B;  2V8J A;  4GTV B;  2H6H B;  3KQ4 A;  1JCR B;  1TNU B;  1X81 B;  5JPN B;  1O5M B;  5FO8 B;  1H3A A;  2XQW A;  3E32 B;  1KZP B;  4GTO B;  4ZRP A;  3DSX B;  3SFX B;  1MZC B;  3E30 B;  3CU7 A;  1H36 A;  1JCS B;  4GTS B;  5AGD A;  3Q7A B;  4LNB B;  2WIN B;  1N95 B;  1O1S B;  3OXU A;  3DPY B;  4GTP B;  1N4S B;  4L9P B;  4GTM B;  5FOB B;  2XWB B;  3EUV B;  1H3C A;  4D94 A;  1TN6 B;  1FPP B;  4KKJ A;  3PZ2 B;  4ZRQ A;  1H35 A;  1N4R B;  1SA5 B;  1H37 A;  4FXG B;  2G0D A;  2SQC A;  1FT1 B;  2V3N A;  4V1S A; 
#chains in the Genus database with same CATH topology
 3GLY A;  1RW9 A;  4YDE B;  2XFG A;  3PMM A;  2BED B;  3QXQ A;  1CEM A;  2ZIR B;  3QSP A;  3DSU B;  3SAE A;  2F6D A;  1RWC A;  3HXB B;  1S63 B;  1GXO A;  5EAT A;  3QT9 A;  3C72 B;  4TXT A;  3ACT A;  1JCQ B;  3EZ8 A;  3M00 A;  2DRS A;  4D4C A;  1N7P A;  1IA6 A;  2V8K A;  1OJM A;  2DRQ A;  1N4P B;  3ANK A;  3D3I A;  4V1R A;  2D5J A;  1F9O A;  1RQ5 A;  2NVP A;  3RRS A;  3M78 A;  1TN8 B;  4M76 A;  1XWQ A;  5IM1 A;  1RWG A;  2P0V A;  4ZG8 A;  3M7B A;  2FUZ A;  1HV6 A;  5GZK A;  5ILH A;  1O6R A;  3WC3 A;  1N7O A;  1OJO A;  2JJB A;  5IK6 A;  4CJ0 A;  4YDO B;  1W3Y A;  1GXM A;  1O79 A;  3WKF A;  1OJN A;  4ZH1 A;  3TF4 A;  1D8D B;  1GAH A;  3HXE B;  3DSS B;  2WCO A;  3M01 A;  3OED A;  1DCE B;  3G4D A;  2F0Y B;  2DRO A;  2GZ6 A;  2BRW A;  3S4C A;  1D8E B;  4LNG B;  4WVB A;  2IEJ B;  1LOH A;  2YIK A;  5M7Y A;  3DSW B;  1S64 B;  5FO9 B;  2R2L B;  2BRV X;  5C05 A;  2BRP A;  3ANJ A;  3NNB A;  1O6H A;  1N4Q B;  4XUV A;  4AYO A;  3T33 A;  5JMF A;  1FP3 A;  3KQ4 A;  4QT9 A;  2X03 A;  1GAI A;  5IL3 A;  2XQW A;  1KZP B;  4GTO B;  4ZRP A;  3DSX B;  3CU7 A;  5EAS A;  5AGD A;  3M72 A;  5IKH A;  1VD5 A;  3OXU A;  3LZ9 A;  4AYQ A;  4L0G A;  3E80 A;  4L9P B;  3QXF A;  4GTM B;  5IL8 A;  2EAD A;  1TN6 B;  1G9J A;  3W7U A;  5DHK A;  1H35 A;  1N4R B;  1H37 A;  2G0D A;  2SQC A;  1FT1 B;  4NEI A;  4EL8 A;  1WZZ A;  4GTR B;  1X9D A;  2BB6 A;  4WVC A;  1R76 A;  4GTQ B;  3Q73 B;  2RI9 A;  2XWJ B;  4C1S A;  4CJ1 A;  3SDU A;  1TNO B;  1UT9 A;  3W7T A;  3SDV A;  4AYR A;  2V3P A;  2WY8 A;  3G6J B;  2AHG A;  1TNY B;  1FT2 B;  3KLS A;  4KKI A;  4D4A A;  1KZO B;  1G87 A;  1L1Y A;  3M7C A;  2VN4 A;  3SDR A;  1LXK A;  4E1Y A;  2H6F B;  4GL3 A;  1W6J A;  3P5R A;  4BOJ A;  4MMH A;  1RWF A;  1TF4 A;  4MU9 A;  1XW2 A;  3M77 A;  3M76 A;  1X1H A;  2OKX A;  1KSC A;  5JPM B;  3DST B;  2NOJ A;  3M7L A;  1N7Q A;  3QPF A;  3E34 B;  5IKA A;  1CB8 A;  1WU4 A;  2WY7 A;  4Q88 A;  2WDA A;  3SDT A;  3M75 A;  3SQC A;  3W5M A;  1IS9 A;  4KTP A;  3RJ3 A;  4F13 A;  3KSL B;  3VSN A;  3W7S A;  4CE7 A;  3P5P A;  1XWT A;  4LNV A;  4OZV A;  1G9G A;  2D8L A;  1O1R B;  3M7E A;  1FAE A;  1AGM A;  5DGQ A;  1W6K A;  2FV1 A;  1X81 B;  5JPN B;  5E2J A;  1H3A A;  3G4F A;  4TF4 A;  3SFX B;  3E30 B;  5GW7 A;  1H36 A;  1N20 A;  1JCS B;  1GA2 A;  3WKI A;  2Z07 A;  5CZL A;  2B4F A;  2WIN B;  1N95 B;  4GTP B;  3AFJ A;  5FOB B;  3WIR A;  5KKB A;  3H7L A;  3PZ2 B;  4FJQ A;  2V3N A;  1HXG A;  3RX7 A;  1HMU A;  4D4D A;  4WVA A;  1HCU A;  2ZIS B;  1I8Q A;  4Z4J A;  1GSZ A;  2JG0 A;  1HZF A;  4JJJ A;  3QFZ A;  1TNZ B;  4OK4 A;  2VN7 A;  1LD8 B;  1JS4 A;  4KTR A;  3QT3 A;  1O1T B;  2H6G B;  1LF9 A;  4YCR A;  1O6Q A;  1SA4 B;  2FUT A;  2DRR A;  3Q79 B;  1H3B A;  2WYN A;  4Q2B A;  1IA7 A;  2RGK A;  2QNO A;  3X17 A;  1FBO A;  1N94 B;  3W7X A;  3EQA A;  3PZ3 B;  2FBA A;  1TNB B;  1FCE A;  1TN7 B;  2ONH A;  2EAB A;  1RWH A;  3RX8 A;  3WIW A;  1AYX A;  1KRE A;  3E33 B;  1QBQ B;  1QSJ A;  3H2W A;  5ILZ A;  1C3D A;  5M7I A;  1DL2 A;  1N1Z A;  2JF4 A;  2A8Z A;  3QDE A;  1GHQ A;  1H13 A;  1UMP A;  3HXF B;  2J5C A;  1H39 A;  2FUQ A;  1L2A A;  3DSV B;  1GXN A;  2A73 B;  3PZ1 B;  3ACS A;  5ILI A;  1HMW A;  1SQC A;  1N7R A;  1LD7 B;  1WU5 A;  2B39 A;  3E37 B;  3GZK A;  3K7X A;  3H3K A;  4EHM B;  1KWF A;  3E7J A;  4DOD A;  3GT5 A;  2V8I A;  3P2C A;  1F9D A;  2WII B;  2ZBL A;  3VSM A;  2H6I B;  4OZW A;  1N1B A;  1X1J A;  4ZH5 A;  2H6H B;  3ANI A;  1TNU B;  1X1I A;  3E32 B;  1F9G A;  1H12 A;  3M71 A;  1MZC B;  3EU8 A;  1UG9 A;  3PYA A;  3ON6 A;  5MEH A;  1N7N A;  4L6X A;  2RI8 A;  2E22 A;  3Q7A B;  3QG0 A;  2FV0 A;  4LNB B;  3WUX A;  1V7X A;  3N0G A;  1N4S B;  1N22 A;  4LIX A;  2XWB B;  1ULV A;  5IK9 A;  1C82 A;  4D94 A;  1WU6 A;  1FPP B;  4KKJ A;  1N23 A;  1HM2 A;  1SA5 B;  3CIH A;  3QWT A;  1HN0 A;  1G6I A;  1OJP A;  5ILY A;  5GY3 A;  3S4D A;  3D5S A;  3PYB A;  3S9V A;  4MBG B;  3A0O A;  3D5R A;  1NL4 B;  3Q75 B;  3VW5 A;  2CQT A;  2PN5 A;  3E73 A;  1LTX B;  1NXC A;  3E6U A;  3QRY A;  1KKT A;  3DRA B;  1N9A B;  3Q7F B;  1GLM A;  5IK0 A;  1F1S A;  3KSQ B;  1FBW A;  1RWA A;  2GOX A;  3WKH A;  4DOE A;  1KSD A;  3HXC B;  1H54 A;  4ONT A;  1HM3 A;  1HXA A;  5DGR A;  4J5T A;  5FO7 B;  1V7V A;  5CD2 A;  2ZZR A;  3S4B A;  3VXD A;  4AYP A;  2EAE A;  3AFL A;  1NI1 B;  4Z4L A;  4GTT B;  3PZ4 B;  1HXC A;  5EAU A;  2BBC A;  2GH4 A;  4D4B A;  3EU5 B;  3HXD B;  1N24 A;  2AHF A;  3M73 A;  1HX9 A;  1QQF A;  3K11 A;  4BOK A;  3RX5 A;  3Q78 B;  4RNQ A;  2E24 A;  3SDQ A;  4MMI A;  2G02 A;  5CA3 A;  2PMV A;  1H14 A;  3REN A;  4WU0 A;  1V7W A;  3W5N A;  1KFG A;  2BB5 A;  1KS8 A;  5DHI A;  4GAX A;  3SFY B;  3WIQ A;  4OK2 A;  1LXM A;  2CQS A;  4FXK B;  3M74 A;  4FNV A;  4FUS A;  2Q1F A;  1FO2 A;  1DOG A;  1V5C A;  5ILJ A;  1FO3 A;  2EAC A;  2I07 B;  1CLC A;  2AFA A;  3S4A A;  2V8J A;  4GTV B;  3WKG A;  1LF6 A;  5ILK A;  2ONG A;  1JCR B;  3QFY A;  1O5M B;  5FO8 B;  1V5D A;  3NFV A;  3N0F A;  4F10 A;  5JMD A;  4DI5 A;  1K72 A;  3W7W A;  1N21 A;  1J0M A;  4GTS B;  3RSY A;  1J0N A;  1O1S B;  5ILD A;  1QAZ A;  3DPY B;  1EGU A;  1FMI A;  1KRF A;  1NC5 A;  3EUV B;  1H3C A;  4OJZ A;  3M02 A;  4ZRQ A;  3A3V A;  4FXG B;  4V1S A; 
#chains in the Genus database with same CATH homology
 3GLY A;  4YDE B;  2XFG A;  3PMM A;  2BED B;  3QXQ A;  1CEM A;  2ZIR B;  3QSP A;  3DSU B;  3SAE A;  2F6D A;  3HXB B;  1S63 B;  1GXO A;  3QT9 A;  3C72 B;  4TXT A;  3ACT A;  1JCQ B;  3EZ8 A;  4D4C A;  2DRS A;  1IA6 A;  2V8K A;  2DRQ A;  1N4P B;  3ANK A;  3D3I A;  4V1R A;  2D5J A;  1F9O A;  1RQ5 A;  2NVP A;  3RRS A;  3M78 A;  1TN8 B;  4M76 A;  1XWQ A;  2P0V A;  4ZG8 A;  3M7B A;  2FUZ A;  5GZK A;  1O6R A;  3WC3 A;  2JJB A;  4CJ0 A;  4YDO B;  1GXM A;  1O79 A;  3WKF A;  4ZH1 A;  3TF4 A;  1D8D B;  1GAH A;  3HXE B;  3DSS B;  3OED A;  1DCE B;  2F0Y B;  2DRO A;  2GZ6 A;  3S4C A;  1D8E B;  4LNG B;  4WVB A;  2IEJ B;  5M7Y A;  2YIK A;  3DSW B;  1S64 B;  5FO9 B;  2R2L B;  3ANJ A;  1O6H A;  1N4Q B;  4XUV A;  4AYO A;  3T33 A;  1FP3 A;  3KQ4 A;  4QT9 A;  1GAI A;  2XQW A;  1KZP B;  4GTO B;  4ZRP A;  3DSX B;  3CU7 A;  5AGD A;  3M72 A;  1VD5 A;  3OXU A;  4AYQ A;  4L0G A;  4L9P B;  3QXF A;  4GTM B;  2EAD A;  1TN6 B;  1G9J A;  3W7U A;  1H35 A;  1N4R B;  1H37 A;  2G0D A;  2SQC A;  1FT1 B;  4EL8 A;  1WZZ A;  4GTR B;  1X9D A;  2BB6 A;  4WVC A;  1R76 A;  4GTQ B;  3Q73 B;  2RI9 A;  2XWJ B;  4C1S A;  4CJ1 A;  3SDU A;  1TNO B;  1UT9 A;  3W7T A;  3SDV A;  4AYR A;  2V3P A;  2WY8 A;  3G6J B;  2AHG A;  1TNY B;  1FT2 B;  3KLS A;  4KKI A;  4D4A A;  1KZO B;  1G87 A;  1L1Y A;  3M7C A;  2VN4 A;  3SDR A;  2H6F B;  4GL3 A;  1W6J A;  3P5R A;  4BOJ A;  1TF4 A;  4MU9 A;  1XW2 A;  3M77 A;  3M76 A;  2OKX A;  1KSC A;  5JPM B;  3DST B;  2NOJ A;  3M7L A;  3QPF A;  3E34 B;  2WY7 A;  1WU4 A;  4Q88 A;  3SDT A;  3M75 A;  3SQC A;  3W5M A;  1IS9 A;  4KTP A;  3RJ3 A;  3KSL B;  3W7S A;  4CE7 A;  3P5P A;  1XWT A;  4LNV A;  1G9G A;  2D8L A;  1O1R B;  3M7E A;  1FAE A;  1AGM A;  5DGQ A;  1W6K A;  2FV1 A;  1X81 B;  5JPN B;  5E2J A;  1H3A A;  4TF4 A;  3SFX B;  3E30 B;  5GW7 A;  1H36 A;  1JCS B;  1GA2 A;  3WKI A;  2Z07 A;  5CZL A;  2B4F A;  2WIN B;  1N95 B;  4GTP B;  3AFJ A;  5FOB B;  3WIR A;  5KKB A;  3H7L A;  3PZ2 B;  2V3N A;  3RX7 A;  4D4D A;  4WVA A;  1HCU A;  2ZIS B;  4Z4J A;  1GSZ A;  2JG0 A;  1HZF A;  4JJJ A;  3QFZ A;  1TNZ B;  2VN7 A;  1LD8 B;  1JS4 A;  4KTR A;  3QT3 A;  1O1T B;  2H6G B;  1LF9 A;  4YCR A;  1O6Q A;  1SA4 B;  2DRR A;  3Q79 B;  1H3B A;  2WYN A;  4Q2B A;  1IA7 A;  2RGK A;  2QNO A;  3X17 A;  1FBO A;  1N94 B;  3W7X A;  3EQA A;  3PZ3 B;  2FBA A;  1TNB B;  1FCE A;  1TN7 B;  2EAB A;  3RX8 A;  3WIW A;  1AYX A;  1KRE A;  3E33 B;  1QBQ B;  1QSJ A;  3H2W A;  1C3D A;  5M7I A;  1DL2 A;  2JF4 A;  2A8Z A;  3QDE A;  1GHQ A;  1H13 A;  1UMP A;  3HXF B;  1H39 A;  1L2A A;  3DSV B;  1GXN A;  2A73 B;  3PZ1 B;  3ACS A;  1SQC A;  1LD7 B;  1WU5 A;  2B39 A;  3E37 B;  3GZK A;  3K7X A;  3H3K A;  4EHM B;  1KWF A;  4DOD A;  3GT5 A;  2V8I A;  3P2C A;  1F9D A;  2WII B;  2ZBL A;  2H6I B;  4ZH5 A;  2H6H B;  3ANI A;  1TNU B;  3E32 B;  1H12 A;  3M71 A;  1MZC B;  3EU8 A;  1UG9 A;  3PYA A;  3ON6 A;  5MEH A;  4L6X A;  2RI8 A;  3Q7A B;  3QG0 A;  2FV0 A;  4LNB B;  3WUX A;  1V7X A;  1N4S B;  4LIX A;  2XWB B;  1ULV A;  4D94 A;  1WU6 A;  1FPP B;  4KKJ A;  1SA5 B;  3CIH A;  3QWT A;  1G6I A;  5GY3 A;  3S4D A;  3D5S A;  3PYB A;  3S9V A;  4MBG B;  3D5R A;  1NL4 B;  3Q75 B;  3VW5 A;  2CQT A;  2PN5 A;  3E73 A;  1LTX B;  1NXC A;  3E6U A;  3QRY A;  1KKT A;  3DRA B;  1N9A B;  3Q7F B;  1GLM A;  3KSQ B;  1FBW A;  3WKH A;  2GOX A;  4DOE A;  1KSD A;  3HXC B;  1H54 A;  4ONT A;  5DGR A;  4J5T A;  5FO7 B;  1V7V A;  5CD2 A;  2ZZR A;  3S4B A;  3VXD A;  4AYP A;  2EAE A;  1NI1 B;  4Z4L A;  4GTT B;  3PZ4 B;  2BBC A;  2GH4 A;  4D4B A;  3EU5 B;  3HXD B;  2AHF A;  3M73 A;  1QQF A;  3K11 A;  4BOK A;  3RX5 A;  3Q78 B;  3SDQ A;  2G02 A;  5CA3 A;  2PMV A;  1H14 A;  3REN A;  4WU0 A;  1V7W A;  3W5N A;  1KFG A;  2BB5 A;  1KS8 A;  3SFY B;  3WIQ A;  2CQS A;  4FXK B;  3M74 A;  4FUS A;  1FO2 A;  1DOG A;  1V5C A;  1FO3 A;  2EAC A;  2I07 B;  1CLC A;  2AFA A;  3S4A A;  2V8J A;  4GTV B;  3WKG A;  1LF6 A;  1JCR B;  3QFY A;  1O5M B;  5FO8 B;  1V5D A;  1K72 A;  3W7W A;  4GTS B;  3RSY A;  1O1S B;  3DPY B;  1FMI A;  1KRF A;  1NC5 A;  3EUV B;  1H3C A;  4ZRQ A;  3A3V A;  4FXG B;  4V1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...