3DSVB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys-ser-cys(gg) derivated from rab7
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dsvB00
1HZFA 2V8IA 3KSQB 1TN6B 1TN7B 1TN8B 1O79A 3EUVB 1H3AA 2G02A 4FXKB 4KKJA 1H37A 2H6HB 5JPMB 1LD8B 1N4RB 1W6KA 1N94B 3Q7FB 4V1RA 2NOJA 4M76A 3Q73B 1JCRB 3OEDA 3PZ2B 1S63B 3PZ4B 1GSZA 1DCEB 4D4AA 3Q75B 2XWBB 1NL4B 4ZRPA 2I07B 2XQWA 1N4QB 1TNBB 4C1SA 1H39A 1N95B 3KLSA 1H36A 1JCQB 2H6GB 5JPNB 2IEJB 3HXCB 4BOKA 3DSVB 4GTRB 1QQFA 4EHMB 3E33B 1H3CA 2A73B 4MU9A 4D94A 2B39A 1D8DB 1GXOA 3D5SA 4LNVA 1FT1B 2G0DA 1C3DA 2BB5A 3D5RA 1LD7B 3HXBB 2ZISB 1LTXB 2BEDB 4LNBB 3DPYB 2WIIB 4BOJA 1MZCB 4GTSB 3RJ3A 3PZ3B 1KZOB 2H6IB 1FPPB 4YDOB 3Q79B 1TNUB 3HXDB 3DSSB 1X81B 4GTOB 4KKIA 2H6FB 4L9PB 3KSLB 3G6JB 5FO7B 2WY7A 1KZPB 1TNOB 3SFXB 2GOXA 2PMVA 3C72B 3E30B 2V8JA 2XWJB 1S64B 1SQCA 2WINB 4ONTA 3Q7AB 1N4SB 1FT2B 3DSXB 3DRAB 4GTQB 4GTVB 2BBCA 4GTMB 4D4BA 3E32B 1JCSB 1O5MB 1TNYB 3OXUA 2PN5A 1UMPA 2F0YB 1D8EB 4FXGB 3SQCA 4ZRQA 1O1SB 4V1SA 3DSTB 1GHQA 1H3BA 4MBGB 1SA4B 3PZ1B 2SQCA 1NI1B 3E37B 4GTPB 3DSWB 1QBQB 1H35A 3EU5B 1GXNA 5FO9B 4GTTB 3HXEB 4D4CA 4LNGB 2ZIRB 2BB6A 1TNZB 5FOBB 1W6JA 1QSJA 1N4PB 3DSUB 1R76A 1O1RB 1SA5B 4ZH1A 2WY8A 2V3PA 3E34B 1O1TB 1O6QA 3K7XA 1N9AB 4YDEB 5FO8B 2V3NA 3Q78B 5AGDA 3HXFB 3SFYB 3KQ4A 2V8KA 1GXMA 2R2LB 1O6HA 4D4DA 3CU7A 1O6RA
chains in the Genus database with same CATH superfamily
3WC3A 3KSQB 4FUSA 5DGQA 1X1HA 5JPMB 1N4RB 1WU5A 3SDTA 3S4BA 3S9VA 1V7WA 1GLMA 3VSMA 3QSPA 1AYXA 3VXDA 3W7SA 4TF4A 1N4QB 1OJOA 1TNBB 1FAEA 4Z4JA 1JCQB 1XWTA 5JPNB 3HXCB 2DRRA 4GTRB 1FBOA 1QQFA 2X03A 4OK4A 2A73B 3G4DA 4GAXA 1GXOA 3S4CA 4QT9A 3EQAA 2BB5A 2ZISB 1N20A 3DPYB 2WIIB 4OZWA 4BOJA 4GTSB 3RJ3A 1V5CA 4FJQA 2H6IB 3GZKA 1IA7A 3QPFA 2JF4A 3ANIA 3SFXB 2WY7A 1TNOB 1N7QA 1HCUA 1KREA 3A0OA 3C72B 3E30B 2V8JA 5GZKA 4ONTA 3QG0A 1V7XA 2YIKA 2A8ZA 1FP3A 3M7BA 4GTMB 5DHKA 5C05A 1O5MB 3QXFA 1TNYB 3AFLA 4OZVA 2VN4A 1UMPA 4Q88A 2F0YB 3RENA 3QFZA 3DSTB 4MBGB 1KS8A 2FUQA 3M72A 1G87A 2WCOA 1F1SA 2GZ6A 3DSWB 1WU4A 2BRWA 1GXNA 5FO9B 4GTTB 4D4CA 1X1IA 4LNGB 2JJBA 2D8LA 1RWHA 3M76A 3QFYA 3M78A 1QSJA 4OK2A 1HN0A 3DSUB 2WY8A 3VW5A 2OKXA 5AGDA 3KQ4A 1O6HA 3CU7A 1O6RA 5IL3A 3P5RA 4MMIA 1LOHA 3EUVB 1RWCA 2QNOA 4FXKB 4KKJA 4F13A 1H37A 2H6HB 5IM1A 4L0GA 1HX9A 3X17A 3Q7FB 3M77A 4M76A 4ZG8A 1S63B 1GSZA 2JG0A 1AGMA 3ACSA 1DCEB 1N24A 1JS4A 1DOGA 1N7NA 1NL4B 4ZRPA 4ZH5A 3SAEA 3W7XA 4LIXA 1KSDA 2WDAA 1C82A 1H36A 2H6GB 5ILJA 1N7OA 2IEJB 4BOKA 4WVAA 3RSYA 4EHMB 1LXKA 4EL8A 3E33B 1FBWA 1WZZA 2NVPA 4OJZA 4D94A 5M7YA 1EGUA 2G0DA 1G6IA 1LXMA 3D5RA 3HXBB 5EAUA 5ILDA 5EATA 2E22A 4LNBB 1MZCB 3M7EA 1HV6A 1FPPB 1ULVA 2AHGA 1I8QA 3E7JA 5FO7B 2EABA 1KRFA 1S64B 3RX8A 2WINB 3TF4A 3DRAB 1HXCA 2FV0A 4WVCA 1H14A 2BBCA 3H2WA 1H54A 3OXUA 2PN5A 3WKGA 1XW2A 4JJJA 3QDEA 4V1SA 1NXCA 3S4DA 3NNBA 3QWTA 1H3BA 1SA4B 2BRVX 2SQCA 5IL8A 2ZZRA 1N21A 1N23A 1DL2A 3GT5A 5IK9A 2BB6A 3M7CA 5FOBB 1W6JA 5IKAA 2ONGA 3VSNA 1R76A 2FBAA 5ILYA 4F10A 5CD2A 3WKIA 3N0GA 2CQTA 3K7XA 1KFGA 1CLCA 1VD5A 5FO8B 2V3NA 3ON6A 4RNQA 3HXFB 3SFYB 2V8KA 3E80A 2R2LB 3E37B 3Q75B 4TXTA 2V8IA 1TN6B 5ILHA 1TN7B 3PMMA 3M71A 1O79A 3SDVA 1H3AA 2G02A 3T33A 1LD8B 1N94B 2J5CA 1UT9A 3N0FA 2NOJA 4XUVA 3Q73B 1JCRB 1IA6A 5DGRA 3PZ2B 3PZ4B 1RWFA 3PYAA 2FUTA 1H13A 2I07B 4C1SA 1TF4A 1H39A 2BRPA 4CE7A 1N95B 3SDRA 3EU8A 3DSVB 1KSCA 4MU9A 5E2JA 2B39A 3D5SA 3ACTA 3M00A 2Q1FA 1LTXB 3QT9A 1KWFA 2XFGA 1N22A 2DROA 3PZ3B 4YCRA 3HXDB 3DSSB 1RWAA 1NC5A 2H6FB 3KSLB 4AYRA 1RQ5A 1CB8A 1V5DA 5GW7A 1L2AA 5ILZA 4CJ0A 2XWJB 5IK6A 4FNVA 4NEIA 3WKFA 3DSXB 3LZ9A 2VN7A 3E32B 5EASA 1JCSB 1FCEA 3WUXA 2WYNA 4L6XA 4DOEA 4ZRQA 3QT3A 1LF6A 1GHQA 3A3VA 1NI1B 1GAIA 4GTPB 1QBQB 1H35A 5MEHA 3EU5B 3WKHA 1X9DA 5ILKA 4AYQA 3M75A 2ZIRB 1HXAA 1TNZB 1HMWA 4MMHA 2RGKA 1O1RB 1V7VA 5CA3A 5IKHA 4WVBA 1GAHA 4YDEB 3Q78B 1KKTA 2EACA 3M01A 1GXMA 1HZFA 1IS9A 2EAEA 1TN8B 2B4FA 2FV1A 4DI5A 4GL3A 3RX7A 2E24A 1QAZA 1HXGA 1W6KA 2ZBLA 1RW9A 4V1RA 2FUZA 3M73A 3OEDA 2EADA 1H12A 3G4FA 4DODA 3W7UA 4KTPA 3QXQA 4D4AA 2XWBB 3K11A 1F9OA 2Z07A 1W3YA 2XQWA 3WIQA 5KKBA 4WU0A 1FO3A 1F9DA 2RI8A 3KLSA 3E73A 1K72A 1WU6A 1H3CA 1J0NA 2RI9A 3EZ8A 1FO2A 1D8DB 1HM2A 4LNVA 3RRSA 5IK0A 1FT1B 3RX5A 1C3DA 3M7LA 1LD7B 2CQSA 3ANJA 2BEDB 1N7PA 1N1ZA 3H7LA 1KZOB 4YDOB 4Z4LA 3Q79B 1HMUA 1TNUB 3M02A 1X81B 4GTOB 4KKIA 4KTRA 3W7WA 3WIWA 1LF9A 3W7TA 4L9PB 4D4DA 3G6JB 3P5PA 1KZPB 2GOXA 2PMVA 1HM3A 2GH4A 1OJPA 1F9GA 5M7IA 3PYBA 1SQCA 1N1BA 2AHFA 3Q7AB 1GA2A 4Q2BA 1N4SB 1FT2B 4GTQB 3W5NA 4GTVB 2DRSA 1L1YA 2F6DA 5CZLA 4D4BA 5DHIA 3WIRA 3D3IA 1OJNA 5JMFA 1D8EB 5ILIA 4FXGB 3SQCA 1O1SB 5GY3A 3GLYA 4E1YA 4AYOA 3PZ1B 2ONHA 2DRQA 3W5MA 3E6UA 4J5TA 3H3KA 3ANKA 1G9GA 1G9JA 1X1JA 3HXEB 3SDQA 1FMIA 3CIHA 1UG9A 1XWQA 1N4PB 2AFAA 4ZH1A 2D5JA 2P0VA 1SA5B 1RWGA 1OJMA 1J0MA 5JMDA 1N7RA 2V3PA 3E34B 1O1TB 3NFVA 3M74A 1O6QA 1N9AB 4CJ1A 1CEMA 3P2CA 3AFJA 3QRYA 3SDUA 4AYPA 3S4AA
chains in the Genus database with same CATH topology
3WC3A 3KSQB 4FUSA 5DGQA 5JPMB 1N4RB 1WU5A 3SDTA 3S4BA 3S9VA 1V7WA 1GLMA 3QSPA 1AYXA 3VXDA 3W7SA 4TF4A 1N4QB 1TNBB 1FAEA 4Z4JA 1JCQB 1XWTA 5JPNB 3HXCB 2DRRA 4GTRB 1FBOA 1QQFA 2A73B 1GXOA 3S4CA 4QT9A 3EQAA 2BB5A 2ZISB 3DPYB 2WIIB 4BOJA 4GTSB 3RJ3A 1V5CA 2H6IB 3GZKA 1IA7A 3QPFA 2JF4A 3ANIA 3SFXB 2WY7A 1TNOB 1HCUA 1KREA 3C72B 3E30B 2V8JA 5GZKA 4ONTA 3QG0A 1V7XA 2YIKA 2A8ZA 1FP3A 3M7BA 4GTMB 1O5MB 3QXFA 1TNYB 2VN4A 1UMPA 4Q88A 2F0YB 3RENA 3QFZA 3DSTB 4MBGB 1KS8A 3M72A 1G87A 2GZ6A 3DSWB 1WU4A 1GXNA 5FO9B 4GTTB 4D4CA 4LNGB 2JJBA 2D8LA 3M76A 3QFYA 3M78A 1QSJA 3DSUB 2WY8A 3VW5A 2OKXA 5AGDA 3KQ4A 1O6HA 3CU7A 1O6RA 3P5RA 3EUVB 2QNOA 4FXKB 4KKJA 1H37A 2H6HB 4L0GA 3X17A 3Q7FB 3M77A 4M76A 4ZG8A 1S63B 1GSZA 2JG0A 1AGMA 3ACSA 1DCEB 1JS4A 1DOGA 4ZH5A 1NL4B 4ZRPA 3SAEA 3W7XA 4LIXA 1KSDA 1H36A 2H6GB 2IEJB 4BOKA 4WVAA 3RSYA 4EHMB 4EL8A 3E33B 1FBWA 1WZZA 2NVPA 4D94A 5M7YA 2G0DA 1G6IA 3D5RA 3HXBB 4LNBB 1MZCB 3M7EA 1FPPB 1ULVA 2AHGA 5FO7B 2EABA 1KRFA 1S64B 3RX8A 2WINB 3TF4A 3DRAB 2FV0A 4WVCA 1H14A 2BBCA 3H2WA 1H54A 3OXUA 2PN5A 3WKGA 1XW2A 4JJJA 3QDEA 4V1SA 1NXCA 3S4DA 3QWTA 1H3BA 1SA4B 2SQCA 2ZZRA 1DL2A 3GT5A 2BB6A 3M7CA 5FOBB 1W6JA 1R76A 2FBAA 5CD2A 3WKIA 2CQTA 3K7XA 1KFGA 1CLCA 1VD5A 5FO8B 2V3NA 3ON6A 3HXFB 3SFYB 2V8KA 2R2LB 3E37B 3Q75B 4TXTA 2V8IA 1TN6B 1TN7B 3PMMA 3M71A 1O79A 3SDVA 1H3AA 2G02A 3T33A 1LD8B 1N94B 1UT9A 2NOJA 4XUVA 3Q73B 1JCRB 1IA6A 5DGRA 3PZ2B 3PZ4B 3PYAA 1H13A 2I07B 4C1SA 1TF4A 1H39A 4CE7A 1N95B 3SDRA 3EU8A 3DSVB 1KSCA 4MU9A 5E2JA 2B39A 3D5SA 3ACTA 1LTXB 3QT9A 1KWFA 2XFGA 2DROA 3PZ3B 4YCRA 3HXDB 3DSSB 2H6FB 1NC5A 3KSLB 4AYRA 1RQ5A 5GW7A 1V5DA 1L2AA 4CJ0A 2XWJB 3WKFA 3DSXB 2VN7A 3E32B 1JCSB 1FCEA 3WUXA 2WYNA 4L6XA 4DOEA 4ZRQA 3QT3A 1LF6A 1GHQA 3A3VA 1NI1B 1GAIA 4GTPB 1QBQB 1H35A 5MEHA 3EU5B 3WKHA 1X9DA 4AYQA 3M75A 2ZIRB 1TNZB 2RGKA 1O1RB 1V7VA 5CA3A 4WVBA 1GAHA 4YDEB 3Q78B 1KKTA 2EACA 1GXMA 1HZFA 1IS9A 2EAEA 1TN8B 2B4FA 2FV1A 4GL3A 3RX7A 1W6KA 2ZBLA 4V1RA 2FUZA 3M73A 3OEDA 2EADA 1H12A 4DODA 3W7UA 4KTPA 3QXQA 4D4AA 2XWBB 3K11A 1F9OA 2Z07A 2XQWA 3WIQA 5KKBA 4WU0A 1FO3A 1F9DA 2RI8A 3KLSA 3E73A 1K72A 1WU6A 1H3CA 2RI9A 3EZ8A 1FO2A 1D8DB 4LNVA 3RRSA 1FT1B 3RX5A 1C3DA 3M7LA 1LD7B 2CQSA 3ANJA 2BEDB 3H7LA 1KZOB 4YDOB 4Z4LA 3Q79B 1TNUB 4GTOB 4KKIA 1X81B 4KTRA 3W7WA 3WIWA 1LF9A 3W7TA 4L9PB 4D4DA 3G6JB 3P5PA 1KZPB 2GOXA 2PMVA 2GH4A 5M7IA 3PYBA 1SQCA 2AHFA 3Q7AB 1GA2A 4Q2BA 1N4SB 1FT2B 4GTQB 3W5NA 4GTVB 2DRSA 1L1YA 2F6DA 5CZLA 4D4BA 3WIRA 3D3IA 1D8EB 4FXGB 3SQCA 1O1SB 5GY3A 3GLYA 4AYOA 3PZ1B 2DRQA 3W5MA 3E6UA 4J5TA 3H3KA 3ANKA 1G9GA 1G9JA 3HXEB 3SDQA 1FMIA 3CIHA 1UG9A 1XWQA 1N4PB 2AFAA 4ZH1A 2D5JA 2P0VA 1SA5B 2V3PA 3E34B 1O1TB 3M74A 1O6QA 1N9AB 4CJ1A 1CEMA 3P2CA 3AFJA 3QRYA 3SDUA 4AYPA 3S4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZF A;  2V8I A;  3KSQ B;  1TN6 B;  1TN7 B;  1TN8 B;  1O79 A;  3EUV B;  1H3A A;  2G02 A;  4FXK B;  4KKJ A;  1H37 A;  2H6H B;  5JPM B;  1LD8 B;  1N4R B;  1W6K A;  1N94 B;  3Q7F B;  4V1R A;  2NOJ A;  4M76 A;  3Q73 B;  1JCR B;  3OED A;  3PZ2 B;  1S63 B;  3PZ4 B;  1GSZ A;  1DCE B;  4D4A A;  3Q75 B;  2XWB B;  1NL4 B;  4ZRP A;  2I07 B;  2XQW A;  1N4Q B;  1TNB B;  4C1S A;  1H39 A;  1N95 B;  3KLS A;  1H36 A;  1JCQ B;  2H6G B;  5JPN B;  2IEJ B;  3HXC B;  4BOK A;  3DSV B;  4GTR B;  1QQF A;  4EHM B;  3E33 B;  1H3C A;  2A73 B;  4MU9 A;  4D94 A;  2B39 A;  1D8D B;  1GXO A;  3D5S A;  4LNV A;  1FT1 B;  2G0D A;  1C3D A;  2BB5 A;  3D5R A;  1LD7 B;  3HXB B;  2ZIS B;  1LTX B;  2BED B;  4LNB B;  3DPY B;  2WII B;  4BOJ A;  1MZC B;  4GTS B;  3RJ3 A;  3PZ3 B;  1KZO B;  2H6I B;  1FPP B;  4YDO B;  3Q79 B;  1TNU B;  3HXD B;  3DSS B;  1X81 B;  4GTO B;  4KKI A;  2H6F B;  4L9P B;  3KSL B;  3G6J B;  5FO7 B;  2WY7 A;  1KZP B;  1TNO B;  3SFX B;  2GOX A;  2PMV A;  3C72 B;  3E30 B;  2V8J A;  2XWJ B;  1S64 B;  1SQC A;  2WIN B;  4ONT A;  3Q7A B;  1N4S B;  1FT2 B;  3DSX B;  3DRA B;  4GTQ B;  4GTV B;  2BBC A;  4GTM B;  4D4B A;  3E32 B;  1JCS B;  1O5M B;  1TNY B;  3OXU A;  2PN5 A;  1UMP A;  2F0Y B;  1D8E B;  4FXG B;  3SQC A;  4ZRQ A;  1O1S B;  4V1S A;  3DST B;  1GHQ A;  1H3B A;  4MBG B;  1SA4 B;  3PZ1 B;  2SQC A;  1NI1 B;  3E37 B;  4GTP B;  3DSW B;  1QBQ B;  1H35 A;  3EU5 B;  1GXN A;  5FO9 B;  4GTT B;  3HXE B;  4D4C A;  4LNG B;  2ZIR B;  2BB6 A;  1TNZ B;  5FOB B;  1W6J A;  1QSJ A;  1N4P B;  3DSU B;  1R76 A;  1O1R B;  1SA5 B;  4ZH1 A;  2WY8 A;  2V3P A;  3E34 B;  1O1T B;  1O6Q A;  3K7X A;  1N9A B;  4YDE B;  5FO8 B;  2V3N A;  3Q78 B;  5AGD A;  3HXF B;  3SFY B;  3KQ4 A;  2V8K A;  1GXM A;  2R2L B;  1O6H A;  4D4D A;  3CU7 A;  1O6R A; 
#chains in the Genus database with same CATH topology
 3WC3 A;  3KSQ B;  4FUS A;  5DGQ A;  1X1H A;  5JPM B;  1N4R B;  1WU5 A;  3SDT A;  3S4B A;  3S9V A;  1V7W A;  1GLM A;  3VSM A;  3QSP A;  1AYX A;  3VXD A;  3W7S A;  4TF4 A;  1N4Q B;  1OJO A;  1TNB B;  1FAE A;  4Z4J A;  1JCQ B;  1XWT A;  5JPN B;  3HXC B;  2DRR A;  4GTR B;  1FBO A;  1QQF A;  2X03 A;  4OK4 A;  2A73 B;  3G4D A;  4GAX A;  1GXO A;  3S4C A;  4QT9 A;  3EQA A;  2BB5 A;  2ZIS B;  1N20 A;  3DPY B;  2WII B;  4OZW A;  4BOJ A;  4GTS B;  3RJ3 A;  1V5C A;  4FJQ A;  2H6I B;  3GZK A;  1IA7 A;  3QPF A;  2JF4 A;  3ANI A;  3SFX B;  2WY7 A;  1TNO B;  1N7Q A;  1HCU A;  1KRE A;  3A0O A;  3C72 B;  3E30 B;  2V8J A;  5GZK A;  4ONT A;  3QG0 A;  1V7X A;  2YIK A;  2A8Z A;  1FP3 A;  3M7B A;  4GTM B;  5DHK A;  5C05 A;  1O5M B;  3QXF A;  1TNY B;  3AFL A;  4OZV A;  2VN4 A;  1UMP A;  4Q88 A;  2F0Y B;  3REN A;  3QFZ A;  3DST B;  4MBG B;  1KS8 A;  2FUQ A;  3M72 A;  1G87 A;  2WCO A;  1F1S A;  2GZ6 A;  3DSW B;  1WU4 A;  2BRW A;  1GXN A;  5FO9 B;  4GTT B;  4D4C A;  1X1I A;  4LNG B;  2JJB A;  2D8L A;  1RWH A;  3M76 A;  3QFY A;  3M78 A;  1QSJ A;  4OK2 A;  1HN0 A;  3DSU B;  2WY8 A;  3VW5 A;  2OKX A;  5AGD A;  3KQ4 A;  1O6H A;  3CU7 A;  1O6R A;  5IL3 A;  3P5R A;  4MMI A;  1LOH A;  3EUV B;  1RWC A;  2QNO A;  4FXK B;  4KKJ A;  4F13 A;  1H37 A;  2H6H B;  5IM1 A;  4L0G A;  1HX9 A;  3X17 A;  3Q7F B;  3M77 A;  4M76 A;  4ZG8 A;  1S63 B;  1GSZ A;  2JG0 A;  1AGM A;  3ACS A;  1DCE B;  1N24 A;  1JS4 A;  1DOG A;  1N7N A;  1NL4 B;  4ZRP A;  4ZH5 A;  3SAE A;  3W7X A;  4LIX A;  1KSD A;  2WDA A;  1C82 A;  1H36 A;  2H6G B;  5ILJ A;  1N7O A;  2IEJ B;  4BOK A;  4WVA A;  3RSY A;  4EHM B;  1LXK A;  4EL8 A;  3E33 B;  1FBW A;  1WZZ A;  2NVP A;  4OJZ A;  4D94 A;  5M7Y A;  1EGU A;  2G0D A;  1G6I A;  1LXM A;  3D5R A;  3HXB B;  5EAU A;  5ILD A;  5EAT A;  2E22 A;  4LNB B;  1MZC B;  3M7E A;  1HV6 A;  1FPP B;  1ULV A;  2AHG A;  1I8Q A;  3E7J A;  5FO7 B;  2EAB A;  1KRF A;  1S64 B;  3RX8 A;  2WIN B;  3TF4 A;  3DRA B;  1HXC A;  2FV0 A;  4WVC A;  1H14 A;  2BBC A;  3H2W A;  1H54 A;  3OXU A;  2PN5 A;  3WKG A;  1XW2 A;  4JJJ A;  3QDE A;  4V1S A;  1NXC A;  3S4D A;  3NNB A;  3QWT A;  1H3B A;  1SA4 B;  2BRV X;  2SQC A;  5IL8 A;  2ZZR A;  1N21 A;  1N23 A;  1DL2 A;  3GT5 A;  5IK9 A;  2BB6 A;  3M7C A;  5FOB B;  1W6J A;  5IKA A;  2ONG A;  3VSN A;  1R76 A;  2FBA A;  5ILY A;  4F10 A;  5CD2 A;  3WKI A;  3N0G A;  2CQT A;  3K7X A;  1KFG A;  1CLC A;  1VD5 A;  5FO8 B;  2V3N A;  3ON6 A;  4RNQ A;  3HXF B;  3SFY B;  2V8K A;  3E80 A;  2R2L B;  3E37 B;  3Q75 B;  4TXT A;  2V8I A;  1TN6 B;  5ILH A;  1TN7 B;  3PMM A;  3M71 A;  1O79 A;  3SDV A;  1H3A A;  2G02 A;  3T33 A;  1LD8 B;  1N94 B;  2J5C A;  1UT9 A;  3N0F A;  2NOJ A;  4XUV A;  3Q73 B;  1JCR B;  1IA6 A;  5DGR A;  3PZ2 B;  3PZ4 B;  1RWF A;  3PYA A;  2FUT A;  1H13 A;  2I07 B;  4C1S A;  1TF4 A;  1H39 A;  2BRP A;  4CE7 A;  1N95 B;  3SDR A;  3EU8 A;  3DSV B;  1KSC A;  4MU9 A;  5E2J A;  2B39 A;  3D5S A;  3ACT A;  3M00 A;  2Q1F A;  1LTX B;  3QT9 A;  1KWF A;  2XFG A;  1N22 A;  2DRO A;  3PZ3 B;  4YCR A;  3HXD B;  3DSS B;  1RWA A;  1NC5 A;  2H6F B;  3KSL B;  4AYR A;  1RQ5 A;  1CB8 A;  1V5D A;  5GW7 A;  1L2A A;  5ILZ A;  4CJ0 A;  2XWJ B;  5IK6 A;  4FNV A;  4NEI A;  3WKF A;  3DSX B;  3LZ9 A;  2VN7 A;  3E32 B;  5EAS A;  1JCS B;  1FCE A;  3WUX A;  2WYN A;  4L6X A;  4DOE A;  4ZRQ A;  3QT3 A;  1LF6 A;  1GHQ A;  3A3V A;  1NI1 B;  1GAI A;  4GTP B;  1QBQ B;  1H35 A;  5MEH A;  3EU5 B;  3WKH A;  1X9D A;  5ILK A;  4AYQ A;  3M75 A;  2ZIR B;  1HXA A;  1TNZ B;  1HMW A;  4MMH A;  2RGK A;  1O1R B;  1V7V A;  5CA3 A;  5IKH A;  4WVB A;  1GAH A;  4YDE B;  3Q78 B;  1KKT A;  2EAC A;  3M01 A;  1GXM A;  1HZF A;  1IS9 A;  2EAE A;  1TN8 B;  2B4F A;  2FV1 A;  4DI5 A;  4GL3 A;  3RX7 A;  2E24 A;  1QAZ A;  1HXG A;  1W6K A;  2ZBL A;  1RW9 A;  4V1R A;  2FUZ A;  3M73 A;  3OED A;  2EAD A;  1H12 A;  3G4F A;  4DOD A;  3W7U A;  4KTP A;  3QXQ A;  4D4A A;  2XWB B;  3K11 A;  1F9O A;  2Z07 A;  1W3Y A;  2XQW A;  3WIQ A;  5KKB A;  4WU0 A;  1FO3 A;  1F9D A;  2RI8 A;  3KLS A;  3E73 A;  1K72 A;  1WU6 A;  1H3C A;  1J0N A;  2RI9 A;  3EZ8 A;  1FO2 A;  1D8D B;  1HM2 A;  4LNV A;  3RRS A;  5IK0 A;  1FT1 B;  3RX5 A;  1C3D A;  3M7L A;  1LD7 B;  2CQS A;  3ANJ A;  2BED B;  1N7P A;  1N1Z A;  3H7L A;  1KZO B;  4YDO B;  4Z4L A;  3Q79 B;  1HMU A;  1TNU B;  3M02 A;  1X81 B;  4GTO B;  4KKI A;  4KTR A;  3W7W A;  3WIW A;  1LF9 A;  3W7T A;  4L9P B;  4D4D A;  3G6J B;  3P5P A;  1KZP B;  2GOX A;  2PMV A;  1HM3 A;  2GH4 A;  1OJP A;  1F9G A;  5M7I A;  3PYB A;  1SQC A;  1N1B A;  2AHF A;  3Q7A B;  1GA2 A;  4Q2B A;  1N4S B;  1FT2 B;  4GTQ B;  3W5N A;  4GTV B;  2DRS A;  1L1Y A;  2F6D A;  5CZL A;  4D4B A;  5DHI A;  3WIR A;  3D3I A;  1OJN A;  5JMF A;  1D8E B;  5ILI A;  4FXG B;  3SQC A;  1O1S B;  5GY3 A;  3GLY A;  4E1Y A;  4AYO A;  3PZ1 B;  2ONH A;  2DRQ A;  3W5M A;  3E6U A;  4J5T A;  3H3K A;  3ANK A;  1G9G A;  1G9J A;  1X1J A;  3HXE B;  3SDQ A;  1FMI A;  3CIH A;  1UG9 A;  1XWQ A;  1N4P B;  2AFA A;  4ZH1 A;  2D5J A;  2P0V A;  1SA5 B;  1RWG A;  1OJM A;  1J0M A;  5JMD A;  1N7R A;  2V3P A;  3E34 B;  1O1T B;  3NFV A;  3M74 A;  1O6Q A;  1N9A B;  4CJ1 A;  1CEM A;  3P2C A;  3AFJ A;  3QRY A;  3SDU A;  4AYP A;  3S4A A; 
#chains in the Genus database with same CATH homology
 3WC3 A;  3KSQ B;  4FUS A;  5DGQ A;  5JPM B;  1N4R B;  1WU5 A;  3SDT A;  3S4B A;  3S9V A;  1V7W A;  1GLM A;  3QSP A;  1AYX A;  3VXD A;  3W7S A;  4TF4 A;  1N4Q B;  1TNB B;  1FAE A;  4Z4J A;  1JCQ B;  1XWT A;  5JPN B;  3HXC B;  2DRR A;  4GTR B;  1FBO A;  1QQF A;  2A73 B;  1GXO A;  3S4C A;  4QT9 A;  3EQA A;  2BB5 A;  2ZIS B;  3DPY B;  2WII B;  4BOJ A;  4GTS B;  3RJ3 A;  1V5C A;  2H6I B;  3GZK A;  1IA7 A;  3QPF A;  2JF4 A;  3ANI A;  3SFX B;  2WY7 A;  1TNO B;  1HCU A;  1KRE A;  3C72 B;  3E30 B;  2V8J A;  5GZK A;  4ONT A;  3QG0 A;  1V7X A;  2YIK A;  2A8Z A;  1FP3 A;  3M7B A;  4GTM B;  1O5M B;  3QXF A;  1TNY B;  2VN4 A;  1UMP A;  4Q88 A;  2F0Y B;  3REN A;  3QFZ A;  3DST B;  4MBG B;  1KS8 A;  3M72 A;  1G87 A;  2GZ6 A;  3DSW B;  1WU4 A;  1GXN A;  5FO9 B;  4GTT B;  4D4C A;  4LNG B;  2JJB A;  2D8L A;  3M76 A;  3QFY A;  3M78 A;  1QSJ A;  3DSU B;  2WY8 A;  3VW5 A;  2OKX A;  5AGD A;  3KQ4 A;  1O6H A;  3CU7 A;  1O6R A;  3P5R A;  3EUV B;  2QNO A;  4FXK B;  4KKJ A;  1H37 A;  2H6H B;  4L0G A;  3X17 A;  3Q7F B;  3M77 A;  4M76 A;  4ZG8 A;  1S63 B;  1GSZ A;  2JG0 A;  1AGM A;  3ACS A;  1DCE B;  1JS4 A;  1DOG A;  4ZH5 A;  1NL4 B;  4ZRP A;  3SAE A;  3W7X A;  4LIX A;  1KSD A;  1H36 A;  2H6G B;  2IEJ B;  4BOK A;  4WVA A;  3RSY A;  4EHM B;  4EL8 A;  3E33 B;  1FBW A;  1WZZ A;  2NVP A;  4D94 A;  5M7Y A;  2G0D A;  1G6I A;  3D5R A;  3HXB B;  4LNB B;  1MZC B;  3M7E A;  1FPP B;  1ULV A;  2AHG A;  5FO7 B;  2EAB A;  1KRF A;  1S64 B;  3RX8 A;  2WIN B;  3TF4 A;  3DRA B;  2FV0 A;  4WVC A;  1H14 A;  2BBC A;  3H2W A;  1H54 A;  3OXU A;  2PN5 A;  3WKG A;  1XW2 A;  4JJJ A;  3QDE A;  4V1S A;  1NXC A;  3S4D A;  3QWT A;  1H3B A;  1SA4 B;  2SQC A;  2ZZR A;  1DL2 A;  3GT5 A;  2BB6 A;  3M7C A;  5FOB B;  1W6J A;  1R76 A;  2FBA A;  5CD2 A;  3WKI A;  2CQT A;  3K7X A;  1KFG A;  1CLC A;  1VD5 A;  5FO8 B;  2V3N A;  3ON6 A;  3HXF B;  3SFY B;  2V8K A;  2R2L B;  3E37 B;  3Q75 B;  4TXT A;  2V8I A;  1TN6 B;  1TN7 B;  3PMM A;  3M71 A;  1O79 A;  3SDV A;  1H3A A;  2G02 A;  3T33 A;  1LD8 B;  1N94 B;  1UT9 A;  2NOJ A;  4XUV A;  3Q73 B;  1JCR B;  1IA6 A;  5DGR A;  3PZ2 B;  3PZ4 B;  3PYA A;  1H13 A;  2I07 B;  4C1S A;  1TF4 A;  1H39 A;  4CE7 A;  1N95 B;  3SDR A;  3EU8 A;  3DSV B;  1KSC A;  4MU9 A;  5E2J A;  2B39 A;  3D5S A;  3ACT A;  1LTX B;  3QT9 A;  1KWF A;  2XFG A;  2DRO A;  3PZ3 B;  4YCR A;  3HXD B;  3DSS B;  2H6F B;  1NC5 A;  3KSL B;  4AYR A;  1RQ5 A;  5GW7 A;  1V5D A;  1L2A A;  4CJ0 A;  2XWJ B;  3WKF A;  3DSX B;  2VN7 A;  3E32 B;  1JCS B;  1FCE A;  3WUX A;  2WYN A;  4L6X A;  4DOE A;  4ZRQ A;  3QT3 A;  1LF6 A;  1GHQ A;  3A3V A;  1NI1 B;  1GAI A;  4GTP B;  1QBQ B;  1H35 A;  5MEH A;  3EU5 B;  3WKH A;  1X9D A;  4AYQ A;  3M75 A;  2ZIR B;  1TNZ B;  2RGK A;  1O1R B;  1V7V A;  5CA3 A;  4WVB A;  1GAH A;  4YDE B;  3Q78 B;  1KKT A;  2EAC A;  1GXM A;  1HZF A;  1IS9 A;  2EAE A;  1TN8 B;  2B4F A;  2FV1 A;  4GL3 A;  3RX7 A;  1W6K A;  2ZBL A;  4V1R A;  2FUZ A;  3M73 A;  3OED A;  2EAD A;  1H12 A;  4DOD A;  3W7U A;  4KTP A;  3QXQ A;  4D4A A;  2XWB B;  3K11 A;  1F9O A;  2Z07 A;  2XQW A;  3WIQ A;  5KKB A;  4WU0 A;  1FO3 A;  1F9D A;  2RI8 A;  3KLS A;  3E73 A;  1K72 A;  1WU6 A;  1H3C A;  2RI9 A;  3EZ8 A;  1FO2 A;  1D8D B;  4LNV A;  3RRS A;  1FT1 B;  3RX5 A;  1C3D A;  3M7L A;  1LD7 B;  2CQS A;  3ANJ A;  2BED B;  3H7L A;  1KZO B;  4YDO B;  4Z4L A;  3Q79 B;  1TNU B;  4GTO B;  4KKI A;  1X81 B;  4KTR A;  3W7W A;  3WIW A;  1LF9 A;  3W7T A;  4L9P B;  4D4D A;  3G6J B;  3P5P A;  1KZP B;  2GOX A;  2PMV A;  2GH4 A;  5M7I A;  3PYB A;  1SQC A;  2AHF A;  3Q7A B;  1GA2 A;  4Q2B A;  1N4S B;  1FT2 B;  4GTQ B;  3W5N A;  4GTV B;  2DRS A;  1L1Y A;  2F6D A;  5CZL A;  4D4B A;  3WIR A;  3D3I A;  1D8E B;  4FXG B;  3SQC A;  1O1S B;  5GY3 A;  3GLY A;  4AYO A;  3PZ1 B;  2DRQ A;  3W5M A;  3E6U A;  4J5T A;  3H3K A;  3ANK A;  1G9G A;  1G9J A;  3HXE B;  3SDQ A;  1FMI A;  3CIH A;  1UG9 A;  1XWQ A;  1N4P B;  2AFA A;  4ZH1 A;  2D5J A;  2P0V A;  1SA5 B;  2V3P A;  3E34 B;  1O1T B;  3M74 A;  1O6Q A;  1N9A B;  4CJ1 A;  1CEM A;  3P2C A;  3AFJ A;  3QRY A;  3SDU A;  4AYP A;  3S4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...