3WKGA

Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
410
structure length
410
Chain Sequence
b'TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHVRSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 164
structure length 410
sequence length 410
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkgA00
1G87A 1DL2A 4TF4A 3WKIA 5GY3A 2FBAA 3QT3A 3QWTA 3QRYA 1AYXA 1H12A 3QFZA 1JS4A 4ZG8A 3QG0A 2JF4A 1XWQA 1V5CA 3ANJA 3QPFA 2JJBA 1GLMA 2VN7A 4L6XA 2AFAA 5KKBA 1IS9A 1H14A 1F9OA 3W7TA 5CZLA 1V7VA 2OKXA 5CA3A 1NXCA 5DGRA 4CE7A 4CJ1A 3QDEA 3E73A 4KTPA 1WU5A 1V7XA 3EQAA 3VXDA 3RX8A 1G9JA 3H7LA 3K11A 1G6IA 2DRSA 2A8ZA 2FV0A 1GAHA 3RX5A 3W5MA 2YIKA 1WZZA 3S4CA 3RSYA 1H54A 1CLCA 3WIQA 1V5DA 1KREA 1NC5A 3EZ8A 2VN4A 1AGMA 4DOEA 3QFYA 1RQ5A 3W7SA 1ULVA 1GAIA 3CIHA 5M7YA 1DOGA 1VD5A 2FV1A 3WIWA 1KRFA 3D3IA 2EADA 3W7XA 1TF4A 1IA6A 3P2CA 2DRQA 4TXTA 3W5NA 4J5TA 1WU6A 1FAEA 1FBWA 2JG0A 2RGKA 1WU4A 1K72A 3WIRA 2DRRA 5GW7A 3X17A 4DODA 3H2WA 2NVPA 5CD2A 2AHFA 1LF9A 1L1YA 3RX7A 1FCEA 4FUSA 4ZH5A 1KWFA 2WYNA 4EL8A 3RRSA 4AYPA 3GLYA 4WVAA 4Q2BA 3VW5A 2ZBLA 1FBOA 5M7IA 1KS8A 4Z4LA 1LF6A 1IA7A 1FP3A 2AHGA 4L0GA 3WKHA 4AYRA 2DROA 1XWTA 2F6DA 4AYQA 2FUZA 2EAEA 2D5JA 3ANKA 4Z4JA 3RENA 3TF4A 1HCUA 1FO3A 4CJ0A 2B4FA 3ACTA 1KSDA 3H3KA 1GA2A 5MEHA 1L2AA 1UT9A 2EABA 3ON6A 3W7WA 2CQTA 3WUXA 2RI9A 4WU0A 1FO2A 3ACSA 2D8LA 2EACA 1H13A 3AFJA 4KTRA 2GZ6A 2P0VA 5E2JA 1KSCA 1V7WA 4XUVA 3WKFA 3QXFA 2XFGA 2ZZRA 1G9GA 3A3VA 4WVBA 2RI8A 4JJJA 5DGQA 1FMIA 3S4BA 3QXQA 4AYOA 4Q88A 3W7UA 1XW2A 3QSPA 3T33A 1F9DA 1CEMA 1UG9A 2GH4A 3ANIA 2QNOA 2CQSA 1KFGA 1KKTA 1X9DA 4WVCA 3E6UA 3WC3A 3WKGA 3S4AA 3GZKA 3QT9A 2Z07A 3S4DA 3GT5A 3PMMA
chains in the Genus database with same CATH superfamily
2ONHA 1DL2A 1HV6A 3M77A 3P5PA 3E34B 1H39A 1H12A 3QFZA 5EAUA 4ZG8A 3QG0A 3KSLB 5ILJA 4LNGB 4DI5A 1GLMA 4L6XA 5IKAA 1H14A 1N7QA 1V7VA 2OKXA 4F13A 1TNBB 3VSMA 1QSJA 3E73A 4LIXA 1WU5A 4BOKA 1N4RB 3HXEB 5FO9B 2WINB 3AFLA 1G9JA 3K11A 4OZVA 2DRSA 2FV0A 1GAHA 1GXMA 3S4CA 1R76A 1N1ZA 3WIQA 5IL3A 2SQCA 5ILIA 1RWGA 1N23A 3W7SA 5JMDA 1DOGA 1KZOB 2FV1A 3WIWA 3W7XA 1IA6A 2BRVX 4MBGB 1C3DA 1LD8B 3E32B 2NOJA 1HM3A 3K7XA 2PN5A 4J5TA 5IKHA 4GTSB 1J0MA 2V8JA 3SDRA 2H6FB 5IK6A 5ILHA 1K72A 3NNBA 3M75A 2WY8A 2A73B 2WY7A 2WYNA 4OZWA 5ILZA 3GLYA 4NEIA 4Q2BA 4GTMB 5FOBB 2V3NA 2ONGA 1LOHA 1N4PB 1IA7A 2AHGA 4L0GA 4AYRA 3E33B 1X1JA 3S9VA 2FUZA 1HCUA 1HMWA 1KSDA 1RWFA 1GSZA 5MEHA 3VSNA 1UT9A 1N21A 3WUXA 1FO2A 2BBCA 1O6QA 3AFJA 4KTRA 1KSCA 1V7WA 4XUVA 5IM1A 1UMPA 5DGQA 3S4BA 1O1RB 3E80A 1XW2A 3T33A 1KKTA 1OJMA 1N7PA 3WC3A 3WKGA 1X81B 1JCSB 1KZPB 1G87A 1N94B 1EGUA 1O1SB 4FXKB 4YCRA 5GY3A 4D4DA 3Q78B 1AYXA 1X1HA 1XWQA 1V5CA 1GXNA 3ANJA 4ONTA 5ILKA 2AFAA 1IS9A 4ZH1A 5DGRA 2H6HB 4CE7A 4CJ1A 3QDEA 4YDEB 3EUVB 4KTPA 1C82A 5JMFA 4E1YA 4EHMB 1G6IA 2BEDB 3SAEA 2V3PA 3SQCA 2BB6A 1H54A 1CLCA 3PZ3B 2Q1FA 1NC5A 3EU5B 2VN4A 1F9GA 5EATA 3G4FA 3EU8A 2IEJB 3PZ1B 1TNZB 3CIHA 1VD5A 1HXCA 1S63B 1RW9A 2EADA 3P2CA 2XWBB 2DRQA 3DSTB 3DSSB 3M7EA 3Q79B 1FAEA 1N9AB 2JG0A 1S64B 2V8IA 1D8EB 3PZ4B 5GW7A 3Q7FB 3X17A 2NVPA 1L1YA 1O1TB 2G0DA 4OK2A 1SQCA 1HN0A 3DSVB 4M76A 1HM2A 4GTQB 1RWCA 2ZIRB 4ZH5A 1W6KA 4MMIA 1TNOB 4WVAA 3VW5A 3KLSA 5M7IA 1KS8A 4Z4LA 4ZRPA 1HMUA 2DROA 1XWTA 2F6DA 3NFVA 3SDVA 1FPPB 4ZRQA 3ANKA 1W6JA 1N20A 3C72B 1TN7B 2CQTA 2RI9A 3ACSA 1H13A 5E2JA 2B39A 1OJPA 3Q75B 1SA4B 2WDAA 1H3CA 3Q7AB 3QXFA 1OJOA 4FXGB 1JCQB 1N4SB 3SFXB 1FMIA 1N22A 3SDTA 1UG9A 1FT2B 4WVCA 2G02A 3E6UA 3M01A 2Z07A 4GTTB 3SDUA 1DCEB 3WKIA 2BB5A 2BRWA 3QRYA 5JPMB 1JS4A 3DPYB 2X03A 1OJNA 2R2LB 4MU9A 3SDQA 4L9PB 1H3AA 5KKBA 1F9OA 5CA3A 1NXCA 4GTVB 4V1SA 2XQWA 1TN8B 3SFYB 2BRPA 5IK0A 1V7XA 1RWAA 1NI1B 4D94A 3RX8A 3H7LA 3DSUB 3D5RA 3Q73B 1J0NA 4OJZA 1H3BA 1WZZA 3HXBB 3EZ8A 1AGMA 3PYAA 4DOEA 1RQ5A 1ULVA 3M78A 4MMHA 1GAIA 1KRFA 4BOJA 3N0GA 1SA5B 3CU7A 5DHKA 4KKIA 3PZ2B 1FBWA 2FUTA 1RWHA 2ZISB 2RGKA 3WIRA 2DRRA 1LF9A 2AHFA 3RX7A 1FCEA 3M7BA 4FUSA 5JPNB 1KWFA 5DHIA 4EL8A 3RRSA 1MZCB 4KKJA 3M72A 1H35A 2ZBLA 3A0OA 1LXMA 1N95B 2E24A 4AYQA 4FJQA 2EAEA 2D5JA 1O6HA 4CJ0A 2B4FA 3GT5A 1GA2A 3N0FA 1L2AA 2EABA 3OEDA 3ON6A 3W7WA 5ILYA 4WU0A 2E22A 2EACA 2I07B 3RJ3A 2GZ6A 2P0VA 1JCRB 3E37B 1H36A 1O6RA 3OXUA 1TN6B 2FUQA 3WKFA 1HZFA 1CB8A 3P5RA 2H6IB 4V1RA 2ZZRA 1G9GA 2RI8A 3QXQA 1N7RA 1NL4B 5C05A 4Q88A 1F9DA 3D5SA 1CEMA 2GH4A 3ANIA 3M76A 1KFGA 1X9DA 1LXKA 5ILDA 3M7LA 1TNUB 5AGDA 3E30B 2WIIB 3S4DA 3PMMA 5IK9A 4GTOB 4TF4A 3M73A 2FBAA 3QT3A 3QWTA 3DSXB 1X1IA 3M02A 1F1SA 2JF4A 3QPFA 3M71A 2JJBA 2VN7A 3W7TA 5CZLA 1GHQA 4F10A 3DRAB 1H37A 3EQAA 3VXDA 4GL3A 4GAXA 2A8ZA 1N24A 1QQFA 3RX5A 2YIKA 4OK4A 5FO8B 3W5MA 5IL8A 3RSYA 1HX9A 1V5DA 1KREA 3QFYA 4YDOB 5M7YA 3D3IA 1O5MB 4GTRB 1TF4A 4TXTA 4LNVA 4D4BA 3W5NA 3LZ9A 1WU6A 4C1SA 1FT1B 3PYBA 2XWJB 3KSQB 1D8DB 1GXOA 1HXAA 1WU4A 4DODA 1LD7B 2PMVA 3H2WA 5CD2A 3E7JA 5GZKA 2GOXA 1LTXB 3G6JB 1N1BA 1TNYB 4RNQA 4AYPA 2V8KA 1N7NA 1I8QA 2WCOA 1FBOA 3M00A 3M7CA 1LF6A 1FP3A 3WKHA 4QT9A 4GTPB 4LNBB 4Z4JA 3RENA 3TF4A 1FO3A 3ACTA 3H3KA 5EASA 1W3YA 1O79A 2H6GB 1N7OA 1QBQB 3HXFB 2D8LA 3DSWB 1HXGA 3KQ4A 3G4DA 2XFGA 4WVBA 3A3VA 4JJJA 4AYOA 1N4QB 3HXCB 3W7UA 3QSPA 5FO7B 2QNOA 2CQSA 3M74A 4FNVA 3HXDB 3S4AA 1QAZA 2F0YB 3GZKA 3QT9A 4D4CA 4D4AA 2J5CA
chains in the Genus database with same CATH topology
1DL2A 3M77A 3P5PA 3E34B 1H39A 1H12A 3QFZA 4ZG8A 3QG0A 3KSLB 4LNGB 1GLMA 4L6XA 1H14A 1V7VA 2OKXA 1TNBB 1QSJA 3E73A 4LIXA 1WU5A 4BOKA 1N4RB 3HXEB 5FO9B 2WINB 1G9JA 3K11A 2DRSA 2FV0A 1GAHA 1GXMA 3S4CA 1R76A 3WIQA 2SQCA 3W7SA 1DOGA 1KZOB 2FV1A 3WIWA 3W7XA 1IA6A 4MBGB 1C3DA 1LD8B 3E32B 2NOJA 3K7XA 2PN5A 4J5TA 4GTSB 2V8JA 3SDRA 2H6FB 1K72A 3M75A 2WY8A 2A73B 2WY7A 2WYNA 3GLYA 4Q2BA 4GTMB 5FOBB 2V3NA 1N4PB 1IA7A 2AHGA 4L0GA 4AYRA 3E33B 3S9VA 2FUZA 1HCUA 1KSDA 1GSZA 5MEHA 1UT9A 3WUXA 1FO2A 2BBCA 1O6QA 3AFJA 4KTRA 1KSCA 1V7WA 4XUVA 1UMPA 5DGQA 3S4BA 1O1RB 1XW2A 3T33A 1KKTA 3WC3A 3WKGA 1X81B 1JCSB 1KZPB 1G87A 1N94B 4FXKB 1O1SB 4YCRA 5GY3A 4D4DA 3Q78B 1AYXA 1XWQA 1V5CA 1GXNA 3ANJA 4ONTA 2AFAA 1IS9A 4ZH1A 5DGRA 2H6HB 4CE7A 4CJ1A 3QDEA 4YDEB 3EUVB 4KTPA 4EHMB 1G6IA 2BEDB 3SAEA 2V3PA 3SQCA 2BB6A 1H54A 1CLCA 3PZ3B 3EU5B 1NC5A 2VN4A 3EU8A 2IEJB 3PZ1B 1TNZB 3CIHA 1VD5A 1S63B 2EADA 3P2CA 2XWBB 2DRQA 3DSTB 3DSSB 3M7EA 3Q79B 1FAEA 1N9AB 2JG0A 1S64B 2V8IA 1D8EB 3PZ4B 5GW7A 3Q7FB 3X17A 2NVPA 1L1YA 1O1TB 2G0DA 1SQCA 3DSVB 4M76A 4GTQB 2ZIRB 4ZH5A 1W6KA 1TNOB 4WVAA 3VW5A 3KLSA 5M7IA 1KS8A 4Z4LA 4ZRPA 2DROA 1XWTA 2F6DA 3SDVA 1FPPB 4ZRQA 3ANKA 1W6JA 3C72B 1TN7B 2CQTA 2RI9A 3ACSA 1H13A 5E2JA 2B39A 3Q75B 1SA4B 1H3CA 3Q7AB 3QXFA 4FXGB 1JCQB 1N4SB 3SFXB 1FMIA 3SDTA 1UG9A 1FT2B 4WVCA 2G02A 3E6UA 2Z07A 4GTTB 3SDUA 1DCEB 3WKIA 2BB5A 3QRYA 5JPMB 1JS4A 3DPYB 4MU9A 2R2LB 3SDQA 4L9PB 1H3AA 5KKBA 1F9OA 5CA3A 1NXCA 4GTVB 4V1SA 2XQWA 1TN8B 3SFYB 1V7XA 1NI1B 4D94A 3RX8A 3H7LA 3DSUB 3D5RA 3Q73B 1H3BA 1WZZA 3HXBB 3EZ8A 1AGMA 3PYAA 4DOEA 1RQ5A 1ULVA 3M78A 1GAIA 1KRFA 4BOJA 1SA5B 3CU7A 4KKIA 3PZ2B 1FBWA 2ZISB 2RGKA 3WIRA 2DRRA 1LF9A 2AHFA 3RX7A 1FCEA 3M7BA 4FUSA 5JPNB 1KWFA 4EL8A 3RRSA 1MZCB 4KKJA 3M72A 1H35A 2ZBLA 1N95B 4AYQA 2EAEA 2D5JA 1O6HA 4CJ0A 2B4FA 1GA2A 1L2AA 2EABA 3OEDA 3ON6A 3W7WA 4WU0A 2EACA 2I07B 3RJ3A 2GZ6A 2P0VA 1JCRB 3E37B 1H36A 1O6RA 3OXUA 1TN6B 3WKFA 1HZFA 3P5RA 2H6IB 4V1RA 2ZZRA 1G9GA 2RI8A 3QXQA 4Q88A 1NL4B 1F9DA 3D5SA 1CEMA 2GH4A 3ANIA 3M76A 1KFGA 1X9DA 3M7LA 1TNUB 5AGDA 3E30B 2WIIB 3S4DA 3PMMA 4GTOB 4TF4A 3M73A 2FBAA 3QT3A 3QWTA 3DSXB 2JF4A 3QPFA 3M71A 2JJBA 2VN7A 3W7TA 5CZLA 1GHQA 3DRAB 1H37A 3EQAA 3VXDA 4GL3A 2A8ZA 1QQFA 3RX5A 2YIKA 5FO8B 3W5MA 3RSYA 1V5DA 1KREA 3QFYA 4YDOB 5M7YA 3D3IA 1O5MB 4GTRB 1TF4A 4TXTA 4LNVA 4D4BA 3W5NA 1WU6A 4C1SA 1FT1B 3PYBA 2XWJB 3KSQB 1D8DB 1GXOA 1WU4A 4DODA 1LD7B 2PMVA 3H2WA 5CD2A 5GZKA 2GOXA 1LTXB 3G6JB 1TNYB 4AYPA 2V8KA 1FBOA 3M7CA 1LF6A 1FP3A 3WKHA 4QT9A 4GTPB 4LNBB 4Z4JA 3RENA 3TF4A 1FO3A 3ACTA 3H3KA 1O79A 2H6GB 1QBQB 3HXFB 2D8LA 3DSWB 3KQ4A 2XFGA 4WVBA 3A3VA 4JJJA 4AYOA 1N4QB 3HXCB 3W7UA 3QSPA 5FO7B 2QNOA 2CQSA 3M74A 3HXDB 3S4AA 2F0YB 3GZKA 3QT9A 4D4CA 4D4AA 3GT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G87 A;  1DL2 A;  4TF4 A;  3WKI A;  5GY3 A;  2FBA A;  3QT3 A;  3QWT A;  3QRY A;  1AYX A;  1H12 A;  3QFZ A;  1JS4 A;  4ZG8 A;  3QG0 A;  2JF4 A;  1XWQ A;  1V5C A;  3ANJ A;  3QPF A;  2JJB A;  1GLM A;  2VN7 A;  4L6X A;  2AFA A;  5KKB A;  1IS9 A;  1H14 A;  1F9O A;  3W7T A;  5CZL A;  1V7V A;  2OKX A;  5CA3 A;  1NXC A;  5DGR A;  4CE7 A;  4CJ1 A;  3QDE A;  3E73 A;  4KTP A;  1WU5 A;  1V7X A;  3EQA A;  3VXD A;  3RX8 A;  1G9J A;  3H7L A;  3K11 A;  1G6I A;  2DRS A;  2A8Z A;  2FV0 A;  1GAH A;  3RX5 A;  3W5M A;  2YIK A;  1WZZ A;  3S4C A;  3RSY A;  1H54 A;  1CLC A;  3WIQ A;  1V5D A;  1KRE A;  1NC5 A;  3EZ8 A;  2VN4 A;  1AGM A;  4DOE A;  3QFY A;  1RQ5 A;  3W7S A;  1ULV A;  1GAI A;  3CIH A;  5M7Y A;  1DOG A;  1VD5 A;  2FV1 A;  3WIW A;  1KRF A;  3D3I A;  2EAD A;  3W7X A;  1TF4 A;  1IA6 A;  3P2C A;  2DRQ A;  4TXT A;  3W5N A;  4J5T A;  1WU6 A;  1FAE A;  1FBW A;  2JG0 A;  2RGK A;  1WU4 A;  1K72 A;  3WIR A;  2DRR A;  5GW7 A;  3X17 A;  4DOD A;  3H2W A;  2NVP A;  5CD2 A;  2AHF A;  1LF9 A;  1L1Y A;  3RX7 A;  1FCE A;  4FUS A;  4ZH5 A;  1KWF A;  2WYN A;  4EL8 A;  3RRS A;  4AYP A;  3GLY A;  4WVA A;  4Q2B A;  3VW5 A;  2ZBL A;  1FBO A;  5M7I A;  1KS8 A;  4Z4L A;  1LF6 A;  1IA7 A;  1FP3 A;  2AHG A;  4L0G A;  3WKH A;  4AYR A;  2DRO A;  1XWT A;  2F6D A;  4AYQ A;  2FUZ A;  2EAE A;  2D5J A;  3ANK A;  4Z4J A;  3REN A;  3TF4 A;  1HCU A;  1FO3 A;  4CJ0 A;  2B4F A;  3ACT A;  1KSD A;  3H3K A;  1GA2 A;  5MEH A;  1L2A A;  1UT9 A;  2EAB A;  3ON6 A;  3W7W A;  2CQT A;  3WUX A;  2RI9 A;  4WU0 A;  1FO2 A;  3ACS A;  2D8L A;  2EAC A;  1H13 A;  3AFJ A;  4KTR A;  2GZ6 A;  2P0V A;  5E2J A;  1KSC A;  1V7W A;  4XUV A;  3WKF A;  3QXF A;  2XFG A;  2ZZR A;  1G9G A;  3A3V A;  4WVB A;  2RI8 A;  4JJJ A;  5DGQ A;  1FMI A;  3S4B A;  3QXQ A;  4AYO A;  4Q88 A;  3W7U A;  1XW2 A;  3QSP A;  3T33 A;  1F9D A;  1CEM A;  1UG9 A;  2GH4 A;  3ANI A;  2QNO A;  2CQS A;  1KFG A;  1KKT A;  1X9D A;  4WVC A;  3E6U A;  3WC3 A;  3WKG A;  3S4A A;  3GZK A;  3QT9 A;  2Z07 A;  3S4D A;  3GT5 A;  3PMM A; 
#chains in the Genus database with same CATH topology
 2ONH A;  1DL2 A;  1HV6 A;  3M77 A;  3P5P A;  3E34 B;  1H39 A;  1H12 A;  3QFZ A;  5EAU A;  4ZG8 A;  3QG0 A;  3KSL B;  5ILJ A;  4LNG B;  4DI5 A;  1GLM A;  4L6X A;  5IKA A;  1H14 A;  1N7Q A;  1V7V A;  2OKX A;  4F13 A;  1TNB B;  3VSM A;  1QSJ A;  3E73 A;  4LIX A;  1WU5 A;  4BOK A;  1N4R B;  3HXE B;  5FO9 B;  2WIN B;  3AFL A;  1G9J A;  3K11 A;  4OZV A;  2DRS A;  2FV0 A;  1GAH A;  1GXM A;  3S4C A;  1R76 A;  1N1Z A;  3WIQ A;  5IL3 A;  2SQC A;  5ILI A;  1RWG A;  1N23 A;  3W7S A;  5JMD A;  1DOG A;  1KZO B;  2FV1 A;  3WIW A;  3W7X A;  1IA6 A;  2BRV X;  4MBG B;  1C3D A;  1LD8 B;  3E32 B;  2NOJ A;  1HM3 A;  3K7X A;  2PN5 A;  4J5T A;  5IKH A;  4GTS B;  1J0M A;  2V8J A;  3SDR A;  2H6F B;  5IK6 A;  5ILH A;  1K72 A;  3NNB A;  3M75 A;  2WY8 A;  2A73 B;  2WY7 A;  2WYN A;  4OZW A;  5ILZ A;  3GLY A;  4NEI A;  4Q2B A;  4GTM B;  5FOB B;  2V3N A;  2ONG A;  1LOH A;  1N4P B;  1IA7 A;  2AHG A;  4L0G A;  4AYR A;  3E33 B;  1X1J A;  3S9V A;  2FUZ A;  1HCU A;  1HMW A;  1KSD A;  1RWF A;  1GSZ A;  5MEH A;  3VSN A;  1UT9 A;  1N21 A;  3WUX A;  1FO2 A;  2BBC A;  1O6Q A;  3AFJ A;  4KTR A;  1KSC A;  1V7W A;  4XUV A;  5IM1 A;  1UMP A;  5DGQ A;  3S4B A;  1O1R B;  3E80 A;  1XW2 A;  3T33 A;  1KKT A;  1OJM A;  1N7P A;  3WC3 A;  3WKG A;  1X81 B;  1JCS B;  1KZP B;  1G87 A;  1N94 B;  1EGU A;  1O1S B;  4FXK B;  4YCR A;  5GY3 A;  4D4D A;  3Q78 B;  1AYX A;  1X1H A;  1XWQ A;  1V5C A;  1GXN A;  3ANJ A;  4ONT A;  5ILK A;  2AFA A;  1IS9 A;  4ZH1 A;  5DGR A;  2H6H B;  4CE7 A;  4CJ1 A;  3QDE A;  4YDE B;  3EUV B;  4KTP A;  1C82 A;  5JMF A;  4E1Y A;  4EHM B;  1G6I A;  2BED B;  3SAE A;  2V3P A;  3SQC A;  2BB6 A;  1H54 A;  1CLC A;  3PZ3 B;  2Q1F A;  1NC5 A;  3EU5 B;  2VN4 A;  1F9G A;  5EAT A;  3G4F A;  3EU8 A;  2IEJ B;  3PZ1 B;  1TNZ B;  3CIH A;  1VD5 A;  1HXC A;  1S63 B;  1RW9 A;  2EAD A;  3P2C A;  2XWB B;  2DRQ A;  3DST B;  3DSS B;  3M7E A;  3Q79 B;  1FAE A;  1N9A B;  2JG0 A;  1S64 B;  2V8I A;  1D8E B;  3PZ4 B;  5GW7 A;  3Q7F B;  3X17 A;  2NVP A;  1L1Y A;  1O1T B;  2G0D A;  4OK2 A;  1SQC A;  1HN0 A;  3DSV B;  4M76 A;  1HM2 A;  4GTQ B;  1RWC A;  2ZIR B;  4ZH5 A;  1W6K A;  4MMI A;  1TNO B;  4WVA A;  3VW5 A;  3KLS A;  5M7I A;  1KS8 A;  4Z4L A;  4ZRP A;  1HMU A;  2DRO A;  1XWT A;  2F6D A;  3NFV A;  3SDV A;  1FPP B;  4ZRQ A;  3ANK A;  1W6J A;  1N20 A;  3C72 B;  1TN7 B;  2CQT A;  2RI9 A;  3ACS A;  1H13 A;  5E2J A;  2B39 A;  1OJP A;  3Q75 B;  1SA4 B;  2WDA A;  1H3C A;  3Q7A B;  3QXF A;  1OJO A;  4FXG B;  1JCQ B;  1N4S B;  3SFX B;  1FMI A;  1N22 A;  3SDT A;  1UG9 A;  1FT2 B;  4WVC A;  2G02 A;  3E6U A;  3M01 A;  2Z07 A;  4GTT B;  3SDU A;  1DCE B;  3WKI A;  2BB5 A;  2BRW A;  3QRY A;  5JPM B;  1JS4 A;  3DPY B;  2X03 A;  1OJN A;  2R2L B;  4MU9 A;  3SDQ A;  4L9P B;  1H3A A;  5KKB A;  1F9O A;  5CA3 A;  1NXC A;  4GTV B;  4V1S A;  2XQW A;  1TN8 B;  3SFY B;  2BRP A;  5IK0 A;  1V7X A;  1RWA A;  1NI1 B;  4D94 A;  3RX8 A;  3H7L A;  3DSU B;  3D5R A;  3Q73 B;  1J0N A;  4OJZ A;  1H3B A;  1WZZ A;  3HXB B;  3EZ8 A;  1AGM A;  3PYA A;  4DOE A;  1RQ5 A;  1ULV A;  3M78 A;  4MMH A;  1GAI A;  1KRF A;  4BOJ A;  3N0G A;  1SA5 B;  3CU7 A;  5DHK A;  4KKI A;  3PZ2 B;  1FBW A;  2FUT A;  1RWH A;  2ZIS B;  2RGK A;  3WIR A;  2DRR A;  1LF9 A;  2AHF A;  3RX7 A;  1FCE A;  3M7B A;  4FUS A;  5JPN B;  1KWF A;  5DHI A;  4EL8 A;  3RRS A;  1MZC B;  4KKJ A;  3M72 A;  1H35 A;  2ZBL A;  3A0O A;  1LXM A;  1N95 B;  2E24 A;  4AYQ A;  4FJQ A;  2EAE A;  2D5J A;  1O6H A;  4CJ0 A;  2B4F A;  3GT5 A;  1GA2 A;  3N0F A;  1L2A A;  2EAB A;  3OED A;  3ON6 A;  3W7W A;  5ILY A;  4WU0 A;  2E22 A;  2EAC A;  2I07 B;  3RJ3 A;  2GZ6 A;  2P0V A;  1JCR B;  3E37 B;  1H36 A;  1O6R A;  3OXU A;  1TN6 B;  2FUQ A;  3WKF A;  1HZF A;  1CB8 A;  3P5R A;  2H6I B;  4V1R A;  2ZZR A;  1G9G A;  2RI8 A;  3QXQ A;  1N7R A;  1NL4 B;  5C05 A;  4Q88 A;  1F9D A;  3D5S A;  1CEM A;  2GH4 A;  3ANI A;  3M76 A;  1KFG A;  1X9D A;  1LXK A;  5ILD A;  3M7L A;  1TNU B;  5AGD A;  3E30 B;  2WII B;  3S4D A;  3PMM A;  5IK9 A;  4GTO B;  4TF4 A;  3M73 A;  2FBA A;  3QT3 A;  3QWT A;  3DSX B;  1X1I A;  3M02 A;  1F1S A;  2JF4 A;  3QPF A;  3M71 A;  2JJB A;  2VN7 A;  3W7T A;  5CZL A;  1GHQ A;  4F10 A;  3DRA B;  1H37 A;  3EQA A;  3VXD A;  4GL3 A;  4GAX A;  2A8Z A;  1N24 A;  1QQF A;  3RX5 A;  2YIK A;  4OK4 A;  5FO8 B;  3W5M A;  5IL8 A;  3RSY A;  1HX9 A;  1V5D A;  1KRE A;  3QFY A;  4YDO B;  5M7Y A;  3D3I A;  1O5M B;  4GTR B;  1TF4 A;  4TXT A;  4LNV A;  4D4B A;  3W5N A;  3LZ9 A;  1WU6 A;  4C1S A;  1FT1 B;  3PYB A;  2XWJ B;  3KSQ B;  1D8D B;  1GXO A;  1HXA A;  1WU4 A;  4DOD A;  1LD7 B;  2PMV A;  3H2W A;  5CD2 A;  3E7J A;  5GZK A;  2GOX A;  1LTX B;  3G6J B;  1N1B A;  1TNY B;  4RNQ A;  4AYP A;  2V8K A;  1N7N A;  1I8Q A;  2WCO A;  1FBO A;  3M00 A;  3M7C A;  1LF6 A;  1FP3 A;  3WKH A;  4QT9 A;  4GTP B;  4LNB B;  4Z4J A;  3REN A;  3TF4 A;  1FO3 A;  3ACT A;  3H3K A;  5EAS A;  1W3Y A;  1O79 A;  2H6G B;  1N7O A;  1QBQ B;  3HXF B;  2D8L A;  3DSW B;  1HXG A;  3KQ4 A;  3G4D A;  2XFG A;  4WVB A;  3A3V A;  4JJJ A;  4AYO A;  1N4Q B;  3HXC B;  3W7U A;  3QSP A;  5FO7 B;  2QNO A;  2CQS A;  3M74 A;  4FNV A;  3HXD B;  3S4A A;  1QAZ A;  2F0Y B;  3GZK A;  3QT9 A;  4D4C A;  4D4A A;  2J5C A; 
#chains in the Genus database with same CATH homology
 1DL2 A;  3M77 A;  3P5P A;  3E34 B;  1H39 A;  1H12 A;  3QFZ A;  4ZG8 A;  3QG0 A;  3KSL B;  4LNG B;  1GLM A;  4L6X A;  1H14 A;  1V7V A;  2OKX A;  1TNB B;  1QSJ A;  3E73 A;  4LIX A;  1WU5 A;  4BOK A;  1N4R B;  3HXE B;  5FO9 B;  2WIN B;  1G9J A;  3K11 A;  2DRS A;  2FV0 A;  1GAH A;  1GXM A;  3S4C A;  1R76 A;  3WIQ A;  2SQC A;  3W7S A;  1DOG A;  1KZO B;  2FV1 A;  3WIW A;  3W7X A;  1IA6 A;  4MBG B;  1C3D A;  1LD8 B;  3E32 B;  2NOJ A;  3K7X A;  2PN5 A;  4J5T A;  4GTS B;  2V8J A;  3SDR A;  2H6F B;  1K72 A;  3M75 A;  2WY8 A;  2A73 B;  2WY7 A;  2WYN A;  3GLY A;  4Q2B A;  4GTM B;  5FOB B;  2V3N A;  1N4P B;  1IA7 A;  2AHG A;  4L0G A;  4AYR A;  3E33 B;  3S9V A;  2FUZ A;  1HCU A;  1KSD A;  1GSZ A;  5MEH A;  1UT9 A;  3WUX A;  1FO2 A;  2BBC A;  1O6Q A;  3AFJ A;  4KTR A;  1KSC A;  1V7W A;  4XUV A;  1UMP A;  5DGQ A;  3S4B A;  1O1R B;  1XW2 A;  3T33 A;  1KKT A;  3WC3 A;  3WKG A;  1X81 B;  1JCS B;  1KZP B;  1G87 A;  1N94 B;  4FXK B;  1O1S B;  4YCR A;  5GY3 A;  4D4D A;  3Q78 B;  1AYX A;  1XWQ A;  1V5C A;  1GXN A;  3ANJ A;  4ONT A;  2AFA A;  1IS9 A;  4ZH1 A;  5DGR A;  2H6H B;  4CE7 A;  4CJ1 A;  3QDE A;  4YDE B;  3EUV B;  4KTP A;  4EHM B;  1G6I A;  2BED B;  3SAE A;  2V3P A;  3SQC A;  2BB6 A;  1H54 A;  1CLC A;  3PZ3 B;  3EU5 B;  1NC5 A;  2VN4 A;  3EU8 A;  2IEJ B;  3PZ1 B;  1TNZ B;  3CIH A;  1VD5 A;  1S63 B;  2EAD A;  3P2C A;  2XWB B;  2DRQ A;  3DST B;  3DSS B;  3M7E A;  3Q79 B;  1FAE A;  1N9A B;  2JG0 A;  1S64 B;  2V8I A;  1D8E B;  3PZ4 B;  5GW7 A;  3Q7F B;  3X17 A;  2NVP A;  1L1Y A;  1O1T B;  2G0D A;  1SQC A;  3DSV B;  4M76 A;  4GTQ B;  2ZIR B;  4ZH5 A;  1W6K A;  1TNO B;  4WVA A;  3VW5 A;  3KLS A;  5M7I A;  1KS8 A;  4Z4L A;  4ZRP A;  2DRO A;  1XWT A;  2F6D A;  3SDV A;  1FPP B;  4ZRQ A;  3ANK A;  1W6J A;  3C72 B;  1TN7 B;  2CQT A;  2RI9 A;  3ACS A;  1H13 A;  5E2J A;  2B39 A;  3Q75 B;  1SA4 B;  1H3C A;  3Q7A B;  3QXF A;  4FXG B;  1JCQ B;  1N4S B;  3SFX B;  1FMI A;  3SDT A;  1UG9 A;  1FT2 B;  4WVC A;  2G02 A;  3E6U A;  2Z07 A;  4GTT B;  3SDU A;  1DCE B;  3WKI A;  2BB5 A;  3QRY A;  5JPM B;  1JS4 A;  3DPY B;  4MU9 A;  2R2L B;  3SDQ A;  4L9P B;  1H3A A;  5KKB A;  1F9O A;  5CA3 A;  1NXC A;  4GTV B;  4V1S A;  2XQW A;  1TN8 B;  3SFY B;  1V7X A;  1NI1 B;  4D94 A;  3RX8 A;  3H7L A;  3DSU B;  3D5R A;  3Q73 B;  1H3B A;  1WZZ A;  3HXB B;  3EZ8 A;  1AGM A;  3PYA A;  4DOE A;  1RQ5 A;  1ULV A;  3M78 A;  1GAI A;  1KRF A;  4BOJ A;  1SA5 B;  3CU7 A;  4KKI A;  3PZ2 B;  1FBW A;  2ZIS B;  2RGK A;  3WIR A;  2DRR A;  1LF9 A;  2AHF A;  3RX7 A;  1FCE A;  3M7B A;  4FUS A;  5JPN B;  1KWF A;  4EL8 A;  3RRS A;  1MZC B;  4KKJ A;  3M72 A;  1H35 A;  2ZBL A;  1N95 B;  4AYQ A;  2EAE A;  2D5J A;  1O6H A;  4CJ0 A;  2B4F A;  1GA2 A;  1L2A A;  2EAB A;  3OED A;  3ON6 A;  3W7W A;  4WU0 A;  2EAC A;  2I07 B;  3RJ3 A;  2GZ6 A;  2P0V A;  1JCR B;  3E37 B;  1H36 A;  1O6R A;  3OXU A;  1TN6 B;  3WKF A;  1HZF A;  3P5R A;  2H6I B;  4V1R A;  2ZZR A;  1G9G A;  2RI8 A;  3QXQ A;  4Q88 A;  1NL4 B;  1F9D A;  3D5S A;  1CEM A;  2GH4 A;  3ANI A;  3M76 A;  1KFG A;  1X9D A;  3M7L A;  1TNU B;  5AGD A;  3E30 B;  2WII B;  3S4D A;  3PMM A;  4GTO B;  4TF4 A;  3M73 A;  2FBA A;  3QT3 A;  3QWT A;  3DSX B;  2JF4 A;  3QPF A;  3M71 A;  2JJB A;  2VN7 A;  3W7T A;  5CZL A;  1GHQ A;  3DRA B;  1H37 A;  3EQA A;  3VXD A;  4GL3 A;  2A8Z A;  1QQF A;  3RX5 A;  2YIK A;  5FO8 B;  3W5M A;  3RSY A;  1V5D A;  1KRE A;  3QFY A;  4YDO B;  5M7Y A;  3D3I A;  1O5M B;  4GTR B;  1TF4 A;  4TXT A;  4LNV A;  4D4B A;  3W5N A;  1WU6 A;  4C1S A;  1FT1 B;  3PYB A;  2XWJ B;  3KSQ B;  1D8D B;  1GXO A;  1WU4 A;  4DOD A;  1LD7 B;  2PMV A;  3H2W A;  5CD2 A;  5GZK A;  2GOX A;  1LTX B;  3G6J B;  1TNY B;  4AYP A;  2V8K A;  1FBO A;  3M7C A;  1LF6 A;  1FP3 A;  3WKH A;  4QT9 A;  4GTP B;  4LNB B;  4Z4J A;  3REN A;  3TF4 A;  1FO3 A;  3ACT A;  3H3K A;  1O79 A;  2H6G B;  1QBQ B;  3HXF B;  2D8L A;  3DSW B;  3KQ4 A;  2XFG A;  4WVB A;  3A3V A;  4JJJ A;  4AYO A;  1N4Q B;  3HXC B;  3W7U A;  3QSP A;  5FO7 B;  2QNO A;  2CQS A;  3M74 A;  3HXD B;  3S4A A;  2F0Y B;  3GZK A;  3QT9 A;  4D4C A;  4D4A A;  3GT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...