3WKGA

Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
410
structure length
410
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 164
structure length 410
sequence length 410
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkgA00
2VN4A 1JS4A 1FO3A 3GT5A 1V7XA 3W7XA 2D8LA 4XUVA 3QT9A 1ULVA 5CD2A 4AYRA 3RSYA 1FMIA 1XWTA 2AFAA 3W7TA 3T33A 1KSDA 1L1YA 4Z4JA 1TF4A 3ANJA 2NVPA 3RX5A 1L2AA 3QT3A 2ZBLA 1CEMA 1DOGA 2CQSA 3VXDA 4WVAA 3TF4A 1NC5A 2A8ZA 1KREA 2QNOA 1K72A 1KSCA 3PMMA 3QXFA 3RX8A 3WC3A 3W5NA 2F6DA 3K11A 4DOEA 1FAEA 1FO2A 4L0GA 3S4DA 2AHFA 3QDEA 4AYQA 3E6UA 2RGKA 3GZKA 2ZZRA 4CE7A 3QXQA 3QRYA 1AYXA 2XFGA 1NXCA 2DROA 3QSPA 1GLMA 1XW2A 3WKGA 1KS8A 3WKFA 3X17A 3W7SA 3S4CA 3D3IA 4AYPA 1FP3A 1WU6A 1V5CA 1HCUA 1GAIA 1KWFA 3CIHA 3W5MA 1V7WA 2FV1A 4L6XA 4TF4A 3W7WA 2EADA 2FV0A 2FBAA 3H7LA 3QFYA 1XWQA 4Q2BA 5M7YA 3QWTA 5E2JA 4ZG8A 1FBWA 3RENA 1G6IA 3ANIA 1VD5A 2AHGA 1GAHA 1FBOA 5GY3A 3S4BA 2JJBA 4AYOA 3EQAA 4WVBA 2VN7A 2EABA 1KKTA 1UT9A 2EAEA 1H12A 5DGRA 2WYNA 3S4AA 3WKHA 2FUZA 1WZZA 3WUXA 2RI9A 2DRQA 3WKIA 2D5JA 3GLYA 1IA6A 5DGQA 2P0VA 4KTPA 3VW5A 4TXTA 5CA3A 1AGMA 2OKXA 3AFJA 2DRRA 1UG9A 4J5TA 2RI8A 5KKBA 3P2CA 2JF4A 5CZLA 1V7VA 5GW7A 3ANKA 1KFGA 1LF6A 3QG0A 1H13A 1X9DA 1IS9A 4EL8A 2B4FA 2CQTA 3W7UA 4WVCA 3QPFA 2EACA 5MEHA 1WU5A 3EZ8A 3QFZA 4WU0A 5M7IA 1H14A 1H54A 1WU4A 3WIRA 3H2WA 1F9DA 3E73A 4CJ1A 2JG0A 4JJJA 2DRSA 4ZH5A 1V5DA 3RRSA 4FUSA 3ACTA 1G87A 3RX7A 4CJ0A 3WIQA 2GZ6A 4Z4LA 1RQ5A 1GA2A 1F9OA 1FCEA 1LF9A 3H3KA 1CLCA 4DODA 4KTRA 3ACSA 3A3VA 1DL2A 2GH4A 3ON6A 4Q88A 2Z07A 1G9GA 1IA7A 1G9JA 3WIWA 1KRFA 2YIKA
chains in the Genus database with same CATH superfamily
4LNBB 4XUVA 5IM1A 3VSNA 1ULVA 3Q79B 3RSYA 1FMIA 3T33A 1H3BA 1TF4A 2A73B 1L2AA 2ZBLA 1CEMA 2WY7A 1DOGA 5IL3A 1SA4B 4ZRPA 1NC5A 2QNOA 3M71A 3PMMA 3QXFA 4YDOB 3K11A 2V3PA 3KSLB 1FAEA 3AFLA 4L0GA 2AHFA 4NEIA 4RNQA 1W6JA 3E6UA 4OZVA 2H6HB 1W3YA 1RWGA 3QRYA 1AYXA 1GHQA 3P5PA 3QSPA 3M7CA 2H6GB 4OK4A 3E34B 3WKFA 3S4CA 3EUVB 4GTSB 1GXMA 1V7WA 4TF4A 4D4AA 1OJMA 1W6KA 1XWQA 1H3AA 2PN5A 4ZG8A 1O1RB 4LNGB 4KKIA 3M72A 1N1BA 2I07B 1HXCA 1HN0A 3DPYB 1GXNA 5C05A 1QBQB 2XQWA 4AYOA 1S63B 3M77A 1NL4B 4WVBA 2VN7A 2EAEA 2E24A 1HXAA 2FUZA 1O79A 2RI9A 4GTVB 1HMUA 1QAZA 4DI5A 1TNBB 3M76A 3AFJA 3DSWB 2XWJB 5KKBA 3DSUB 5ILIA 1H3CA 5FO9B 1LF6A 3QG0A 5AGDA 1LD7B 2BRVX 2CQTA 4L9PB 1N7PA 2WDAA 4EHMB 1JCRB 3QPFA 1WU5A 3EZ8A 5IK6A 1HM2A 3DSVB 1WU4A 1X1HA 3M73A 1F9DA 1V5DA 1KZOB 3RX7A 3WIQA 1N4QB 3M01A 4Z4LA 1GA2A 1F9OA 1N24A 4GTTB 2FUQA 1O6QA 4FXGB 1S64B 2VN4A 1FO3A 1V7XA 2D8LA 4FNVA 1N4PB 5CD2A 4MBGB 5ILYA 4LNVA 1KSDA 4Z4JA 2NVPA 3DSXB 3A0OA 3G4FA 1TNZB 3M74A 3W5NA 1GSZA 4DOEA 5IKAA 5DHKA 2V8KA 3HXCB 4D4CA 1J0MA 4ZH1A 1N4SB 4AYQA 1H36A 1RWAA 5JMFA 2XFGA 1NXCA 4V1RA 3SDQA 1XW2A 3WKGA 1KS8A 1LTXB 3D3IA 1FP3A 1V5CA 3SDVA 1GAIA 4D4BA 3CIHA 3EU8A 3E37B 3HXEB 2FV0A 3M7EA 4Q2BA 5E2JA 1FBWA 3VSMA 1GAHA 4KKJA 1FT2B 3DSSB 1HM3A 2EABA 1KKTA 3Q78B 1UMPA 5ILZA 3E7JA 2BEDB 5IL8A 3WUXA 3M7LA 4FXKB 1TN6B 1R76A 3GLYA 1N7RA 2P0VA 1HX9A 4KTPA 3LZ9A 1O6HA 1LXKA 5EAUA 5GW7A 5GZKA 3ANKA 1TNYB 1HV6A 1N94B 1H13A 4EL8A 3D5SA 2ZIRB 1N9AB 1QQFA 3W7UA 3HXBB 1N22A 1D8DB 3QFZA 1SA5B 4WU0A 1N7NA 3KQ4A 2WCOA 1H54A 3E32B 3H2WA 3Q7AB 3M78A 2DRSA 4GTQB 1OJPA 3SQCA 1G87A 1D8EB 3KSQB 2GZ6A 4D94A 1N1ZA 3C72B 1O1TB 2H6IB 4KTRA 3ACSA 3A3VA 1DL2A 2WY8A 3ON6A 2Z07A 2NOJA 2G0DA 3N0FA 3E33B 2YIKA 1C82A 1JS4A 4V1SA 1X1JA 1LD8B 3HXFB 4M76A 4D4DA 5JMDA 1HXGA 2B39A 1XWTA 1H39A 2AFAA 1JCQB 2ONGA 4YDEB 3SFYB 3W7TA 3ANJA 1H37A 1X81B 4WVAA 2PMVA 1MZCB 5ILDA 2ZISB 5FO7B 1K72A 3WC3A 3RX8A 3M7BA 1I8QA 1FO2A 4ZRQA 4MMHA 3QDEA 2RGKA 2ZZRA 1N20A 4F10A 1GLMA 4OK2A 3N0GA 3X17A 1WU6A 1J0NA 1KWFA 3S9VA 3W5MA 3W7WA 2EADA 3H7LA 3QFYA 3QWTA 4BOKA 2H6FB 5ILHA 1G6IA 1RWCA 3ANIA 1LOHA 1VD5A 4F13A 2FUTA 3E80A 3Q73B 5GY3A 2JJBA 3NNBA 3WKHA 1UT9A 1H12A 5DGRA 4GTRB 1TN7B 2IEJB 3S4AA 3SDTA 5JPMB 1H35A 1O6RA 3D5RA 1GXOA 1SQCA 3SDUA 3VW5A 5CA3A 2OKXA 2DRRA 2BRWA 2JF4A 5CZLA 1V7VA 1N23A 2F0YB 1JCSB 1X9DA 1IS9A 2SQCA 3OEDA 2V8JA 3PYBA 5MEHA 5JPNB 5DHIA 3WIRA 4C1SA 5FOBB 1N21A 4JJJA 4ZH5A 3RRSA 4FUSA 3ACTA 3EU5B 2Q1FA 5FO8B 5IK9A 1RQ5A 2WIIB 1FCEA 1LXMA 1LF9A 4DODA 1RWFA 4MMIA 2GH4A 1RW9A 3CU7A 1OJNA 1G9GA 5IKHA 1IA7A 1G9JA 3WIWA 3NFVA 1EGUA 3G4DA 3W7XA 3GT5A 2BB6A 1N7OA 5IK0A 3QT9A 4AYRA 1TN8B 3DRAB 5EASA 1C3DA 1HMWA 1L1YA 3RX5A 3QT3A 4LIXA 2CQSA 3G6JB 3VXDA 1F9GA 3TF4A 2A8ZA 1KREA 3M00A 4GTPB 1KSCA 3PZ2B 2V3NA 2F6DA 3Q7FB 1O5MB 3PZ1B 3S4DA 1KZPB 2WINB 3GZKA 4CE7A 3QXQA 1HZFA 2DROA 1QSJA 4GTOB 2ONHA 3K7XA 4GL3A 4OZWA 3P5RA 3W7SA 3KLSA 4MU9A 4AYPA 1TNUB 1HCUA 2FV1A 4L6XA 2FBAA 5M7YA 5ILKA 4GAXA 3RENA 4ONTA 2AHGA 1FBOA 1RWHA 2J5CA 3S4BA 3PZ4B 3EQAA 1FPPB 2E22A 3Q75B 3PZ3B 2R2LB 2WYNA 1OJOA 2X03A 1WZZA 3WKIA 2DRQA 5ILJA 3M75A 2D5JA 2BBCA 5EATA 3RJ3A 4E1YA 1IA6A 3M02A 5DGQA 1N4RB 3SAEA 1DCEB 4QT9A 4TXTA 1AGMA 4BOJA 3PYAA 2XWBB 1UG9A 1X1IA 2RI8A 4J5TA 3P2CA 4GTMB 2BRPA 1TNOB 1KFGA 3SDRA 1N95B 3SFXB 2B4FA 1NI1B 4WVCA 4OJZA 2V8IA 2EACA 2GOXA 3E30B 5M7IA 1H14A 1F1SA 3DSTB 3E73A 4CJ1A 2JG0A 2G02A 1O1SB 2BB5A 4CJ0A 3OXUA 1N7QA 4YCRA 3H3KA 1CLCA 3HXDB 4Q88A 1CB8A 4FJQA 1KRFA 1FT1B
chains in the Genus database with same CATH topology
4LNBB 4XUVA 1ULVA 3Q79B 3RSYA 1FMIA 3T33A 1H3BA 1TF4A 2A73B 1L2AA 2ZBLA 1CEMA 2WY7A 1DOGA 1SA4B 4ZRPA 1NC5A 2QNOA 3M71A 3PMMA 3QXFA 4YDOB 3K11A 2V3PA 3KSLB 1FAEA 4L0GA 2AHFA 1W6JA 3E6UA 2H6HB 3QRYA 1AYXA 1GHQA 3P5PA 3QSPA 3M7CA 2H6GB 3E34B 3WKFA 3S4CA 3EUVB 4GTSB 1GXMA 1V7WA 4TF4A 4D4AA 1W6KA 1XWQA 1H3AA 2PN5A 4ZG8A 1O1RB 4LNGB 4KKIA 3M72A 2I07B 3DPYB 1GXNA 1QBQB 2XQWA 4AYOA 1S63B 3M77A 1NL4B 4WVBA 2VN7A 2EAEA 2FUZA 1O79A 2RI9A 4GTVB 1TNBB 3M76A 3AFJA 3DSWB 2XWJB 5KKBA 3DSUB 1H3CA 5FO9B 1LF6A 3QG0A 5AGDA 1LD7B 2CQTA 4L9PB 4EHMB 1JCRB 3QPFA 1WU5A 3EZ8A 3DSVB 1WU4A 3M73A 1F9DA 1V5DA 1KZOB 3RX7A 3WIQA 1N4QB 4Z4LA 1GA2A 1F9OA 4GTTB 1O6QA 4FXGB 1S64B 2VN4A 1FO3A 1V7XA 2D8LA 1N4PB 5CD2A 4MBGB 4LNVA 1KSDA 4Z4JA 2NVPA 3DSXB 1TNZB 3M74A 3W5NA 1GSZA 4DOEA 2V8KA 3HXCB 4D4CA 4ZH1A 1N4SB 4AYQA 1H36A 2XFGA 1NXCA 4V1RA 3SDQA 1XW2A 3WKGA 1KS8A 1LTXB 3D3IA 1FP3A 1V5CA 3SDVA 1GAIA 4D4BA 3CIHA 3EU8A 3E37B 3HXEB 2FV0A 3M7EA 4Q2BA 5E2JA 1FBWA 1GAHA 4KKJA 1FT2B 3DSSB 2EABA 1KKTA 3Q78B 1UMPA 2BEDB 3WUXA 3M7LA 4FXKB 1TN6B 1R76A 3GLYA 2P0VA 4KTPA 1O6HA 5GW7A 5GZKA 3ANKA 1TNYB 1N94B 1H13A 4EL8A 3D5SA 2ZIRB 1N9AB 1QQFA 3W7UA 3HXBB 1D8DB 3QFZA 1SA5B 4WU0A 3KQ4A 1H54A 3E32B 3H2WA 3Q7AB 3M78A 2DRSA 4GTQB 3SQCA 1G87A 1D8EB 3KSQB 2GZ6A 4D94A 3C72B 1O1TB 2H6IB 4KTRA 3ACSA 3A3VA 1DL2A 2WY8A 3ON6A 2Z07A 2NOJA 2G0DA 3E33B 2YIKA 1JS4A 4V1SA 1LD8B 3HXFB 4M76A 4D4DA 2B39A 1XWTA 1H39A 2AFAA 1JCQB 4YDEB 3SFYB 3W7TA 3ANJA 1H37A 1X81B 4WVAA 2PMVA 1MZCB 2ZISB 5FO7B 1K72A 3WC3A 3RX8A 3M7BA 1FO2A 4ZRQA 3QDEA 2RGKA 2ZZRA 1GLMA 3X17A 1WU6A 1KWFA 3S9VA 3W5MA 3W7WA 2EADA 3H7LA 3QFYA 3QWTA 4BOKA 2H6FB 1G6IA 3ANIA 1VD5A 3Q73B 5GY3A 2JJBA 3WKHA 1UT9A 1H12A 5DGRA 4GTRB 1TN7B 2IEJB 3S4AA 3SDTA 5JPMB 1H35A 1O6RA 3D5RA 1GXOA 1SQCA 3SDUA 3VW5A 5CA3A 2OKXA 2DRRA 2JF4A 5CZLA 1V7VA 2F0YB 1JCSB 1X9DA 1IS9A 2SQCA 3OEDA 2V8JA 3PYBA 5MEHA 5JPNB 4C1SA 3WIRA 5FOBB 4JJJA 3RRSA 4ZH5A 4FUSA 3ACTA 3EU5B 5FO8B 1RQ5A 2WIIB 1FCEA 1LF9A 4DODA 2GH4A 3CU7A 1G9GA 1IA7A 1G9JA 3WIWA 3W7XA 3GT5A 2BB6A 3QT9A 4AYRA 1TN8B 3DRAB 1C3DA 1L1YA 3RX5A 3QT3A 4LIXA 2CQSA 3G6JB 3VXDA 3TF4A 2A8ZA 1KREA 4GTPB 1KSCA 3PZ2B 2V3NA 2F6DA 3Q7FB 1O5MB 3PZ1B 3S4DA 1KZPB 2WINB 3GZKA 4CE7A 3QXQA 1HZFA 2DROA 1QSJA 4GTOB 3K7XA 4GL3A 3W7SA 3P5RA 3KLSA 4MU9A 4AYPA 1TNUB 1HCUA 2FV1A 4L6XA 2FBAA 5M7YA 3RENA 4ONTA 2AHGA 1FBOA 3S4BA 3PZ4B 3EQAA 1FPPB 3Q75B 3PZ3B 2R2LB 2WYNA 1WZZA 3WKIA 2DRQA 3M75A 2D5JA 2BBCA 3RJ3A 1IA6A 5DGQA 1N4RB 3SAEA 1DCEB 4QT9A 4TXTA 1AGMA 4BOJA 3PYAA 2XWBB 1UG9A 4J5TA 2RI8A 3P2CA 4GTMB 1TNOB 1KFGA 3SDRA 1N95B 3SFXB 2B4FA 1NI1B 4WVCA 2V8IA 2EACA 2GOXA 3E30B 5M7IA 1H14A 3DSTB 3E73A 4CJ1A 2JG0A 2G02A 1O1SB 2BB5A 4CJ0A 3OXUA 4YCRA 3H3KA 1CLCA 3HXDB 4Q88A 1KRFA 1FT1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN4 A;  1JS4 A;  1FO3 A;  3GT5 A;  1V7X A;  3W7X A;  2D8L A;  4XUV A;  3QT9 A;  1ULV A;  5CD2 A;  4AYR A;  3RSY A;  1FMI A;  1XWT A;  2AFA A;  3W7T A;  3T33 A;  1KSD A;  1L1Y A;  4Z4J A;  1TF4 A;  3ANJ A;  2NVP A;  3RX5 A;  1L2A A;  3QT3 A;  2ZBL A;  1CEM A;  1DOG A;  2CQS A;  3VXD A;  4WVA A;  3TF4 A;  1NC5 A;  2A8Z A;  1KRE A;  2QNO A;  1K72 A;  1KSC A;  3PMM A;  3QXF A;  3RX8 A;  3WC3 A;  3W5N A;  2F6D A;  3K11 A;  4DOE A;  1FAE A;  1FO2 A;  4L0G A;  3S4D A;  2AHF A;  3QDE A;  4AYQ A;  3E6U A;  2RGK A;  3GZK A;  2ZZR A;  4CE7 A;  3QXQ A;  3QRY A;  1AYX A;  2XFG A;  1NXC A;  2DRO A;  3QSP A;  1GLM A;  1XW2 A;  3WKG A;  1KS8 A;  3WKF A;  3X17 A;  3W7S A;  3S4C A;  3D3I A;  4AYP A;  1FP3 A;  1WU6 A;  1V5C A;  1HCU A;  1GAI A;  1KWF A;  3CIH A;  3W5M A;  1V7W A;  2FV1 A;  4L6X A;  4TF4 A;  3W7W A;  2EAD A;  2FV0 A;  2FBA A;  3H7L A;  3QFY A;  1XWQ A;  4Q2B A;  5M7Y A;  3QWT A;  5E2J A;  4ZG8 A;  1FBW A;  3REN A;  1G6I A;  3ANI A;  1VD5 A;  2AHG A;  1GAH A;  1FBO A;  5GY3 A;  3S4B A;  2JJB A;  4AYO A;  3EQA A;  4WVB A;  2VN7 A;  2EAB A;  1KKT A;  1UT9 A;  2EAE A;  1H12 A;  5DGR A;  2WYN A;  3S4A A;  3WKH A;  2FUZ A;  1WZZ A;  3WUX A;  2RI9 A;  2DRQ A;  3WKI A;  2D5J A;  3GLY A;  1IA6 A;  5DGQ A;  2P0V A;  4KTP A;  3VW5 A;  4TXT A;  5CA3 A;  1AGM A;  2OKX A;  3AFJ A;  2DRR A;  1UG9 A;  4J5T A;  2RI8 A;  5KKB A;  3P2C A;  2JF4 A;  5CZL A;  1V7V A;  5GW7 A;  3ANK A;  1KFG A;  1LF6 A;  3QG0 A;  1H13 A;  1X9D A;  1IS9 A;  4EL8 A;  2B4F A;  2CQT A;  3W7U A;  4WVC A;  3QPF A;  2EAC A;  5MEH A;  1WU5 A;  3EZ8 A;  3QFZ A;  4WU0 A;  5M7I A;  1H14 A;  1H54 A;  1WU4 A;  3WIR A;  3H2W A;  1F9D A;  3E73 A;  4CJ1 A;  2JG0 A;  4JJJ A;  2DRS A;  4ZH5 A;  1V5D A;  3RRS A;  4FUS A;  3ACT A;  1G87 A;  3RX7 A;  4CJ0 A;  3WIQ A;  2GZ6 A;  4Z4L A;  1RQ5 A;  1GA2 A;  1F9O A;  1FCE A;  1LF9 A;  3H3K A;  1CLC A;  4DOD A;  4KTR A;  3ACS A;  3A3V A;  1DL2 A;  2GH4 A;  3ON6 A;  4Q88 A;  2Z07 A;  1G9G A;  1IA7 A;  1G9J A;  3WIW A;  1KRF A;  2YIK A; 
#chains in the Genus database with same CATH topology
 4LNB B;  4XUV A;  5IM1 A;  3VSN A;  1ULV A;  3Q79 B;  3RSY A;  1FMI A;  3T33 A;  1H3B A;  1TF4 A;  2A73 B;  1L2A A;  2ZBL A;  1CEM A;  2WY7 A;  1DOG A;  5IL3 A;  1SA4 B;  4ZRP A;  1NC5 A;  2QNO A;  3M71 A;  3PMM A;  3QXF A;  4YDO B;  3K11 A;  2V3P A;  3KSL B;  1FAE A;  3AFL A;  4L0G A;  2AHF A;  4NEI A;  4RNQ A;  1W6J A;  3E6U A;  4OZV A;  2H6H B;  1W3Y A;  1RWG A;  3QRY A;  1AYX A;  1GHQ A;  3P5P A;  3QSP A;  3M7C A;  2H6G B;  4OK4 A;  3E34 B;  3WKF A;  3S4C A;  3EUV B;  4GTS B;  1GXM A;  1V7W A;  4TF4 A;  4D4A A;  1OJM A;  1W6K A;  1XWQ A;  1H3A A;  2PN5 A;  4ZG8 A;  1O1R B;  4LNG B;  4KKI A;  3M72 A;  1N1B A;  2I07 B;  1HXC A;  1HN0 A;  3DPY B;  1GXN A;  5C05 A;  1QBQ B;  2XQW A;  4AYO A;  1S63 B;  3M77 A;  1NL4 B;  4WVB A;  2VN7 A;  2EAE A;  2E24 A;  1HXA A;  2FUZ A;  1O79 A;  2RI9 A;  4GTV B;  1HMU A;  1QAZ A;  4DI5 A;  1TNB B;  3M76 A;  3AFJ A;  3DSW B;  2XWJ B;  5KKB A;  3DSU B;  5ILI A;  1H3C A;  5FO9 B;  1LF6 A;  3QG0 A;  5AGD A;  1LD7 B;  2BRV X;  2CQT A;  4L9P B;  1N7P A;  2WDA A;  4EHM B;  1JCR B;  3QPF A;  1WU5 A;  3EZ8 A;  5IK6 A;  1HM2 A;  3DSV B;  1WU4 A;  1X1H A;  3M73 A;  1F9D A;  1V5D A;  1KZO B;  3RX7 A;  3WIQ A;  1N4Q B;  3M01 A;  4Z4L A;  1GA2 A;  1F9O A;  1N24 A;  4GTT B;  2FUQ A;  1O6Q A;  4FXG B;  1S64 B;  2VN4 A;  1FO3 A;  1V7X A;  2D8L A;  4FNV A;  1N4P B;  5CD2 A;  4MBG B;  5ILY A;  4LNV A;  1KSD A;  4Z4J A;  2NVP A;  3DSX B;  3A0O A;  3G4F A;  1TNZ B;  3M74 A;  3W5N A;  1GSZ A;  4DOE A;  5IKA A;  5DHK A;  2V8K A;  3HXC B;  4D4C A;  1J0M A;  4ZH1 A;  1N4S B;  4AYQ A;  1H36 A;  1RWA A;  5JMF A;  2XFG A;  1NXC A;  4V1R A;  3SDQ A;  1XW2 A;  3WKG A;  1KS8 A;  1LTX B;  3D3I A;  1FP3 A;  1V5C A;  3SDV A;  1GAI A;  4D4B A;  3CIH A;  3EU8 A;  3E37 B;  3HXE B;  2FV0 A;  3M7E A;  4Q2B A;  5E2J A;  1FBW A;  3VSM A;  1GAH A;  4KKJ A;  1FT2 B;  3DSS B;  1HM3 A;  2EAB A;  1KKT A;  3Q78 B;  1UMP A;  5ILZ A;  3E7J A;  2BED B;  5IL8 A;  3WUX A;  3M7L A;  4FXK B;  1TN6 B;  1R76 A;  3GLY A;  1N7R A;  2P0V A;  1HX9 A;  4KTP A;  3LZ9 A;  1O6H A;  1LXK A;  5EAU A;  5GW7 A;  5GZK A;  3ANK A;  1TNY B;  1HV6 A;  1N94 B;  1H13 A;  4EL8 A;  3D5S A;  2ZIR B;  1N9A B;  1QQF A;  3W7U A;  3HXB B;  1N22 A;  1D8D B;  3QFZ A;  1SA5 B;  4WU0 A;  1N7N A;  3KQ4 A;  2WCO A;  1H54 A;  3E32 B;  3H2W A;  3Q7A B;  3M78 A;  2DRS A;  4GTQ B;  1OJP A;  3SQC A;  1G87 A;  1D8E B;  3KSQ B;  2GZ6 A;  4D94 A;  1N1Z A;  3C72 B;  1O1T B;  2H6I B;  4KTR A;  3ACS A;  3A3V A;  1DL2 A;  2WY8 A;  3ON6 A;  2Z07 A;  2NOJ A;  2G0D A;  3N0F A;  3E33 B;  2YIK A;  1C82 A;  1JS4 A;  4V1S A;  1X1J A;  1LD8 B;  3HXF B;  4M76 A;  4D4D A;  5JMD A;  1HXG A;  2B39 A;  1XWT A;  1H39 A;  2AFA A;  1JCQ B;  2ONG A;  4YDE B;  3SFY B;  3W7T A;  3ANJ A;  1H37 A;  1X81 B;  4WVA A;  2PMV A;  1MZC B;  5ILD A;  2ZIS B;  5FO7 B;  1K72 A;  3WC3 A;  3RX8 A;  3M7B A;  1I8Q A;  1FO2 A;  4ZRQ A;  4MMH A;  3QDE A;  2RGK A;  2ZZR A;  1N20 A;  4F10 A;  1GLM A;  4OK2 A;  3N0G A;  3X17 A;  1WU6 A;  1J0N A;  1KWF A;  3S9V A;  3W5M A;  3W7W A;  2EAD A;  3H7L A;  3QFY A;  3QWT A;  4BOK A;  2H6F B;  5ILH A;  1G6I A;  1RWC A;  3ANI A;  1LOH A;  1VD5 A;  4F13 A;  2FUT A;  3E80 A;  3Q73 B;  5GY3 A;  2JJB A;  3NNB A;  3WKH A;  1UT9 A;  1H12 A;  5DGR A;  4GTR B;  1TN7 B;  2IEJ B;  3S4A A;  3SDT A;  5JPM B;  1H35 A;  1O6R A;  3D5R A;  1GXO A;  1SQC A;  3SDU A;  3VW5 A;  5CA3 A;  2OKX A;  2DRR A;  2BRW A;  2JF4 A;  5CZL A;  1V7V A;  1N23 A;  2F0Y B;  1JCS B;  1X9D A;  1IS9 A;  2SQC A;  3OED A;  2V8J A;  3PYB A;  5MEH A;  5JPN B;  5DHI A;  3WIR A;  4C1S A;  5FOB B;  1N21 A;  4JJJ A;  4ZH5 A;  3RRS A;  4FUS A;  3ACT A;  3EU5 B;  2Q1F A;  5FO8 B;  5IK9 A;  1RQ5 A;  2WII B;  1FCE A;  1LXM A;  1LF9 A;  4DOD A;  1RWF A;  4MMI A;  2GH4 A;  1RW9 A;  3CU7 A;  1OJN A;  1G9G A;  5IKH A;  1IA7 A;  1G9J A;  3WIW A;  3NFV A;  1EGU A;  3G4D A;  3W7X A;  3GT5 A;  2BB6 A;  1N7O A;  5IK0 A;  3QT9 A;  4AYR A;  1TN8 B;  3DRA B;  5EAS A;  1C3D A;  1HMW A;  1L1Y A;  3RX5 A;  3QT3 A;  4LIX A;  2CQS A;  3G6J B;  3VXD A;  1F9G A;  3TF4 A;  2A8Z A;  1KRE A;  3M00 A;  4GTP B;  1KSC A;  3PZ2 B;  2V3N A;  2F6D A;  3Q7F B;  1O5M B;  3PZ1 B;  3S4D A;  1KZP B;  2WIN B;  3GZK A;  4CE7 A;  3QXQ A;  1HZF A;  2DRO A;  1QSJ A;  4GTO B;  2ONH A;  3K7X A;  4GL3 A;  4OZW A;  3P5R A;  3W7S A;  3KLS A;  4MU9 A;  4AYP A;  1TNU B;  1HCU A;  2FV1 A;  4L6X A;  2FBA A;  5M7Y A;  5ILK A;  4GAX A;  3REN A;  4ONT A;  2AHG A;  1FBO A;  1RWH A;  2J5C A;  3S4B A;  3PZ4 B;  3EQA A;  1FPP B;  2E22 A;  3Q75 B;  3PZ3 B;  2R2L B;  2WYN A;  1OJO A;  2X03 A;  1WZZ A;  3WKI A;  2DRQ A;  5ILJ A;  3M75 A;  2D5J A;  2BBC A;  5EAT A;  3RJ3 A;  4E1Y A;  1IA6 A;  3M02 A;  5DGQ A;  1N4R B;  3SAE A;  1DCE B;  4QT9 A;  4TXT A;  1AGM A;  4BOJ A;  3PYA A;  2XWB B;  1UG9 A;  1X1I A;  2RI8 A;  4J5T A;  3P2C A;  4GTM B;  2BRP A;  1TNO B;  1KFG A;  3SDR A;  1N95 B;  3SFX B;  2B4F A;  1NI1 B;  4WVC A;  4OJZ A;  2V8I A;  2EAC A;  2GOX A;  3E30 B;  5M7I A;  1H14 A;  1F1S A;  3DST B;  3E73 A;  4CJ1 A;  2JG0 A;  2G02 A;  1O1S B;  2BB5 A;  4CJ0 A;  3OXU A;  1N7Q A;  4YCR A;  3H3K A;  1CLC A;  3HXD B;  4Q88 A;  1CB8 A;  4FJQ A;  1KRF A;  1FT1 B; 
#chains in the Genus database with same CATH homology
 4LNB B;  4XUV A;  1ULV A;  3Q79 B;  3RSY A;  1FMI A;  3T33 A;  1H3B A;  1TF4 A;  2A73 B;  1L2A A;  2ZBL A;  1CEM A;  2WY7 A;  1DOG A;  1SA4 B;  4ZRP A;  1NC5 A;  2QNO A;  3M71 A;  3PMM A;  3QXF A;  4YDO B;  3K11 A;  2V3P A;  3KSL B;  1FAE A;  4L0G A;  2AHF A;  1W6J A;  3E6U A;  2H6H B;  3QRY A;  1AYX A;  1GHQ A;  3P5P A;  3QSP A;  3M7C A;  2H6G B;  3E34 B;  3WKF A;  3S4C A;  3EUV B;  4GTS B;  1GXM A;  1V7W A;  4TF4 A;  4D4A A;  1W6K A;  1XWQ A;  1H3A A;  2PN5 A;  4ZG8 A;  1O1R B;  4LNG B;  4KKI A;  3M72 A;  2I07 B;  3DPY B;  1GXN A;  1QBQ B;  2XQW A;  4AYO A;  1S63 B;  3M77 A;  1NL4 B;  4WVB A;  2VN7 A;  2EAE A;  2FUZ A;  1O79 A;  2RI9 A;  4GTV B;  1TNB B;  3M76 A;  3AFJ A;  3DSW B;  2XWJ B;  5KKB A;  3DSU B;  1H3C A;  5FO9 B;  1LF6 A;  3QG0 A;  5AGD A;  1LD7 B;  2CQT A;  4L9P B;  4EHM B;  1JCR B;  3QPF A;  1WU5 A;  3EZ8 A;  3DSV B;  1WU4 A;  3M73 A;  1F9D A;  1V5D A;  1KZO B;  3RX7 A;  3WIQ A;  1N4Q B;  4Z4L A;  1GA2 A;  1F9O A;  4GTT B;  1O6Q A;  4FXG B;  1S64 B;  2VN4 A;  1FO3 A;  1V7X A;  2D8L A;  1N4P B;  5CD2 A;  4MBG B;  4LNV A;  1KSD A;  4Z4J A;  2NVP A;  3DSX B;  1TNZ B;  3M74 A;  3W5N A;  1GSZ A;  4DOE A;  2V8K A;  3HXC B;  4D4C A;  4ZH1 A;  1N4S B;  4AYQ A;  1H36 A;  2XFG A;  1NXC A;  4V1R A;  3SDQ A;  1XW2 A;  3WKG A;  1KS8 A;  1LTX B;  3D3I A;  1FP3 A;  1V5C A;  3SDV A;  1GAI A;  4D4B A;  3CIH A;  3EU8 A;  3E37 B;  3HXE B;  2FV0 A;  3M7E A;  4Q2B A;  5E2J A;  1FBW A;  1GAH A;  4KKJ A;  1FT2 B;  3DSS B;  2EAB A;  1KKT A;  3Q78 B;  1UMP A;  2BED B;  3WUX A;  3M7L A;  4FXK B;  1TN6 B;  1R76 A;  3GLY A;  2P0V A;  4KTP A;  1O6H A;  5GW7 A;  5GZK A;  3ANK A;  1TNY B;  1N94 B;  1H13 A;  4EL8 A;  3D5S A;  2ZIR B;  1N9A B;  1QQF A;  3W7U A;  3HXB B;  1D8D B;  3QFZ A;  1SA5 B;  4WU0 A;  3KQ4 A;  1H54 A;  3E32 B;  3H2W A;  3Q7A B;  3M78 A;  2DRS A;  4GTQ B;  3SQC A;  1G87 A;  1D8E B;  3KSQ B;  2GZ6 A;  4D94 A;  3C72 B;  1O1T B;  2H6I B;  4KTR A;  3ACS A;  3A3V A;  1DL2 A;  2WY8 A;  3ON6 A;  2Z07 A;  2NOJ A;  2G0D A;  3E33 B;  2YIK A;  1JS4 A;  4V1S A;  1LD8 B;  3HXF B;  4M76 A;  4D4D A;  2B39 A;  1XWT A;  1H39 A;  2AFA A;  1JCQ B;  4YDE B;  3SFY B;  3W7T A;  3ANJ A;  1H37 A;  1X81 B;  4WVA A;  2PMV A;  1MZC B;  2ZIS B;  5FO7 B;  1K72 A;  3WC3 A;  3RX8 A;  3M7B A;  1FO2 A;  4ZRQ A;  3QDE A;  2RGK A;  2ZZR A;  1GLM A;  3X17 A;  1WU6 A;  1KWF A;  3S9V A;  3W5M A;  3W7W A;  2EAD A;  3H7L A;  3QFY A;  3QWT A;  4BOK A;  2H6F B;  1G6I A;  3ANI A;  1VD5 A;  3Q73 B;  5GY3 A;  2JJB A;  3WKH A;  1UT9 A;  1H12 A;  5DGR A;  4GTR B;  1TN7 B;  2IEJ B;  3S4A A;  3SDT A;  5JPM B;  1H35 A;  1O6R A;  3D5R A;  1GXO A;  1SQC A;  3SDU A;  3VW5 A;  5CA3 A;  2OKX A;  2DRR A;  2JF4 A;  5CZL A;  1V7V A;  2F0Y B;  1JCS B;  1X9D A;  1IS9 A;  2SQC A;  3OED A;  2V8J A;  3PYB A;  5MEH A;  5JPN B;  4C1S A;  3WIR A;  5FOB B;  4JJJ A;  3RRS A;  4ZH5 A;  4FUS A;  3ACT A;  3EU5 B;  5FO8 B;  1RQ5 A;  2WII B;  1FCE A;  1LF9 A;  4DOD A;  2GH4 A;  3CU7 A;  1G9G A;  1IA7 A;  1G9J A;  3WIW A;  3W7X A;  3GT5 A;  2BB6 A;  3QT9 A;  4AYR A;  1TN8 B;  3DRA B;  1C3D A;  1L1Y A;  3RX5 A;  3QT3 A;  4LIX A;  2CQS A;  3G6J B;  3VXD A;  3TF4 A;  2A8Z A;  1KRE A;  4GTP B;  1KSC A;  3PZ2 B;  2V3N A;  2F6D A;  3Q7F B;  1O5M B;  3PZ1 B;  3S4D A;  1KZP B;  2WIN B;  3GZK A;  4CE7 A;  3QXQ A;  1HZF A;  2DRO A;  1QSJ A;  4GTO B;  3K7X A;  4GL3 A;  3W7S A;  3P5R A;  3KLS A;  4MU9 A;  4AYP A;  1TNU B;  1HCU A;  2FV1 A;  4L6X A;  2FBA A;  5M7Y A;  3REN A;  4ONT A;  2AHG A;  1FBO A;  3S4B A;  3PZ4 B;  3EQA A;  1FPP B;  3Q75 B;  3PZ3 B;  2R2L B;  2WYN A;  1WZZ A;  3WKI A;  2DRQ A;  3M75 A;  2D5J A;  2BBC A;  3RJ3 A;  1IA6 A;  5DGQ A;  1N4R B;  3SAE A;  1DCE B;  4QT9 A;  4TXT A;  1AGM A;  4BOJ A;  3PYA A;  2XWB B;  1UG9 A;  4J5T A;  2RI8 A;  3P2C A;  4GTM B;  1TNO B;  1KFG A;  3SDR A;  1N95 B;  3SFX B;  2B4F A;  1NI1 B;  4WVC A;  2V8I A;  2EAC A;  2GOX A;  3E30 B;  5M7I A;  1H14 A;  3DST B;  3E73 A;  4CJ1 A;  2JG0 A;  2G02 A;  1O1S B;  2BB5 A;  4CJ0 A;  3OXU A;  4YCR A;  3H3K A;  1CLC A;  3HXD B;  4Q88 A;  1KRF A;  1FT1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...