3WKGA

Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
410
structure length
410
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 164
structure length 410
sequence length 410
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkgA00
1JS4A 4AYQA 2ZBLA 1X9DA 1G9GA 4AYOA 2EAEA 3EQAA 3W7XA 1FBOA 2DROA 2F6DA 3W5NA 3GZKA 2FV0A 2GH4A 4ZG8A 1HCUA 3QXFA 2JJBA 2CQSA 2QNOA 2AHFA 3A3VA 4FUSA 3RENA 3W5MA 1KKTA 1CLCA 1XWTA 1KRFA 3ACSA 4DOEA 2B4FA 3E73A 4KTPA 1V7XA 3H2WA 1VD5A 4KTRA 4TXTA 1WZZA 2D5JA 1IA7A 2RI9A 3QT3A 1XWQA 1GA2A 2P0VA 4TF4A 1WU5A 3QPFA 4JJJA 4Q2BA 3AFJA 1F9OA 1NXCA 1V5CA 3ON6A 1FO3A 2XFGA 5GW7A 5M7IA 3D3IA 1LF9A 4EL8A 1DL2A 1KWFA 1CEMA 3S4AA 3RX7A 2RGKA 3ANKA 3WKGA 1H13A 2VN4A 3QXQA 2NVPA 2FUZA 1G9JA 1KS8A 3E6UA 3P2CA 3WIRA 4WU0A 1KREA 1FP3A 2ZZRA 1GAIA 2A8ZA 2DRQA 2JG0A 3WKIA 3WUXA 5CA3A 3GLYA 5CZLA 4ZH5A 1ULVA 4DODA 3RX5A 3QFZA 3QG0A 2VN7A 1AGMA 1AYXA 2AFAA 3QRYA 4Z4LA 3GT5A 1G6IA 1DOGA 2WYNA 2JF4A 3ACTA 2EADA 5MEHA 3EZ8A 3QT9A 3W7TA 3ANIA 1FMIA 3CIHA 2OKXA 1V7VA 3ANJA 2D8LA 3K11A 1FAEA 1FBWA 1K72A 2FV1A 5DGQA 1H54A 3RX8A 3RRSA 1IS9A 1TF4A 3W7UA 1FCEA 5GY3A 4Q88A 1UG9A 3QDEA 1RQ5A 4XUVA 1L2AA 2EABA 1H12A 4Z4JA 2Z07A 1KSCA 3QFYA 3WIQA 3H7LA 1WU6A 4CJ0A 1GLMA 3S4DA 5DGRA 3VW5A 4AYRA 1NC5A 1V5DA 3W7SA 3QSPA 2RI8A 5KKBA 2DRRA 1LF6A 2FBAA 1L1YA 3X17A 5M7YA 4J5TA 3T33A 2GZ6A 3VXDA 4WVBA 1H14A 1V7WA 1G87A 3TF4A 3PMMA 2AHGA 3W7WA 4CE7A 4WVCA 1XW2A 5E2JA 3S4CA 3QWTA 4L6XA 4WVAA 2CQTA 1F9DA 1UT9A 2YIKA 3S4BA 1KFGA 2DRSA 3WIWA 4L0GA 5CD2A 3H3KA 1IA6A 1GAHA 4AYPA 3RSYA 2EACA 1FO2A 3WKHA 4CJ1A 1WU4A 3WKFA 1KSDA 3WC3A
chains in the Genus database with same CATH superfamily
3M75A 2WCOA 4BOJA 1X9DA 1G9GA 3SDQA 4AYOA 2EAEA 3W5NA 2DROA 3GZKA 2FV0A 1N4SB 2GH4A 1GHQA 2ONHA 4V1RA 3QXFA 2JJBA 2AHFA 2WDAA 3RENA 1N20A 1CLCA 1N23A 1O1SB 3ACSA 3M02A 3E73A 3DSTB 5ILHA 1N7NA 2D5JA 4GTRB 1HXCA 4FXGB 3K7XA 1O6QA 1GA2A 4NEIA 1WU5A 2XWBB 1F9OA 1V5CA 1OJOA 5JMDA 2G0DA 1LF9A 2E24A 4OK2A 1KWFA 1QQFA 3PZ4B 1N9AB 2NVPA 5EAUA 3E6UA 3WIRA 1TNUB 2BRPA 1GAIA 2JG0A 3WKIA 1N7OA 5CA3A 1N7RA 1N1ZA 3G4FA 2H6FB 1HM2A 3RX5A 4F10A 4FNVA 2PN5A 2VN7A 3SDVA 1AYXA 1UMPA 3GT5A 2WYNA 1W6KA 3ANIA 5ILYA 2IEJB 1FBWA 1H54A 3RRSA 5FOBB 2FUQA 1J0NA 1N7QA 2Z07A 3CU7A 1KSCA 1NL4B 1KZOB 1TN8B 3S4DA 1NC5A 1V5DA 3PZ1B 1HXAA 4ONTA 5KKBA 4GTQB 1LF6A 4ZRPA 4MMHA 1RWCA 5IK9A 1HZFA 3T33A 2BEDB 4D4AA 1RWHA 3E33B 1V7WA 3SAEA 1H3BA 3OXUA 4OK4A 3SDTA 3DSSB 1D8DB 4YDOB 3A0OA 4LNGB 1NI1B 1F9DA 2WINB 3PZ3B 5CD2A 3M7CA 5JMFA 1O1TB 3RSYA 3PYBA 5EATA 5ILIA 1L2AA 3W7TA 3WC3A 3SFYB 2ZBLA 3W7XA 1N4PB 3SQCA 2E22A 5FO8B 1LOHA 1KKTA 4D94A 4DOEA 2B4FA 3VSNA 1V7XA 3DSUB 4GTMB 4KTRA 4TXTA 1IA7A 2A73B 1FT1B 2RI9A 1LTXB 3HXFB 3QT3A 1MZCB 4TF4A 1N94B 1X1IA 4JJJA 4D4BA 1FO3A 2XFGA 4L9PB 5M7IA 2XWJB 3M7BA 1S63B 4EL8A 1OJPA 1CB8A 5AGDA 1SA5B 2NOJA 2VN4A 3M00A 3SDUA 1N4QB 1G9JA 1RW9A 1KS8A 3P2CA 1GSZA 2BB6A 4YDEB 4RNQA 2I07B 1HMWA 1JCRB 3E30B 1R76A 4GTSB 1S64B 1H39A 2PMVA 3QRYA 4Z4LA 2JF4A 2G02A 3DSXB 1LD7B 1FMIA 3KSQB 4OZVA 5EASA 3ANJA 1W6JA 1K72A 2FV1A 3G4DA 5DGQA 3RX8A 1HV6A 1SA4B 1IS9A 2V3NA 4QT9A 4F13A 5GY3A 2ZIRB 1RQ5A 4XUVA 3D5SA 3QFYA 3WIQA 3H7LA 3EU8A 1GLMA 4MU9A 1HMUA 3VW5A 1C3DA 5IL8A 4FJQA 2J5CA 1TN7B 5DHKA 2DRRA 5FO9B 4D4DA 3SFXB 3Q78B 2H6IB 1TNBB 2R2LB 3E34B 3Q73B 1N95B 1TNYB 1H3AA 3W7WA 3Q79B 4CE7A 5E2JA 3D5RA 3M7LA 3S9VA 3QWTA 2V8JA 1F1SA 2CQTA 1F9GA 1UT9A 2DRSA 3KQ4A 3DSWB 4C1SA 4AYPA 5JPMB 3P5PA 5C05A 3Q7FB 3WKHA 4E1YA 1N24A 3VSMA 1O6HA 5IKAA 3NNBA 1N1BA 3P5RA 1J0MA 1FBOA 2F6DA 3HXEB 4ZG8A 2QNOA 4FUSA 3W5MA 1XWTA 1KRFA 5IM1A 3DPYB 4KTPA 3SDRA 3N0FA 1LXMA 1WZZA 1D8EB 3M72A 2P0VA 3QPFA 1HX9A 1NXCA 3ON6A 4GL3A 4DI5A 1LXKA 2F0YB 1TNOB 2BRWA 4GTTB 1DL2A 2SQCA 1CEMA 3S4AA 1GXOA 1H13A 4FXKB 1W3YA 1H37A 1QAZA 2A8ZA 2DRQA 2Q1FA 3M74A 3WUXA 3GLYA 1ULVA 4DODA 3QFZA 4D4CA 3QG0A 4V1SA 3KSLB 2AFAA 1DOGA 3ACTA 2EADA 1RWFA 3EZ8A 3QT9A 3CIHA 3E37B 5ILDA 1SQCA 1N7PA 1V7VA 2D8LA 3K11A 1JCQB 2X03A 3G6JB 5IKHA 2V8IA 4LIXA 1TF4A 1FCEA 1H36A 1HXGA 3QDEA 1H12A 1O1RB 4CJ0A 3HXBB 1GXMA 2XQWA 5IK0A 3M7EA 4ZRQA 3M77A 3W7SA 2RI8A 4LNVA 5ILKA 5M7YA 4MMIA 3C72B 4WVBA 1H14A 1H3CA 1QSJA 5DHIA 4EHMB 3TF4A 1O5MB 2AHGA 3M73A 1X81B 1XW2A 3E80A 1RWGA 2H6GB 2WY8A 2ONGA 3M76A 2YIKA 3S4BA 4MBGB 1KFGA 1N4RB 3WIWA 4L0GA 3KLSA 1IA6A 1GAHA 1O79A 2EACA 1C82A 1HN0A 2BRVX 1GXNA 1WU4A 3WKFA 3EUVB 1KSDA 3OEDA 4LNBB 5ILZA 1TN6B 1JS4A 4AYQA 4OJZA 4OZWA 5IL3A 2WY7A 1JCSB 3DSVB 3EQAA 3M78A 1HCUA 3PYAA 1FT2B 2CQSA 3A3VA 1HM3A 3PZ2B 4GTPB 1TNZB 1VD5A 3H2WA 1N21A 5IK6A 4GTOB 1H35A 3M71A 4GAXA 1XWQA 4KKJA 3N0GA 3DRAB 4Q2BA 3AFJA 1I8QA 3Q7AB 5GW7A 3D3IA 5JPNB 1LD8B 3RX7A 2RGKA 3ANKA 3WKGA 2V3PA 3QXQA 2FUZA 3Q75B 1DCEB 4WU0A 1KREA 2FUTA 3LZ9A 2ZZRA 1FP3A 3E32B 5CZLA 4ZH5A 2BB5A 1X1HA 1AGMA 3RJ3A 3HXCB 1G6IA 5MEHA 1O6RA 4BOKA 1KZPB 2OKXA 3M01A 1EGUA 3E7JA 1FAEA 1QBQB 3W7UA 4ZH1A 2H6HB 4Q88A 1FPPB 1UG9A 2BBCA 2EABA 4Z4JA 3NFVA 4KKIA 1WU6A 4GTVB 5DGRA 4AYRA 5GZKA 4M76A 2V8KA 3QSPA 2FBAA 1X1JA 1L1YA 3X17A 4J5TA 2GZ6A 5FO7B 3VXDA 3AFLA 1G87A 2B39A 5ILJA 3PMMA 1N22A 3HXDB 4WVCA 1OJNA 3S4CA 4L6XA 2GOXA 1RWAA 4WVAA 3EU5B 2WIIB 1OJMA 4YCRA 3H3KA 2ZISB 1FO2A 4CJ1A
chains in the Genus database with same CATH topology
3M75A 4BOJA 1X9DA 1G9GA 3SDQA 4AYOA 2EAEA 3W5NA 2DROA 3GZKA 2FV0A 1N4SB 2GH4A 1GHQA 4V1RA 3QXFA 2JJBA 2AHFA 3RENA 1CLCA 1O1SB 3ACSA 3E73A 3DSTB 2D5JA 4GTRB 4FXGB 3K7XA 1O6QA 1GA2A 1WU5A 2XWBB 1F9OA 1V5CA 2G0DA 1LF9A 1KWFA 1QQFA 3PZ4B 1N9AB 2NVPA 3E6UA 3WIRA 1TNUB 1GAIA 2JG0A 3WKIA 5CA3A 2H6FB 3RX5A 2PN5A 2VN7A 3SDVA 1AYXA 1UMPA 3GT5A 2WYNA 1W6KA 3ANIA 2IEJB 1FBWA 1H54A 3RRSA 5FOBB 2Z07A 3CU7A 1KSCA 1NL4B 1KZOB 1TN8B 3S4DA 1NC5A 1V5DA 3PZ1B 4ONTA 5KKBA 4GTQB 1LF6A 4ZRPA 1HZFA 3T33A 2BEDB 4D4AA 3E33B 1V7WA 3SAEA 1H3BA 3OXUA 3SDTA 3DSSB 1D8DB 4YDOB 4LNGB 1NI1B 1F9DA 2WINB 3PZ3B 5CD2A 3M7CA 1O1TB 3RSYA 3PYBA 1L2AA 3W7TA 3WC3A 3SFYB 2ZBLA 3W7XA 1N4PB 3SQCA 5FO8B 1KKTA 4D94A 4DOEA 2B4FA 1V7XA 3DSUB 4GTMB 4KTRA 4TXTA 1IA7A 2A73B 1FT1B 2RI9A 1LTXB 3HXFB 3QT3A 1MZCB 4TF4A 1N94B 4JJJA 4D4BA 1FO3A 2XFGA 4L9PB 5M7IA 2XWJB 3M7BA 1S63B 4EL8A 5AGDA 1SA5B 2NOJA 2VN4A 3SDUA 1N4QB 1G9JA 1KS8A 3P2CA 1GSZA 2BB6A 4YDEB 2I07B 1JCRB 3E30B 1R76A 4GTSB 1S64B 1H39A 2PMVA 3QRYA 4Z4LA 2JF4A 2G02A 3DSXB 1LD7B 1FMIA 3KSQB 3ANJA 1W6JA 1K72A 2FV1A 5DGQA 3RX8A 1SA4B 1IS9A 2V3NA 4QT9A 5GY3A 2ZIRB 1RQ5A 4XUVA 3D5SA 3QFYA 3WIQA 3H7LA 3EU8A 1GLMA 4MU9A 3VW5A 1C3DA 1TN7B 2DRRA 5FO9B 4D4DA 3SFXB 3Q78B 2H6IB 1TNBB 2R2LB 3E34B 3Q73B 1N95B 1TNYB 1H3AA 3W7WA 3Q79B 4CE7A 5E2JA 3D5RA 3M7LA 3S9VA 3QWTA 2V8JA 2CQTA 1UT9A 2DRSA 3KQ4A 3DSWB 4C1SA 4AYPA 5JPMB 3P5PA 3Q7FB 3WKHA 1O6HA 3P5RA 1FBOA 2F6DA 3HXEB 4ZG8A 2QNOA 4FUSA 3W5MA 1XWTA 1KRFA 3DPYB 4KTPA 3SDRA 1WZZA 1D8EB 3M72A 2P0VA 3QPFA 1NXCA 4GL3A 3ON6A 2F0YB 1TNOB 4GTTB 1DL2A 2SQCA 1CEMA 3S4AA 1GXOA 1H13A 4FXKB 1H37A 2A8ZA 2DRQA 3M74A 3WUXA 3GLYA 1ULVA 4DODA 3QFZA 4D4CA 3QG0A 4V1SA 3KSLB 2AFAA 1DOGA 3ACTA 2EADA 3EZ8A 3QT9A 3CIHA 3E37B 1SQCA 1V7VA 2D8LA 3K11A 1JCQB 3G6JB 2V8IA 4LIXA 1TF4A 1FCEA 1H36A 3QDEA 1H12A 1O1RB 4CJ0A 3HXBB 1GXMA 2XQWA 3M7EA 4ZRQA 3M77A 3W7SA 2RI8A 4LNVA 5M7YA 3C72B 4WVBA 1H14A 1H3CA 1QSJA 4EHMB 3TF4A 1O5MB 2AHGA 3M73A 1X81B 1XW2A 2H6GB 2WY8A 3M76A 2YIKA 3S4BA 4MBGB 1KFGA 1N4RB 3WIWA 4L0GA 3KLSA 1IA6A 1GAHA 1O79A 2EACA 1GXNA 1WU4A 3WKFA 3EUVB 1KSDA 3OEDA 4LNBB 1TN6B 1JS4A 4AYQA 2WY7A 1JCSB 3DSVB 3EQAA 3M78A 1HCUA 3PYAA 1FT2B 2CQSA 3A3VA 3PZ2B 4GTPB 1TNZB 1VD5A 3H2WA 4GTOB 1H35A 3M71A 1XWQA 4KKJA 3DRAB 4Q2BA 3AFJA 3Q7AB 5GW7A 3D3IA 5JPNB 1LD8B 3RX7A 2RGKA 3ANKA 3WKGA 2V3PA 3QXQA 2FUZA 3Q75B 1DCEB 4WU0A 1KREA 1FP3A 2ZZRA 3E32B 5CZLA 4ZH5A 2BB5A 1AGMA 3RJ3A 3HXCB 1G6IA 5MEHA 1O6RA 4BOKA 1KZPB 2OKXA 1FAEA 1QBQB 3W7UA 4ZH1A 2H6HB 4Q88A 1FPPB 1UG9A 2BBCA 2EABA 4Z4JA 4KKIA 1WU6A 4GTVB 5DGRA 4AYRA 5GZKA 4M76A 2V8KA 3QSPA 2FBAA 1L1YA 3X17A 4J5TA 2GZ6A 5FO7B 3VXDA 1G87A 2B39A 3PMMA 3HXDB 4WVCA 3S4CA 4L6XA 2GOXA 4WVAA 3EU5B 2WIIB 4YCRA 3H3KA 2ZISB 1FO2A 4CJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JS4 A;  4AYQ A;  2ZBL A;  1X9D A;  1G9G A;  4AYO A;  2EAE A;  3EQA A;  3W7X A;  1FBO A;  2DRO A;  2F6D A;  3W5N A;  3GZK A;  2FV0 A;  2GH4 A;  4ZG8 A;  1HCU A;  3QXF A;  2JJB A;  2CQS A;  2QNO A;  2AHF A;  3A3V A;  4FUS A;  3REN A;  3W5M A;  1KKT A;  1CLC A;  1XWT A;  1KRF A;  3ACS A;  4DOE A;  2B4F A;  3E73 A;  4KTP A;  1V7X A;  3H2W A;  1VD5 A;  4KTR A;  4TXT A;  1WZZ A;  2D5J A;  1IA7 A;  2RI9 A;  3QT3 A;  1XWQ A;  1GA2 A;  2P0V A;  4TF4 A;  1WU5 A;  3QPF A;  4JJJ A;  4Q2B A;  3AFJ A;  1F9O A;  1NXC A;  1V5C A;  3ON6 A;  1FO3 A;  2XFG A;  5GW7 A;  5M7I A;  3D3I A;  1LF9 A;  4EL8 A;  1DL2 A;  1KWF A;  1CEM A;  3S4A A;  3RX7 A;  2RGK A;  3ANK A;  3WKG A;  1H13 A;  2VN4 A;  3QXQ A;  2NVP A;  2FUZ A;  1G9J A;  1KS8 A;  3E6U A;  3P2C A;  3WIR A;  4WU0 A;  1KRE A;  1FP3 A;  2ZZR A;  1GAI A;  2A8Z A;  2DRQ A;  2JG0 A;  3WKI A;  3WUX A;  5CA3 A;  3GLY A;  5CZL A;  4ZH5 A;  1ULV A;  4DOD A;  3RX5 A;  3QFZ A;  3QG0 A;  2VN7 A;  1AGM A;  1AYX A;  2AFA A;  3QRY A;  4Z4L A;  3GT5 A;  1G6I A;  1DOG A;  2WYN A;  2JF4 A;  3ACT A;  2EAD A;  5MEH A;  3EZ8 A;  3QT9 A;  3W7T A;  3ANI A;  1FMI A;  3CIH A;  2OKX A;  1V7V A;  3ANJ A;  2D8L A;  3K11 A;  1FAE A;  1FBW A;  1K72 A;  2FV1 A;  5DGQ A;  1H54 A;  3RX8 A;  3RRS A;  1IS9 A;  1TF4 A;  3W7U A;  1FCE A;  5GY3 A;  4Q88 A;  1UG9 A;  3QDE A;  1RQ5 A;  4XUV A;  1L2A A;  2EAB A;  1H12 A;  4Z4J A;  2Z07 A;  1KSC A;  3QFY A;  3WIQ A;  3H7L A;  1WU6 A;  4CJ0 A;  1GLM A;  3S4D A;  5DGR A;  3VW5 A;  4AYR A;  1NC5 A;  1V5D A;  3W7S A;  3QSP A;  2RI8 A;  5KKB A;  2DRR A;  1LF6 A;  2FBA A;  1L1Y A;  3X17 A;  5M7Y A;  4J5T A;  3T33 A;  2GZ6 A;  3VXD A;  4WVB A;  1H14 A;  1V7W A;  1G87 A;  3TF4 A;  3PMM A;  2AHG A;  3W7W A;  4CE7 A;  4WVC A;  1XW2 A;  5E2J A;  3S4C A;  3QWT A;  4L6X A;  4WVA A;  2CQT A;  1F9D A;  1UT9 A;  2YIK A;  3S4B A;  1KFG A;  2DRS A;  3WIW A;  4L0G A;  5CD2 A;  3H3K A;  1IA6 A;  1GAH A;  4AYP A;  3RSY A;  2EAC A;  1FO2 A;  3WKH A;  4CJ1 A;  1WU4 A;  3WKF A;  1KSD A;  3WC3 A; 
#chains in the Genus database with same CATH topology
 3M75 A;  2WCO A;  4BOJ A;  1X9D A;  1G9G A;  3SDQ A;  4AYO A;  2EAE A;  3W5N A;  2DRO A;  3GZK A;  2FV0 A;  1N4S B;  2GH4 A;  1GHQ A;  2ONH A;  4V1R A;  3QXF A;  2JJB A;  2AHF A;  2WDA A;  3REN A;  1N20 A;  1CLC A;  1N23 A;  1O1S B;  3ACS A;  3M02 A;  3E73 A;  3DST B;  5ILH A;  1N7N A;  2D5J A;  4GTR B;  1HXC A;  4FXG B;  3K7X A;  1O6Q A;  1GA2 A;  4NEI A;  1WU5 A;  2XWB B;  1F9O A;  1V5C A;  1OJO A;  5JMD A;  2G0D A;  1LF9 A;  2E24 A;  4OK2 A;  1KWF A;  1QQF A;  3PZ4 B;  1N9A B;  2NVP A;  5EAU A;  3E6U A;  3WIR A;  1TNU B;  2BRP A;  1GAI A;  2JG0 A;  3WKI A;  1N7O A;  5CA3 A;  1N7R A;  1N1Z A;  3G4F A;  2H6F B;  1HM2 A;  3RX5 A;  4F10 A;  4FNV A;  2PN5 A;  2VN7 A;  3SDV A;  1AYX A;  1UMP A;  3GT5 A;  2WYN A;  1W6K A;  3ANI A;  5ILY A;  2IEJ B;  1FBW A;  1H54 A;  3RRS A;  5FOB B;  2FUQ A;  1J0N A;  1N7Q A;  2Z07 A;  3CU7 A;  1KSC A;  1NL4 B;  1KZO B;  1TN8 B;  3S4D A;  1NC5 A;  1V5D A;  3PZ1 B;  1HXA A;  4ONT A;  5KKB A;  4GTQ B;  1LF6 A;  4ZRP A;  4MMH A;  1RWC A;  5IK9 A;  1HZF A;  3T33 A;  2BED B;  4D4A A;  1RWH A;  3E33 B;  1V7W A;  3SAE A;  1H3B A;  3OXU A;  4OK4 A;  3SDT A;  3DSS B;  1D8D B;  4YDO B;  3A0O A;  4LNG B;  1NI1 B;  1F9D A;  2WIN B;  3PZ3 B;  5CD2 A;  3M7C A;  5JMF A;  1O1T B;  3RSY A;  3PYB A;  5EAT A;  5ILI A;  1L2A A;  3W7T A;  3WC3 A;  3SFY B;  2ZBL A;  3W7X A;  1N4P B;  3SQC A;  2E22 A;  5FO8 B;  1LOH A;  1KKT A;  4D94 A;  4DOE A;  2B4F A;  3VSN A;  1V7X A;  3DSU B;  4GTM B;  4KTR A;  4TXT A;  1IA7 A;  2A73 B;  1FT1 B;  2RI9 A;  1LTX B;  3HXF B;  3QT3 A;  1MZC B;  4TF4 A;  1N94 B;  1X1I A;  4JJJ A;  4D4B A;  1FO3 A;  2XFG A;  4L9P B;  5M7I A;  2XWJ B;  3M7B A;  1S63 B;  4EL8 A;  1OJP A;  1CB8 A;  5AGD A;  1SA5 B;  2NOJ A;  2VN4 A;  3M00 A;  3SDU A;  1N4Q B;  1G9J A;  1RW9 A;  1KS8 A;  3P2C A;  1GSZ A;  2BB6 A;  4YDE B;  4RNQ A;  2I07 B;  1HMW A;  1JCR B;  3E30 B;  1R76 A;  4GTS B;  1S64 B;  1H39 A;  2PMV A;  3QRY A;  4Z4L A;  2JF4 A;  2G02 A;  3DSX B;  1LD7 B;  1FMI A;  3KSQ B;  4OZV A;  5EAS A;  3ANJ A;  1W6J A;  1K72 A;  2FV1 A;  3G4D A;  5DGQ A;  3RX8 A;  1HV6 A;  1SA4 B;  1IS9 A;  2V3N A;  4QT9 A;  4F13 A;  5GY3 A;  2ZIR B;  1RQ5 A;  4XUV A;  3D5S A;  3QFY A;  3WIQ A;  3H7L A;  3EU8 A;  1GLM A;  4MU9 A;  1HMU A;  3VW5 A;  1C3D A;  5IL8 A;  4FJQ A;  2J5C A;  1TN7 B;  5DHK A;  2DRR A;  5FO9 B;  4D4D A;  3SFX B;  3Q78 B;  2H6I B;  1TNB B;  2R2L B;  3E34 B;  3Q73 B;  1N95 B;  1TNY B;  1H3A A;  3W7W A;  3Q79 B;  4CE7 A;  5E2J A;  3D5R A;  3M7L A;  3S9V A;  3QWT A;  2V8J A;  1F1S A;  2CQT A;  1F9G A;  1UT9 A;  2DRS A;  3KQ4 A;  3DSW B;  4C1S A;  4AYP A;  5JPM B;  3P5P A;  5C05 A;  3Q7F B;  3WKH A;  4E1Y A;  1N24 A;  3VSM A;  1O6H A;  5IKA A;  3NNB A;  1N1B A;  3P5R A;  1J0M A;  1FBO A;  2F6D A;  3HXE B;  4ZG8 A;  2QNO A;  4FUS A;  3W5M A;  1XWT A;  1KRF A;  5IM1 A;  3DPY B;  4KTP A;  3SDR A;  3N0F A;  1LXM A;  1WZZ A;  1D8E B;  3M72 A;  2P0V A;  3QPF A;  1HX9 A;  1NXC A;  3ON6 A;  4GL3 A;  4DI5 A;  1LXK A;  2F0Y B;  1TNO B;  2BRW A;  4GTT B;  1DL2 A;  2SQC A;  1CEM A;  3S4A A;  1GXO A;  1H13 A;  4FXK B;  1W3Y A;  1H37 A;  1QAZ A;  2A8Z A;  2DRQ A;  2Q1F A;  3M74 A;  3WUX A;  3GLY A;  1ULV A;  4DOD A;  3QFZ A;  4D4C A;  3QG0 A;  4V1S A;  3KSL B;  2AFA A;  1DOG A;  3ACT A;  2EAD A;  1RWF A;  3EZ8 A;  3QT9 A;  3CIH A;  3E37 B;  5ILD A;  1SQC A;  1N7P A;  1V7V A;  2D8L A;  3K11 A;  1JCQ B;  2X03 A;  3G6J B;  5IKH A;  2V8I A;  4LIX A;  1TF4 A;  1FCE A;  1H36 A;  1HXG A;  3QDE A;  1H12 A;  1O1R B;  4CJ0 A;  3HXB B;  1GXM A;  2XQW A;  5IK0 A;  3M7E A;  4ZRQ A;  3M77 A;  3W7S A;  2RI8 A;  4LNV A;  5ILK A;  5M7Y A;  4MMI A;  3C72 B;  4WVB A;  1H14 A;  1H3C A;  1QSJ A;  5DHI A;  4EHM B;  3TF4 A;  1O5M B;  2AHG A;  3M73 A;  1X81 B;  1XW2 A;  3E80 A;  1RWG A;  2H6G B;  2WY8 A;  2ONG A;  3M76 A;  2YIK A;  3S4B A;  4MBG B;  1KFG A;  1N4R B;  3WIW A;  4L0G A;  3KLS A;  1IA6 A;  1GAH A;  1O79 A;  2EAC A;  1C82 A;  1HN0 A;  2BRV X;  1GXN A;  1WU4 A;  3WKF A;  3EUV B;  1KSD A;  3OED A;  4LNB B;  5ILZ A;  1TN6 B;  1JS4 A;  4AYQ A;  4OJZ A;  4OZW A;  5IL3 A;  2WY7 A;  1JCS B;  3DSV B;  3EQA A;  3M78 A;  1HCU A;  3PYA A;  1FT2 B;  2CQS A;  3A3V A;  1HM3 A;  3PZ2 B;  4GTP B;  1TNZ B;  1VD5 A;  3H2W A;  1N21 A;  5IK6 A;  4GTO B;  1H35 A;  3M71 A;  4GAX A;  1XWQ A;  4KKJ A;  3N0G A;  3DRA B;  4Q2B A;  3AFJ A;  1I8Q A;  3Q7A B;  5GW7 A;  3D3I A;  5JPN B;  1LD8 B;  3RX7 A;  2RGK A;  3ANK A;  3WKG A;  2V3P A;  3QXQ A;  2FUZ A;  3Q75 B;  1DCE B;  4WU0 A;  1KRE A;  2FUT A;  3LZ9 A;  2ZZR A;  1FP3 A;  3E32 B;  5CZL A;  4ZH5 A;  2BB5 A;  1X1H A;  1AGM A;  3RJ3 A;  3HXC B;  1G6I A;  5MEH A;  1O6R A;  4BOK A;  1KZP B;  2OKX A;  3M01 A;  1EGU A;  3E7J A;  1FAE A;  1QBQ B;  3W7U A;  4ZH1 A;  2H6H B;  4Q88 A;  1FPP B;  1UG9 A;  2BBC A;  2EAB A;  4Z4J A;  3NFV A;  4KKI A;  1WU6 A;  4GTV B;  5DGR A;  4AYR A;  5GZK A;  4M76 A;  2V8K A;  3QSP A;  2FBA A;  1X1J A;  1L1Y A;  3X17 A;  4J5T A;  2GZ6 A;  5FO7 B;  3VXD A;  3AFL A;  1G87 A;  2B39 A;  5ILJ A;  3PMM A;  1N22 A;  3HXD B;  4WVC A;  1OJN A;  3S4C A;  4L6X A;  2GOX A;  1RWA A;  4WVA A;  3EU5 B;  2WII B;  1OJM A;  4YCR A;  3H3K A;  2ZIS B;  1FO2 A;  4CJ1 A; 
#chains in the Genus database with same CATH homology
 3M75 A;  4BOJ A;  1X9D A;  1G9G A;  3SDQ A;  4AYO A;  2EAE A;  3W5N A;  2DRO A;  3GZK A;  2FV0 A;  1N4S B;  2GH4 A;  1GHQ A;  4V1R A;  3QXF A;  2JJB A;  2AHF A;  3REN A;  1CLC A;  1O1S B;  3ACS A;  3E73 A;  3DST B;  2D5J A;  4GTR B;  4FXG B;  3K7X A;  1O6Q A;  1GA2 A;  1WU5 A;  2XWB B;  1F9O A;  1V5C A;  2G0D A;  1LF9 A;  1KWF A;  1QQF A;  3PZ4 B;  1N9A B;  2NVP A;  3E6U A;  3WIR A;  1TNU B;  1GAI A;  2JG0 A;  3WKI A;  5CA3 A;  2H6F B;  3RX5 A;  2PN5 A;  2VN7 A;  3SDV A;  1AYX A;  1UMP A;  3GT5 A;  2WYN A;  1W6K A;  3ANI A;  2IEJ B;  1FBW A;  1H54 A;  3RRS A;  5FOB B;  2Z07 A;  3CU7 A;  1KSC A;  1NL4 B;  1KZO B;  1TN8 B;  3S4D A;  1NC5 A;  1V5D A;  3PZ1 B;  4ONT A;  5KKB A;  4GTQ B;  1LF6 A;  4ZRP A;  1HZF A;  3T33 A;  2BED B;  4D4A A;  3E33 B;  1V7W A;  3SAE A;  1H3B A;  3OXU A;  3SDT A;  3DSS B;  1D8D B;  4YDO B;  4LNG B;  1NI1 B;  1F9D A;  2WIN B;  3PZ3 B;  5CD2 A;  3M7C A;  1O1T B;  3RSY A;  3PYB A;  1L2A A;  3W7T A;  3WC3 A;  3SFY B;  2ZBL A;  3W7X A;  1N4P B;  3SQC A;  5FO8 B;  1KKT A;  4D94 A;  4DOE A;  2B4F A;  1V7X A;  3DSU B;  4GTM B;  4KTR A;  4TXT A;  1IA7 A;  2A73 B;  1FT1 B;  2RI9 A;  1LTX B;  3HXF B;  3QT3 A;  1MZC B;  4TF4 A;  1N94 B;  4JJJ A;  4D4B A;  1FO3 A;  2XFG A;  4L9P B;  5M7I A;  2XWJ B;  3M7B A;  1S63 B;  4EL8 A;  5AGD A;  1SA5 B;  2NOJ A;  2VN4 A;  3SDU A;  1N4Q B;  1G9J A;  1KS8 A;  3P2C A;  1GSZ A;  2BB6 A;  4YDE B;  2I07 B;  1JCR B;  3E30 B;  1R76 A;  4GTS B;  1S64 B;  1H39 A;  2PMV A;  3QRY A;  4Z4L A;  2JF4 A;  2G02 A;  3DSX B;  1LD7 B;  1FMI A;  3KSQ B;  3ANJ A;  1W6J A;  1K72 A;  2FV1 A;  5DGQ A;  3RX8 A;  1SA4 B;  1IS9 A;  2V3N A;  4QT9 A;  5GY3 A;  2ZIR B;  1RQ5 A;  4XUV A;  3D5S A;  3QFY A;  3WIQ A;  3H7L A;  3EU8 A;  1GLM A;  4MU9 A;  3VW5 A;  1C3D A;  1TN7 B;  2DRR A;  5FO9 B;  4D4D A;  3SFX B;  3Q78 B;  2H6I B;  1TNB B;  2R2L B;  3E34 B;  3Q73 B;  1N95 B;  1TNY B;  1H3A A;  3W7W A;  3Q79 B;  4CE7 A;  5E2J A;  3D5R A;  3M7L A;  3S9V A;  3QWT A;  2V8J A;  2CQT A;  1UT9 A;  2DRS A;  3KQ4 A;  3DSW B;  4C1S A;  4AYP A;  5JPM B;  3P5P A;  3Q7F B;  3WKH A;  1O6H A;  3P5R A;  1FBO A;  2F6D A;  3HXE B;  4ZG8 A;  2QNO A;  4FUS A;  3W5M A;  1XWT A;  1KRF A;  3DPY B;  4KTP A;  3SDR A;  1WZZ A;  1D8E B;  3M72 A;  2P0V A;  3QPF A;  1NXC A;  4GL3 A;  3ON6 A;  2F0Y B;  1TNO B;  4GTT B;  1DL2 A;  2SQC A;  1CEM A;  3S4A A;  1GXO A;  1H13 A;  4FXK B;  1H37 A;  2A8Z A;  2DRQ A;  3M74 A;  3WUX A;  3GLY A;  1ULV A;  4DOD A;  3QFZ A;  4D4C A;  3QG0 A;  4V1S A;  3KSL B;  2AFA A;  1DOG A;  3ACT A;  2EAD A;  3EZ8 A;  3QT9 A;  3CIH A;  3E37 B;  1SQC A;  1V7V A;  2D8L A;  3K11 A;  1JCQ B;  3G6J B;  2V8I A;  4LIX A;  1TF4 A;  1FCE A;  1H36 A;  3QDE A;  1H12 A;  1O1R B;  4CJ0 A;  3HXB B;  1GXM A;  2XQW A;  3M7E A;  4ZRQ A;  3M77 A;  3W7S A;  2RI8 A;  4LNV A;  5M7Y A;  3C72 B;  4WVB A;  1H14 A;  1H3C A;  1QSJ A;  4EHM B;  3TF4 A;  1O5M B;  2AHG A;  3M73 A;  1X81 B;  1XW2 A;  2H6G B;  2WY8 A;  3M76 A;  2YIK A;  3S4B A;  4MBG B;  1KFG A;  1N4R B;  3WIW A;  4L0G A;  3KLS A;  1IA6 A;  1GAH A;  1O79 A;  2EAC A;  1GXN A;  1WU4 A;  3WKF A;  3EUV B;  1KSD A;  3OED A;  4LNB B;  1TN6 B;  1JS4 A;  4AYQ A;  2WY7 A;  1JCS B;  3DSV B;  3EQA A;  3M78 A;  1HCU A;  3PYA A;  1FT2 B;  2CQS A;  3A3V A;  3PZ2 B;  4GTP B;  1TNZ B;  1VD5 A;  3H2W A;  4GTO B;  1H35 A;  3M71 A;  1XWQ A;  4KKJ A;  3DRA B;  4Q2B A;  3AFJ A;  3Q7A B;  5GW7 A;  3D3I A;  5JPN B;  1LD8 B;  3RX7 A;  2RGK A;  3ANK A;  3WKG A;  2V3P A;  3QXQ A;  2FUZ A;  3Q75 B;  1DCE B;  4WU0 A;  1KRE A;  1FP3 A;  2ZZR A;  3E32 B;  5CZL A;  4ZH5 A;  2BB5 A;  1AGM A;  3RJ3 A;  3HXC B;  1G6I A;  5MEH A;  1O6R A;  4BOK A;  1KZP B;  2OKX A;  1FAE A;  1QBQ B;  3W7U A;  4ZH1 A;  2H6H B;  4Q88 A;  1FPP B;  1UG9 A;  2BBC A;  2EAB A;  4Z4J A;  4KKI A;  1WU6 A;  4GTV B;  5DGR A;  4AYR A;  5GZK A;  4M76 A;  2V8K A;  3QSP A;  2FBA A;  1L1Y A;  3X17 A;  4J5T A;  2GZ6 A;  5FO7 B;  3VXD A;  1G87 A;  2B39 A;  3PMM A;  3HXD B;  4WVC A;  3S4C A;  4L6X A;  2GOX A;  4WVA A;  3EU5 B;  2WII B;  4YCR A;  3H3K A;  2ZIS B;  1FO2 A;  4CJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...