3C72B

Engineered rabggtase in complex with a peptidomimetic inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
324
Chain Sequence
DVTIKSDAPDTLLLEKHADYIASYGSKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of selective RabGGTase inhibitors and crystal structure of a RabGGTase-inhibitor complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 324
sequence length 325
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3c72B00
1TN7B 1W6KA 2H6IB 2G02A 2V3PA 3K7XA 3PZ4B 2V8IA 1H36A 3D5SA 4YDEB 1H35A 1QBQB 4LNVA 2XWJB 1GXNA 1GXMA 1S63B 4LNBB 1N4RB 3OEDA 4GTSB 1N94B 3HXDB 3DPYB 3PZ1B 2F0YB 1O1TB 1H3BA 3E32B 1SA5B 3KSLB 1D8DB 1UMPA 4D4CA 2BEDB 1JCSB 2V3NA 5FOBB 1GXOA 3HXEB 1H37A 3DRAB 1GSZA 1NI1B 2G0DA 3E33B 4KKIA 2WIIB 3OXUA 1N95B 1TN6B 2SQCA 3D5RA 1QSJA 3HXFB 1O1SB 3SQCA 3DSSB 3DSVB 3E37B 3C72B 4MBGB 2PN5A 4GTRB 1JCQB 1SA4B 3HXBB 3KSQB 1LD8B 3G6JB 4C1SA 4ZH1A 1TNUB 2WY8A 1C3DA 5FO9B 1D8EB 3SFYB 3DSXB 3CU7A 3DSTB 2H6HB 1H39A 4FXKB 4GTVB 2V8JA 4L9PB 1S64B 2XQWA 3Q75B 2XWBB 4EHMB 3E34B 3EU5B 3RJ3A 2H6GB 2NOJA 2R2LB 2A73B 1MZCB 5JPMB 1H3AA 2H6FB 4KKJA 3E30B 2IEJB 1O6QA 1O1RB 1FPPB 1N4QB 1LTXB 1O6HA 3Q78B 4GTPB 2B39A 1HZFA 2ZISB 4LNGB 3DSUB 3PZ3B 4GTTB 2BB6A 1SQCA 3HXCB 3SFXB 1KZOB 4D4AA 2BBCA 4D4DA 2I07B 1N4SB 4M76A 1FT2B 1KZPB 1O5MB 3DSWB 1X81B 4D4BA 2V8KA 2ZIRB 4MU9A 1DCEB 3EUVB 4BOJA 3Q79B 4D94A 5AGDA 5JPNB 1TNOB 4GTMB 2WY7A 3KLSA 1N4PB 2GOXA 1TN8B 1N9AB 4GTQB 1R76A 4ZRQA 5FO8B 4ONTA 1JCRB 1TNYB 4V1SA 1W6JA 4BOKA 2PMVA 1O6RA 1NL4B 2WINB 1H3CA 4ZRPA 1GHQA 1QQFA 3Q7FB 1TNZB 3PZ2B 3Q73B 4FXGB 4YDOB 5FO7B 4GTOB 3KQ4A 1FT1B 1LD7B 3Q7AB 4V1RA 1O79A 1TNBB 2BB5A
chains in the Genus database with same CATH superfamily
2H6IB 4J5TA 1L2AA 4F10A 5KKBA 2JJBA 2NVPA 5ILKA 2V8IA 1H36A 4YDEB 1N7NA 3M78A 4WVCA 4LNBB 3WKFA 1K72A 4DOEA 1LF6A 2B4FA 3DPYB 5ILZA 1SA5B 1AGMA 2DRSA 4GL3A 2V3NA 3HXEB 5ILJA 4FJQA 1NI1B 4MMIA 2G0DA 2EACA 2EABA 5IKHA 3NNBA 3S9VA 1V7XA 5CZLA 4F13A 3OXUA 1N7PA 3QSPA 2SQCA 1QSJA 1AYXA 3SDVA 4JJJA 4OZWA 1JCQB 3SDRA 3H7LA 3P5PA 2XFGA 3KSQB 1I8QA 2RGKA 1IA6A 2VN4A 2D5JA 3PYBA 4FXKB 1KRFA 3M7EA 4L9PB 1XWQA 3AFLA 5CD2A 1KS8A 2FUZA 3Q75B 3RJ3A 2H6GB 2NOJA 2R2LB 1FMIA 4OK2A 2H6FB 4KTRA 3E30B 1O6QA 1FP3A 1O6HA 3Q78B 1GA2A 1XW2A 3QXQA 1WU5A 3M02A 1F9OA 4GTTB 1H12A 2VN7A 3HXCB 5EASA 1KZOB 3ANIA 2A8ZA 3WUXA 3NFVA 2Q1FA 1GLMA 4D4DA 2I07B 3CIHA 2FV1A 1RWAA 3ON6A 3VXDA 3GT5A 4OZVA 4TF4A 5JPNB 1F1SA 1LOHA 3A3VA 4GTMB 4CJ0A 2WY7A 5ILYA 1N4PB 2GH4A 3RX5A 5MEHA 4GTQB 1R76A 4ZRQA 1UT9A 4ONTA 3M01A 1JCRB 4V1SA 4BOKA 3RSYA 1O6RA 1H3CA 1QQFA 1LF9A 1LXKA 3AFJA 3G4DA 5DGRA 1FT1B 1DOGA 1HV6A 1TNBB 2BB5A 1W6KA 2G02A 2ONGA 3PYAA 1H35A 1KKTA 4LNVA 2DRQA 2XWJB 3H3KA 1GXMA 1S63B 1V5DA 1N94B 1O1TB 2P0VA 1D8DB 1UMPA 1VD5A 1N22A 4AYRA 1N24A 2DRRA 3WKIA 3K11A 1X1JA 3DSVB 5ILHA 1N20A 4NEIA 3QT3A 4MBGB 1W3YA 2AFAA 1WZZA 4C1SA 3H2WA 4QT9A 5FO9B 1GAHA 1RWHA 1D8EB 3DSXB 1HMUA 3DSTB 2H6HB 1H39A 2WYNA 2V8JA 3SDTA 1EGUA 5CA3A 3A0OA 1HM3A 3QPFA 1H13A 3W7XA 1MZCB 3QFZA 3RRSA 1J0MA 3RX7A 3M00A 1FPPB 1N4QB 1JS4A 5DHKA 3VSMA 2FBAA 2RI9A 4GTPB 3W5NA 2B39A 3S4DA 1KSCA 1HZFA 3M77A 3RX8A 3DSUB 1N7QA 4LIXA 3SAEA 1H54A 5DGQA 3M7CA 3M71A 2BRVX 5IK9A 1RWFA 1RQ5A 2V8KA 2ZIRB 2WCOA 3W7WA 2RI8A 1DCEB 3EUVB 4BOJA 3Q79B 4D94A 3G4FA 3KLSA 2GOXA 3EQAA 1W6JA 1V7WA 1G6IA 2JG0A 2WINB 3S4CA 3Q7FB 3M73A 4AYQA 3ANJA 3M75A 1IS9A 3Q73B 3QRYA 2X03A 2OKXA 4FXGB 5FO7B 3KQ4A 4V1RA 4WVAA 1QAZA 1O79A 1WU4A 3T33A 1TN7B 5DHIA 2V3PA 3WC3A 1TF4A 3K7XA 3N0GA 3PZ4B 3W7UA 5M7IA 4AYOA 1RWCA 1GXNA 3E73A 1HXGA 4GTSB 2E22A 2GZ6A 3PZ1B 2F0YB 3KSLB 1H3BA 3M72A 3QFYA 4DODA 1C82A 3LZ9A 1FO2A 5M7YA 2BEDB 1JCSB 3M74A 5FOBB 1GXOA 1H37A 3N0FA 3DRAB 1GSZA 4CE7A 2EAEA 3S4BA 3QT9A 4ZG8A 2WIIB 1TN6B 3D5RA 4Z4JA 1OJOA 3WIRA 2ONHA 4Q88A 3E7JA 3SQCA 3DSSB 3E37B 3C72B 4CJ1A 1UG9A 5E2JA 1X9DA 1OJMA 1SA4B 3HXBB 3G6JB 1FO3A 1TNUB 2E24A 3EU8A 5JMDA 2AHGA 2WY8A 1C3DA 1HMWA 1X1HA 5GZKA 2AHFA 3CU7A 4GTVB 3M76A 1N7OA 1KSDA 3GZKA 1J0NA 4TXTA 4EHMB 3E34B 1XWTA 5JPMB 5IKAA 1H3AA 5IM1A 2IEJB 1O1RB 1NXCA 2FV0A 3E6UA 3RENA 2CQSA 4EL8A 2Z07A 1V7VA 5IL3A 1LXMA 2BB6A 3WKGA 1SQCA 1G9GA 4D4AA 5EAUA 1OJNA 2BBCA 1F9DA 1FBOA 4AYPA 1N23A 1N4SB 3M7BA 1KFGA 4M76A 4FNVA 1O5MB 3X17A 1RWGA 3DSWB 3WIWA 1KWFA 3P2CA 4D4BA 3W5MA 4DI5A 3SDUA 3VW5A 1WU6A 1NC5A 2ZBLA 5AGDA 1HXAA 1G9JA 1FCEA 1CB8A 1TN8B 5IL8A 2BRWA 5IK6A 1ULVA 3QXFA 1TNYB 2FUTA 1KREA 1N1BA 1NL4B 3W7SA 4ZRPA 3ANKA 3PZ2B 1L1YA 1FBWA 4YDOB 1HXCA 4OJZA 4WU0A 1IA7A 4OK4A 1N1ZA 2DROA 1HX9A 3GLYA 3D5SA 1QBQB 4GAXA 2ZZRA 1N4RB 3OEDA 5ILDA 3HXDB 4YCRA 4RNQA 3E32B 4D4CA 4MMHA 3WIQA 2CQTA 1GAIA 2WDAA 3E33B 3EZ8A 4KKIA 3TF4A 3QWTA 1N95B 3HXFB 1O1SB 3VSNA 2F6DA 1HM2A 3SDQA 5IK0A 1FAEA 2J5CA 4KTPA 2PN5A 4GTRB 4L0GA 5EATA 1LD8B 4XUVA 4ZH1A 2D8LA 3P5RA 5GW7A 3SFYB 2BRPA 2FUQA 1RW9A 1V5CA 1S64B 2XQWA 4Q2BA 1HN0A 2XWBB 1X1IA 3EU5B 3M7LA 2QNOA 3QDEA 2A73B 4E1YA 4KKJA 1HCUA 1LTXB 1DL2A 1OJPA 3QG0A 2ZISB 4LNGB 1CEMA 3D3IA 3PZ3B 5JMFA 3SFXB 1H14A 2YIKA 3S4AA 1N21A 2EADA 1FT2B 1KZPB 3ACTA 1X81B 4FUSA 4ZH5A 1N7RA 3ACSA 3PMMA 4MU9A 1TNOB 5C05A 5GY3A 3W7TA 1N9AB 3WKHA 4Z4LA 5FO8B 4WVBA 2JF4A 2PMVA 3E80A 1GHQA 1CLCA 1TNZB 5ILIA 4GTOB 1LD7B 3Q7AB 4L6XA 1G87A 1F9GA
chains in the Genus database with same CATH topology
2H6IB 4J5TA 1L2AA 5KKBA 2JJBA 2NVPA 2V8IA 1H36A 4YDEB 3M78A 4WVCA 4LNBB 3WKFA 1K72A 4DOEA 1LF6A 2B4FA 3DPYB 1SA5B 1AGMA 2DRSA 4GL3A 2V3NA 3HXEB 1NI1B 2G0DA 2EACA 2EABA 3S9VA 1V7XA 5CZLA 3OXUA 3QSPA 2SQCA 1QSJA 1AYXA 3SDVA 4JJJA 1JCQB 3SDRA 3H7LA 3P5PA 2XFGA 3KSQB 2RGKA 1IA6A 2VN4A 2D5JA 3PYBA 4FXKB 1KRFA 3M7EA 4L9PB 1XWQA 5CD2A 1KS8A 2FUZA 3Q75B 3RJ3A 2H6GB 2NOJA 2R2LB 1FMIA 2H6FB 4KTRA 3E30B 1O6QA 1FP3A 1O6HA 3Q78B 1GA2A 1XW2A 3QXQA 1WU5A 1F9OA 4GTTB 1H12A 2VN7A 3HXCB 1KZOB 3ANIA 2A8ZA 3WUXA 1GLMA 4D4DA 2I07B 3CIHA 2FV1A 3ON6A 3VXDA 3GT5A 4TF4A 5JPNB 3A3VA 4GTMB 4CJ0A 2WY7A 1N4PB 2GH4A 3RX5A 5MEHA 4GTQB 1R76A 4ZRQA 1UT9A 4ONTA 1JCRB 4V1SA 4BOKA 3RSYA 1O6RA 1H3CA 1QQFA 1LF9A 3AFJA 5DGRA 1FT1B 1DOGA 1TNBB 2BB5A 1W6KA 2G02A 3PYAA 1H35A 1KKTA 4LNVA 2DRQA 2XWJB 3H3KA 1GXMA 1S63B 1V5DA 1N94B 1O1TB 2P0VA 1D8DB 1UMPA 1VD5A 4AYRA 2DRRA 3WKIA 3K11A 3DSVB 3QT3A 4MBGB 2AFAA 1WZZA 4C1SA 3H2WA 4QT9A 5FO9B 1GAHA 1D8EB 3DSXB 3DSTB 2H6HB 1H39A 2WYNA 2V8JA 3SDTA 5CA3A 3QPFA 1H13A 3W7XA 1MZCB 3QFZA 3RRSA 3RX7A 1FPPB 1N4QB 1JS4A 2FBAA 2RI9A 4GTPB 3W5NA 2B39A 3S4DA 1KSCA 1HZFA 1G87A 3M77A 3RX8A 3DSUB 3SAEA 4LIXA 1H54A 5DGQA 3M7CA 3M71A 1RQ5A 2V8KA 2ZIRB 3W7WA 2RI8A 1DCEB 3EUVB 4BOJA 3Q79B 4D94A 3KLSA 2GOXA 3EQAA 1W6JA 1V7WA 1G6IA 2JG0A 2WINB 3S4CA 3Q7FB 3M73A 4AYQA 3ANJA 3M75A 1IS9A 3Q73B 3QRYA 2OKXA 4FXGB 5FO7B 3KQ4A 4V1RA 4WVAA 1O79A 1WU4A 3T33A 1TN7B 3WC3A 2V3PA 1TF4A 3K7XA 3PZ4B 3W7UA 5M7IA 4AYOA 1GXNA 3E73A 4GTSB 2GZ6A 3PZ1B 2F0YB 3KSLB 1H3BA 3M72A 3QFYA 4DODA 1FO2A 5M7YA 2BEDB 1JCSB 3M74A 5FOBB 1GXOA 1H37A 3DRAB 1GSZA 4CE7A 2EAEA 3S4BA 3QT9A 4ZG8A 2WIIB 1TN6B 3D5RA 4Z4JA 3WIRA 4Q88A 3SQCA 3DSSB 3E37B 3C72B 4CJ1A 1UG9A 5E2JA 1X9DA 1SA4B 3HXBB 3G6JB 1FO3A 1TNUB 3EU8A 2AHGA 2WY8A 1C3DA 5GZKA 2AHFA 3CU7A 4GTVB 3M76A 1KSDA 3GZKA 4TXTA 4EHMB 3E34B 1XWTA 5JPMB 1H3AA 2IEJB 1O1RB 1NXCA 2FV0A 3E6UA 3RENA 2CQSA 4EL8A 2Z07A 1V7VA 2BB6A 3WKGA 1SQCA 1G9GA 4D4AA 2BBCA 1F9DA 1FBOA 4AYPA 1N4SB 1KFGA 4M76A 3X17A 1O5MB 3DSWB 3WIWA 1KWFA 3P2CA 4D4BA 3W5MA 3SDUA 3VW5A 1WU6A 1NC5A 2ZBLA 5AGDA 1G9JA 1FCEA 1TN8B 1ULVA 3QXFA 1TNYB 1KREA 1NL4B 3W7SA 4ZRPA 3ANKA 3PZ2B 1L1YA 1FBWA 4YDOB 4WU0A 1IA7A 2DROA 3GLYA 3D5SA 1QBQB 2ZZRA 1N4RB 3OEDA 3HXDB 4YCRA 3E32B 4D4CA 3WIQA 2CQTA 1GAIA 3E33B 3EZ8A 4KKIA 3TF4A 3QWTA 1N95B 3HXFB 1O1SB 2F6DA 3SDQA 1FAEA 4KTPA 2PN5A 4GTRB 4L0GA 1LD8B 4XUVA 4ZH1A 2D8LA 3P5RA 5GW7A 3SFYB 1V5CA 1S64B 2XQWA 4Q2BA 2XWBB 3EU5B 3M7LA 2QNOA 3QDEA 2A73B 4KKJA 1HCUA 1LTXB 1DL2A 3QG0A 2ZISB 4LNGB 1CEMA 3D3IA 3PZ3B 3SFXB 1H14A 2YIKA 3S4AA 2EADA 1FT2B 1KZPB 3ACTA 1X81B 4FUSA 4ZH5A 3ACSA 3PMMA 4MU9A 1TNOB 5GY3A 3W7TA 1N9AB 3WKHA 4Z4LA 5FO8B 4WVBA 2JF4A 2PMVA 1GHQA 1CLCA 1TNZB 4GTOB 1LD7B 3Q7AB 4L6XA 3M7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN7 B;  1W6K A;  2H6I B;  2G02 A;  2V3P A;  3K7X A;  3PZ4 B;  2V8I A;  1H36 A;  3D5S A;  4YDE B;  1H35 A;  1QBQ B;  4LNV A;  2XWJ B;  1GXN A;  1GXM A;  1S63 B;  4LNB B;  1N4R B;  3OED A;  4GTS B;  1N94 B;  3HXD B;  3DPY B;  3PZ1 B;  2F0Y B;  1O1T B;  1H3B A;  3E32 B;  1SA5 B;  3KSL B;  1D8D B;  1UMP A;  4D4C A;  2BED B;  1JCS B;  2V3N A;  5FOB B;  1GXO A;  3HXE B;  1H37 A;  3DRA B;  1GSZ A;  1NI1 B;  2G0D A;  3E33 B;  4KKI A;  2WII B;  3OXU A;  1N95 B;  1TN6 B;  2SQC A;  3D5R A;  1QSJ A;  3HXF B;  1O1S B;  3SQC A;  3DSS B;  3DSV B;  3E37 B;  3C72 B;  4MBG B;  2PN5 A;  4GTR B;  1JCQ B;  1SA4 B;  3HXB B;  3KSQ B;  1LD8 B;  3G6J B;  4C1S A;  4ZH1 A;  1TNU B;  2WY8 A;  1C3D A;  5FO9 B;  1D8E B;  3SFY B;  3DSX B;  3CU7 A;  3DST B;  2H6H B;  1H39 A;  4FXK B;  4GTV B;  2V8J A;  4L9P B;  1S64 B;  2XQW A;  3Q75 B;  2XWB B;  4EHM B;  3E34 B;  3EU5 B;  3RJ3 A;  2H6G B;  2NOJ A;  2R2L B;  2A73 B;  1MZC B;  5JPM B;  1H3A A;  2H6F B;  4KKJ A;  3E30 B;  2IEJ B;  1O6Q A;  1O1R B;  1FPP B;  1N4Q B;  1LTX B;  1O6H A;  3Q78 B;  4GTP B;  2B39 A;  1HZF A;  2ZIS B;  4LNG B;  3DSU B;  3PZ3 B;  4GTT B;  2BB6 A;  1SQC A;  3HXC B;  3SFX B;  1KZO B;  4D4A A;  2BBC A;  4D4D A;  2I07 B;  1N4S B;  4M76 A;  1FT2 B;  1KZP B;  1O5M B;  3DSW B;  1X81 B;  4D4B A;  2V8K A;  2ZIR B;  4MU9 A;  1DCE B;  3EUV B;  4BOJ A;  3Q79 B;  4D94 A;  5AGD A;  5JPN B;  1TNO B;  4GTM B;  2WY7 A;  3KLS A;  1N4P B;  2GOX A;  1TN8 B;  1N9A B;  4GTQ B;  1R76 A;  4ZRQ A;  5FO8 B;  4ONT A;  1JCR B;  1TNY B;  4V1S A;  1W6J A;  4BOK A;  2PMV A;  1O6R A;  1NL4 B;  2WIN B;  1H3C A;  4ZRP A;  1GHQ A;  1QQF A;  3Q7F B;  1TNZ B;  3PZ2 B;  3Q73 B;  4FXG B;  4YDO B;  5FO7 B;  4GTO B;  3KQ4 A;  1FT1 B;  1LD7 B;  3Q7A B;  4V1R A;  1O79 A;  1TNB B;  2BB5 A; 
#chains in the Genus database with same CATH topology
 2H6I B;  4J5T A;  1L2A A;  4F10 A;  5KKB A;  2JJB A;  2NVP A;  5ILK A;  2V8I A;  1H36 A;  4YDE B;  1N7N A;  3M78 A;  4WVC A;  4LNB B;  3WKF A;  1K72 A;  4DOE A;  1LF6 A;  2B4F A;  3DPY B;  5ILZ A;  1SA5 B;  1AGM A;  2DRS A;  4GL3 A;  2V3N A;  3HXE B;  5ILJ A;  4FJQ A;  1NI1 B;  4MMI A;  2G0D A;  2EAC A;  2EAB A;  5IKH A;  3NNB A;  3S9V A;  1V7X A;  5CZL A;  4F13 A;  3OXU A;  1N7P A;  3QSP A;  2SQC A;  1QSJ A;  1AYX A;  3SDV A;  4JJJ A;  4OZW A;  1JCQ B;  3SDR A;  3H7L A;  3P5P A;  2XFG A;  3KSQ B;  1I8Q A;  2RGK A;  1IA6 A;  2VN4 A;  2D5J A;  3PYB A;  4FXK B;  1KRF A;  3M7E A;  4L9P B;  1XWQ A;  3AFL A;  5CD2 A;  1KS8 A;  2FUZ A;  3Q75 B;  3RJ3 A;  2H6G B;  2NOJ A;  2R2L B;  1FMI A;  4OK2 A;  2H6F B;  4KTR A;  3E30 B;  1O6Q A;  1FP3 A;  1O6H A;  3Q78 B;  1GA2 A;  1XW2 A;  3QXQ A;  1WU5 A;  3M02 A;  1F9O A;  4GTT B;  1H12 A;  2VN7 A;  3HXC B;  5EAS A;  1KZO B;  3ANI A;  2A8Z A;  3WUX A;  3NFV A;  2Q1F A;  1GLM A;  4D4D A;  2I07 B;  3CIH A;  2FV1 A;  1RWA A;  3ON6 A;  3VXD A;  3GT5 A;  4OZV A;  4TF4 A;  5JPN B;  1F1S A;  1LOH A;  3A3V A;  4GTM B;  4CJ0 A;  2WY7 A;  5ILY A;  1N4P B;  2GH4 A;  3RX5 A;  5MEH A;  4GTQ B;  1R76 A;  4ZRQ A;  1UT9 A;  4ONT A;  3M01 A;  1JCR B;  4V1S A;  4BOK A;  3RSY A;  1O6R A;  1H3C A;  1QQF A;  1LF9 A;  1LXK A;  3AFJ A;  3G4D A;  5DGR A;  1FT1 B;  1DOG A;  1HV6 A;  1TNB B;  2BB5 A;  1W6K A;  2G02 A;  2ONG A;  3PYA A;  1H35 A;  1KKT A;  4LNV A;  2DRQ A;  2XWJ B;  3H3K A;  1GXM A;  1S63 B;  1V5D A;  1N94 B;  1O1T B;  2P0V A;  1D8D B;  1UMP A;  1VD5 A;  1N22 A;  4AYR A;  1N24 A;  2DRR A;  3WKI A;  3K11 A;  1X1J A;  3DSV B;  5ILH A;  1N20 A;  4NEI A;  3QT3 A;  4MBG B;  1W3Y A;  2AFA A;  1WZZ A;  4C1S A;  3H2W A;  4QT9 A;  5FO9 B;  1GAH A;  1RWH A;  1D8E B;  3DSX B;  1HMU A;  3DST B;  2H6H B;  1H39 A;  2WYN A;  2V8J A;  3SDT A;  1EGU A;  5CA3 A;  3A0O A;  1HM3 A;  3QPF A;  1H13 A;  3W7X A;  1MZC B;  3QFZ A;  3RRS A;  1J0M A;  3RX7 A;  3M00 A;  1FPP B;  1N4Q B;  1JS4 A;  5DHK A;  3VSM A;  2FBA A;  2RI9 A;  4GTP B;  3W5N A;  2B39 A;  3S4D A;  1KSC A;  1HZF A;  3M77 A;  3RX8 A;  3DSU B;  1N7Q A;  4LIX A;  3SAE A;  1H54 A;  5DGQ A;  3M7C A;  3M71 A;  2BRV X;  5IK9 A;  1RWF A;  1RQ5 A;  2V8K A;  2ZIR B;  2WCO A;  3W7W A;  2RI8 A;  1DCE B;  3EUV B;  4BOJ A;  3Q79 B;  4D94 A;  3G4F A;  3KLS A;  2GOX A;  3EQA A;  1W6J A;  1V7W A;  1G6I A;  2JG0 A;  2WIN B;  3S4C A;  3Q7F B;  3M73 A;  4AYQ A;  3ANJ A;  3M75 A;  1IS9 A;  3Q73 B;  3QRY A;  2X03 A;  2OKX A;  4FXG B;  5FO7 B;  3KQ4 A;  4V1R A;  4WVA A;  1QAZ A;  1O79 A;  1WU4 A;  3T33 A;  1TN7 B;  5DHI A;  2V3P A;  3WC3 A;  1TF4 A;  3K7X A;  3N0G A;  3PZ4 B;  3W7U A;  5M7I A;  4AYO A;  1RWC A;  1GXN A;  3E73 A;  1HXG A;  4GTS B;  2E22 A;  2GZ6 A;  3PZ1 B;  2F0Y B;  3KSL B;  1H3B A;  3M72 A;  3QFY A;  4DOD A;  1C82 A;  3LZ9 A;  1FO2 A;  5M7Y A;  2BED B;  1JCS B;  3M74 A;  5FOB B;  1GXO A;  1H37 A;  3N0F A;  3DRA B;  1GSZ A;  4CE7 A;  2EAE A;  3S4B A;  3QT9 A;  4ZG8 A;  2WII B;  1TN6 B;  3D5R A;  4Z4J A;  1OJO A;  3WIR A;  2ONH A;  4Q88 A;  3E7J A;  3SQC A;  3DSS B;  3E37 B;  3C72 B;  4CJ1 A;  1UG9 A;  5E2J A;  1X9D A;  1OJM A;  1SA4 B;  3HXB B;  3G6J B;  1FO3 A;  1TNU B;  2E24 A;  3EU8 A;  5JMD A;  2AHG A;  2WY8 A;  1C3D A;  1HMW A;  1X1H A;  5GZK A;  2AHF A;  3CU7 A;  4GTV B;  3M76 A;  1N7O A;  1KSD A;  3GZK A;  1J0N A;  4TXT A;  4EHM B;  3E34 B;  1XWT A;  5JPM B;  5IKA A;  1H3A A;  5IM1 A;  2IEJ B;  1O1R B;  1NXC A;  2FV0 A;  3E6U A;  3REN A;  2CQS A;  4EL8 A;  2Z07 A;  1V7V A;  5IL3 A;  1LXM A;  2BB6 A;  3WKG A;  1SQC A;  1G9G A;  4D4A A;  5EAU A;  1OJN A;  2BBC A;  1F9D A;  1FBO A;  4AYP A;  1N23 A;  1N4S B;  3M7B A;  1KFG A;  4M76 A;  4FNV A;  1O5M B;  3X17 A;  1RWG A;  3DSW B;  3WIW A;  1KWF A;  3P2C A;  4D4B A;  3W5M A;  4DI5 A;  3SDU A;  3VW5 A;  1WU6 A;  1NC5 A;  2ZBL A;  5AGD A;  1HXA A;  1G9J A;  1FCE A;  1CB8 A;  1TN8 B;  5IL8 A;  2BRW A;  5IK6 A;  1ULV A;  3QXF A;  1TNY B;  2FUT A;  1KRE A;  1N1B A;  1NL4 B;  3W7S A;  4ZRP A;  3ANK A;  3PZ2 B;  1L1Y A;  1FBW A;  4YDO B;  1HXC A;  4OJZ A;  4WU0 A;  1IA7 A;  4OK4 A;  1N1Z A;  2DRO A;  1HX9 A;  3GLY A;  3D5S A;  1QBQ B;  4GAX A;  2ZZR A;  1N4R B;  3OED A;  5ILD A;  3HXD B;  4YCR A;  4RNQ A;  3E32 B;  4D4C A;  4MMH A;  3WIQ A;  2CQT A;  1GAI A;  2WDA A;  3E33 B;  3EZ8 A;  4KKI A;  3TF4 A;  3QWT A;  1N95 B;  3HXF B;  1O1S B;  3VSN A;  2F6D A;  1HM2 A;  3SDQ A;  5IK0 A;  1FAE A;  2J5C A;  4KTP A;  2PN5 A;  4GTR B;  4L0G A;  5EAT A;  1LD8 B;  4XUV A;  4ZH1 A;  2D8L A;  3P5R A;  5GW7 A;  3SFY B;  2BRP A;  2FUQ A;  1RW9 A;  1V5C A;  1S64 B;  2XQW A;  4Q2B A;  1HN0 A;  2XWB B;  1X1I A;  3EU5 B;  3M7L A;  2QNO A;  3QDE A;  2A73 B;  4E1Y A;  4KKJ A;  1HCU A;  1LTX B;  1DL2 A;  1OJP A;  3QG0 A;  2ZIS B;  4LNG B;  1CEM A;  3D3I A;  3PZ3 B;  5JMF A;  3SFX B;  1H14 A;  2YIK A;  3S4A A;  1N21 A;  2EAD A;  1FT2 B;  1KZP B;  3ACT A;  1X81 B;  4FUS A;  4ZH5 A;  1N7R A;  3ACS A;  3PMM A;  4MU9 A;  1TNO B;  5C05 A;  5GY3 A;  3W7T A;  1N9A B;  3WKH A;  4Z4L A;  5FO8 B;  4WVB A;  2JF4 A;  2PMV A;  3E80 A;  1GHQ A;  1CLC A;  1TNZ B;  5ILI A;  4GTO B;  1LD7 B;  3Q7A B;  4L6X A;  1G87 A;  1F9G A; 
#chains in the Genus database with same CATH homology
 2H6I B;  4J5T A;  1L2A A;  5KKB A;  2JJB A;  2NVP A;  2V8I A;  1H36 A;  4YDE B;  3M78 A;  4WVC A;  4LNB B;  3WKF A;  1K72 A;  4DOE A;  1LF6 A;  2B4F A;  3DPY B;  1SA5 B;  1AGM A;  2DRS A;  4GL3 A;  2V3N A;  3HXE B;  1NI1 B;  2G0D A;  2EAC A;  2EAB A;  3S9V A;  1V7X A;  5CZL A;  3OXU A;  3QSP A;  2SQC A;  1QSJ A;  1AYX A;  3SDV A;  4JJJ A;  1JCQ B;  3SDR A;  3H7L A;  3P5P A;  2XFG A;  3KSQ B;  2RGK A;  1IA6 A;  2VN4 A;  2D5J A;  3PYB A;  4FXK B;  1KRF A;  3M7E A;  4L9P B;  1XWQ A;  5CD2 A;  1KS8 A;  2FUZ A;  3Q75 B;  3RJ3 A;  2H6G B;  2NOJ A;  2R2L B;  1FMI A;  2H6F B;  4KTR A;  3E30 B;  1O6Q A;  1FP3 A;  1O6H A;  3Q78 B;  1GA2 A;  1XW2 A;  3QXQ A;  1WU5 A;  1F9O A;  4GTT B;  1H12 A;  2VN7 A;  3HXC B;  1KZO B;  3ANI A;  2A8Z A;  3WUX A;  1GLM A;  4D4D A;  2I07 B;  3CIH A;  2FV1 A;  3ON6 A;  3VXD A;  3GT5 A;  4TF4 A;  5JPN B;  3A3V A;  4GTM B;  4CJ0 A;  2WY7 A;  1N4P B;  2GH4 A;  3RX5 A;  5MEH A;  4GTQ B;  1R76 A;  4ZRQ A;  1UT9 A;  4ONT A;  1JCR B;  4V1S A;  4BOK A;  3RSY A;  1O6R A;  1H3C A;  1QQF A;  1LF9 A;  3AFJ A;  5DGR A;  1FT1 B;  1DOG A;  1TNB B;  2BB5 A;  1W6K A;  2G02 A;  3PYA A;  1H35 A;  1KKT A;  4LNV A;  2DRQ A;  2XWJ B;  3H3K A;  1GXM A;  1S63 B;  1V5D A;  1N94 B;  1O1T B;  2P0V A;  1D8D B;  1UMP A;  1VD5 A;  4AYR A;  2DRR A;  3WKI A;  3K11 A;  3DSV B;  3QT3 A;  4MBG B;  2AFA A;  1WZZ A;  4C1S A;  3H2W A;  4QT9 A;  5FO9 B;  1GAH A;  1D8E B;  3DSX B;  3DST B;  2H6H B;  1H39 A;  2WYN A;  2V8J A;  3SDT A;  5CA3 A;  3QPF A;  1H13 A;  3W7X A;  1MZC B;  3QFZ A;  3RRS A;  3RX7 A;  1FPP B;  1N4Q B;  1JS4 A;  2FBA A;  2RI9 A;  4GTP B;  3W5N A;  2B39 A;  3S4D A;  1KSC A;  1HZF A;  1G87 A;  3M77 A;  3RX8 A;  3DSU B;  3SAE A;  4LIX A;  1H54 A;  5DGQ A;  3M7C A;  3M71 A;  1RQ5 A;  2V8K A;  2ZIR B;  3W7W A;  2RI8 A;  1DCE B;  3EUV B;  4BOJ A;  3Q79 B;  4D94 A;  3KLS A;  2GOX A;  3EQA A;  1W6J A;  1V7W A;  1G6I A;  2JG0 A;  2WIN B;  3S4C A;  3Q7F B;  3M73 A;  4AYQ A;  3ANJ A;  3M75 A;  1IS9 A;  3Q73 B;  3QRY A;  2OKX A;  4FXG B;  5FO7 B;  3KQ4 A;  4V1R A;  4WVA A;  1O79 A;  1WU4 A;  3T33 A;  1TN7 B;  3WC3 A;  2V3P A;  1TF4 A;  3K7X A;  3PZ4 B;  3W7U A;  5M7I A;  4AYO A;  1GXN A;  3E73 A;  4GTS B;  2GZ6 A;  3PZ1 B;  2F0Y B;  3KSL B;  1H3B A;  3M72 A;  3QFY A;  4DOD A;  1FO2 A;  5M7Y A;  2BED B;  1JCS B;  3M74 A;  5FOB B;  1GXO A;  1H37 A;  3DRA B;  1GSZ A;  4CE7 A;  2EAE A;  3S4B A;  3QT9 A;  4ZG8 A;  2WII B;  1TN6 B;  3D5R A;  4Z4J A;  3WIR A;  4Q88 A;  3SQC A;  3DSS B;  3E37 B;  3C72 B;  4CJ1 A;  1UG9 A;  5E2J A;  1X9D A;  1SA4 B;  3HXB B;  3G6J B;  1FO3 A;  1TNU B;  3EU8 A;  2AHG A;  2WY8 A;  1C3D A;  5GZK A;  2AHF A;  3CU7 A;  4GTV B;  3M76 A;  1KSD A;  3GZK A;  4TXT A;  4EHM B;  3E34 B;  1XWT A;  5JPM B;  1H3A A;  2IEJ B;  1O1R B;  1NXC A;  2FV0 A;  3E6U A;  3REN A;  2CQS A;  4EL8 A;  2Z07 A;  1V7V A;  2BB6 A;  3WKG A;  1SQC A;  1G9G A;  4D4A A;  2BBC A;  1F9D A;  1FBO A;  4AYP A;  1N4S B;  1KFG A;  4M76 A;  3X17 A;  1O5M B;  3DSW B;  3WIW A;  1KWF A;  3P2C A;  4D4B A;  3W5M A;  3SDU A;  3VW5 A;  1WU6 A;  1NC5 A;  2ZBL A;  5AGD A;  1G9J A;  1FCE A;  1TN8 B;  1ULV A;  3QXF A;  1TNY B;  1KRE A;  1NL4 B;  3W7S A;  4ZRP A;  3ANK A;  3PZ2 B;  1L1Y A;  1FBW A;  4YDO B;  4WU0 A;  1IA7 A;  2DRO A;  3GLY A;  3D5S A;  1QBQ B;  2ZZR A;  1N4R B;  3OED A;  3HXD B;  4YCR A;  3E32 B;  4D4C A;  3WIQ A;  2CQT A;  1GAI A;  3E33 B;  3EZ8 A;  4KKI A;  3TF4 A;  3QWT A;  1N95 B;  3HXF B;  1O1S B;  2F6D A;  3SDQ A;  1FAE A;  4KTP A;  2PN5 A;  4GTR B;  4L0G A;  1LD8 B;  4XUV A;  4ZH1 A;  2D8L A;  3P5R A;  5GW7 A;  3SFY B;  1V5C A;  1S64 B;  2XQW A;  4Q2B A;  2XWB B;  3EU5 B;  3M7L A;  2QNO A;  3QDE A;  2A73 B;  4KKJ A;  1HCU A;  1LTX B;  1DL2 A;  3QG0 A;  2ZIS B;  4LNG B;  1CEM A;  3D3I A;  3PZ3 B;  3SFX B;  1H14 A;  2YIK A;  3S4A A;  2EAD A;  1FT2 B;  1KZP B;  3ACT A;  1X81 B;  4FUS A;  4ZH5 A;  3ACS A;  3PMM A;  4MU9 A;  1TNO B;  5GY3 A;  3W7T A;  1N9A B;  3WKH A;  4Z4L A;  5FO8 B;  4WVB A;  2JF4 A;  2PMV A;  1GHQ A;  1CLC A;  1TNZ B;  4GTO B;  1LD7 B;  3Q7A B;  4L6X A;  3M7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...