3C72B

Engineered rabggtase in complex with a peptidomimetic inhibitor
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
325
structure length
324
Chain Sequence
DVTIKSDAPDTLLLEKHADYIASYGSKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of selective RabGGTase inhibitors and crystal structure of a RabGGTase-inhibitor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 117
structure length 324
sequence length 325
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3c72B00
1N94B 2V3NA 3G6JB 2R2LB 2G02A 1SA4B 1GSZA 1S63B 1QSJA 1FT2B 1LD7B 3HXDB 3EUVB 1TN7B 4V1SA 3Q7AB 4D4AA 3E37B 1O79A 4ONTA 3CU7A 4BOKA 3D5SA 4M76A 4FXGB 3PZ4B 3PZ3B 3PZ1B 1W6KA 3HXCB 4D4CA 3Q75B 3K7XA 3DSVB 1JCQB 1HZFA 3KQ4A 4LNBB 3SFXB 2V3PA 3EU5B 4D4BA 3E33B 2ZIRB 3KSLB 2V8JA 1W6JA 2SQCA 1D8DB 4MU9A 1H35A 4MBGB 3HXBB 3DRAB 1H3CA 1D8EB 4LNGB 1O5MB 2BB6A 3DSTB 5JPNB 1JCSB 2H6HB 4LNVA 5FO9B 2B39A 1NI1B 1H36A 1SA5B 3Q73B 4ZRQA 1N4QB 3D5RA 4GTTB 4L9PB 4YDEB 1O6QA 3HXFB 2BEDB 4V1RA 1UMPA 2GOXA 1H3AA 4GTSB 1TNBB 3RJ3A 2I07B 4D94A 5FO8B 1LTXB 2WIIB 1QQFA 2NOJA 2V8IA 3DPYB 1TN8B 1NL4B 5AGDA 4BOJA 1O1TB 4ZH1A 1H3BA 1N4PB 3E30B 1O6HA 3DSWB 3DSXB 3KLSA 3Q79B 4D4DA 2WINB 1O1SB 1TNUB 1JCRB 1TNYB 2XWBB 3PZ2B 1KZPB 1N4RB 4GTQB 4KKIA 4GTPB 4C1SA 5FO7B 1N4SB 4YDOB 1TNZB 1KZOB 3E34B 4GTOB 4FXKB 2F0YB 1GXNA 1SQCA 4GTRB 1H39A 3OEDA 3SFYB 1O1RB 5JPMB 1TNOB 1H37A 2H6FB 1MZCB 2H6IB 2XWJB 2ZISB 1S64B 2XQWA 1TN6B 2PN5A 2G0DA 3HXEB 4EHMB 2WY8A 1N9AB 1GHQA 2WY7A 1R76A 3Q78B 1DCEB 2V8KA 3OXUA 1GXOA 1X81B 2BBCA 4GTVB 2BB5A 3E32B 3DSSB 4KKJA 1O6RA 4ZRPA 3Q7FB 1LD8B 2H6GB 1N95B 2PMVA 5FOBB 2IEJB 1C3DA 1GXMA 1QBQB 1FPPB 1FT1B 3DSUB 3C72B 4GTMB 3SQCA 2A73B 3KSQB
chains in the Genus database with same CATH superfamily
4F13A 1F1SA 1N7PA 2G02A 3ACSA 3M78A 2FBAA 1S63B 4Z4JA 4CE7A 3HXDB 3EUVB 4L6XA 3CIHA 4D4AA 3NFVA 4TF4A 4WVCA 4ONTA 5ILZA 1H13A 3SDVA 3PZ3B 3K7XA 3SDRA 3DSVB 4WU0A 5CA3A 3P2CA 4OZVA 3PYBA 4LNBB 1OJMA 1F9DA 4DODA 4FJQA 2SQCA 4J5TA 1FO2A 4MU9A 4MBGB 2QNOA 1DOGA 3RRSA 3ON6A 4LNGB 1WU6A 3S4DA 3SDTA 1HMWA 1SA5B 4CJ0A 3W7WA 1N4QB 4GTTB 4L9PB 5C05A 4V1RA 3RX5A 1H3AA 1N23A 2EABA 4TXTA 4FNVA 4D94A 5FO8B 1N7OA 1LTXB 2WIIB 2XFGA 2NOJA 1TN8B 1NL4B 3AFJA 3M7BA 2D8LA 3S9VA 1H12A 5ILDA 3WKGA 2FUTA 3H3KA 1O1SB 3ANJA 4JJJA 1V7XA 4GTPB 1N4SB 4YDOB 2A8ZA 1KZOB 3QWTA 1V5CA 5EATA 2F0YB 1GXNA 3EZ8A 3SFYB 5JPMB 1H14A 3P5PA 2Q1FA 1TN6B 2PN5A 2AHFA 1UG9A 1GHQA 3VSNA 5E2JA 2WY7A 1HM2A 4KTRA 4DI5A 3VXDA 1DCEB 5CD2A 5KKBA 1RQ5A 2BBCA 1VD5A 1O6RA 2FUZA 1FO3A 3M02A 3Q7FB 1LD8B 1H54A 1WZZA 3W5MA 1FT1B 2OKXA 1AGMA 1N22A 2A73B 3PYAA 4Q2BA 1N94B 3S4CA 2JF4A 1FT2B 1LD7B 3QXFA 4EL8A 1EGUA 4V1SA 2ONHA 2B4FA 3E80A 5GZKA 4BOKA 3D5SA 4FXGB 2GZ6A 3HXCB 1HM3A 3EQAA 1JCQB 4OK2A 1HZFA 3KQ4A 2VN7A 1I8QA 3SFXB 1LF9A 2ZIRB 3W7TA 2ZBLA 1D8DB 1F9OA 1X1JA 3G4FA 4GL3A 5GY3A 1KSDA 5JPNB 1JCSB 5GW7A 2H6HB 4LNVA 1V7VA 4QT9A 3M7LA 5FO9B 3A0OA 4ZRQA 2YIKA 3WIQA 1O6QA 2E22A 2VN4A 3HXFB 4GTSB 4Q88A 2DRSA 2I07B 1QQFA 4WVAA 2V8IA 1HX9A 5ILHA 2BRVX 1HXCA 3E30B 2ONGA 3DSWB 3WUXA 1GAIA 4D4DA 2WINB 1G9GA 1TNUB 2XWBB 1CLCA 3PZ2B 4GTQB 4KKIA 4C1SA 1HXGA 4WVBA 1N20A 5JMFA 2AHGA 1H39A 2JG0A 3N0FA 2EADA 3M7CA 2H6FB 1FCEA 1MZCB 2H6IB 1RWGA 2XWJB 2ZISB 4OJZA 5M7YA 5DHIA 1L2AA 2WY8A 3RX8A 3WIRA 1X81B 3SDQA 3W7SA 1N24A 2BB5A 3DSSB 2F6DA 3M77A 1IS9A 5EAUA 1N95B 2P0VA 4AYPA 1V7WA 2CQSA 5ILIA 5FOBB 3G4DA 1C3DA 1TF4A 1IA7A 5JMDA 4ZG8A 1QBQB 5EASA 3QT3A 3S4BA 3W7XA 3DSUB 5ILYA 1G6IA 3QDEA 3C72B 3QFYA 3SQCA 5CZLA 2V3NA 3G6JB 2R2LB 2WDAA 1SA4B 3ANIA 3M72A 1GSZA 1QSJA 2NVPA 3K11A 3NNBA 1DL2A 2WYNA 1GAHA 5DGRA 1TN7B 3E37B 3ANKA 3M74A 2J5CA 3CU7A 4M76A 1OJOA 1KS8A 1W6KA 1OJPA 4D4CA 3PMMA 4ZH5A 3RSYA 2Z07A 5IK0A 1FBWA 1OJNA 4MMIA 4D4BA 1XWQA 2V8JA 1L1YA 1W6JA 4Z4LA 1N1BA 4L0GA 1HV6A 4FUSA 3SAEA 4XUVA 3GT5A 5DGQA 1H3CA 2EACA 5IKHA 1O5MB 3DSTB 1HCUA 1QAZA 5IK6A 1N7NA 3QPFA 1ULVA 1N7QA 1NI1B 1H36A 1N7RA 3Q73B 1FMIA 3QRYA 1J0NA 5IL8A 1KSCA 2DRQA 1UMPA 2GOXA 4GAXA 1WU5A 1NXCA 3DPYB 1GLMA 5AGDA 1O1TB 4ZH1A 1H3BA 1KKTA 2FUQA 3DSXB 3KLSA 1LF6A 2X03A 3X17A 3TF4A 1K72A 1N4RB 1XWTA 2ZZRA 1HN0A 1LOHA 1TNZB 4AYRA 1WU4A 2E24A 3AFLA 4GTOB 1CB8A 2JJBA 3OEDA 1H37A 3M76A 1S64B 2XQWA 1RWHA 3E73A 2G0DA 1IA6A 3VSMA 4EHMB 1G9JA 4OK4A 2RGKA 1R76A 2V8KA 3WIWA 3OXUA 3WKIA 4RNQA 4GTVB 3M01A 1RW9A 1GA2A 3E32B 3N0GA 4ZRPA 1XW2A 2H6GB 2BRWA 2PMVA 2AFAA 3WKHA 3QT9A 1FPPB 1UT9A 4GTMB 1FAEA 1W3YA 4OZWA 1JS4A 3SDUA 3ACTA 2GH4A 1G87A 4YCRA 1X9DA 4KTPA 3Q7AB 1RWCA 1NC5A 3GZKA 1O79A 1RWFA 3M71A 5IL3A 3PZ4B 3WKFA 3PZ1B 1X1IA 3M73A 3P5RA 1F9GA 3Q75B 2CQTA 3RX7A 3QXQA 3QSPA 3RENA 3M00A 5MEHA 2V3PA 3EU5B 3E33B 3H7LA 4F10A 3KSLB 5IM1A 3M7EA 1H35A 3HXBB 3DRAB 3VW5A 1D8EB 2BB6A 2FV1A 5DHKA 2B39A 4YDEB 3D5RA 1KREA 4MMHA 3S4AA 5M7IA 3WC3A 2BEDB 2DROA 2BRPA 1TNBB 1LXMA 2RI9A 3E7JA 3RJ3A 1KFGA 2WCOA 3GLYA 4CJ1A 4LIXA 1FP3A 1KRFA 4BOJA 1HMUA 3T33A 1N4PB 3D3IA 1N1ZA 1O6HA 1N21A 3Q79B 1C82A 1JCRB 1TNYB 1CEMA 3H2WA 1KZPB 3A3VA 5FO7B 1X1HA 3E34B 4DOEA 4AYOA 1J0MA 2RI8A 4FXKB 1SQCA 4GTRB 1O1RB 1TNOB 4NEIA 2D5JA 5IK9A 3LZ9A 3HXEB 1V5DA 3W7UA 1N9AB 5IKAA 1HXAA 1KWFA 2EAEA 3Q78B 1FBOA 1GXOA 3W5NA 2FV0A 4KKJA 3QG0A 3E6UA 1LXKA 1RWAA 2DRRA 2IEJB 3EU8A 4AYQA 1GXMA 3QFZA 1AYXA 5ILJA 3M75A 5ILKA 4E1YA 3KSQB
chains in the Genus database with same CATH topology
2G02A 3ACSA 3M78A 2FBAA 1S63B 4Z4JA 4CE7A 3HXDB 3EUVB 4L6XA 3CIHA 4D4AA 4TF4A 4WVCA 4ONTA 1H13A 3SDVA 3PZ3B 3K7XA 3SDRA 3DSVB 4WU0A 5CA3A 3P2CA 3PYBA 4LNBB 1F9DA 4DODA 2SQCA 4J5TA 1FO2A 4MU9A 4MBGB 2QNOA 1DOGA 3RRSA 3ON6A 4LNGB 1WU6A 3S4DA 3SDTA 1SA5B 4CJ0A 3W7WA 1N4QB 4GTTB 4L9PB 4V1RA 3RX5A 1H3AA 2EABA 4TXTA 4D94A 5FO8B 1LTXB 2WIIB 2XFGA 2NOJA 1TN8B 1NL4B 3AFJA 3M7BA 2D8LA 3S9VA 1H12A 3WKGA 3H3KA 1O1SB 3ANJA 4JJJA 1V7XA 4GTPB 1N4SB 4YDOB 2A8ZA 1KZOB 3QWTA 1V5CA 2F0YB 1GXNA 3EZ8A 3SFYB 5JPMB 1H14A 3P5PA 1TN6B 2PN5A 2AHFA 1UG9A 1GHQA 5E2JA 2WY7A 4KTRA 3VXDA 1DCEB 5CD2A 5KKBA 1RQ5A 2BBCA 1VD5A 1O6RA 2FUZA 1FO3A 3Q7FB 1LD8B 1H54A 1WZZA 3W5MA 1FT1B 2OKXA 1AGMA 3PYAA 2A73B 4Q2BA 1N94B 3S4CA 2JF4A 1FT2B 1LD7B 3QXFA 4EL8A 4V1SA 2B4FA 5GZKA 4BOKA 3D5SA 4FXGB 2GZ6A 3HXCB 3EQAA 1JCQB 1HZFA 3KQ4A 2VN7A 3SFXB 1LF9A 2ZIRB 3W7TA 2ZBLA 1D8DB 1F9OA 4GL3A 5GY3A 1KSDA 5JPNB 1JCSB 5GW7A 2H6HB 4LNVA 1V7VA 4QT9A 3M7LA 5FO9B 4ZRQA 2YIKA 3WIQA 1O6QA 2VN4A 3HXFB 4GTSB 4Q88A 2DRSA 2I07B 1QQFA 4WVAA 2V8IA 3E30B 3WUXA 3DSWB 1GAIA 4D4DA 2WINB 1G9GA 1TNUB 2XWBB 1CLCA 3PZ2B 4GTQB 4KKIA 4C1SA 4WVBA 2AHGA 1H39A 2JG0A 2EADA 3M7CA 2H6FB 1FCEA 1MZCB 2H6IB 2XWJB 2ZISB 5M7YA 1L2AA 2WY8A 3RX8A 3WIRA 1X81B 3SDQA 3W7SA 2BB5A 3DSSB 2F6DA 3M77A 1IS9A 1N95B 2P0VA 4AYPA 1V7WA 2CQSA 5FOBB 1C3DA 1TF4A 1IA7A 4ZG8A 1QBQB 3QT3A 3S4BA 3W7XA 3DSUB 1G6IA 3QDEA 3C72B 3QFYA 3SQCA 5CZLA 2V3NA 3G6JB 2R2LB 1SA4B 3ANIA 3M72A 1GSZA 1QSJA 2NVPA 3K11A 1DL2A 2WYNA 1GAHA 5DGRA 1TN7B 3E37B 3ANKA 3M74A 3CU7A 4M76A 1KS8A 1W6KA 4D4CA 3PMMA 4ZH5A 3RSYA 2Z07A 1FBWA 4D4BA 1XWQA 2V8JA 1L1YA 1W6JA 4Z4LA 4L0GA 4FUSA 3SAEA 4XUVA 3GT5A 5DGQA 1H3CA 2EACA 1O5MB 3DSTB 1HCUA 3QPFA 1ULVA 1NI1B 1H36A 3Q73B 1FMIA 3QRYA 1KSCA 2DRQA 1UMPA 2GOXA 1WU5A 1NXCA 3DPYB 1GLMA 5AGDA 1O1TB 4ZH1A 1H3BA 1KKTA 3DSXB 3KLSA 1LF6A 3X17A 3TF4A 1K72A 1N4RB 1XWTA 2ZZRA 1TNZB 4AYRA 1WU4A 4GTOB 2JJBA 3OEDA 1H37A 3M76A 1S64B 2XQWA 3E73A 2G0DA 1IA6A 4EHMB 1G9JA 2RGKA 1R76A 2V8KA 3WIWA 3OXUA 3WKIA 4GTVB 1GA2A 3E32B 4ZRPA 1XW2A 2H6GB 2PMVA 2AFAA 3WKHA 3QT9A 1FPPB 1UT9A 4GTMB 1FAEA 1JS4A 3SDUA 3ACTA 2GH4A 1G87A 4YCRA 1X9DA 4KTPA 3Q7AB 1NC5A 3GZKA 1O79A 3M71A 3PZ4B 3WKFA 3PZ1B 3M73A 3P5RA 3Q75B 2CQTA 3RX7A 3QXQA 3QSPA 3RENA 5MEHA 2V3PA 3EU5B 3E33B 3H7LA 3KSLB 3M7EA 1H35A 3HXBB 3DRAB 3VW5A 1D8EB 2BB6A 2FV1A 2B39A 4YDEB 3D5RA 1KREA 3S4AA 5M7IA 3WC3A 2BEDB 2DROA 1TNBB 2RI9A 3RJ3A 1KFGA 3GLYA 4CJ1A 4LIXA 1FP3A 1KRFA 4BOJA 3T33A 1N4PB 3D3IA 1O6HA 3Q79B 1JCRB 1TNYB 1CEMA 3H2WA 1KZPB 3A3VA 5FO7B 3E34B 4DOEA 4AYOA 2RI8A 4FXKB 1SQCA 4GTRB 1O1RB 1TNOB 2D5JA 3HXEB 1V5DA 3W7UA 1N9AB 1KWFA 2EAEA 3Q78B 1FBOA 1GXOA 3W5NA 2FV0A 4KKJA 3QG0A 3E6UA 2DRRA 2IEJB 3EU8A 4AYQA 1GXMA 3QFZA 1AYXA 3M75A 3KSQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N94 B;  2V3N A;  3G6J B;  2R2L B;  2G02 A;  1SA4 B;  1GSZ A;  1S63 B;  1QSJ A;  1FT2 B;  1LD7 B;  3HXD B;  3EUV B;  1TN7 B;  4V1S A;  3Q7A B;  4D4A A;  3E37 B;  1O79 A;  4ONT A;  3CU7 A;  4BOK A;  3D5S A;  4M76 A;  4FXG B;  3PZ4 B;  3PZ3 B;  3PZ1 B;  1W6K A;  3HXC B;  4D4C A;  3Q75 B;  3K7X A;  3DSV B;  1JCQ B;  1HZF A;  3KQ4 A;  4LNB B;  3SFX B;  2V3P A;  3EU5 B;  4D4B A;  3E33 B;  2ZIR B;  3KSL B;  2V8J A;  1W6J A;  2SQC A;  1D8D B;  4MU9 A;  1H35 A;  4MBG B;  3HXB B;  3DRA B;  1H3C A;  1D8E B;  4LNG B;  1O5M B;  2BB6 A;  3DST B;  5JPN B;  1JCS B;  2H6H B;  4LNV A;  5FO9 B;  2B39 A;  1NI1 B;  1H36 A;  1SA5 B;  3Q73 B;  4ZRQ A;  1N4Q B;  3D5R A;  4GTT B;  4L9P B;  4YDE B;  1O6Q A;  3HXF B;  2BED B;  4V1R A;  1UMP A;  2GOX A;  1H3A A;  4GTS B;  1TNB B;  3RJ3 A;  2I07 B;  4D94 A;  5FO8 B;  1LTX B;  2WII B;  1QQF A;  2NOJ A;  2V8I A;  3DPY B;  1TN8 B;  1NL4 B;  5AGD A;  4BOJ A;  1O1T B;  4ZH1 A;  1H3B A;  1N4P B;  3E30 B;  1O6H A;  3DSW B;  3DSX B;  3KLS A;  3Q79 B;  4D4D A;  2WIN B;  1O1S B;  1TNU B;  1JCR B;  1TNY B;  2XWB B;  3PZ2 B;  1KZP B;  1N4R B;  4GTQ B;  4KKI A;  4GTP B;  4C1S A;  5FO7 B;  1N4S B;  4YDO B;  1TNZ B;  1KZO B;  3E34 B;  4GTO B;  4FXK B;  2F0Y B;  1GXN A;  1SQC A;  4GTR B;  1H39 A;  3OED A;  3SFY B;  1O1R B;  5JPM B;  1TNO B;  1H37 A;  2H6F B;  1MZC B;  2H6I B;  2XWJ B;  2ZIS B;  1S64 B;  2XQW A;  1TN6 B;  2PN5 A;  2G0D A;  3HXE B;  4EHM B;  2WY8 A;  1N9A B;  1GHQ A;  2WY7 A;  1R76 A;  3Q78 B;  1DCE B;  2V8K A;  3OXU A;  1GXO A;  1X81 B;  2BBC A;  4GTV B;  2BB5 A;  3E32 B;  3DSS B;  4KKJ A;  1O6R A;  4ZRP A;  3Q7F B;  1LD8 B;  2H6G B;  1N95 B;  2PMV A;  5FOB B;  2IEJ B;  1C3D A;  1GXM A;  1QBQ B;  1FPP B;  1FT1 B;  3DSU B;  3C72 B;  4GTM B;  3SQC A;  2A73 B;  3KSQ B; 
#chains in the Genus database with same CATH topology
 4F13 A;  1F1S A;  1N7P A;  2G02 A;  3ACS A;  3M78 A;  2FBA A;  1S63 B;  4Z4J A;  4CE7 A;  3HXD B;  3EUV B;  4L6X A;  3CIH A;  4D4A A;  3NFV A;  4TF4 A;  4WVC A;  4ONT A;  5ILZ A;  1H13 A;  3SDV A;  3PZ3 B;  3K7X A;  3SDR A;  3DSV B;  4WU0 A;  5CA3 A;  3P2C A;  4OZV A;  3PYB A;  4LNB B;  1OJM A;  1F9D A;  4DOD A;  4FJQ A;  2SQC A;  4J5T A;  1FO2 A;  4MU9 A;  4MBG B;  2QNO A;  1DOG A;  3RRS A;  3ON6 A;  4LNG B;  1WU6 A;  3S4D A;  3SDT A;  1HMW A;  1SA5 B;  4CJ0 A;  3W7W A;  1N4Q B;  4GTT B;  4L9P B;  5C05 A;  4V1R A;  3RX5 A;  1H3A A;  1N23 A;  2EAB A;  4TXT A;  4FNV A;  4D94 A;  5FO8 B;  1N7O A;  1LTX B;  2WII B;  2XFG A;  2NOJ A;  1TN8 B;  1NL4 B;  3AFJ A;  3M7B A;  2D8L A;  3S9V A;  1H12 A;  5ILD A;  3WKG A;  2FUT A;  3H3K A;  1O1S B;  3ANJ A;  4JJJ A;  1V7X A;  4GTP B;  1N4S B;  4YDO B;  2A8Z A;  1KZO B;  3QWT A;  1V5C A;  5EAT A;  2F0Y B;  1GXN A;  3EZ8 A;  3SFY B;  5JPM B;  1H14 A;  3P5P A;  2Q1F A;  1TN6 B;  2PN5 A;  2AHF A;  1UG9 A;  1GHQ A;  3VSN A;  5E2J A;  2WY7 A;  1HM2 A;  4KTR A;  4DI5 A;  3VXD A;  1DCE B;  5CD2 A;  5KKB A;  1RQ5 A;  2BBC A;  1VD5 A;  1O6R A;  2FUZ A;  1FO3 A;  3M02 A;  3Q7F B;  1LD8 B;  1H54 A;  1WZZ A;  3W5M A;  1FT1 B;  2OKX A;  1AGM A;  1N22 A;  2A73 B;  3PYA A;  4Q2B A;  1N94 B;  3S4C A;  2JF4 A;  1FT2 B;  1LD7 B;  3QXF A;  4EL8 A;  1EGU A;  4V1S A;  2ONH A;  2B4F A;  3E80 A;  5GZK A;  4BOK A;  3D5S A;  4FXG B;  2GZ6 A;  3HXC B;  1HM3 A;  3EQA A;  1JCQ B;  4OK2 A;  1HZF A;  3KQ4 A;  2VN7 A;  1I8Q A;  3SFX B;  1LF9 A;  2ZIR B;  3W7T A;  2ZBL A;  1D8D B;  1F9O A;  1X1J A;  3G4F A;  4GL3 A;  5GY3 A;  1KSD A;  5JPN B;  1JCS B;  5GW7 A;  2H6H B;  4LNV A;  1V7V A;  4QT9 A;  3M7L A;  5FO9 B;  3A0O A;  4ZRQ A;  2YIK A;  3WIQ A;  1O6Q A;  2E22 A;  2VN4 A;  3HXF B;  4GTS B;  4Q88 A;  2DRS A;  2I07 B;  1QQF A;  4WVA A;  2V8I A;  1HX9 A;  5ILH A;  2BRV X;  1HXC A;  3E30 B;  2ONG A;  3DSW B;  3WUX A;  1GAI A;  4D4D A;  2WIN B;  1G9G A;  1TNU B;  2XWB B;  1CLC A;  3PZ2 B;  4GTQ B;  4KKI A;  4C1S A;  1HXG A;  4WVB A;  1N20 A;  5JMF A;  2AHG A;  1H39 A;  2JG0 A;  3N0F A;  2EAD A;  3M7C A;  2H6F B;  1FCE A;  1MZC B;  2H6I B;  1RWG A;  2XWJ B;  2ZIS B;  4OJZ A;  5M7Y A;  5DHI A;  1L2A A;  2WY8 A;  3RX8 A;  3WIR A;  1X81 B;  3SDQ A;  3W7S A;  1N24 A;  2BB5 A;  3DSS B;  2F6D A;  3M77 A;  1IS9 A;  5EAU A;  1N95 B;  2P0V A;  4AYP A;  1V7W A;  2CQS A;  5ILI A;  5FOB B;  3G4D A;  1C3D A;  1TF4 A;  1IA7 A;  5JMD A;  4ZG8 A;  1QBQ B;  5EAS A;  3QT3 A;  3S4B A;  3W7X A;  3DSU B;  5ILY A;  1G6I A;  3QDE A;  3C72 B;  3QFY A;  3SQC A;  5CZL A;  2V3N A;  3G6J B;  2R2L B;  2WDA A;  1SA4 B;  3ANI A;  3M72 A;  1GSZ A;  1QSJ A;  2NVP A;  3K11 A;  3NNB A;  1DL2 A;  2WYN A;  1GAH A;  5DGR A;  1TN7 B;  3E37 B;  3ANK A;  3M74 A;  2J5C A;  3CU7 A;  4M76 A;  1OJO A;  1KS8 A;  1W6K A;  1OJP A;  4D4C A;  3PMM A;  4ZH5 A;  3RSY A;  2Z07 A;  5IK0 A;  1FBW A;  1OJN A;  4MMI A;  4D4B A;  1XWQ A;  2V8J A;  1L1Y A;  1W6J A;  4Z4L A;  1N1B A;  4L0G A;  1HV6 A;  4FUS A;  3SAE A;  4XUV A;  3GT5 A;  5DGQ A;  1H3C A;  2EAC A;  5IKH A;  1O5M B;  3DST B;  1HCU A;  1QAZ A;  5IK6 A;  1N7N A;  3QPF A;  1ULV A;  1N7Q A;  1NI1 B;  1H36 A;  1N7R A;  3Q73 B;  1FMI A;  3QRY A;  1J0N A;  5IL8 A;  1KSC A;  2DRQ A;  1UMP A;  2GOX A;  4GAX A;  1WU5 A;  1NXC A;  3DPY B;  1GLM A;  5AGD A;  1O1T B;  4ZH1 A;  1H3B A;  1KKT A;  2FUQ A;  3DSX B;  3KLS A;  1LF6 A;  2X03 A;  3X17 A;  3TF4 A;  1K72 A;  1N4R B;  1XWT A;  2ZZR A;  1HN0 A;  1LOH A;  1TNZ B;  4AYR A;  1WU4 A;  2E24 A;  3AFL A;  4GTO B;  1CB8 A;  2JJB A;  3OED A;  1H37 A;  3M76 A;  1S64 B;  2XQW A;  1RWH A;  3E73 A;  2G0D A;  1IA6 A;  3VSM A;  4EHM B;  1G9J A;  4OK4 A;  2RGK A;  1R76 A;  2V8K A;  3WIW A;  3OXU A;  3WKI A;  4RNQ A;  4GTV B;  3M01 A;  1RW9 A;  1GA2 A;  3E32 B;  3N0G A;  4ZRP A;  1XW2 A;  2H6G B;  2BRW A;  2PMV A;  2AFA A;  3WKH A;  3QT9 A;  1FPP B;  1UT9 A;  4GTM B;  1FAE A;  1W3Y A;  4OZW A;  1JS4 A;  3SDU A;  3ACT A;  2GH4 A;  1G87 A;  4YCR A;  1X9D A;  4KTP A;  3Q7A B;  1RWC A;  1NC5 A;  3GZK A;  1O79 A;  1RWF A;  3M71 A;  5IL3 A;  3PZ4 B;  3WKF A;  3PZ1 B;  1X1I A;  3M73 A;  3P5R A;  1F9G A;  3Q75 B;  2CQT A;  3RX7 A;  3QXQ A;  3QSP A;  3REN A;  3M00 A;  5MEH A;  2V3P A;  3EU5 B;  3E33 B;  3H7L A;  4F10 A;  3KSL B;  5IM1 A;  3M7E A;  1H35 A;  3HXB B;  3DRA B;  3VW5 A;  1D8E B;  2BB6 A;  2FV1 A;  5DHK A;  2B39 A;  4YDE B;  3D5R A;  1KRE A;  4MMH A;  3S4A A;  5M7I A;  3WC3 A;  2BED B;  2DRO A;  2BRP A;  1TNB B;  1LXM A;  2RI9 A;  3E7J A;  3RJ3 A;  1KFG A;  2WCO A;  3GLY A;  4CJ1 A;  4LIX A;  1FP3 A;  1KRF A;  4BOJ A;  1HMU A;  3T33 A;  1N4P B;  3D3I A;  1N1Z A;  1O6H A;  1N21 A;  3Q79 B;  1C82 A;  1JCR B;  1TNY B;  1CEM A;  3H2W A;  1KZP B;  3A3V A;  5FO7 B;  1X1H A;  3E34 B;  4DOE A;  4AYO A;  1J0M A;  2RI8 A;  4FXK B;  1SQC A;  4GTR B;  1O1R B;  1TNO B;  4NEI A;  2D5J A;  5IK9 A;  3LZ9 A;  3HXE B;  1V5D A;  3W7U A;  1N9A B;  5IKA A;  1HXA A;  1KWF A;  2EAE A;  3Q78 B;  1FBO A;  1GXO A;  3W5N A;  2FV0 A;  4KKJ A;  3QG0 A;  3E6U A;  1LXK A;  1RWA A;  2DRR A;  2IEJ B;  3EU8 A;  4AYQ A;  1GXM A;  3QFZ A;  1AYX A;  5ILJ A;  3M75 A;  5ILK A;  4E1Y A;  3KSQ B; 
#chains in the Genus database with same CATH homology
 2G02 A;  3ACS A;  3M78 A;  2FBA A;  1S63 B;  4Z4J A;  4CE7 A;  3HXD B;  3EUV B;  4L6X A;  3CIH A;  4D4A A;  4TF4 A;  4WVC A;  4ONT A;  1H13 A;  3SDV A;  3PZ3 B;  3K7X A;  3SDR A;  3DSV B;  4WU0 A;  5CA3 A;  3P2C A;  3PYB A;  4LNB B;  1F9D A;  4DOD A;  2SQC A;  4J5T A;  1FO2 A;  4MU9 A;  4MBG B;  2QNO A;  1DOG A;  3RRS A;  3ON6 A;  4LNG B;  1WU6 A;  3S4D A;  3SDT A;  1SA5 B;  4CJ0 A;  3W7W A;  1N4Q B;  4GTT B;  4L9P B;  4V1R A;  3RX5 A;  1H3A A;  2EAB A;  4TXT A;  4D94 A;  5FO8 B;  1LTX B;  2WII B;  2XFG A;  2NOJ A;  1TN8 B;  1NL4 B;  3AFJ A;  3M7B A;  2D8L A;  3S9V A;  1H12 A;  3WKG A;  3H3K A;  1O1S B;  3ANJ A;  4JJJ A;  1V7X A;  4GTP B;  1N4S B;  4YDO B;  2A8Z A;  1KZO B;  3QWT A;  1V5C A;  2F0Y B;  1GXN A;  3EZ8 A;  3SFY B;  5JPM B;  1H14 A;  3P5P A;  1TN6 B;  2PN5 A;  2AHF A;  1UG9 A;  1GHQ A;  5E2J A;  2WY7 A;  4KTR A;  3VXD A;  1DCE B;  5CD2 A;  5KKB A;  1RQ5 A;  2BBC A;  1VD5 A;  1O6R A;  2FUZ A;  1FO3 A;  3Q7F B;  1LD8 B;  1H54 A;  1WZZ A;  3W5M A;  1FT1 B;  2OKX A;  1AGM A;  3PYA A;  2A73 B;  4Q2B A;  1N94 B;  3S4C A;  2JF4 A;  1FT2 B;  1LD7 B;  3QXF A;  4EL8 A;  4V1S A;  2B4F A;  5GZK A;  4BOK A;  3D5S A;  4FXG B;  2GZ6 A;  3HXC B;  3EQA A;  1JCQ B;  1HZF A;  3KQ4 A;  2VN7 A;  3SFX B;  1LF9 A;  2ZIR B;  3W7T A;  2ZBL A;  1D8D B;  1F9O A;  4GL3 A;  5GY3 A;  1KSD A;  5JPN B;  1JCS B;  5GW7 A;  2H6H B;  4LNV A;  1V7V A;  4QT9 A;  3M7L A;  5FO9 B;  4ZRQ A;  2YIK A;  3WIQ A;  1O6Q A;  2VN4 A;  3HXF B;  4GTS B;  4Q88 A;  2DRS A;  2I07 B;  1QQF A;  4WVA A;  2V8I A;  3E30 B;  3WUX A;  3DSW B;  1GAI A;  4D4D A;  2WIN B;  1G9G A;  1TNU B;  2XWB B;  1CLC A;  3PZ2 B;  4GTQ B;  4KKI A;  4C1S A;  4WVB A;  2AHG A;  1H39 A;  2JG0 A;  2EAD A;  3M7C A;  2H6F B;  1FCE A;  1MZC B;  2H6I B;  2XWJ B;  2ZIS B;  5M7Y A;  1L2A A;  2WY8 A;  3RX8 A;  3WIR A;  1X81 B;  3SDQ A;  3W7S A;  2BB5 A;  3DSS B;  2F6D A;  3M77 A;  1IS9 A;  1N95 B;  2P0V A;  4AYP A;  1V7W A;  2CQS A;  5FOB B;  1C3D A;  1TF4 A;  1IA7 A;  4ZG8 A;  1QBQ B;  3QT3 A;  3S4B A;  3W7X A;  3DSU B;  1G6I A;  3QDE A;  3C72 B;  3QFY A;  3SQC A;  5CZL A;  2V3N A;  3G6J B;  2R2L B;  1SA4 B;  3ANI A;  3M72 A;  1GSZ A;  1QSJ A;  2NVP A;  3K11 A;  1DL2 A;  2WYN A;  1GAH A;  5DGR A;  1TN7 B;  3E37 B;  3ANK A;  3M74 A;  3CU7 A;  4M76 A;  1KS8 A;  1W6K A;  4D4C A;  3PMM A;  4ZH5 A;  3RSY A;  2Z07 A;  1FBW A;  4D4B A;  1XWQ A;  2V8J A;  1L1Y A;  1W6J A;  4Z4L A;  4L0G A;  4FUS A;  3SAE A;  4XUV A;  3GT5 A;  5DGQ A;  1H3C A;  2EAC A;  1O5M B;  3DST B;  1HCU A;  3QPF A;  1ULV A;  1NI1 B;  1H36 A;  3Q73 B;  1FMI A;  3QRY A;  1KSC A;  2DRQ A;  1UMP A;  2GOX A;  1WU5 A;  1NXC A;  3DPY B;  1GLM A;  5AGD A;  1O1T B;  4ZH1 A;  1H3B A;  1KKT A;  3DSX B;  3KLS A;  1LF6 A;  3X17 A;  3TF4 A;  1K72 A;  1N4R B;  1XWT A;  2ZZR A;  1TNZ B;  4AYR A;  1WU4 A;  4GTO B;  2JJB A;  3OED A;  1H37 A;  3M76 A;  1S64 B;  2XQW A;  3E73 A;  2G0D A;  1IA6 A;  4EHM B;  1G9J A;  2RGK A;  1R76 A;  2V8K A;  3WIW A;  3OXU A;  3WKI A;  4GTV B;  1GA2 A;  3E32 B;  4ZRP A;  1XW2 A;  2H6G B;  2PMV A;  2AFA A;  3WKH A;  3QT9 A;  1FPP B;  1UT9 A;  4GTM B;  1FAE A;  1JS4 A;  3SDU A;  3ACT A;  2GH4 A;  1G87 A;  4YCR A;  1X9D A;  4KTP A;  3Q7A B;  1NC5 A;  3GZK A;  1O79 A;  3M71 A;  3PZ4 B;  3WKF A;  3PZ1 B;  3M73 A;  3P5R A;  3Q75 B;  2CQT A;  3RX7 A;  3QXQ A;  3QSP A;  3REN A;  5MEH A;  2V3P A;  3EU5 B;  3E33 B;  3H7L A;  3KSL B;  3M7E A;  1H35 A;  3HXB B;  3DRA B;  3VW5 A;  1D8E B;  2BB6 A;  2FV1 A;  2B39 A;  4YDE B;  3D5R A;  1KRE A;  3S4A A;  5M7I A;  3WC3 A;  2BED B;  2DRO A;  1TNB B;  2RI9 A;  3RJ3 A;  1KFG A;  3GLY A;  4CJ1 A;  4LIX A;  1FP3 A;  1KRF A;  4BOJ A;  3T33 A;  1N4P B;  3D3I A;  1O6H A;  3Q79 B;  1JCR B;  1TNY B;  1CEM A;  3H2W A;  1KZP B;  3A3V A;  5FO7 B;  3E34 B;  4DOE A;  4AYO A;  2RI8 A;  4FXK B;  1SQC A;  4GTR B;  1O1R B;  1TNO B;  2D5J A;  3HXE B;  1V5D A;  3W7U A;  1N9A B;  1KWF A;  2EAE A;  3Q78 B;  1FBO A;  1GXO A;  3W5N A;  2FV0 A;  4KKJ A;  3QG0 A;  3E6U A;  2DRR A;  2IEJ B;  3EU8 A;  4AYQ A;  1GXM A;  3QFZ A;  1AYX A;  3M75 A;  3KSQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...