3HXFB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 32)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
322
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 120
structure length 322
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxfB00
1TN6B 3E37B 1H39A 1TNBB 3RJ3A 4C1SA 1GXNA 3HXEB 2A73B 4GTRB 3D5SA 4GTOB 1TNZB 2BB5A 1X81B 3OEDA 1JCQB 2ZISB 1O6HA 2WIIB 3D5RA 4BOJA 3DPYB 1TNUB 1N94B 5JPMB 2XWBB 1QBQB 4EHMB 1QQFA 3CU7A 4MBGB 4KKIA 2V8IA 3EU5B 1C3DA 3HXDB 1S63B 2V8KA 1N4QB 4FXKB 2BB6A 4LNBB 4D4DA 3KLSA 4GTVB 4L9PB 3HXCB 1MZCB 3E33B 1KZOB 1GXOA 1N4RB 1N9AB 4YDOB 3E30B 1SA5B 2G0DA 1D8EB 1W6JA 2PMVA 1JCRB 1SQCA 1TN7B 1H35A 4LNGB 1UMPA 4V1RA 1O1SB 2BEDB 1NI1B 2B39A 3DSWB 2I07B 1FT2B 3KQ4A 5FOBB 3PZ4B 1NL4B 3Q7AB 1GSZA 5FO8B 1H3AA 3Q79B 2R2LB 1DCEB 3PZ1B 4FXGB 4ONTA 2IEJB 3DSTB 1SA4B 1D8DB 1O6RA 3KSQB 2V3PA 1R76A 3C72B 3DSVB 4KKJA 4GTQB 2PN5A 1H37A 2WY8A 3OXUA 2ZIRB 1TNYB 5JPNB 2V8JA 3Q75B 4ZRQA 1TN8B 3E34B 3DSSB 3E32B 2H6GB 3KSLB 4D4AA 1H36A 4D4CA 1TNOB 4D4BA 1N95B 2NOJA 2WINB 1KZPB 1JCSB 4MU9A 1N4SB 3SQCA 2SQCA 1O79A 2G02A 3DSXB 4GTMB 2BBCA 4LNVA 4V1SA 1W6KA 4D94A 3Q7FB 2XWJB 3PZ2B 1S64B 5AGDA 4YDEB 2H6FB 4GTTB 2H6IB 1LD8B 4M76A 1FPPB 1H3BA 1O1TB 1QSJA 1HZFA 2F0YB 2H6HB 3HXFB 2WY7A 2XQWA 1GXMA 5FO7B 1O6QA 3SFYB 3K7XA 4ZH1A 4GTPB 1N4PB 4ZRPA 1LTXB 3HXBB 2GOXA 5FO9B 1FT1B 1GHQA 1LD7B 3PZ3B 4GTSB 4BOKA 1O5MB 2V3NA 3SFXB 3EUVB 3G6JB 3DSUB 3DRAB 3Q73B 3Q78B 1H3CA 1O1RB
chains in the Genus database with same CATH superfamily
2JF4A 3GLYA 1N20A 2WYNA 1G87A 1GXNA 3M75A 4CE7A 2ZBLA 1TNZB 3W7TA 3GT5A 3PYAA 2XWBB 5DGRA 1KKTA 3SDQA 2V8IA 1RQ5A 3M02A 1G9JA 1FMIA 2F6DA 3PYBA 4GL3A 1N4QB 4FXKB 1WZZA 3KLSA 2GH4A 2P0VA 1X1IA 4L9PB 5CA3A 3SAEA 3EU8A 3QXQA 5IK0A 3TF4A 1N4RB 4YCRA 2DRRA 2NVPA 1GAHA 1D8EB 1HXAA 1RW9A 1TN7B 1LXMA 1UMPA 5IL3A 1O1SB 5DHKA 1KRFA 1OJMA 2FUZA 3WIWA 2B39A 1FT2B 3AFLA 5FOBB 3PZ4B 3E80A 1W3YA 2JJBA 5FO8B 4L6XA 3PZ1B 4ONTA 1FO3A 1OJPA 2B4FA 1XWTA 2V3PA 4OJZA 1FCEA 3QSPA 4AYQA 3W7UA 2ZIRB 1TNYB 1X9DA 4ZRQA 1V7XA 3H3KA 3N0GA 3ACSA 3W7SA 3DSSB 2H6GB 1H36A 2D8LA 3WKGA 1HXGA 2NOJA 4CJ0A 1KZPB 3RRSA 3WUXA 1J0MA 4E1YA 1OJNA 1HN0A 4V1SA 4WVAA 5JMDA 2FV1A 1CB8A 4MMHA 5IKHA 2H6IB 4J5TA 4M76A 1FPPB 1N7NA 1AYXA 4EL8A 1QSJA 3E7JA 3HXFB 2H6HB 4L0GA 1UG9A 3VSMA 3EZ8A 1HXCA 5FO7B 3SFYB 3T33A 3M73A 1N4PB 3M7EA 1UT9A 4Q2BA 1N22A 2GOXA 2EABA 5IK6A 3PZ3B 4GTSB 4BOKA 1O5MB 1OJOA 5IM1A 3DRAB 1FAEA 3M7BA 3E37B 3HXEB 5KKBA 3QFZA 1HV6A 1KS8A 4GTRB 3GZKA 1F1SA 5CZLA 2ZISB 2A8ZA 3D5RA 4BOJA 3DPYB 1N94B 2FV0A 1KFGA 3H7LA 3S4AA 1C82A 3CU7A 1DL2A 1N7QA 4KKIA 3EU5B 3M72A 5MEHA 1H13A 3G4FA 1S63B 3QPFA 3LZ9A 1KZOB 2QNOA 1GXOA 3A0OA 1SA5B 3M77A 2JG0A 2PMVA 1SQCA 1L2AA 4V1RA 3WIRA 1N24A 1IA7A 3A3VA 4OZVA 3CIHA 1H3AA 5M7IA 2R2LB 4F13A 4FXGB 2OKXA 3E73A 3DSVB 4OK4A 2RI8A 2PN5A 3VSNA 3S9VA 4MMIA 3RX7A 2DROA 1J0NA 3WKHA 3E34B 5IKAA 2EAEA 2GZ6A 1DOGA 3KSLB 4D4CA 3WKIA 4GAXA 2WINB 2DRSA 5M7YA 1KSCA 1JCSB 2WDAA 2CQTA 3SQCA 3WKFA 2SQCA 1O79A 4LNVA 1W6KA 3ON6A 3Q7FB 3PZ2B 1S64B 5AGDA 1FP3A 4YDEB 2ZZRA 2H6FB 1LD8B 2D5JA 4WVBA 3VXDA 1WU5A 4CJ1A 3P2CA 1FBOA 4ZG8A 4DODA 2FBAA 1GXMA 1O6QA 4GTPB 5ILJA 1KREA 3QT9A 2AHFA 3QRYA 1RWCA 1V7VA 1LD7B 2BRPA 3QFYA 3SFXB 3EUVB 3H2WA 4NEIA 5ILZA 3NNBA 3D3IA 3G4DA 1TF4A 4KTRA 1O1RB 3E6UA 3QG0A 1TNBB 4C1SA 1HMUA 2A73B 2WCOA 4GTOB 1HCUA 1N23A 1X81B 1JCQB 1V5DA 2WIIB 4DI5A 4DOEA 5JPMB 1QBQB 4AYOA 2FUQA 1N21A 4TF4A 4FUSA 3SDVA 2DRQA 1G9GA 3HXDB 4LNBB 1WU6A 1LXKA 4GTVB 4TXTA 3P5PA 1MZCB 1RWFA 1N9AB 4YDOB 3E30B 2Z07A 3SDTA 2G0DA 1LF9A 1W6JA 1JS4A 1RWHA 5DHIA 1GAIA 1F9GA 4F10A 1H35A 4LNGB 3M01A 1GA2A 1LOHA 1NL4B 3AFJA 3Q7AB 2FUTA 3M76A 2AFAA 1CLCA 1DCEB 4AYPA 2IEJB 3DSTB 1O6RA 3QT3A 3C72B 1R76A 3RSYA 5ILYA 5ILIA 4GTQB 1F9OA 1H37A 3W7WA 2WY8A 3OXUA 1N1ZA 2YIKA 5GY3A 1XW2A 5JPNB 2V8JA 2AHGA 3NFVA 1TNOB 2E24A 4D4BA 1N95B 5EATA 5GW7A 1IS9A 3M00A 1N4SB 1QAZA 5CD2A 3DSXB 1L1YA 3P5RA 1K72A 1KWFA 2Q1FA 4OK2A 3SDUA 4QT9A 2EADA 5IL8A 2ONGA 3SDRA 1O1TB 3W5MA 1X1HA 1HZFA 1HX9A 2F0YB 2WY7A 1X1JA 3K7XA 4ZH1A 4Z4LA 4Z4JA 4ZRPA 1LTXB 5FO9B 3K11A 1ULVA 3ANIA 1FT1B 1GHQA 3QWTA 2V3NA 5DGQA 1I8QA 3WC3A 4KTPA 1TN6B 2X03A 1H39A 3VW5A 3RJ3A 4AYRA 1G6IA 1NXCA 3D5SA 2BB5A 3OEDA 5E2JA 3S4BA 1O6HA 1TNUB 1WU4A 3QDEA 4EHMB 1QQFA 2RGKA 4ZH5A 5EAUA 3W7XA 4MBGB 1C3DA 3ACTA 2ONHA 4JJJA 2V8KA 1N7RA 2BB6A 4LIXA 3ANKA 4D4DA 3HXCB 3E33B 3RENA 1JCRB 4RNQA 5EASA 1IA6A 4XUVA 1KSDA 4OZWA 2BEDB 1NI1B 3M7LA 4FNVA 3DSWB 2I07B 3KQ4A 1V7WA 3ANJA 2EACA 1GSZA 1NC5A 3Q79B 1N7OA 5C05A 2J5CA 1HM3A 3M7CA 3S4DA 5IK9A 1SA4B 1D8DB 2VN7A 3KSQB 3M78A 1N7PA 4KKJA 1HM2A 5JMFA 4WVCA 3RX5A 4FJQA 1RWAA 3M74A 3Q75B 1TN8B 1H14A 3E32B 3N0FA 4D4AA 2CQSA 4WU0A 1N1BA 1GLMA 4MU9A 2BRWA 2RI9A 2BRVX 2G02A 1RWGA 2BBCA 4GTMB 5ILDA 4D94A 3RX8A 2XWJB 1FBWA 4Q88A 1H12A 1LF6A 3PMMA 4GTTB 3EQAA 1F9DA 3X17A 1V5CA 1VD5A 1H3BA 3S4CA 1XWQA 2XQWA 5ILKA 2VN4A 3HXBB 5GZKA 2XFGA 3M71A 3WIQA 5ILHA 1H54A 2E22A 1FO2A 1CEMA 1EGUA 3G6JB 3DSUB 3Q73B 3Q78B 1H3CA 3QXFA 1AGMA 3W5NA 1HMWA
chains in the Genus database with same CATH topology
2JF4A 3GLYA 2WYNA 1G87A 1GXNA 3M75A 4CE7A 2ZBLA 1TNZB 3W7TA 3GT5A 3PYAA 2XWBB 5DGRA 1KKTA 3SDQA 2V8IA 1RQ5A 1G9JA 1FMIA 2F6DA 3PYBA 4GL3A 1N4QB 4FXKB 1WZZA 3KLSA 2GH4A 2P0VA 4L9PB 3SAEA 5CA3A 3EU8A 3QXQA 3TF4A 1N4RB 4YCRA 2DRRA 2NVPA 1GAHA 1D8EB 1TN7B 1UMPA 1O1SB 1KRFA 2FUZA 3WIWA 2B39A 1FT2B 5FOBB 3PZ4B 2JJBA 5FO8B 4L6XA 3PZ1B 4ONTA 1FO3A 2B4FA 1XWTA 2V3PA 1FCEA 3QSPA 4AYQA 3W7UA 2ZIRB 1TNYB 1X9DA 4ZRQA 1V7XA 3H3KA 3ACSA 3W7SA 3DSSB 2H6GB 1H36A 2D8LA 3WKGA 2NOJA 4CJ0A 1KZPB 3RRSA 3WUXA 4V1SA 4WVAA 2FV1A 2H6IB 4J5TA 4M76A 1FPPB 1AYXA 4EL8A 1QSJA 3HXFB 2H6HB 4L0GA 1UG9A 3EZ8A 5FO7B 3SFYB 3T33A 3M73A 1N4PB 3M7EA 1UT9A 4Q2BA 2GOXA 2EABA 3PZ3B 4GTSB 4BOKA 1O5MB 3DRAB 1FAEA 3M7BA 3E37B 3HXEB 5KKBA 3QFZA 1KS8A 4GTRB 3GZKA 5CZLA 2ZISB 2A8ZA 3D5RA 4BOJA 3DPYB 1N94B 2FV0A 1KFGA 3H7LA 3S4AA 3CU7A 1DL2A 4KKIA 3EU5B 3M72A 5MEHA 1H13A 1S63B 3QPFA 1KZOB 2QNOA 1GXOA 1SA5B 3M77A 2JG0A 2PMVA 1SQCA 1L2AA 4V1RA 3WIRA 1IA7A 3A3VA 3CIHA 1H3AA 5M7IA 2R2LB 4FXGB 2OKXA 3E73A 3DSVB 2RI8A 2PN5A 3S9VA 3RX7A 2DROA 3WKHA 3E34B 2EAEA 2GZ6A 1DOGA 3KSLB 4D4CA 3WKIA 2WINB 2DRSA 5M7YA 1KSCA 1JCSB 2CQTA 3SQCA 3WKFA 2SQCA 1O79A 4LNVA 1W6KA 3ON6A 3Q7FB 3PZ2B 1S64B 5AGDA 1FP3A 4YDEB 2ZZRA 2H6FB 1LD8B 2D5JA 4WVBA 3VXDA 1WU5A 4CJ1A 3P2CA 1FBOA 4ZG8A 4DODA 2FBAA 1GXMA 1O6QA 4GTPB 1KREA 3QT9A 2AHFA 3QRYA 1V7VA 1LD7B 3QFYA 3SFXB 3EUVB 3H2WA 3D3IA 1TF4A 4KTRA 1O1RB 3E6UA 3QG0A 1TNBB 4C1SA 2A73B 4GTOB 1HCUA 1X81B 1JCQB 1V5DA 2WIIB 4DOEA 5JPMB 1QBQB 4AYOA 4TF4A 4FUSA 3SDVA 2DRQA 1G9GA 3HXDB 4LNBB 1WU6A 4TXTA 4GTVB 3P5PA 1MZCB 1N9AB 4YDOB 3E30B 2Z07A 3SDTA 2G0DA 1LF9A 1W6JA 1JS4A 1GAIA 1H35A 4LNGB 1GA2A 1NL4B 3AFJA 3Q7AB 3M76A 2AFAA 1CLCA 1DCEB 4AYPA 2IEJB 3DSTB 1O6RA 3QT3A 3C72B 1R76A 3RSYA 4GTQB 1F9OA 1H37A 3W7WA 2WY8A 3OXUA 2YIKA 5GY3A 1XW2A 5JPNB 2V8JA 2AHGA 1TNOB 4D4BA 1N95B 5GW7A 1IS9A 1N4SB 5CD2A 3DSXB 1L1YA 3P5RA 1K72A 1KWFA 3SDUA 4QT9A 2EADA 3SDRA 1O1TB 3W5MA 1HZFA 2F0YB 2WY7A 3K7XA 4ZH1A 4Z4LA 4Z4JA 4ZRPA 1LTXB 5FO9B 3K11A 1ULVA 3ANIA 1FT1B 1GHQA 3QWTA 2V3NA 5DGQA 3WC3A 4KTPA 1TN6B 1H39A 3VW5A 3RJ3A 4AYRA 1G6IA 1NXCA 3D5SA 2BB5A 3OEDA 5E2JA 3S4BA 1O6HA 1TNUB 1WU4A 3QDEA 4EHMB 1QQFA 2RGKA 4ZH5A 3W7XA 4MBGB 1C3DA 3ACTA 4JJJA 2V8KA 2BB6A 4LIXA 3ANKA 4D4DA 3HXCB 3E33B 3RENA 1JCRB 1IA6A 4XUVA 1KSDA 2BEDB 1NI1B 3M7LA 3DSWB 2I07B 3KQ4A 1V7WA 3ANJA 2EACA 1GSZA 1NC5A 3Q79B 3M7CA 3S4DA 1SA4B 1D8DB 2VN7A 3KSQB 3M78A 4KKJA 4WVCA 3RX5A 3M74A 3Q75B 1TN8B 1H14A 3E32B 4D4AA 2CQSA 4WU0A 1GLMA 4MU9A 2RI9A 2G02A 4GTMB 2BBCA 4D94A 3RX8A 2XWJB 1FBWA 4Q88A 1H12A 1LF6A 3PMMA 4GTTB 3EQAA 1F9DA 3X17A 1V5CA 1VD5A 1H3BA 3S4CA 1XWQA 2XQWA 2VN4A 3HXBB 5GZKA 2XFGA 3M71A 3WIQA 1H54A 1FO2A 1CEMA 3G6JB 3DSUB 3Q73B 3Q78B 1H3CA 3QXFA 1AGMA 3W5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN6 B;  3E37 B;  1H39 A;  1TNB B;  3RJ3 A;  4C1S A;  1GXN A;  3HXE B;  2A73 B;  4GTR B;  3D5S A;  4GTO B;  1TNZ B;  2BB5 A;  1X81 B;  3OED A;  1JCQ B;  2ZIS B;  1O6H A;  2WII B;  3D5R A;  4BOJ A;  3DPY B;  1TNU B;  1N94 B;  5JPM B;  2XWB B;  1QBQ B;  4EHM B;  1QQF A;  3CU7 A;  4MBG B;  4KKI A;  2V8I A;  3EU5 B;  1C3D A;  3HXD B;  1S63 B;  2V8K A;  1N4Q B;  4FXK B;  2BB6 A;  4LNB B;  4D4D A;  3KLS A;  4GTV B;  4L9P B;  3HXC B;  1MZC B;  3E33 B;  1KZO B;  1GXO A;  1N4R B;  1N9A B;  4YDO B;  3E30 B;  1SA5 B;  2G0D A;  1D8E B;  1W6J A;  2PMV A;  1JCR B;  1SQC A;  1TN7 B;  1H35 A;  4LNG B;  1UMP A;  4V1R A;  1O1S B;  2BED B;  1NI1 B;  2B39 A;  3DSW B;  2I07 B;  1FT2 B;  3KQ4 A;  5FOB B;  3PZ4 B;  1NL4 B;  3Q7A B;  1GSZ A;  5FO8 B;  1H3A A;  3Q79 B;  2R2L B;  1DCE B;  3PZ1 B;  4FXG B;  4ONT A;  2IEJ B;  3DST B;  1SA4 B;  1D8D B;  1O6R A;  3KSQ B;  2V3P A;  1R76 A;  3C72 B;  3DSV B;  4KKJ A;  4GTQ B;  2PN5 A;  1H37 A;  2WY8 A;  3OXU A;  2ZIR B;  1TNY B;  5JPN B;  2V8J A;  3Q75 B;  4ZRQ A;  1TN8 B;  3E34 B;  3DSS B;  3E32 B;  2H6G B;  3KSL B;  4D4A A;  1H36 A;  4D4C A;  1TNO B;  4D4B A;  1N95 B;  2NOJ A;  2WIN B;  1KZP B;  1JCS B;  4MU9 A;  1N4S B;  3SQC A;  2SQC A;  1O79 A;  2G02 A;  3DSX B;  4GTM B;  2BBC A;  4LNV A;  4V1S A;  1W6K A;  4D94 A;  3Q7F B;  2XWJ B;  3PZ2 B;  1S64 B;  5AGD A;  4YDE B;  2H6F B;  4GTT B;  2H6I B;  1LD8 B;  4M76 A;  1FPP B;  1H3B A;  1O1T B;  1QSJ A;  1HZF A;  2F0Y B;  2H6H B;  3HXF B;  2WY7 A;  2XQW A;  1GXM A;  5FO7 B;  1O6Q A;  3SFY B;  3K7X A;  4ZH1 A;  4GTP B;  1N4P B;  4ZRP A;  1LTX B;  3HXB B;  2GOX A;  5FO9 B;  1FT1 B;  1GHQ A;  1LD7 B;  3PZ3 B;  4GTS B;  4BOK A;  1O5M B;  2V3N A;  3SFX B;  3EUV B;  3G6J B;  3DSU B;  3DRA B;  3Q73 B;  3Q78 B;  1H3C A;  1O1R B; 
#chains in the Genus database with same CATH topology
 2JF4 A;  3GLY A;  1N20 A;  2WYN A;  1G87 A;  1GXN A;  3M75 A;  4CE7 A;  2ZBL A;  1TNZ B;  3W7T A;  3GT5 A;  3PYA A;  2XWB B;  5DGR A;  1KKT A;  3SDQ A;  2V8I A;  1RQ5 A;  3M02 A;  1G9J A;  1FMI A;  2F6D A;  3PYB A;  4GL3 A;  1N4Q B;  4FXK B;  1WZZ A;  3KLS A;  2GH4 A;  2P0V A;  1X1I A;  4L9P B;  5CA3 A;  3SAE A;  3EU8 A;  3QXQ A;  5IK0 A;  3TF4 A;  1N4R B;  4YCR A;  2DRR A;  2NVP A;  1GAH A;  1D8E B;  1HXA A;  1RW9 A;  1TN7 B;  1LXM A;  1UMP A;  5IL3 A;  1O1S B;  5DHK A;  1KRF A;  1OJM A;  2FUZ A;  3WIW A;  2B39 A;  1FT2 B;  3AFL A;  5FOB B;  3PZ4 B;  3E80 A;  1W3Y A;  2JJB A;  5FO8 B;  4L6X A;  3PZ1 B;  4ONT A;  1FO3 A;  1OJP A;  2B4F A;  1XWT A;  2V3P A;  4OJZ A;  1FCE A;  3QSP A;  4AYQ A;  3W7U A;  2ZIR B;  1TNY B;  1X9D A;  4ZRQ A;  1V7X A;  3H3K A;  3N0G A;  3ACS A;  3W7S A;  3DSS B;  2H6G B;  1H36 A;  2D8L A;  3WKG A;  1HXG A;  2NOJ A;  4CJ0 A;  1KZP B;  3RRS A;  3WUX A;  1J0M A;  4E1Y A;  1OJN A;  1HN0 A;  4V1S A;  4WVA A;  5JMD A;  2FV1 A;  1CB8 A;  4MMH A;  5IKH A;  2H6I B;  4J5T A;  4M76 A;  1FPP B;  1N7N A;  1AYX A;  4EL8 A;  1QSJ A;  3E7J A;  3HXF B;  2H6H B;  4L0G A;  1UG9 A;  3VSM A;  3EZ8 A;  1HXC A;  5FO7 B;  3SFY B;  3T33 A;  3M73 A;  1N4P B;  3M7E A;  1UT9 A;  4Q2B A;  1N22 A;  2GOX A;  2EAB A;  5IK6 A;  3PZ3 B;  4GTS B;  4BOK A;  1O5M B;  1OJO A;  5IM1 A;  3DRA B;  1FAE A;  3M7B A;  3E37 B;  3HXE B;  5KKB A;  3QFZ A;  1HV6 A;  1KS8 A;  4GTR B;  3GZK A;  1F1S A;  5CZL A;  2ZIS B;  2A8Z A;  3D5R A;  4BOJ A;  3DPY B;  1N94 B;  2FV0 A;  1KFG A;  3H7L A;  3S4A A;  1C82 A;  3CU7 A;  1DL2 A;  1N7Q A;  4KKI A;  3EU5 B;  3M72 A;  5MEH A;  1H13 A;  3G4F A;  1S63 B;  3QPF A;  3LZ9 A;  1KZO B;  2QNO A;  1GXO A;  3A0O A;  1SA5 B;  3M77 A;  2JG0 A;  2PMV A;  1SQC A;  1L2A A;  4V1R A;  3WIR A;  1N24 A;  1IA7 A;  3A3V A;  4OZV A;  3CIH A;  1H3A A;  5M7I A;  2R2L B;  4F13 A;  4FXG B;  2OKX A;  3E73 A;  3DSV B;  4OK4 A;  2RI8 A;  2PN5 A;  3VSN A;  3S9V A;  4MMI A;  3RX7 A;  2DRO A;  1J0N A;  3WKH A;  3E34 B;  5IKA A;  2EAE A;  2GZ6 A;  1DOG A;  3KSL B;  4D4C A;  3WKI A;  4GAX A;  2WIN B;  2DRS A;  5M7Y A;  1KSC A;  1JCS B;  2WDA A;  2CQT A;  3SQC A;  3WKF A;  2SQC A;  1O79 A;  4LNV A;  1W6K A;  3ON6 A;  3Q7F B;  3PZ2 B;  1S64 B;  5AGD A;  1FP3 A;  4YDE B;  2ZZR A;  2H6F B;  1LD8 B;  2D5J A;  4WVB A;  3VXD A;  1WU5 A;  4CJ1 A;  3P2C A;  1FBO A;  4ZG8 A;  4DOD A;  2FBA A;  1GXM A;  1O6Q A;  4GTP B;  5ILJ A;  1KRE A;  3QT9 A;  2AHF A;  3QRY A;  1RWC A;  1V7V A;  1LD7 B;  2BRP A;  3QFY A;  3SFX B;  3EUV B;  3H2W A;  4NEI A;  5ILZ A;  3NNB A;  3D3I A;  3G4D A;  1TF4 A;  4KTR A;  1O1R B;  3E6U A;  3QG0 A;  1TNB B;  4C1S A;  1HMU A;  2A73 B;  2WCO A;  4GTO B;  1HCU A;  1N23 A;  1X81 B;  1JCQ B;  1V5D A;  2WII B;  4DI5 A;  4DOE A;  5JPM B;  1QBQ B;  4AYO A;  2FUQ A;  1N21 A;  4TF4 A;  4FUS A;  3SDV A;  2DRQ A;  1G9G A;  3HXD B;  4LNB B;  1WU6 A;  1LXK A;  4GTV B;  4TXT A;  3P5P A;  1MZC B;  1RWF A;  1N9A B;  4YDO B;  3E30 B;  2Z07 A;  3SDT A;  2G0D A;  1LF9 A;  1W6J A;  1JS4 A;  1RWH A;  5DHI A;  1GAI A;  1F9G A;  4F10 A;  1H35 A;  4LNG B;  3M01 A;  1GA2 A;  1LOH A;  1NL4 B;  3AFJ A;  3Q7A B;  2FUT A;  3M76 A;  2AFA A;  1CLC A;  1DCE B;  4AYP A;  2IEJ B;  3DST B;  1O6R A;  3QT3 A;  3C72 B;  1R76 A;  3RSY A;  5ILY A;  5ILI A;  4GTQ B;  1F9O A;  1H37 A;  3W7W A;  2WY8 A;  3OXU A;  1N1Z A;  2YIK A;  5GY3 A;  1XW2 A;  5JPN B;  2V8J A;  2AHG A;  3NFV A;  1TNO B;  2E24 A;  4D4B A;  1N95 B;  5EAT A;  5GW7 A;  1IS9 A;  3M00 A;  1N4S B;  1QAZ A;  5CD2 A;  3DSX B;  1L1Y A;  3P5R A;  1K72 A;  1KWF A;  2Q1F A;  4OK2 A;  3SDU A;  4QT9 A;  2EAD A;  5IL8 A;  2ONG A;  3SDR A;  1O1T B;  3W5M A;  1X1H A;  1HZF A;  1HX9 A;  2F0Y B;  2WY7 A;  1X1J A;  3K7X A;  4ZH1 A;  4Z4L A;  4Z4J A;  4ZRP A;  1LTX B;  5FO9 B;  3K11 A;  1ULV A;  3ANI A;  1FT1 B;  1GHQ A;  3QWT A;  2V3N A;  5DGQ A;  1I8Q A;  3WC3 A;  4KTP A;  1TN6 B;  2X03 A;  1H39 A;  3VW5 A;  3RJ3 A;  4AYR A;  1G6I A;  1NXC A;  3D5S A;  2BB5 A;  3OED A;  5E2J A;  3S4B A;  1O6H A;  1TNU B;  1WU4 A;  3QDE A;  4EHM B;  1QQF A;  2RGK A;  4ZH5 A;  5EAU A;  3W7X A;  4MBG B;  1C3D A;  3ACT A;  2ONH A;  4JJJ A;  2V8K A;  1N7R A;  2BB6 A;  4LIX A;  3ANK A;  4D4D A;  3HXC B;  3E33 B;  3REN A;  1JCR B;  4RNQ A;  5EAS A;  1IA6 A;  4XUV A;  1KSD A;  4OZW A;  2BED B;  1NI1 B;  3M7L A;  4FNV A;  3DSW B;  2I07 B;  3KQ4 A;  1V7W A;  3ANJ A;  2EAC A;  1GSZ A;  1NC5 A;  3Q79 B;  1N7O A;  5C05 A;  2J5C A;  1HM3 A;  3M7C A;  3S4D A;  5IK9 A;  1SA4 B;  1D8D B;  2VN7 A;  3KSQ B;  3M78 A;  1N7P A;  4KKJ A;  1HM2 A;  5JMF A;  4WVC A;  3RX5 A;  4FJQ A;  1RWA A;  3M74 A;  3Q75 B;  1TN8 B;  1H14 A;  3E32 B;  3N0F A;  4D4A A;  2CQS A;  4WU0 A;  1N1B A;  1GLM A;  4MU9 A;  2BRW A;  2RI9 A;  2BRV X;  2G02 A;  1RWG A;  2BBC A;  4GTM B;  5ILD A;  4D94 A;  3RX8 A;  2XWJ B;  1FBW A;  4Q88 A;  1H12 A;  1LF6 A;  3PMM A;  4GTT B;  3EQA A;  1F9D A;  3X17 A;  1V5C A;  1VD5 A;  1H3B A;  3S4C A;  1XWQ A;  2XQW A;  5ILK A;  2VN4 A;  3HXB B;  5GZK A;  2XFG A;  3M71 A;  3WIQ A;  5ILH A;  1H54 A;  2E22 A;  1FO2 A;  1CEM A;  1EGU A;  3G6J B;  3DSU B;  3Q73 B;  3Q78 B;  1H3C A;  3QXF A;  1AGM A;  3W5N A;  1HMW A; 
#chains in the Genus database with same CATH homology
 2JF4 A;  3GLY A;  2WYN A;  1G87 A;  1GXN A;  3M75 A;  4CE7 A;  2ZBL A;  1TNZ B;  3W7T A;  3GT5 A;  3PYA A;  2XWB B;  5DGR A;  1KKT A;  3SDQ A;  2V8I A;  1RQ5 A;  1G9J A;  1FMI A;  2F6D A;  3PYB A;  4GL3 A;  1N4Q B;  4FXK B;  1WZZ A;  3KLS A;  2GH4 A;  2P0V A;  4L9P B;  3SAE A;  5CA3 A;  3EU8 A;  3QXQ A;  3TF4 A;  1N4R B;  4YCR A;  2DRR A;  2NVP A;  1GAH A;  1D8E B;  1TN7 B;  1UMP A;  1O1S B;  1KRF A;  2FUZ A;  3WIW A;  2B39 A;  1FT2 B;  5FOB B;  3PZ4 B;  2JJB A;  5FO8 B;  4L6X A;  3PZ1 B;  4ONT A;  1FO3 A;  2B4F A;  1XWT A;  2V3P A;  1FCE A;  3QSP A;  4AYQ A;  3W7U A;  2ZIR B;  1TNY B;  1X9D A;  4ZRQ A;  1V7X A;  3H3K A;  3ACS A;  3W7S A;  3DSS B;  2H6G B;  1H36 A;  2D8L A;  3WKG A;  2NOJ A;  4CJ0 A;  1KZP B;  3RRS A;  3WUX A;  4V1S A;  4WVA A;  2FV1 A;  2H6I B;  4J5T A;  4M76 A;  1FPP B;  1AYX A;  4EL8 A;  1QSJ A;  3HXF B;  2H6H B;  4L0G A;  1UG9 A;  3EZ8 A;  5FO7 B;  3SFY B;  3T33 A;  3M73 A;  1N4P B;  3M7E A;  1UT9 A;  4Q2B A;  2GOX A;  2EAB A;  3PZ3 B;  4GTS B;  4BOK A;  1O5M B;  3DRA B;  1FAE A;  3M7B A;  3E37 B;  3HXE B;  5KKB A;  3QFZ A;  1KS8 A;  4GTR B;  3GZK A;  5CZL A;  2ZIS B;  2A8Z A;  3D5R A;  4BOJ A;  3DPY B;  1N94 B;  2FV0 A;  1KFG A;  3H7L A;  3S4A A;  3CU7 A;  1DL2 A;  4KKI A;  3EU5 B;  3M72 A;  5MEH A;  1H13 A;  1S63 B;  3QPF A;  1KZO B;  2QNO A;  1GXO A;  1SA5 B;  3M77 A;  2JG0 A;  2PMV A;  1SQC A;  1L2A A;  4V1R A;  3WIR A;  1IA7 A;  3A3V A;  3CIH A;  1H3A A;  5M7I A;  2R2L B;  4FXG B;  2OKX A;  3E73 A;  3DSV B;  2RI8 A;  2PN5 A;  3S9V A;  3RX7 A;  2DRO A;  3WKH A;  3E34 B;  2EAE A;  2GZ6 A;  1DOG A;  3KSL B;  4D4C A;  3WKI A;  2WIN B;  2DRS A;  5M7Y A;  1KSC A;  1JCS B;  2CQT A;  3SQC A;  3WKF A;  2SQC A;  1O79 A;  4LNV A;  1W6K A;  3ON6 A;  3Q7F B;  3PZ2 B;  1S64 B;  5AGD A;  1FP3 A;  4YDE B;  2ZZR A;  2H6F B;  1LD8 B;  2D5J A;  4WVB A;  3VXD A;  1WU5 A;  4CJ1 A;  3P2C A;  1FBO A;  4ZG8 A;  4DOD A;  2FBA A;  1GXM A;  1O6Q A;  4GTP B;  1KRE A;  3QT9 A;  2AHF A;  3QRY A;  1V7V A;  1LD7 B;  3QFY A;  3SFX B;  3EUV B;  3H2W A;  3D3I A;  1TF4 A;  4KTR A;  1O1R B;  3E6U A;  3QG0 A;  1TNB B;  4C1S A;  2A73 B;  4GTO B;  1HCU A;  1X81 B;  1JCQ B;  1V5D A;  2WII B;  4DOE A;  5JPM B;  1QBQ B;  4AYO A;  4TF4 A;  4FUS A;  3SDV A;  2DRQ A;  1G9G A;  3HXD B;  4LNB B;  1WU6 A;  4TXT A;  4GTV B;  3P5P A;  1MZC B;  1N9A B;  4YDO B;  3E30 B;  2Z07 A;  3SDT A;  2G0D A;  1LF9 A;  1W6J A;  1JS4 A;  1GAI A;  1H35 A;  4LNG B;  1GA2 A;  1NL4 B;  3AFJ A;  3Q7A B;  3M76 A;  2AFA A;  1CLC A;  1DCE B;  4AYP A;  2IEJ B;  3DST B;  1O6R A;  3QT3 A;  3C72 B;  1R76 A;  3RSY A;  4GTQ B;  1F9O A;  1H37 A;  3W7W A;  2WY8 A;  3OXU A;  2YIK A;  5GY3 A;  1XW2 A;  5JPN B;  2V8J A;  2AHG A;  1TNO B;  4D4B A;  1N95 B;  5GW7 A;  1IS9 A;  1N4S B;  5CD2 A;  3DSX B;  1L1Y A;  3P5R A;  1K72 A;  1KWF A;  3SDU A;  4QT9 A;  2EAD A;  3SDR A;  1O1T B;  3W5M A;  1HZF A;  2F0Y B;  2WY7 A;  3K7X A;  4ZH1 A;  4Z4L A;  4Z4J A;  4ZRP A;  1LTX B;  5FO9 B;  3K11 A;  1ULV A;  3ANI A;  1FT1 B;  1GHQ A;  3QWT A;  2V3N A;  5DGQ A;  3WC3 A;  4KTP A;  1TN6 B;  1H39 A;  3VW5 A;  3RJ3 A;  4AYR A;  1G6I A;  1NXC A;  3D5S A;  2BB5 A;  3OED A;  5E2J A;  3S4B A;  1O6H A;  1TNU B;  1WU4 A;  3QDE A;  4EHM B;  1QQF A;  2RGK A;  4ZH5 A;  3W7X A;  4MBG B;  1C3D A;  3ACT A;  4JJJ A;  2V8K A;  2BB6 A;  4LIX A;  3ANK A;  4D4D A;  3HXC B;  3E33 B;  3REN A;  1JCR B;  1IA6 A;  4XUV A;  1KSD A;  2BED B;  1NI1 B;  3M7L A;  3DSW B;  2I07 B;  3KQ4 A;  1V7W A;  3ANJ A;  2EAC A;  1GSZ A;  1NC5 A;  3Q79 B;  3M7C A;  3S4D A;  1SA4 B;  1D8D B;  2VN7 A;  3KSQ B;  3M78 A;  4KKJ A;  4WVC A;  3RX5 A;  3M74 A;  3Q75 B;  1TN8 B;  1H14 A;  3E32 B;  4D4A A;  2CQS A;  4WU0 A;  1GLM A;  4MU9 A;  2RI9 A;  2G02 A;  4GTM B;  2BBC A;  4D94 A;  3RX8 A;  2XWJ B;  1FBW A;  4Q88 A;  1H12 A;  1LF6 A;  3PMM A;  4GTT B;  3EQA A;  1F9D A;  3X17 A;  1V5C A;  1VD5 A;  1H3B A;  3S4C A;  1XWQ A;  2XQW A;  2VN4 A;  3HXB B;  5GZK A;  2XFG A;  3M71 A;  3WIQ A;  1H54 A;  1FO2 A;  1CEM A;  3G6J B;  3DSU B;  3Q73 B;  3Q78 B;  1H3C A;  3QXF A;  1AGM A;  3W5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...