3HXFB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 32)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
322
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 120
structure length 322
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxfB00
4KKIA 1HZFA 3PZ4B 2V3NA 1LD8B 1FT2B 4D4DA 2V8KA 1SQCA 3EU5B 3DSTB 4EHMB 4ZRPA 1TNUB 4GTQB 1DCEB 3Q73B 4GTVB 3KSLB 3RJ3A 1N4QB 1LTXB 1GSZA 1H37A 2PN5A 1FPPB 1TN8B 5AGDA 1QBQB 5FOBB 1O6HA 2SQCA 3DSVB 4M76A 2WINB 2WY8A 3KQ4A 2H6FB 1X81B 5JPMB 2H6IB 2V8IA 2H6GB 3E34B 4BOJA 3CU7A 2BEDB 3KSQB 2R2LB 2A73B 1NI1B 3SFXB 4D94A 2BBCA 1C3DA 2B39A 3D5RA 1H36A 4D4AA 3D5SA 1TNYB 3PZ1B 1TN7B 1S64B 1SA5B 1O6QA 4D4BA 1MZCB 4FXGB 4ZRQA 2G02A 3HXBB 3KLSA 4YDOB 5JPNB 2G0DA 2WIIB 1H3AA 1JCSB 3K7XA 3Q78B 1O79A 3HXCB 4GTMB 1QQFA 3Q7AB 2V3PA 5FO8B 1GXOA 4BOKA 3OEDA 2H6HB 3HXEB 3Q79B 4D4CA 1O5MB 1GXMA 3C72B 1QSJA 3DSSB 1N4PB 2IEJB 2PMVA 1N4SB 3PZ3B 1H3CA 4YDEB 2NOJA 4LNVA 3HXDB 2ZISB 1UMPA 1NL4B 1O1TB 4ONTA 3E37B 1D8DB 1JCQB 1KZOB 1O1SB 2F0YB 4GTTB 2XWJB 4C1SA 3DSXB 4GTPB 2BB6A 4LNGB 1TN6B 3E30B 1N94B 1KZPB 1TNBB 1GHQA 1W6JA 1H3BA 4MU9A 1TNOB 1N9AB 1JCRB 3EUVB 2XQWA 3G6JB 4FXKB 1GXNA 3SQCA 3Q7FB 3HXFB 4MBGB 2ZIRB 3DRAB 4L9PB 3SFYB 1S63B 3OXUA 1H35A 1N95B 1D8EB 3DSWB 1R76A 3PZ2B 4GTSB 5FO9B 4V1RA 1SA4B 1TNZB 1H39A 3DPYB 3E32B 2GOXA 2V8JA 2I07B 1LD7B 2WY7A 5FO7B 4KKJA 4LNBB 3E33B 2BB5A 4V1SA 2XWBB 3Q75B 1FT1B 1O6RA 4ZH1A 3DSUB 1O1RB 1W6KA 4GTRB 4GTOB 1N4RB
chains in the Genus database with same CATH superfamily
1N7OA 2BRPA 1AGMA 2V3NA 3W7UA 2FUZA 2CQTA 4EHMB 3W5NA 3EZ8A 1N23A 3QSPA 1HM3A 3RJ3A 1N4QB 3SDQA 1H37A 1X1IA 4GL3A 1FPPB 3PYBA 1O6HA 4M76A 2RI9A 2H6FB 2B4FA 4GAXA 2V8IA 3W5MA 3E34B 5M7YA 1V7WA 1N1ZA 3QFYA 1G87A 3AFJA 2BBCA 1HN0A 2X03A 2AHFA 3D5RA 1NXCA 1TNYB 3N0FA 3AFLA 3PZ1B 5E2JA 1TN7B 1S64B 4ZRQA 4YDOB 5JMDA 2G0DA 2WIIB 3QT9A 1DL2A 1QQFA 2DRQA 1HCUA 1GXOA 1GXMA 1QSJA 1N4PB 2PMVA 1WU4A 1CB8A 4QT9A 4WVCA 2GH4A 2FBAA 1KSDA 5ILYA 3P5PA 1KZOB 3ANIA 1O1SB 1KS8A 5IM1A 4DODA 4LNGB 3WKFA 3S4AA 3M77A 3RX5A 3W7TA 1RWGA 5EATA 1TNOB 1H13A 1FO2A 3EUVB 3SAEA 2YIKA 4KTRA 2XQWA 3HXFB 1X1HA 3M78A 3PYAA 1XWTA 3E6UA 3P2CA 1FBWA 4WU0A 4XUVA 1S63B 3OXUA 1N95B 3M7LA 1IS9A 3M74A 1G9GA 4KTPA 1H39A 2GOXA 1G9JA 2I07B 2WY7A 3E33B 1LF9A 3M02A 1H14A 4V1SA 1FT1B 1O1RB 1W6KA 2WDAA 3QPFA 3WIWA 4GTOB 1CEMA 1FAEA 4FJQA 4F10A 5CA3A 1LD8B 1KFGA 1HX9A 1V7VA 4ZRPA 3QWTA 2DROA 1TNUB 3ACTA 4GTVB 1N21A 4AYQA 4LIXA 2NVPA 1GSZA 3VSNA 1F1SA 2PN5A 5KKBA 1TN8B 5ILIA 4FNVA 5FOBB 3S9VA 3E73A 2WY8A 1X81B 4TF4A 1H12A 2RGKA 1DOGA 4WVBA 3CU7A 4Z4JA 1KKTA 2BEDB 2DRSA 4ZH5A 5IK0A 2A73B 3GT5A 1XWQA 1OJOA 4CJ0A 3SDTA 3SFXB 4D94A 1OJNA 2B39A 1LF6A 3D5SA 4OZVA 3RRSA 1HV6A 1MZCB 4FXGB 2G02A 3HXBB 5JPNB 1H3AA 5DHKA 5IK6A 1QAZA 3CIHA 3E80A 4YCRA 3HXEB 4D4CA 2ONGA 3W7SA 2ZBLA 3M7BA 2VN7A 3ANJA 4AYOA 1H3CA 2NOJA 3WKIA 2E24A 2ZZRA 4ONTA 3E37B 1D8DB 2WCOA 3GLYA 4EL8A 2XWJB 2D8LA 3DSXB 4GTPB 2AHGA 1RWAA 4WVAA 5ILHA 1GHQA 1W6JA 1H3BA 1N9AB 2CQSA 5ILZA 3G6JB 4FXKB 3NFVA 2E22A 3EQAA 3QT3A 2ZIRB 2BRWA 3M7EA 1H35A 3RSYA 2WYNA 3DSWB 4RNQA 1J0NA 1R76A 3S4DA 5FO9B 1FO3A 2GZ6A 2ONHA 1TNZB 3E32B 2V8JA 3WIRA 2QNOA 1RWFA 1HXCA 3TF4A 3RENA 4KKJA 1TF4A 1KREA 2FV1A 2XWBB 4GTRB 1N4RB 3VW5A 2P0VA 4L6XA 3WC3A 1FT2B 2V8KA 5EASA 4E1YA 3EU5B 3DSTB 2EADA 3KSLB 1I8QA 3ACSA 1LTXB 4L0GA 1GAHA 3WKGA 4ZG8A 1QBQB 1CLCA 3PMMA 3WKHA 4AYRA 2SQCA 3DSVB 1F9DA 2WINB 3S4BA 5JPMB 2H6IB 2H6GB 3W7WA 1UG9A 1FBOA 3KSQB 2R2LB 3X17A 1EGUA 1NI1B 1KRFA 5EAUA 2VN4A 1HMWA 1N7QA 4JJJA 3GZKA 2FUQA 3H3KA 3KLSA 3W7XA 1KWFA 4DI5A 2JF4A 1F9OA 2D5JA 1JCSB 1OJPA 4AYPA 1N7NA 1L1YA 3Q78B 1O79A 3HXCB 4GTMB 2FV0A 3Q7AB 2V3PA 1W3YA 3OEDA 3Q79B 1V5DA 3C72B 1O5MB 1X1JA 3M7CA 1FCEA 2ZISB 1NL4B 1WU6A 2RI8A 1O1TB 1C82A 1IA7A 2F0YB 5DHIA 1IA6A 4C1SA 5M7IA 2BB6A 4Z4LA 3VSMA 1TN6B 3E30B 5DGRA 3WUXA 1KZPB 1GA2A 1TNBB 3D3IA 3QG0A 4MU9A 3NNBA 1JCRB 4DOEA 1GXNA 1RWHA 3Q7FB 1G6IA 1JS4A 3EU8A 4MBGB 3RX7A 3DRAB 4L9PB 1LXKA 2J5CA 1AYXA 1L2AA 5IL8A 1LOHA 4V1RA 2Q1FA 1SA4B 2F6DA 3WIQA 1N24A 3QXQA 3DPYB 3SDVA 4OK2A 5IKAA 3N0GA 5DGQA 5ILKA 3Q75B 4ZH1A 3DSUB 3K11A 1WZZA 1KSCA 5ILJA 3M00A 4MMHA 4KKIA 3VXDA 1HZFA 3PZ4B 1FMIA 2EACA 4D4DA 4CJ1A 1SQCA 3QRYA 4TXTA 5GZKA 5ILDA 4MMIA 1VD5A 2JG0A 4GTQB 1DCEB 3M73A 3Q73B 3ANKA 1GAIA 2EAEA 1LXMA 1FP3A 5AGDA 2EABA 1F9GA 1RW9A 3SDUA 3KQ4A 1XW2A 2JJBA 1RWCA 1HMUA 3G4FA 4BOJA 1ULVA 5IL3A 1UT9A 1RQ5A 4Q88A 4OJZA 1N7PA 1C3DA 5GY3A 4D4AA 1H36A 4NEIA 2XFGA 5MEHA 1N1BA 1OJMA 3G4DA 1SA5B 1O6QA 3M76A 1N22A 4D4BA 1HM2A 3M72A 1NC5A 3K7XA 2BRVX 4CE7A 1K72A 1X9DA 5FO8B 5IKHA 4BOKA 2H6HB 3H2WA 2FUTA 3M01A 1GLMA 3DSSB 2DRRA 2A8ZA 2IEJB 3LZ9A 1N4SB 3PZ3B 1V5CA 4YDEB 1H54A 3H7LA 4LNVA 3HXDB 3T33A 1UMPA 2OKXA 1JCQB 4GTTB 2AFAA 1N7RA 2Z07A 1V7XA 4J5TA 1HXAA 3A0OA 3M71A 1N94B 5C05A 1WU5A 3ON6A 1N20A 3P5RA 3QDEA 5CD2A 3SQCA 5IK9A 4OZWA 3A3VA 5JMFA 3SFYB 1HXGA 1D8EB 1J0MA 3PZ2B 4GTSB 3E7JA 4F13A 3SDRA 4OK4A 4FUSA 3S4CA 3QFZA 1LD7B 5FO7B 4LNBB 3M75A 2BB5A 3QXFA 1O6RA 5GW7A 4Q2BA 3RX8A 5CZLA
chains in the Genus database with same CATH topology
1AGMA 2V3NA 3W7UA 2FUZA 2CQTA 4EHMB 3W5NA 3EZ8A 3QSPA 3RJ3A 1N4QB 3SDQA 1H37A 4GL3A 1FPPB 3PYBA 1O6HA 4M76A 2RI9A 2H6FB 2B4FA 2V8IA 3W5MA 3E34B 5M7YA 1V7WA 3QFYA 1G87A 3AFJA 2BBCA 2AHFA 3D5RA 1NXCA 1TNYB 3PZ1B 5E2JA 1TN7B 1S64B 4ZRQA 4YDOB 2G0DA 2WIIB 3QT9A 1DL2A 1QQFA 2DRQA 1HCUA 1GXOA 1GXMA 1QSJA 1N4PB 2PMVA 1WU4A 4QT9A 4WVCA 2GH4A 2FBAA 1KSDA 3P5PA 1KZOB 3ANIA 1O1SB 1KS8A 4DODA 4LNGB 3WKFA 3S4AA 3M77A 3RX5A 3W7TA 1TNOB 1H13A 1FO2A 3EUVB 3SAEA 2YIKA 4KTRA 2XQWA 3HXFB 3M78A 3PYAA 1XWTA 3E6UA 3P2CA 1FBWA 4WU0A 4XUVA 1S63B 3OXUA 1N95B 3M7LA 1IS9A 3M74A 1G9GA 4KTPA 1H39A 2GOXA 1G9JA 2I07B 2WY7A 3E33B 1LF9A 1H14A 4V1SA 1FT1B 1O1RB 1W6KA 3QPFA 3WIWA 4GTOB 1CEMA 1FAEA 5CA3A 1LD8B 1KFGA 1V7VA 4ZRPA 3QWTA 2DROA 1TNUB 3ACTA 4GTVB 4AYQA 4LIXA 2NVPA 1GSZA 2PN5A 5KKBA 1TN8B 5FOBB 3S9VA 3E73A 2WY8A 1X81B 4TF4A 1H12A 2RGKA 1DOGA 4WVBA 3CU7A 4Z4JA 1KKTA 2BEDB 2DRSA 4ZH5A 2A73B 3GT5A 1XWQA 4CJ0A 3SDTA 3SFXB 4D94A 2B39A 1LF6A 3D5SA 3RRSA 1MZCB 4FXGB 2G02A 3HXBB 5JPNB 1H3AA 3CIHA 4YCRA 3HXEB 4D4CA 3W7SA 2ZBLA 3M7BA 2VN7A 3ANJA 4AYOA 1H3CA 2NOJA 3WKIA 2ZZRA 4ONTA 3E37B 1D8DB 3GLYA 4EL8A 2XWJB 2D8LA 3DSXB 4GTPB 2AHGA 4WVAA 1GHQA 1W6JA 1H3BA 1N9AB 2CQSA 3G6JB 4FXKB 3EQAA 3QT3A 2ZIRB 3M7EA 1H35A 3RSYA 2WYNA 3DSWB 1R76A 3S4DA 5FO9B 1FO3A 2GZ6A 1TNZB 3E32B 2V8JA 3WIRA 2QNOA 3TF4A 3RENA 4KKJA 1TF4A 1KREA 2FV1A 2XWBB 4GTRB 1N4RB 3VW5A 2P0VA 4L6XA 3WC3A 1FT2B 2V8KA 3EU5B 3DSTB 2EADA 3KSLB 3ACSA 1LTXB 4L0GA 1GAHA 3WKGA 4ZG8A 1QBQB 1CLCA 3PMMA 3WKHA 4AYRA 2SQCA 3DSVB 1F9DA 2WINB 3S4BA 5JPMB 2H6IB 2H6GB 3W7WA 1UG9A 1FBOA 3KSQB 2R2LB 3X17A 1NI1B 1KRFA 2VN4A 4JJJA 3GZKA 3H3KA 3KLSA 3W7XA 1KWFA 2JF4A 1F9OA 2D5JA 1JCSB 4AYPA 1L1YA 3Q78B 1O79A 3HXCB 4GTMB 2FV0A 3Q7AB 2V3PA 3OEDA 3Q79B 1V5DA 3M7CA 1O5MB 3C72B 1FCEA 2ZISB 1NL4B 1WU6A 2RI8A 1O1TB 1IA7A 2F0YB 1IA6A 4C1SA 5M7IA 2BB6A 4Z4LA 1TN6B 3E30B 5DGRA 3WUXA 1KZPB 1GA2A 1TNBB 3D3IA 3QG0A 4MU9A 1JCRB 4DOEA 1GXNA 3Q7FB 1G6IA 1JS4A 3EU8A 4MBGB 3RX7A 3DRAB 4L9PB 1AYXA 1L2AA 4V1RA 1SA4B 2F6DA 3WIQA 3QXQA 3DPYB 3SDVA 5DGQA 3Q75B 4ZH1A 3DSUB 3K11A 1WZZA 1KSCA 3VXDA 4KKIA 1HZFA 3PZ4B 1FMIA 2EACA 4D4DA 4CJ1A 1SQCA 3QRYA 4TXTA 5GZKA 1VD5A 2JG0A 4GTQB 1DCEB 3M73A 3Q73B 3ANKA 1GAIA 2EAEA 1FP3A 5AGDA 2EABA 3SDUA 3KQ4A 1XW2A 2JJBA 4BOJA 1ULVA 1UT9A 1RQ5A 4Q88A 1C3DA 5GY3A 4D4AA 1H36A 2XFGA 5MEHA 1SA5B 1O6QA 3M76A 4D4BA 3M72A 1NC5A 3K7XA 4CE7A 1K72A 1X9DA 5FO8B 4BOKA 2H6HB 3H2WA 1GLMA 3DSSB 2DRRA 2A8ZA 2IEJB 1N4SB 3PZ3B 1V5CA 4YDEB 1H54A 3H7LA 4LNVA 3HXDB 3T33A 1UMPA 2OKXA 1JCQB 4GTTB 2AFAA 4J5TA 2Z07A 1V7XA 3M71A 1N94B 1WU5A 3ON6A 3QDEA 3P5RA 5CD2A 3SQCA 3A3VA 3SFYB 1D8EB 3PZ2B 4GTSB 3SDRA 4FUSA 3S4CA 3QFZA 1LD7B 5FO7B 4LNBB 3M75A 2BB5A 3QXFA 1O6RA 5GW7A 4Q2BA 3RX8A 5CZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKI A;  1HZF A;  3PZ4 B;  2V3N A;  1LD8 B;  1FT2 B;  4D4D A;  2V8K A;  1SQC A;  3EU5 B;  3DST B;  4EHM B;  4ZRP A;  1TNU B;  4GTQ B;  1DCE B;  3Q73 B;  4GTV B;  3KSL B;  3RJ3 A;  1N4Q B;  1LTX B;  1GSZ A;  1H37 A;  2PN5 A;  1FPP B;  1TN8 B;  5AGD A;  1QBQ B;  5FOB B;  1O6H A;  2SQC A;  3DSV B;  4M76 A;  2WIN B;  2WY8 A;  3KQ4 A;  2H6F B;  1X81 B;  5JPM B;  2H6I B;  2V8I A;  2H6G B;  3E34 B;  4BOJ A;  3CU7 A;  2BED B;  3KSQ B;  2R2L B;  2A73 B;  1NI1 B;  3SFX B;  4D94 A;  2BBC A;  1C3D A;  2B39 A;  3D5R A;  1H36 A;  4D4A A;  3D5S A;  1TNY B;  3PZ1 B;  1TN7 B;  1S64 B;  1SA5 B;  1O6Q A;  4D4B A;  1MZC B;  4FXG B;  4ZRQ A;  2G02 A;  3HXB B;  3KLS A;  4YDO B;  5JPN B;  2G0D A;  2WII B;  1H3A A;  1JCS B;  3K7X A;  3Q78 B;  1O79 A;  3HXC B;  4GTM B;  1QQF A;  3Q7A B;  2V3P A;  5FO8 B;  1GXO A;  4BOK A;  3OED A;  2H6H B;  3HXE B;  3Q79 B;  4D4C A;  1O5M B;  1GXM A;  3C72 B;  1QSJ A;  3DSS B;  1N4P B;  2IEJ B;  2PMV A;  1N4S B;  3PZ3 B;  1H3C A;  4YDE B;  2NOJ A;  4LNV A;  3HXD B;  2ZIS B;  1UMP A;  1NL4 B;  1O1T B;  4ONT A;  3E37 B;  1D8D B;  1JCQ B;  1KZO B;  1O1S B;  2F0Y B;  4GTT B;  2XWJ B;  4C1S A;  3DSX B;  4GTP B;  2BB6 A;  4LNG B;  1TN6 B;  3E30 B;  1N94 B;  1KZP B;  1TNB B;  1GHQ A;  1W6J A;  1H3B A;  4MU9 A;  1TNO B;  1N9A B;  1JCR B;  3EUV B;  2XQW A;  3G6J B;  4FXK B;  1GXN A;  3SQC A;  3Q7F B;  3HXF B;  4MBG B;  2ZIR B;  3DRA B;  4L9P B;  3SFY B;  1S63 B;  3OXU A;  1H35 A;  1N95 B;  1D8E B;  3DSW B;  1R76 A;  3PZ2 B;  4GTS B;  5FO9 B;  4V1R A;  1SA4 B;  1TNZ B;  1H39 A;  3DPY B;  3E32 B;  2GOX A;  2V8J A;  2I07 B;  1LD7 B;  2WY7 A;  5FO7 B;  4KKJ A;  4LNB B;  3E33 B;  2BB5 A;  4V1S A;  2XWB B;  3Q75 B;  1FT1 B;  1O6R A;  4ZH1 A;  3DSU B;  1O1R B;  1W6K A;  4GTR B;  4GTO B;  1N4R B; 
#chains in the Genus database with same CATH topology
 1N7O A;  2BRP A;  1AGM A;  2V3N A;  3W7U A;  2FUZ A;  2CQT A;  4EHM B;  3W5N A;  3EZ8 A;  1N23 A;  3QSP A;  1HM3 A;  3RJ3 A;  1N4Q B;  3SDQ A;  1H37 A;  1X1I A;  4GL3 A;  1FPP B;  3PYB A;  1O6H A;  4M76 A;  2RI9 A;  2H6F B;  2B4F A;  4GAX A;  2V8I A;  3W5M A;  3E34 B;  5M7Y A;  1V7W A;  1N1Z A;  3QFY A;  1G87 A;  3AFJ A;  2BBC A;  1HN0 A;  2X03 A;  2AHF A;  3D5R A;  1NXC A;  1TNY B;  3N0F A;  3AFL A;  3PZ1 B;  5E2J A;  1TN7 B;  1S64 B;  4ZRQ A;  4YDO B;  5JMD A;  2G0D A;  2WII B;  3QT9 A;  1DL2 A;  1QQF A;  2DRQ A;  1HCU A;  1GXO A;  1GXM A;  1QSJ A;  1N4P B;  2PMV A;  1WU4 A;  1CB8 A;  4QT9 A;  4WVC A;  2GH4 A;  2FBA A;  1KSD A;  5ILY A;  3P5P A;  1KZO B;  3ANI A;  1O1S B;  1KS8 A;  5IM1 A;  4DOD A;  4LNG B;  3WKF A;  3S4A A;  3M77 A;  3RX5 A;  3W7T A;  1RWG A;  5EAT A;  1TNO B;  1H13 A;  1FO2 A;  3EUV B;  3SAE A;  2YIK A;  4KTR A;  2XQW A;  3HXF B;  1X1H A;  3M78 A;  3PYA A;  1XWT A;  3E6U A;  3P2C A;  1FBW A;  4WU0 A;  4XUV A;  1S63 B;  3OXU A;  1N95 B;  3M7L A;  1IS9 A;  3M74 A;  1G9G A;  4KTP A;  1H39 A;  2GOX A;  1G9J A;  2I07 B;  2WY7 A;  3E33 B;  1LF9 A;  3M02 A;  1H14 A;  4V1S A;  1FT1 B;  1O1R B;  1W6K A;  2WDA A;  3QPF A;  3WIW A;  4GTO B;  1CEM A;  1FAE A;  4FJQ A;  4F10 A;  5CA3 A;  1LD8 B;  1KFG A;  1HX9 A;  1V7V A;  4ZRP A;  3QWT A;  2DRO A;  1TNU B;  3ACT A;  4GTV B;  1N21 A;  4AYQ A;  4LIX A;  2NVP A;  1GSZ A;  3VSN A;  1F1S A;  2PN5 A;  5KKB A;  1TN8 B;  5ILI A;  4FNV A;  5FOB B;  3S9V A;  3E73 A;  2WY8 A;  1X81 B;  4TF4 A;  1H12 A;  2RGK A;  1DOG A;  4WVB A;  3CU7 A;  4Z4J A;  1KKT A;  2BED B;  2DRS A;  4ZH5 A;  5IK0 A;  2A73 B;  3GT5 A;  1XWQ A;  1OJO A;  4CJ0 A;  3SDT A;  3SFX B;  4D94 A;  1OJN A;  2B39 A;  1LF6 A;  3D5S A;  4OZV A;  3RRS A;  1HV6 A;  1MZC B;  4FXG B;  2G02 A;  3HXB B;  5JPN B;  1H3A A;  5DHK A;  5IK6 A;  1QAZ A;  3CIH A;  3E80 A;  4YCR A;  3HXE B;  4D4C A;  2ONG A;  3W7S A;  2ZBL A;  3M7B A;  2VN7 A;  3ANJ A;  4AYO A;  1H3C A;  2NOJ A;  3WKI A;  2E24 A;  2ZZR A;  4ONT A;  3E37 B;  1D8D B;  2WCO A;  3GLY A;  4EL8 A;  2XWJ B;  2D8L A;  3DSX B;  4GTP B;  2AHG A;  1RWA A;  4WVA A;  5ILH A;  1GHQ A;  1W6J A;  1H3B A;  1N9A B;  2CQS A;  5ILZ A;  3G6J B;  4FXK B;  3NFV A;  2E22 A;  3EQA A;  3QT3 A;  2ZIR B;  2BRW A;  3M7E A;  1H35 A;  3RSY A;  2WYN A;  3DSW B;  4RNQ A;  1J0N A;  1R76 A;  3S4D A;  5FO9 B;  1FO3 A;  2GZ6 A;  2ONH A;  1TNZ B;  3E32 B;  2V8J A;  3WIR A;  2QNO A;  1RWF A;  1HXC A;  3TF4 A;  3REN A;  4KKJ A;  1TF4 A;  1KRE A;  2FV1 A;  2XWB B;  4GTR B;  1N4R B;  3VW5 A;  2P0V A;  4L6X A;  3WC3 A;  1FT2 B;  2V8K A;  5EAS A;  4E1Y A;  3EU5 B;  3DST B;  2EAD A;  3KSL B;  1I8Q A;  3ACS A;  1LTX B;  4L0G A;  1GAH A;  3WKG A;  4ZG8 A;  1QBQ B;  1CLC A;  3PMM A;  3WKH A;  4AYR A;  2SQC A;  3DSV B;  1F9D A;  2WIN B;  3S4B A;  5JPM B;  2H6I B;  2H6G B;  3W7W A;  1UG9 A;  1FBO A;  3KSQ B;  2R2L B;  3X17 A;  1EGU A;  1NI1 B;  1KRF A;  5EAU A;  2VN4 A;  1HMW A;  1N7Q A;  4JJJ A;  3GZK A;  2FUQ A;  3H3K A;  3KLS A;  3W7X A;  1KWF A;  4DI5 A;  2JF4 A;  1F9O A;  2D5J A;  1JCS B;  1OJP A;  4AYP A;  1N7N A;  1L1Y A;  3Q78 B;  1O79 A;  3HXC B;  4GTM B;  2FV0 A;  3Q7A B;  2V3P A;  1W3Y A;  3OED A;  3Q79 B;  1V5D A;  3C72 B;  1O5M B;  1X1J A;  3M7C A;  1FCE A;  2ZIS B;  1NL4 B;  1WU6 A;  2RI8 A;  1O1T B;  1C82 A;  1IA7 A;  2F0Y B;  5DHI A;  1IA6 A;  4C1S A;  5M7I A;  2BB6 A;  4Z4L A;  3VSM A;  1TN6 B;  3E30 B;  5DGR A;  3WUX A;  1KZP B;  1GA2 A;  1TNB B;  3D3I A;  3QG0 A;  4MU9 A;  3NNB A;  1JCR B;  4DOE A;  1GXN A;  1RWH A;  3Q7F B;  1G6I A;  1JS4 A;  3EU8 A;  4MBG B;  3RX7 A;  3DRA B;  4L9P B;  1LXK A;  2J5C A;  1AYX A;  1L2A A;  5IL8 A;  1LOH A;  4V1R A;  2Q1F A;  1SA4 B;  2F6D A;  3WIQ A;  1N24 A;  3QXQ A;  3DPY B;  3SDV A;  4OK2 A;  5IKA A;  3N0G A;  5DGQ A;  5ILK A;  3Q75 B;  4ZH1 A;  3DSU B;  3K11 A;  1WZZ A;  1KSC A;  5ILJ A;  3M00 A;  4MMH A;  4KKI A;  3VXD A;  1HZF A;  3PZ4 B;  1FMI A;  2EAC A;  4D4D A;  4CJ1 A;  1SQC A;  3QRY A;  4TXT A;  5GZK A;  5ILD A;  4MMI A;  1VD5 A;  2JG0 A;  4GTQ B;  1DCE B;  3M73 A;  3Q73 B;  3ANK A;  1GAI A;  2EAE A;  1LXM A;  1FP3 A;  5AGD A;  2EAB A;  1F9G A;  1RW9 A;  3SDU A;  3KQ4 A;  1XW2 A;  2JJB A;  1RWC A;  1HMU A;  3G4F A;  4BOJ A;  1ULV A;  5IL3 A;  1UT9 A;  1RQ5 A;  4Q88 A;  4OJZ A;  1N7P A;  1C3D A;  5GY3 A;  4D4A A;  1H36 A;  4NEI A;  2XFG A;  5MEH A;  1N1B A;  1OJM A;  3G4D A;  1SA5 B;  1O6Q A;  3M76 A;  1N22 A;  4D4B A;  1HM2 A;  3M72 A;  1NC5 A;  3K7X A;  2BRV X;  4CE7 A;  1K72 A;  1X9D A;  5FO8 B;  5IKH A;  4BOK A;  2H6H B;  3H2W A;  2FUT A;  3M01 A;  1GLM A;  3DSS B;  2DRR A;  2A8Z A;  2IEJ B;  3LZ9 A;  1N4S B;  3PZ3 B;  1V5C A;  4YDE B;  1H54 A;  3H7L A;  4LNV A;  3HXD B;  3T33 A;  1UMP A;  2OKX A;  1JCQ B;  4GTT B;  2AFA A;  1N7R A;  2Z07 A;  1V7X A;  4J5T A;  1HXA A;  3A0O A;  3M71 A;  1N94 B;  5C05 A;  1WU5 A;  3ON6 A;  1N20 A;  3P5R A;  3QDE A;  5CD2 A;  3SQC A;  5IK9 A;  4OZW A;  3A3V A;  5JMF A;  3SFY B;  1HXG A;  1D8E B;  1J0M A;  3PZ2 B;  4GTS B;  3E7J A;  4F13 A;  3SDR A;  4OK4 A;  4FUS A;  3S4C A;  3QFZ A;  1LD7 B;  5FO7 B;  4LNB B;  3M75 A;  2BB5 A;  3QXF A;  1O6R A;  5GW7 A;  4Q2B A;  3RX8 A;  5CZL A; 
#chains in the Genus database with same CATH homology
 1AGM A;  2V3N A;  3W7U A;  2FUZ A;  2CQT A;  4EHM B;  3W5N A;  3EZ8 A;  3QSP A;  3RJ3 A;  1N4Q B;  3SDQ A;  1H37 A;  4GL3 A;  1FPP B;  3PYB A;  1O6H A;  4M76 A;  2RI9 A;  2H6F B;  2B4F A;  2V8I A;  3W5M A;  3E34 B;  5M7Y A;  1V7W A;  3QFY A;  1G87 A;  3AFJ A;  2BBC A;  2AHF A;  3D5R A;  1NXC A;  1TNY B;  3PZ1 B;  5E2J A;  1TN7 B;  1S64 B;  4ZRQ A;  4YDO B;  2G0D A;  2WII B;  3QT9 A;  1DL2 A;  1QQF A;  2DRQ A;  1HCU A;  1GXO A;  1GXM A;  1QSJ A;  1N4P B;  2PMV A;  1WU4 A;  4QT9 A;  4WVC A;  2GH4 A;  2FBA A;  1KSD A;  3P5P A;  1KZO B;  3ANI A;  1O1S B;  1KS8 A;  4DOD A;  4LNG B;  3WKF A;  3S4A A;  3M77 A;  3RX5 A;  3W7T A;  1TNO B;  1H13 A;  1FO2 A;  3EUV B;  3SAE A;  2YIK A;  4KTR A;  2XQW A;  3HXF B;  3M78 A;  3PYA A;  1XWT A;  3E6U A;  3P2C A;  1FBW A;  4WU0 A;  4XUV A;  1S63 B;  3OXU A;  1N95 B;  3M7L A;  1IS9 A;  3M74 A;  1G9G A;  4KTP A;  1H39 A;  2GOX A;  1G9J A;  2I07 B;  2WY7 A;  3E33 B;  1LF9 A;  1H14 A;  4V1S A;  1FT1 B;  1O1R B;  1W6K A;  3QPF A;  3WIW A;  4GTO B;  1CEM A;  1FAE A;  5CA3 A;  1LD8 B;  1KFG A;  1V7V A;  4ZRP A;  3QWT A;  2DRO A;  1TNU B;  3ACT A;  4GTV B;  4AYQ A;  4LIX A;  2NVP A;  1GSZ A;  2PN5 A;  5KKB A;  1TN8 B;  5FOB B;  3S9V A;  3E73 A;  2WY8 A;  1X81 B;  4TF4 A;  1H12 A;  2RGK A;  1DOG A;  4WVB A;  3CU7 A;  4Z4J A;  1KKT A;  2BED B;  2DRS A;  4ZH5 A;  2A73 B;  3GT5 A;  1XWQ A;  4CJ0 A;  3SDT A;  3SFX B;  4D94 A;  2B39 A;  1LF6 A;  3D5S A;  3RRS A;  1MZC B;  4FXG B;  2G02 A;  3HXB B;  5JPN B;  1H3A A;  3CIH A;  4YCR A;  3HXE B;  4D4C A;  3W7S A;  2ZBL A;  3M7B A;  2VN7 A;  3ANJ A;  4AYO A;  1H3C A;  2NOJ A;  3WKI A;  2ZZR A;  4ONT A;  3E37 B;  1D8D B;  3GLY A;  4EL8 A;  2XWJ B;  2D8L A;  3DSX B;  4GTP B;  2AHG A;  4WVA A;  1GHQ A;  1W6J A;  1H3B A;  1N9A B;  2CQS A;  3G6J B;  4FXK B;  3EQA A;  3QT3 A;  2ZIR B;  3M7E A;  1H35 A;  3RSY A;  2WYN A;  3DSW B;  1R76 A;  3S4D A;  5FO9 B;  1FO3 A;  2GZ6 A;  1TNZ B;  3E32 B;  2V8J A;  3WIR A;  2QNO A;  3TF4 A;  3REN A;  4KKJ A;  1TF4 A;  1KRE A;  2FV1 A;  2XWB B;  4GTR B;  1N4R B;  3VW5 A;  2P0V A;  4L6X A;  3WC3 A;  1FT2 B;  2V8K A;  3EU5 B;  3DST B;  2EAD A;  3KSL B;  3ACS A;  1LTX B;  4L0G A;  1GAH A;  3WKG A;  4ZG8 A;  1QBQ B;  1CLC A;  3PMM A;  3WKH A;  4AYR A;  2SQC A;  3DSV B;  1F9D A;  2WIN B;  3S4B A;  5JPM B;  2H6I B;  2H6G B;  3W7W A;  1UG9 A;  1FBO A;  3KSQ B;  2R2L B;  3X17 A;  1NI1 B;  1KRF A;  2VN4 A;  4JJJ A;  3GZK A;  3H3K A;  3KLS A;  3W7X A;  1KWF A;  2JF4 A;  1F9O A;  2D5J A;  1JCS B;  4AYP A;  1L1Y A;  3Q78 B;  1O79 A;  3HXC B;  4GTM B;  2FV0 A;  3Q7A B;  2V3P A;  3OED A;  3Q79 B;  1V5D A;  3M7C A;  1O5M B;  3C72 B;  1FCE A;  2ZIS B;  1NL4 B;  1WU6 A;  2RI8 A;  1O1T B;  1IA7 A;  2F0Y B;  1IA6 A;  4C1S A;  5M7I A;  2BB6 A;  4Z4L A;  1TN6 B;  3E30 B;  5DGR A;  3WUX A;  1KZP B;  1GA2 A;  1TNB B;  3D3I A;  3QG0 A;  4MU9 A;  1JCR B;  4DOE A;  1GXN A;  3Q7F B;  1G6I A;  1JS4 A;  3EU8 A;  4MBG B;  3RX7 A;  3DRA B;  4L9P B;  1AYX A;  1L2A A;  4V1R A;  1SA4 B;  2F6D A;  3WIQ A;  3QXQ A;  3DPY B;  3SDV A;  5DGQ A;  3Q75 B;  4ZH1 A;  3DSU B;  3K11 A;  1WZZ A;  1KSC A;  3VXD A;  4KKI A;  1HZF A;  3PZ4 B;  1FMI A;  2EAC A;  4D4D A;  4CJ1 A;  1SQC A;  3QRY A;  4TXT A;  5GZK A;  1VD5 A;  2JG0 A;  4GTQ B;  1DCE B;  3M73 A;  3Q73 B;  3ANK A;  1GAI A;  2EAE A;  1FP3 A;  5AGD A;  2EAB A;  3SDU A;  3KQ4 A;  1XW2 A;  2JJB A;  4BOJ A;  1ULV A;  1UT9 A;  1RQ5 A;  4Q88 A;  1C3D A;  5GY3 A;  4D4A A;  1H36 A;  2XFG A;  5MEH A;  1SA5 B;  1O6Q A;  3M76 A;  4D4B A;  3M72 A;  1NC5 A;  3K7X A;  4CE7 A;  1K72 A;  1X9D A;  5FO8 B;  4BOK A;  2H6H B;  3H2W A;  1GLM A;  3DSS B;  2DRR A;  2A8Z A;  2IEJ B;  1N4S B;  3PZ3 B;  1V5C A;  4YDE B;  1H54 A;  3H7L A;  4LNV A;  3HXD B;  3T33 A;  1UMP A;  2OKX A;  1JCQ B;  4GTT B;  2AFA A;  4J5T A;  2Z07 A;  1V7X A;  3M71 A;  1N94 B;  1WU5 A;  3ON6 A;  3QDE A;  3P5R A;  5CD2 A;  3SQC A;  3A3V A;  3SFY B;  1D8E B;  3PZ2 B;  4GTS B;  3SDR A;  4FUS A;  3S4C A;  3QFZ A;  1LD7 B;  5FO7 B;  4LNB B;  3M75 A;  2BB5 A;  3QXF A;  1O6R A;  5GW7 A;  4Q2B A;  3RX8 A;  5CZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...