3HXFB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 32)
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
326
structure length
322
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 120
structure length 322
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxfB00
3KQ4A 2NOJA 1MZCB 1SA4B 1N4PB 1GXOA 4V1RA 3SQCA 1O1TB 1X81B 3OEDA 1S64B 2XWJB 1TNOB 4BOJA 2H6IB 2PN5A 1LD8B 3DSTB 1GXNA 4GTTB 4C1SA 3DSWB 3HXEB 1GXMA 4YDEB 2ZIRB 4D4BA 4GTVB 4GTQB 3SFXB 3HXBB 1H37A 1TN6B 1N95B 1H3CA 1GHQA 3D5SA 4LNVA 1NL4B 1QQFA 1O6HA 3DSXB 3HXCB 5AGDA 4ZH1A 5FO8B 2XWBB 1NI1B 2BB6A 3G6JB 1O1RB 3OXUA 3E34B 1JCSB 3E37B 2H6GB 1TN8B 1FT2B 3SFYB 5FOBB 1SA5B 3HXDB 3KLSA 2BB5A 3D5RA 4KKIA 2BEDB 2V8IA 5JPMB 1TN7B 3Q7AB 1SQCA 1W6KA 4LNGB 3DSVB 3Q7FB 4GTPB 3EUVB 1O6RA 3PZ4B 1N4SB 2WY7A 4D4DA 1H39A 1W6JA 2BBCA 2R2LB 2XQWA 1JCRB 3PZ1B 1KZPB 1H3BA 1LTXB 1N9AB 4ONTA 1O5MB 1TNBB 4M76A 2SQCA 2V8JA 1KZOB 5JPNB 3E32B 2F0YB 3Q79B 4YDOB 2WY8A 3Q78B 1D8DB 1N4QB 2A73B 2WINB 1O79A 4GTOB 1TNUB 4L9PB 4BOKA 2B39A 1LD7B 3DSUB 3Q75B 1C3DA 3RJ3A 4KKJA 1FT1B 1S63B 1TNYB 3Q73B 3K7XA 4V1SA 3KSQB 1H3AA 2WIIB 2V3NA 3CU7A 4D94A 1O6QA 1O1SB 2GOXA 1DCEB 1N94B 2V8KA 3EU5B 4MU9A 4D4CA 3DSSB 3E30B 4LNBB 2I07B 4MBGB 3HXFB 4FXKB 4GTSB 1H36A 3DPYB 4ZRQA 1JCQB 1QSJA 3PZ3B 1TNZB 1UMPA 2G02A 4EHMB 1FPPB 4FXGB 3PZ2B 1D8EB 2PMVA 4GTMB 1GSZA 4D4AA 5FO9B 2H6FB 1QBQB 3E33B 2V3PA 1H35A 2IEJB 3DRAB 1HZFA 3C72B 3KSLB 2G0DA 4GTRB 5FO7B 2H6HB 2ZISB 1N4RB 1R76A 4ZRPA
chains in the Genus database with same CATH superfamily
1MZCB 5GY3A 3PYAA 5IM1A 1GXOA 2A8ZA 2E22A 5IL3A 1O1TB 3ANJA 3OEDA 4EL8A 3M76A 4WVBA 3QXQA 4L6XA 1GXNA 4GTTB 5M7YA 3M7EA 4GTVB 4OZVA 3SFXB 1H37A 1GHQA 3W7TA 3P2CA 3QDEA 1F9DA 4ZH1A 4AYQA 2DRSA 3M7CA 4CJ1A 2BB6A 4CJ0A 3G6JB 1DOGA 2ZBLA 1RWGA 3E37B 1HN0A 1G9GA 1TN8B 2CQSA 4L0GA 1H13A 3D5RA 4WU0A 2BEDB 3M74A 2EACA 4LNGB 1IA6A 4GTPB 1LXKA 3N0FA 3PZ4B 5ILJA 1W6JA 3CIHA 4KTRA 1O5MB 1I8QA 3SAEA 3T33A 5JPNB 3E32B 5E2JA 4TXTA 4YDOB 2WY8A 3WKFA 2RI9A 3WKHA 1TNUB 4BOKA 4ZH5A 4KKJA 3K7XA 2FUQA 3KSQB 5EAUA 1O1SB 2BRVX 4D4CA 1WU5A 3HXFB 1NC5A 1CLCA 1H36A 4ZRQA 1KWFA 4FJQA 3W7WA 1N7PA 1HV6A 2EAEA 1CEMA 1UG9A 4EHMB 1FPPB 4MMHA 4AYPA 1KS8A 2EADA 4GTMB 4AYOA 2H6FB 4Q2BA 3M7LA 1HCUA 1RWCA 1QBQB 1N22A 1X9DA 1KFGA 3C72B 2Q1FA 1G87A 2H6HB 3S4AA 1SA4B 2FBAA 3ACTA 1FMIA 3WIRA 2AFAA 1HXGA 1X81B 5C05A 5DGQA 1S64B 2WCOA 2VN4A 3S4BA 2QNOA 4JJJA 1K72A 3WKIA 4BOJA 2PN5A 1W3YA 3DSTB 3X17A 3DSWB 1HXAA 2ZIRB 3RX8A 4NEIA 3G4FA 2OKXA 1NL4B 1QQFA 3QPFA 3A0OA 3DSXB 3VXDA 1N23A 1NXCA 5FO8B 2P0VA 3H3KA 3WIQA 2YIKA 1DL2A 1TF4A 3E34B 1JCSB 1HMWA 5FOBB 1SA5B 5JPMB 1TN7B 1FCEA 3PMMA 3Q7FB 1O6RA 1N4SB 2WY7A 3M75A 3P5RA 5IK6A 2BBCA 2XQWA 1N7QA 4GAXA 3PZ1B 3EU8A 3WIWA 3RRSA 1OJOA 1N7OA 4XUVA 3ANKA 1FAEA 3QFYA 3TF4A 1CB8A 2ZZRA 3S4DA 1RWHA 3Q75B 1C3DA 1FBOA 4DOEA 3W5NA 1N24A 3E80A 1H3AA 2WIIB 2EABA 2AHFA 1L2AA 3VSMA 4AYRA 3M7BA 1F9OA 2AHGA 1RWFA 1KSDA 3E73A 1L1YA 1F9GA 1F1SA 1RWAA 1QSJA 4OK4A 2B4FA 1UMPA 3AFJA 3SDQA 2CQTA 3E6UA 3RX5A 1GSZA 1FBWA 1X1JA 1V5CA 2WYNA 3RSYA 2WDAA 1HZFA 1KKTA 5FO7B 5GW7A 5GZKA 3LZ9A 1N20A 3KQ4A 2NOJA 1GLMA 4V1RA 5JMFA 3SQCA 4D94A 4Z4LA 3PYBA 4RNQA 1GAHA 2DROA 2XWJB 5ILDA 1TNOB 3QT3A 2H6IB 1LD8B 3M00A 5IL8A 4C1SA 4YDEB 4D4BA 3GLYA 2GZ6A 5ILYA 3M01A 3HXBB 2ONGA 1H3CA 3D3IA 4LNVA 4Z4JA 1O6HA 3HXCB 3QRYA 2NVPA 5AGDA 2Z07A 4QT9A 3SDTA 1NI1B 2RI8A 4OJZA 3WC3A 1OJPA 1O1RB 4LIXA 3RENA 1ULVA 3NNBA 1FT2B 3SFYB 3SDRA 2FV1A 1FP3A 3GT5A 5EASA 4GL3A 5DGRA 3Q7AB 3ON6A 1J0MA 1SQCA 4FUSA 1G6IA 1W6KA 1XWQA 3EUVB 4D4DA 3WUXA 2F6DA 3QSPA 5MEHA 4ONTA 1HMUA 1TNBB 1LF9A 4WVAA 2V8JA 2D8LA 1KZOB 3E7JA 1AYXA 2F0YB 3Q79B 3ACSA 3G4DA 3Q78B 1D8DB 1N4QB 1V5DA 2A73B 4DI5A 3QWTA 4L9PB 5ILKA 2B39A 3QT9A 1LD7B 5ILHA 3RJ3A 3M71A 1S63B 3Q73B 4F13A 5IKAA 3M72A 1V7XA 5JMDA 3SDVA 4TF4A 5M7IA 3NFVA 1DCEB 4CE7A 5EATA 4WVCA 1VD5A 3W7UA 3M77A 2FUZA 3S9VA 2I07B 1IS9A 4GTSB 3M78A 2X03A 5DHIA 3PZ3B 1N21A 2G02A 4FXGB 1D8EB 5FO9B 4YCRA 3VSNA 2FUTA 2V3PA 3QFZA 1HXCA 2IEJB 1XW2A 3KSLB 1X1IA 2ZISB 3VW5A 3RX7A 1R76A 4OZWA 4ZRPA 1H14A 4J5TA 4OK2A 1G9JA 1KSCA 1N4PB 3W5MA 2BRWA 2JJBA 1GAIA 2JF4A 2ONHA 1LXMA 2GH4A 3EQAA 2DRQA 1HM2A 2DRRA 1AGMA 5DHKA 3M02A 3HXEB 2XFGA 1GXMA 3QXFA 4GTQB 1UT9A 3M73A 3EZ8A 1TN6B 1N95B 3D5SA 5CD2A 4DODA 5IK0A 2J5CA 1RQ5A 1HM3A 1EGUA 3A3VA 2BRPA 1C82A 1KREA 1N1BA 2XWBB 3ANIA 1JS4A 3OXUA 1XWTA 5KKBA 2H6GB 4ZG8A 3HXDB 3KLSA 2BB5A 2D5JA 4KKIA 4KTPA 2V8IA 4MMIA 2VN7A 1J0NA 1N7RA 3DSVB 1FO3A 1X1HA 2JG0A 1WU4A 1KRFA 1OJMA 1H39A 5ILZA 2R2LB 1JCRB 3H2WA 5IKHA 1KZPB 1H3BA 1LTXB 1N9AB 1H54A 1LF6A 4M76A 2SQCA 1FO2A 4Q88A 4FNVA 2WINB 1O79A 1GA2A 4GTOB 3DSUB 1QAZA 1V7WA 1FT1B 1N7NA 1TNYB 4V1SA 3H7LA 3K11A 3GZKA 2V3NA 3CU7A 2RGKA 1O6QA 1N1ZA 2GOXA 1N94B 2V8KA 4MU9A 1LOHA 3EU5B 3DSSB 3E30B 3P5PA 4LNBB 4MBGB 4FXKB 3S4CA 3SDUA 5CZLA 3DPYB 1JCQB 4E1YA 1IA7A 1TNZB 1RW9A 3W7SA 1WU6A 2E24A 3PZ2B 1OJNA 3QG0A 2PMVA 4D4AA 5IK9A 1HX9A 3WKGA 3E33B 3AFLA 1V7VA 1H35A 3W7XA 2FV0A 3DRAB 1WZZA 2G0DA 4F10A 4GTRB 3N0GA 5CA3A 5ILIA 1N4RB 1H12A
chains in the Genus database with same CATH topology
1MZCB 5GY3A 3PYAA 1GXOA 2A8ZA 1O1TB 3ANJA 3OEDA 4EL8A 3M76A 4WVBA 3QXQA 4L6XA 1GXNA 4GTTB 5M7YA 3M7EA 4GTVB 3SFXB 1H37A 1GHQA 3W7TA 3P2CA 3QDEA 1F9DA 4ZH1A 4AYQA 2DRSA 3M7CA 4CJ1A 2BB6A 4CJ0A 3G6JB 1DOGA 2ZBLA 3E37B 1G9GA 1TN8B 2CQSA 4L0GA 1H13A 3D5RA 4WU0A 2BEDB 3M74A 2EACA 4LNGB 1IA6A 4GTPB 3PZ4B 1W6JA 3CIHA 4KTRA 1O5MB 3SAEA 3T33A 5JPNB 3E32B 5E2JA 4TXTA 4YDOB 2WY8A 3WKFA 2RI9A 3WKHA 1TNUB 4BOKA 4ZH5A 4KKJA 3K7XA 3KSQB 1O1SB 4D4CA 1WU5A 3HXFB 1NC5A 1CLCA 1H36A 4ZRQA 1KWFA 3W7WA 2EAEA 1CEMA 1UG9A 4EHMB 1FPPB 4AYPA 1KS8A 2EADA 4GTMB 4AYOA 2H6FB 4Q2BA 3M7LA 1HCUA 1QBQB 1X9DA 1KFGA 3C72B 1G87A 2H6HB 3S4AA 1SA4B 2FBAA 3ACTA 1FMIA 3WIRA 2AFAA 1X81B 5DGQA 1S64B 2VN4A 3S4BA 2QNOA 4JJJA 1K72A 3WKIA 4BOJA 2PN5A 3DSTB 3X17A 3DSWB 3RX8A 2ZIRB 2OKXA 1NL4B 1QQFA 3QPFA 3DSXB 3VXDA 1NXCA 5FO8B 2P0VA 3H3KA 3WIQA 2YIKA 1DL2A 1TF4A 3E34B 1JCSB 5FOBB 1SA5B 5JPMB 1TN7B 1FCEA 3PMMA 3Q7FB 1O6RA 1N4SB 2WY7A 3M75A 3P5RA 2BBCA 2XQWA 3PZ1B 3EU8A 3WIWA 3RRSA 4XUVA 3ANKA 1FAEA 3QFYA 3TF4A 2ZZRA 3S4DA 3Q75B 1C3DA 1FBOA 4DOEA 3W5NA 1H3AA 2WIIB 2EABA 2AHFA 1L2AA 4AYRA 3M7BA 1F9OA 2AHGA 1KSDA 3E73A 1L1YA 1QSJA 2B4FA 1UMPA 3AFJA 3SDQA 2CQTA 3E6UA 3RX5A 1GSZA 1FBWA 2WYNA 1V5CA 3RSYA 1HZFA 1KKTA 5FO7B 5GW7A 5GZKA 3KQ4A 2NOJA 1GLMA 4V1RA 3SQCA 4Z4LA 3PYBA 1GAHA 2DROA 2XWJB 1TNOB 3QT3A 2H6IB 1LD8B 4C1SA 4YDEB 4D4BA 3GLYA 2GZ6A 3HXBB 1H3CA 3D3IA 4LNVA 4Z4JA 1O6HA 3HXCB 3QRYA 2NVPA 5AGDA 2Z07A 4QT9A 3SDTA 1NI1B 2RI8A 3WC3A 1O1RB 4LIXA 3RENA 1ULVA 1FT2B 3SFYB 3SDRA 2FV1A 1FP3A 3GT5A 4GL3A 5DGRA 3Q7AB 3ON6A 1SQCA 4FUSA 1G6IA 1W6KA 1XWQA 3EUVB 4D4DA 3WUXA 2F6DA 3QSPA 5MEHA 4ONTA 1TNBB 1LF9A 4WVAA 2V8JA 2D8LA 1KZOB 1AYXA 2F0YB 3Q79B 3ACSA 3Q78B 1D8DB 1N4QB 1V5DA 2A73B 3QWTA 4L9PB 2B39A 3QT9A 1LD7B 3RJ3A 3M71A 1S63B 3Q73B 3M72A 1V7XA 3SDVA 4TF4A 5M7IA 1DCEB 4CE7A 4WVCA 1VD5A 3W7UA 3M77A 2FUZA 3S9VA 2I07B 1IS9A 4GTSB 3M78A 3PZ3B 2G02A 4FXGB 1D8EB 5FO9B 4YCRA 2V3PA 3QFZA 2IEJB 1XW2A 3KSLB 3VW5A 2ZISB 3RX7A 1R76A 4ZRPA 1H14A 4J5TA 1G9JA 1KSCA 1N4PB 3W5MA 2JJBA 1GAIA 2JF4A 2GH4A 3EQAA 2DRQA 2DRRA 1AGMA 3HXEB 2XFGA 1GXMA 3QXFA 4GTQB 1UT9A 3M73A 3EZ8A 1TN6B 1N95B 3D5SA 5CD2A 4DODA 1RQ5A 3A3VA 1KREA 2XWBB 3ANIA 1JS4A 3OXUA 1XWTA 5KKBA 2H6GB 4ZG8A 3HXDB 3KLSA 2BB5A 2D5JA 4KKIA 4KTPA 2V8IA 2VN7A 3DSVB 1FO3A 2JG0A 1WU4A 1KRFA 1H39A 2R2LB 1JCRB 3H2WA 1KZPB 1H3BA 1LTXB 1N9AB 1H54A 1LF6A 4M76A 2SQCA 1FO2A 4Q88A 2WINB 1O79A 1GA2A 4GTOB 3DSUB 1V7WA 1FT1B 1TNYB 4V1SA 3H7LA 3K11A 3GZKA 2V3NA 3CU7A 2RGKA 1O6QA 4D94A 2GOXA 1N94B 2V8KA 4MU9A 3EU5B 3DSSB 3E30B 3P5PA 4LNBB 4MBGB 4FXKB 3S4CA 3SDUA 5CZLA 3DPYB 1JCQB 1IA7A 1TNZB 3W7SA 1WU6A 3PZ2B 3QG0A 2PMVA 4D4AA 3WKGA 3E33B 1V7VA 1H35A 3W7XA 2FV0A 3DRAB 1WZZA 2G0DA 4GTRB 5CA3A 1N4RB 1H12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQ4 A;  2NOJ A;  1MZC B;  1SA4 B;  1N4P B;  1GXO A;  4V1R A;  3SQC A;  1O1T B;  1X81 B;  3OED A;  1S64 B;  2XWJ B;  1TNO B;  4BOJ A;  2H6I B;  2PN5 A;  1LD8 B;  3DST B;  1GXN A;  4GTT B;  4C1S A;  3DSW B;  3HXE B;  1GXM A;  4YDE B;  2ZIR B;  4D4B A;  4GTV B;  4GTQ B;  3SFX B;  3HXB B;  1H37 A;  1TN6 B;  1N95 B;  1H3C A;  1GHQ A;  3D5S A;  4LNV A;  1NL4 B;  1QQF A;  1O6H A;  3DSX B;  3HXC B;  5AGD A;  4ZH1 A;  5FO8 B;  2XWB B;  1NI1 B;  2BB6 A;  3G6J B;  1O1R B;  3OXU A;  3E34 B;  1JCS B;  3E37 B;  2H6G B;  1TN8 B;  1FT2 B;  3SFY B;  5FOB B;  1SA5 B;  3HXD B;  3KLS A;  2BB5 A;  3D5R A;  4KKI A;  2BED B;  2V8I A;  5JPM B;  1TN7 B;  3Q7A B;  1SQC A;  1W6K A;  4LNG B;  3DSV B;  3Q7F B;  4GTP B;  3EUV B;  1O6R A;  3PZ4 B;  1N4S B;  2WY7 A;  4D4D A;  1H39 A;  1W6J A;  2BBC A;  2R2L B;  2XQW A;  1JCR B;  3PZ1 B;  1KZP B;  1H3B A;  1LTX B;  1N9A B;  4ONT A;  1O5M B;  1TNB B;  4M76 A;  2SQC A;  2V8J A;  1KZO B;  5JPN B;  3E32 B;  2F0Y B;  3Q79 B;  4YDO B;  2WY8 A;  3Q78 B;  1D8D B;  1N4Q B;  2A73 B;  2WIN B;  1O79 A;  4GTO B;  1TNU B;  4L9P B;  4BOK A;  2B39 A;  1LD7 B;  3DSU B;  3Q75 B;  1C3D A;  3RJ3 A;  4KKJ A;  1FT1 B;  1S63 B;  1TNY B;  3Q73 B;  3K7X A;  4V1S A;  3KSQ B;  1H3A A;  2WII B;  2V3N A;  3CU7 A;  4D94 A;  1O6Q A;  1O1S B;  2GOX A;  1DCE B;  1N94 B;  2V8K A;  3EU5 B;  4MU9 A;  4D4C A;  3DSS B;  3E30 B;  4LNB B;  2I07 B;  4MBG B;  3HXF B;  4FXK B;  4GTS B;  1H36 A;  3DPY B;  4ZRQ A;  1JCQ B;  1QSJ A;  3PZ3 B;  1TNZ B;  1UMP A;  2G02 A;  4EHM B;  1FPP B;  4FXG B;  3PZ2 B;  1D8E B;  2PMV A;  4GTM B;  1GSZ A;  4D4A A;  5FO9 B;  2H6F B;  1QBQ B;  3E33 B;  2V3P A;  1H35 A;  2IEJ B;  3DRA B;  1HZF A;  3C72 B;  3KSL B;  2G0D A;  4GTR B;  5FO7 B;  2H6H B;  2ZIS B;  1N4R B;  1R76 A;  4ZRP A; 
#chains in the Genus database with same CATH topology
 1MZC B;  5GY3 A;  3PYA A;  5IM1 A;  1GXO A;  2A8Z A;  2E22 A;  5IL3 A;  1O1T B;  3ANJ A;  3OED A;  4EL8 A;  3M76 A;  4WVB A;  3QXQ A;  4L6X A;  1GXN A;  4GTT B;  5M7Y A;  3M7E A;  4GTV B;  4OZV A;  3SFX B;  1H37 A;  1GHQ A;  3W7T A;  3P2C A;  3QDE A;  1F9D A;  4ZH1 A;  4AYQ A;  2DRS A;  3M7C A;  4CJ1 A;  2BB6 A;  4CJ0 A;  3G6J B;  1DOG A;  2ZBL A;  1RWG A;  3E37 B;  1HN0 A;  1G9G A;  1TN8 B;  2CQS A;  4L0G A;  1H13 A;  3D5R A;  4WU0 A;  2BED B;  3M74 A;  2EAC A;  4LNG B;  1IA6 A;  4GTP B;  1LXK A;  3N0F A;  3PZ4 B;  5ILJ A;  1W6J A;  3CIH A;  4KTR A;  1O5M B;  1I8Q A;  3SAE A;  3T33 A;  5JPN B;  3E32 B;  5E2J A;  4TXT A;  4YDO B;  2WY8 A;  3WKF A;  2RI9 A;  3WKH A;  1TNU B;  4BOK A;  4ZH5 A;  4KKJ A;  3K7X A;  2FUQ A;  3KSQ B;  5EAU A;  1O1S B;  2BRV X;  4D4C A;  1WU5 A;  3HXF B;  1NC5 A;  1CLC A;  1H36 A;  4ZRQ A;  1KWF A;  4FJQ A;  3W7W A;  1N7P A;  1HV6 A;  2EAE A;  1CEM A;  1UG9 A;  4EHM B;  1FPP B;  4MMH A;  4AYP A;  1KS8 A;  2EAD A;  4GTM B;  4AYO A;  2H6F B;  4Q2B A;  3M7L A;  1HCU A;  1RWC A;  1QBQ B;  1N22 A;  1X9D A;  1KFG A;  3C72 B;  2Q1F A;  1G87 A;  2H6H B;  3S4A A;  1SA4 B;  2FBA A;  3ACT A;  1FMI A;  3WIR A;  2AFA A;  1HXG A;  1X81 B;  5C05 A;  5DGQ A;  1S64 B;  2WCO A;  2VN4 A;  3S4B A;  2QNO A;  4JJJ A;  1K72 A;  3WKI A;  4BOJ A;  2PN5 A;  1W3Y A;  3DST B;  3X17 A;  3DSW B;  1HXA A;  2ZIR B;  3RX8 A;  4NEI A;  3G4F A;  2OKX A;  1NL4 B;  1QQF A;  3QPF A;  3A0O A;  3DSX B;  3VXD A;  1N23 A;  1NXC A;  5FO8 B;  2P0V A;  3H3K A;  3WIQ A;  2YIK A;  1DL2 A;  1TF4 A;  3E34 B;  1JCS B;  1HMW A;  5FOB B;  1SA5 B;  5JPM B;  1TN7 B;  1FCE A;  3PMM A;  3Q7F B;  1O6R A;  1N4S B;  2WY7 A;  3M75 A;  3P5R A;  5IK6 A;  2BBC A;  2XQW A;  1N7Q A;  4GAX A;  3PZ1 B;  3EU8 A;  3WIW A;  3RRS A;  1OJO A;  1N7O A;  4XUV A;  3ANK A;  1FAE A;  3QFY A;  3TF4 A;  1CB8 A;  2ZZR A;  3S4D A;  1RWH A;  3Q75 B;  1C3D A;  1FBO A;  4DOE A;  3W5N A;  1N24 A;  3E80 A;  1H3A A;  2WII B;  2EAB A;  2AHF A;  1L2A A;  3VSM A;  4AYR A;  3M7B A;  1F9O A;  2AHG A;  1RWF A;  1KSD A;  3E73 A;  1L1Y A;  1F9G A;  1F1S A;  1RWA A;  1QSJ A;  4OK4 A;  2B4F A;  1UMP A;  3AFJ A;  3SDQ A;  2CQT A;  3E6U A;  3RX5 A;  1GSZ A;  1FBW A;  1X1J A;  1V5C A;  2WYN A;  3RSY A;  2WDA A;  1HZF A;  1KKT A;  5FO7 B;  5GW7 A;  5GZK A;  3LZ9 A;  1N20 A;  3KQ4 A;  2NOJ A;  1GLM A;  4V1R A;  5JMF A;  3SQC A;  4D94 A;  4Z4L A;  3PYB A;  4RNQ A;  1GAH A;  2DRO A;  2XWJ B;  5ILD A;  1TNO B;  3QT3 A;  2H6I B;  1LD8 B;  3M00 A;  5IL8 A;  4C1S A;  4YDE B;  4D4B A;  3GLY A;  2GZ6 A;  5ILY A;  3M01 A;  3HXB B;  2ONG A;  1H3C A;  3D3I A;  4LNV A;  4Z4J A;  1O6H A;  3HXC B;  3QRY A;  2NVP A;  5AGD A;  2Z07 A;  4QT9 A;  3SDT A;  1NI1 B;  2RI8 A;  4OJZ A;  3WC3 A;  1OJP A;  1O1R B;  4LIX A;  3REN A;  1ULV A;  3NNB A;  1FT2 B;  3SFY B;  3SDR A;  2FV1 A;  1FP3 A;  3GT5 A;  5EAS A;  4GL3 A;  5DGR A;  3Q7A B;  3ON6 A;  1J0M A;  1SQC A;  4FUS A;  1G6I A;  1W6K A;  1XWQ A;  3EUV B;  4D4D A;  3WUX A;  2F6D A;  3QSP A;  5MEH A;  4ONT A;  1HMU A;  1TNB B;  1LF9 A;  4WVA A;  2V8J A;  2D8L A;  1KZO B;  3E7J A;  1AYX A;  2F0Y B;  3Q79 B;  3ACS A;  3G4D A;  3Q78 B;  1D8D B;  1N4Q B;  1V5D A;  2A73 B;  4DI5 A;  3QWT A;  4L9P B;  5ILK A;  2B39 A;  3QT9 A;  1LD7 B;  5ILH A;  3RJ3 A;  3M71 A;  1S63 B;  3Q73 B;  4F13 A;  5IKA A;  3M72 A;  1V7X A;  5JMD A;  3SDV A;  4TF4 A;  5M7I A;  3NFV A;  1DCE B;  4CE7 A;  5EAT A;  4WVC A;  1VD5 A;  3W7U A;  3M77 A;  2FUZ A;  3S9V A;  2I07 B;  1IS9 A;  4GTS B;  3M78 A;  2X03 A;  5DHI A;  3PZ3 B;  1N21 A;  2G02 A;  4FXG B;  1D8E B;  5FO9 B;  4YCR A;  3VSN A;  2FUT A;  2V3P A;  3QFZ A;  1HXC A;  2IEJ B;  1XW2 A;  3KSL B;  1X1I A;  2ZIS B;  3VW5 A;  3RX7 A;  1R76 A;  4OZW A;  4ZRP A;  1H14 A;  4J5T A;  4OK2 A;  1G9J A;  1KSC A;  1N4P B;  3W5M A;  2BRW A;  2JJB A;  1GAI A;  2JF4 A;  2ONH A;  1LXM A;  2GH4 A;  3EQA A;  2DRQ A;  1HM2 A;  2DRR A;  1AGM A;  5DHK A;  3M02 A;  3HXE B;  2XFG A;  1GXM A;  3QXF A;  4GTQ B;  1UT9 A;  3M73 A;  3EZ8 A;  1TN6 B;  1N95 B;  3D5S A;  5CD2 A;  4DOD A;  5IK0 A;  2J5C A;  1RQ5 A;  1HM3 A;  1EGU A;  3A3V A;  2BRP A;  1C82 A;  1KRE A;  1N1B A;  2XWB B;  3ANI A;  1JS4 A;  3OXU A;  1XWT A;  5KKB A;  2H6G B;  4ZG8 A;  3HXD B;  3KLS A;  2BB5 A;  2D5J A;  4KKI A;  4KTP A;  2V8I A;  4MMI A;  2VN7 A;  1J0N A;  1N7R A;  3DSV B;  1FO3 A;  1X1H A;  2JG0 A;  1WU4 A;  1KRF A;  1OJM A;  1H39 A;  5ILZ A;  2R2L B;  1JCR B;  3H2W A;  5IKH A;  1KZP B;  1H3B A;  1LTX B;  1N9A B;  1H54 A;  1LF6 A;  4M76 A;  2SQC A;  1FO2 A;  4Q88 A;  4FNV A;  2WIN B;  1O79 A;  1GA2 A;  4GTO B;  3DSU B;  1QAZ A;  1V7W A;  1FT1 B;  1N7N A;  1TNY B;  4V1S A;  3H7L A;  3K11 A;  3GZK A;  2V3N A;  3CU7 A;  2RGK A;  1O6Q A;  1N1Z A;  2GOX A;  1N94 B;  2V8K A;  4MU9 A;  1LOH A;  3EU5 B;  3DSS B;  3E30 B;  3P5P A;  4LNB B;  4MBG B;  4FXK B;  3S4C A;  3SDU A;  5CZL A;  3DPY B;  1JCQ B;  4E1Y A;  1IA7 A;  1TNZ B;  1RW9 A;  3W7S A;  1WU6 A;  2E24 A;  3PZ2 B;  1OJN A;  3QG0 A;  2PMV A;  4D4A A;  5IK9 A;  1HX9 A;  3WKG A;  3E33 B;  3AFL A;  1V7V A;  1H35 A;  3W7X A;  2FV0 A;  3DRA B;  1WZZ A;  2G0D A;  4F10 A;  4GTR B;  3N0G A;  5CA3 A;  5ILI A;  1N4R B;  1H12 A; 
#chains in the Genus database with same CATH homology
 1MZC B;  5GY3 A;  3PYA A;  1GXO A;  2A8Z A;  1O1T B;  3ANJ A;  3OED A;  4EL8 A;  3M76 A;  4WVB A;  3QXQ A;  4L6X A;  1GXN A;  4GTT B;  5M7Y A;  3M7E A;  4GTV B;  3SFX B;  1H37 A;  1GHQ A;  3W7T A;  3P2C A;  3QDE A;  1F9D A;  4ZH1 A;  4AYQ A;  2DRS A;  3M7C A;  4CJ1 A;  2BB6 A;  4CJ0 A;  3G6J B;  1DOG A;  2ZBL A;  3E37 B;  1G9G A;  1TN8 B;  2CQS A;  4L0G A;  1H13 A;  3D5R A;  4WU0 A;  2BED B;  3M74 A;  2EAC A;  4LNG B;  1IA6 A;  4GTP B;  3PZ4 B;  1W6J A;  3CIH A;  4KTR A;  1O5M B;  3SAE A;  3T33 A;  5JPN B;  3E32 B;  5E2J A;  4TXT A;  4YDO B;  2WY8 A;  3WKF A;  2RI9 A;  3WKH A;  1TNU B;  4BOK A;  4ZH5 A;  4KKJ A;  3K7X A;  3KSQ B;  1O1S B;  4D4C A;  1WU5 A;  3HXF B;  1NC5 A;  1CLC A;  1H36 A;  4ZRQ A;  1KWF A;  3W7W A;  2EAE A;  1CEM A;  1UG9 A;  4EHM B;  1FPP B;  4AYP A;  1KS8 A;  2EAD A;  4GTM B;  4AYO A;  2H6F B;  4Q2B A;  3M7L A;  1HCU A;  1QBQ B;  1X9D A;  1KFG A;  3C72 B;  1G87 A;  2H6H B;  3S4A A;  1SA4 B;  2FBA A;  3ACT A;  1FMI A;  3WIR A;  2AFA A;  1X81 B;  5DGQ A;  1S64 B;  2VN4 A;  3S4B A;  2QNO A;  4JJJ A;  1K72 A;  3WKI A;  4BOJ A;  2PN5 A;  3DST B;  3X17 A;  3DSW B;  3RX8 A;  2ZIR B;  2OKX A;  1NL4 B;  1QQF A;  3QPF A;  3DSX B;  3VXD A;  1NXC A;  5FO8 B;  2P0V A;  3H3K A;  3WIQ A;  2YIK A;  1DL2 A;  1TF4 A;  3E34 B;  1JCS B;  5FOB B;  1SA5 B;  5JPM B;  1TN7 B;  1FCE A;  3PMM A;  3Q7F B;  1O6R A;  1N4S B;  2WY7 A;  3M75 A;  3P5R A;  2BBC A;  2XQW A;  3PZ1 B;  3EU8 A;  3WIW A;  3RRS A;  4XUV A;  3ANK A;  1FAE A;  3QFY A;  3TF4 A;  2ZZR A;  3S4D A;  3Q75 B;  1C3D A;  1FBO A;  4DOE A;  3W5N A;  1H3A A;  2WII B;  2EAB A;  2AHF A;  1L2A A;  4AYR A;  3M7B A;  1F9O A;  2AHG A;  1KSD A;  3E73 A;  1L1Y A;  1QSJ A;  2B4F A;  1UMP A;  3AFJ A;  3SDQ A;  2CQT A;  3E6U A;  3RX5 A;  1GSZ A;  1FBW A;  2WYN A;  1V5C A;  3RSY A;  1HZF A;  1KKT A;  5FO7 B;  5GW7 A;  5GZK A;  3KQ4 A;  2NOJ A;  1GLM A;  4V1R A;  3SQC A;  4Z4L A;  3PYB A;  1GAH A;  2DRO A;  2XWJ B;  1TNO B;  3QT3 A;  2H6I B;  1LD8 B;  4C1S A;  4YDE B;  4D4B A;  3GLY A;  2GZ6 A;  3HXB B;  1H3C A;  3D3I A;  4LNV A;  4Z4J A;  1O6H A;  3HXC B;  3QRY A;  2NVP A;  5AGD A;  2Z07 A;  4QT9 A;  3SDT A;  1NI1 B;  2RI8 A;  3WC3 A;  1O1R B;  4LIX A;  3REN A;  1ULV A;  1FT2 B;  3SFY B;  3SDR A;  2FV1 A;  1FP3 A;  3GT5 A;  4GL3 A;  5DGR A;  3Q7A B;  3ON6 A;  1SQC A;  4FUS A;  1G6I A;  1W6K A;  1XWQ A;  3EUV B;  4D4D A;  3WUX A;  2F6D A;  3QSP A;  5MEH A;  4ONT A;  1TNB B;  1LF9 A;  4WVA A;  2V8J A;  2D8L A;  1KZO B;  1AYX A;  2F0Y B;  3Q79 B;  3ACS A;  3Q78 B;  1D8D B;  1N4Q B;  1V5D A;  2A73 B;  3QWT A;  4L9P B;  2B39 A;  3QT9 A;  1LD7 B;  3RJ3 A;  3M71 A;  1S63 B;  3Q73 B;  3M72 A;  1V7X A;  3SDV A;  4TF4 A;  5M7I A;  1DCE B;  4CE7 A;  4WVC A;  1VD5 A;  3W7U A;  3M77 A;  2FUZ A;  3S9V A;  2I07 B;  1IS9 A;  4GTS B;  3M78 A;  3PZ3 B;  2G02 A;  4FXG B;  1D8E B;  5FO9 B;  4YCR A;  2V3P A;  3QFZ A;  2IEJ B;  1XW2 A;  3KSL B;  3VW5 A;  2ZIS B;  3RX7 A;  1R76 A;  4ZRP A;  1H14 A;  4J5T A;  1G9J A;  1KSC A;  1N4P B;  3W5M A;  2JJB A;  1GAI A;  2JF4 A;  2GH4 A;  3EQA A;  2DRQ A;  2DRR A;  1AGM A;  3HXE B;  2XFG A;  1GXM A;  3QXF A;  4GTQ B;  1UT9 A;  3M73 A;  3EZ8 A;  1TN6 B;  1N95 B;  3D5S A;  5CD2 A;  4DOD A;  1RQ5 A;  3A3V A;  1KRE A;  2XWB B;  3ANI A;  1JS4 A;  3OXU A;  1XWT A;  5KKB A;  2H6G B;  4ZG8 A;  3HXD B;  3KLS A;  2BB5 A;  2D5J A;  4KKI A;  4KTP A;  2V8I A;  2VN7 A;  3DSV B;  1FO3 A;  2JG0 A;  1WU4 A;  1KRF A;  1H39 A;  2R2L B;  1JCR B;  3H2W A;  1KZP B;  1H3B A;  1LTX B;  1N9A B;  1H54 A;  1LF6 A;  4M76 A;  2SQC A;  1FO2 A;  4Q88 A;  2WIN B;  1O79 A;  1GA2 A;  4GTO B;  3DSU B;  1V7W A;  1FT1 B;  1TNY B;  4V1S A;  3H7L A;  3K11 A;  3GZK A;  2V3N A;  3CU7 A;  2RGK A;  1O6Q A;  4D94 A;  2GOX A;  1N94 B;  2V8K A;  4MU9 A;  3EU5 B;  3DSS B;  3E30 B;  3P5P A;  4LNB B;  4MBG B;  4FXK B;  3S4C A;  3SDU A;  5CZL A;  3DPY B;  1JCQ B;  1IA7 A;  1TNZ B;  3W7S A;  1WU6 A;  3PZ2 B;  3QG0 A;  2PMV A;  4D4A A;  3WKG A;  3E33 B;  1V7V A;  1H35 A;  3W7X A;  2FV0 A;  3DRA B;  1WZZ A;  2G0D A;  4GTR B;  5CA3 A;  1N4R B;  1H12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...