3T33A

Crystal structure of arabidopsis gcr2
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
407
structure length
407
Chain Sequence
RFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein coupled receptor
publication title Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein receptor
total genus 154
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2011-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3t33A00
1NXCA 4AYOA 4WVCA 5CZLA 3RX5A 3S4BA 2EADA 2EABA 3VW5A 5CA3A 1G87A 2XFGA 1VD5A 4WVBA 3WC3A 3GLYA 4L6XA 3QT9A 2AFAA 2DRRA 2OKXA 3QG0A 1FBOA 3RSYA 1CEMA 2FUZA 1RQ5A 3ANIA 1G9GA 3QFYA 5DGRA 1F9OA 2P0VA 1V7XA 2DROA 4ZH5A 2VN7A 3S4DA 4AYPA 1FO2A 5DGQA 3RENA 1AGMA 4KTRA 1FMIA 3WIRA 3W7WA 2DRQA 1FBWA 1GAHA 3EQAA 5CD2A 1IS9A 2GH4A 3W7TA 1CLCA 4L0GA 3WKFA 3E6UA 4Q2BA 3VXDA 1V5CA 3A3VA 3ANKA 4JJJA 1H54A 1UT9A 1WZZA 2RI9A 1H13A 1XWTA 3QPFA 3GT5A 3S4CA 3W7SA 1X9DA 2JJBA 1G9JA 3H7LA 1H14A 2Z07A 3W5NA 1TF4A 4AYQA 2FV0A 1WU5A 1KREA 4Z4LA 3WUXA 4J5TA 2AHFA 2F6DA 2CQSA 2ZBLA 3T33A 1KKTA 3E73A 2A8ZA 5M7YA 1V7VA 3RRSA 3W7XA 1XWQA 3WIQA 4ZG8A 3WIWA 1KWFA 1ULVA 3QFZA 3S4AA 1KRFA 2FBAA 1JS4A 1XW2A 3QXQA 2RGKA 4CJ0A 3QRYA 2EACA 1WU4A 3ON6A 1F9DA 2EAEA 1FCEA 3AFJA 4DODA 3W5MA 1AYXA 2NVPA 2ZZRA 1HCUA 4CE7A 3TF4A 2FV1A 1GA2A 1G6IA 1K72A 3ACTA 3H2WA 3CIHA 3QT3A 2AHGA 1FAEA 4WVAA 1L2AA 2VN4A 1V7WA 2DRSA 3D3IA 3WKHA 2YIKA 4AYRA 2WYNA 3H3KA 1FO3A 5M7IA 3ANJA 1KFGA 1LF6A 4CJ1A 4XUVA 1WU6A 3P2CA 2JF4A 1FP3A 1UG9A 2D5JA 3ACSA 1KS8A 4FUSA 5GW7A 3QWTA 4DOEA 3RX7A 3W7UA 5E2JA 1DOGA 2JG0A 1H12A 3WKIA 5GY3A 3GZKA 3QXFA 4TF4A 3RX8A 1KSDA 1LF9A 4Q88A 4TXTA 3WKGA 3QDEA 4EL8A 3K11A 1V5DA 5KKBA 5MEHA 4WU0A 1GLMA 2CQTA 2B4FA 1L1YA 2RI8A 4KTPA 2GZ6A 2D8LA 1NC5A 1GAIA 1DL2A 3EZ8A 1KSCA 1IA6A 2QNOA 1IA7A 3QSPA 4Z4JA 3X17A 3PMMA
chains in the Genus database with same CATH superfamily
3P5RA 1HZFA 1NXCA 1R76A 1GXNA 2EABA 3Q79B 1G87A 1RW9A 1X1IA 2XFGA 3WC3A 4L6XA 5EASA 2BRPA 2AFAA 2DRRA 2OKXA 3QG0A 1FBOA 1SA4B 1LXMA 1HMWA 2P0VA 4ZH5A 2VN7A 4AYPA 1N1BA 3E80A 3E33B 4D4BA 3RENA 1J0NA 3M71A 4F13A 2ZIRB 1X1JA 3A0OA 3WIRA 1FBWA 3OXUA 4GTSB 3VSMA 3PYBA 2GH4A 3W7TA 1RWFA 2BRWA 3VXDA 4EL8A 3ANKA 3WUXA 3QPFA 1OJOA 2XQWA 3EUVB 3PZ1B 2Z07A 5FOBB 1KREA 3DSSB 3G4DA 1KKTA 2A8ZA 5IM1A 4KKIA 4GTQB 4MBGB 1OJMA 1HXCA 4OZWA 1GXMA 3SFXB 2FBAA 2RGKA 4CJ0A 4V1SA 2EACA 5AGDA 3AFJA 3TF4A 2WCOA 2FV1A 3E37B 1O6HA 2WDAA 3H2WA 1HN0A 3PYAA 3PZ4B 5ILJA 1V7WA 1O6RA 2ONHA 4FXGB 3DSTB 1KFGA 1LF6A 3KSLB 2FUQA 3P2CA 3KLSA 3ACSA 5GW7A 1KS8A 4FUSA 4E1YA 4OK4A 5GY3A 4TF4A 3WKGA 5MEHA 1I8QA 1KZPB 5GZKA 3RJ3A 4D4DA 2SQCA 1L1YA 2XWBB 1TNZB 4GTVB 1DL2A 1W3YA 3M72A 1QBQB 3EU5B 3PMMA 1N95B 2WY7A 4WVCA 1N23A 3G6JB 1OJPA 3VW5A 5CA3A 1VD5A 4WVBA 3QT9A 1CEMA 2FUZA 3KQ4A 1G9GA 1DCEB 5EATA 2E24A 2X03A 4GTTB 3Q75B 4KTRA 3W7WA 1GAHA 5CD2A 1IS9A 1X81B 5IL8A 1N7QA 3VSNA 2A73B 1N4RB 3E6UA 1V5CA 4JJJA 1H54A 1WZZA 2RI9A 1C3DA 5DHIA 1H39A 4QT9A 1X9DA 2JJBA 3H7LA 1H14A 1N20A 1H36A 1TNYB 1J0MA 1WU5A 3E30B 4ZRPA 1RWCA 5DHKA 1W6JA 2F6DA 2CQSA 1CB8A 2ZBLA 4GTPB 3E73A 3T33A 5M7YA 1V7VA 5ILYA 4GTRB 5IK9A 1ULVA 1N94B 4C1SA 4D94A 1JS4A 1TN7B 3HXEB 1N4SB 3QXQA 1H35A 1H3BA 2F0YB 1LD8B 4RNQA 1RWHA 3ON6A 2V8IA 1AYXA 3E34B 2V3NA 1HCUA 3M7CA 3G4FA 1RWGA 2V3PA 1N7RA 3K7XA 1O5MB 1FAEA 2ZISB 3M00A 2PN5A 2VN4A 3D3IA 4GL3A 4BOJA 2YIKA 5EAUA 2WYNA 1FO3A 5M7IA 3ANJA 2Q1FA 1JCSB 1UG9A 1N4QB 3M73A 1DOGA 2BBCA 5IKAA 1QAZA 1LF9A 3QDEA 3M77A 5IKHA 1N22A 1O79A 3NFVA 4YCRA 4MMHA 2IEJB 4KTPA 5FO9B 5ILKA 3SAEA 1NC5A 5JPNB 3M7LA 1IA6A 2QNOA 5ILIA 3SDVA 1IA7A 1LXKA 2E22A 1FPPB 3QSPA 3X17A 1O1RB 4F10A 1N9AB 1HX9A 4ZH1A 4DI5A 1W6KA 1S64B 3RX5A 5CZLA 3S4BA 2B39A 3DSUB 1LTXB 2GOXA 1RQ5A 3Q7AB 3QFYA 3PZ2B 3D5SA 1HXAA 3S4DA 5IL3A 1FO2A 1HM2A 5DGQA 1AGMA 4YDEB 1FMIA 3HXDB 2DRQA 4FJQA 4ZRQA 1QSJA 3EQAA 1LD7B 4FXKB 3M78A 4Q2BA 3C72B 5JMFA 1UT9A 1H13A 1XWTA 3GT5A 2BB6A 1TN8B 3W7SA 4D4AA 1G9JA 3W5NA 1TF4A 3P5PA 2R2LB 3M75A 4Z4LA 3HXCB 1N21A 1HMUA 3Q73B 2WY8A 2I07B 3RRSA 3W7XA 3WIWA 1KWFA 3CU7A 5ILZA 3PZ3B 4GAXA 1KRFA 1NI1B 3HXBB 4ONTA 3QRYA 1WU4A 1F9DA 1FCEA 4DODA 3SDUA 4LNGB 2NVPA 2ZZRA 4GTMB 1GA2A 4MU9A 1K72A 3SDRA 4MMIA 3M74A 3ACTA 1RWAA 3CIHA 3QT3A 2AHGA 4V1RA 1H37A 4YDOB 4WVAA 1GXOA 3Q7FB 1X1HA 3DRAB 2DRSA 3WKHA 5FO7B 1N1ZA 1TNOB 4XUVA 1OJNA 3M02A 4OJZA 1UMPA 3M01A 1H3AA 2D5JA 3RX7A 2JG0A 1H12A 3WKIA 1D8DB 3M7EA 2V8KA 3SQCA 4LNBB 3RX8A 4Q88A 4TXTA 1FT2B 1V5DA 1GLMA 5JPMB 3DSWB 2B4FA 2RI8A 3SFYB 2WIIB 2D8LA 5FO8B 3EZ8A 4Z4JA 3Q78B 3DSXB 2V8JA 2ONGA 1JCRB 4AYOA 3E7JA 2EADA 1LOHA 4LIXA 3GLYA 4LNVA 4D4CA 3D5RA 4GTOB 3RSYA 1NL4B 1QQFA 4OZVA 3ANIA 3DSVB 5DGRA 4EHMB 1F9OA 1V7XA 1TN6B 2DROA 2H6GB 1TNUB 3AFLA 3NNBA 1HV6A 1MZCB 1SA5B 4M76A 5ILDA 1F9GA 4NEIA 3DPYB 2H6HB 1H3CA 1CLCA 5ILHA 4L0GA 3WKFA 2WINB 3A3VA 5IK6A 1N7OA 3S4CA 3N0GA 4AYQA 2FV0A 1EGUA 1HXGA 2BRVX 2FUTA 4J5TA 2AHFA 3M76A 1N4PB 1FT1B 1C82A 1O1TB 3OEDA 1XWQA 3WIQA 4ZG8A 1SQCA 1GSZA 3QFZA 3S4AA 1XW2A 2G02A 3EU8A 2EAEA 5JMDA 3W5MA 2H6IB 4CE7A 1G6IA 5IK0A 1O6QA 3KSQB 3SDQA 5C05A 3S9VA 2XWJB 3E32B 3N0FA 1L2AA 4AYRA 2BEDB 3H3KA 2NOJA 4CJ1A 1JCQB 1WU6A 2G0DA 2JF4A 4L9PB 1FP3A 3M7BA 3QWTA 1HM3A 4DOEA 4BOKA 3W7UA 5E2JA 4OK2A 1GHQA 1S63B 2PMVA 4KKJA 2J5CA 3GZKA 3QXFA 2BB5A 3LZ9A 1KSDA 3SDTA 1D8EB 5KKBA 1F1SA 3K11A 4FNVA 1O1SB 4WU0A 2CQTA 2H6FB 2GZ6A 1KZOB 1GAIA 3HXFB 1N7NA 1KSCA 1N24A 1N7PA 1TNBB
chains in the Genus database with same CATH topology
3P5RA 1HZFA 1NXCA 1R76A 1GXNA 2EABA 3Q79B 1G87A 2XFGA 3WC3A 4L6XA 2AFAA 2DRRA 2OKXA 3QG0A 1FBOA 1SA4B 2P0VA 4ZH5A 2VN7A 4AYPA 3E33B 4D4BA 3RENA 3M71A 2ZIRB 3WIRA 1FBWA 3OXUA 4GTSB 3PYBA 2GH4A 3W7TA 3VXDA 4EL8A 3ANKA 3WUXA 3QPFA 2XQWA 3EUVB 3PZ1B 2Z07A 5FOBB 1KREA 3DSSB 1KKTA 2A8ZA 4KKIA 4GTQB 4MBGB 1GXMA 3SFXB 2FBAA 2RGKA 4CJ0A 4V1SA 2EACA 5AGDA 3AFJA 3TF4A 2FV1A 3E37B 1O6HA 3H2WA 3PYAA 3PZ4B 1V7WA 1O6RA 4FXGB 3DSTB 1KFGA 1LF6A 3KSLB 3P2CA 3KLSA 3ACSA 5GW7A 1KS8A 4FUSA 5GY3A 4TF4A 3WKGA 5MEHA 1KZPB 5GZKA 3RJ3A 4D4DA 2SQCA 1L1YA 2XWBB 1TNZB 4GTVB 1DL2A 3M72A 1QBQB 3EU5B 3PMMA 1N95B 2WY7A 4WVCA 3G6JB 3VW5A 5CA3A 1VD5A 4WVBA 3QT9A 1CEMA 2FUZA 3KQ4A 1G9GA 1DCEB 4GTTB 3Q75B 4KTRA 3W7WA 1GAHA 5CD2A 1IS9A 1X81B 2A73B 1N4RB 3E6UA 1V5CA 4JJJA 1H54A 1WZZA 2RI9A 1C3DA 1H39A 4QT9A 1X9DA 2JJBA 3H7LA 1H14A 1H36A 1TNYB 1WU5A 3E30B 4ZRPA 1W6JA 2F6DA 2CQSA 2ZBLA 4GTPB 3T33A 3E73A 5M7YA 1V7VA 4GTRB 1ULVA 1N94B 4C1SA 4D94A 1JS4A 1TN7B 3HXEB 1N4SB 3QXQA 1H35A 1H3BA 2F0YB 1LD8B 3ON6A 2V8IA 1AYXA 3E34B 2V3NA 1HCUA 3M7CA 2V3PA 3K7XA 1O5MB 1FAEA 2ZISB 2PN5A 2VN4A 3D3IA 4GL3A 4BOJA 2YIKA 2WYNA 1FO3A 5M7IA 3ANJA 1JCSB 1UG9A 1N4QB 3M73A 1DOGA 2BBCA 1LF9A 3QDEA 3M77A 1O79A 4YCRA 2IEJB 4KTPA 5FO9B 3SAEA 1NC5A 5JPNB 3M7LA 1IA6A 2QNOA 3SDVA 1IA7A 1FPPB 3QSPA 3X17A 1O1RB 1N9AB 4ZH1A 1W6KA 1S64B 3RX5A 5CZLA 3S4BA 2B39A 3DSUB 1LTXB 2GOXA 1RQ5A 3Q7AB 3QFYA 3PZ2B 3D5SA 3S4DA 1FO2A 5DGQA 1AGMA 4YDEB 1FMIA 3HXDB 2DRQA 4ZRQA 1QSJA 3EQAA 1LD7B 4FXKB 3M78A 4Q2BA 3C72B 1UT9A 1H13A 1XWTA 3GT5A 2BB6A 1TN8B 3W7SA 4D4AA 1G9JA 3W5NA 1TF4A 3P5PA 2R2LB 3M75A 4Z4LA 3HXCB 3Q73B 2WY8A 2I07B 3RRSA 3W7XA 3WIWA 1KWFA 3CU7A 3PZ3B 1KRFA 1NI1B 3HXBB 4ONTA 3QRYA 1WU4A 1F9DA 1FCEA 4DODA 3SDUA 4LNGB 2NVPA 2ZZRA 4GTMB 1GA2A 4MU9A 1K72A 3SDRA 3M74A 3ACTA 3CIHA 3QT3A 2AHGA 4V1RA 1H37A 4YDOB 4WVAA 1GXOA 3Q7FB 3DRAB 2DRSA 3WKHA 5FO7B 1TNOB 4XUVA 1UMPA 1H3AA 2D5JA 3RX7A 2JG0A 1H12A 3WKIA 1D8DB 3M7EA 2V8KA 3SQCA 4LNBB 3RX8A 4Q88A 4TXTA 1FT2B 1V5DA 1GLMA 5JPMB 3DSWB 2B4FA 2RI8A 3SFYB 2WIIB 2D8LA 5FO8B 3EZ8A 4Z4JA 3Q78B 3DSXB 2V8JA 1JCRB 4AYOA 2EADA 4LIXA 3GLYA 4LNVA 4D4CA 3D5RA 4GTOB 3RSYA 1NL4B 1QQFA 3ANIA 3DSVB 5DGRA 4EHMB 1F9OA 1V7XA 1TN6B 2DROA 2H6GB 1TNUB 1MZCB 1SA5B 4M76A 3DPYB 2H6HB 1H3CA 1CLCA 4L0GA 3WKFA 2WINB 3A3VA 3S4CA 4AYQA 2FV0A 4J5TA 2AHFA 3M76A 1N4PB 1FT1B 1O1TB 3OEDA 1XWQA 3WIQA 4ZG8A 1SQCA 1GSZA 3QFZA 3S4AA 1XW2A 2G02A 3EU8A 2EAEA 3W5MA 2H6IB 4CE7A 1G6IA 1O6QA 3KSQB 3SDQA 3S9VA 2XWJB 3E32B 1L2AA 4AYRA 2BEDB 3H3KA 2NOJA 4CJ1A 1JCQB 1WU6A 2G0DA 2JF4A 4L9PB 1FP3A 3M7BA 3QWTA 4DOEA 4BOKA 3W7UA 5E2JA 1GHQA 1S63B 2PMVA 4KKJA 3GZKA 3QXFA 2BB5A 1KSDA 3SDTA 1D8EB 5KKBA 3K11A 1O1SB 4WU0A 2CQTA 2H6FB 2GZ6A 1KZOB 1GAIA 3HXFB 1KSCA 1TNBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NXC A;  4AYO A;  4WVC A;  5CZL A;  3RX5 A;  3S4B A;  2EAD A;  2EAB A;  3VW5 A;  5CA3 A;  1G87 A;  2XFG A;  1VD5 A;  4WVB A;  3WC3 A;  3GLY A;  4L6X A;  3QT9 A;  2AFA A;  2DRR A;  2OKX A;  3QG0 A;  1FBO A;  3RSY A;  1CEM A;  2FUZ A;  1RQ5 A;  3ANI A;  1G9G A;  3QFY A;  5DGR A;  1F9O A;  2P0V A;  1V7X A;  2DRO A;  4ZH5 A;  2VN7 A;  3S4D A;  4AYP A;  1FO2 A;  5DGQ A;  3REN A;  1AGM A;  4KTR A;  1FMI A;  3WIR A;  3W7W A;  2DRQ A;  1FBW A;  1GAH A;  3EQA A;  5CD2 A;  1IS9 A;  2GH4 A;  3W7T A;  1CLC A;  4L0G A;  3WKF A;  3E6U A;  4Q2B A;  3VXD A;  1V5C A;  3A3V A;  3ANK A;  4JJJ A;  1H54 A;  1UT9 A;  1WZZ A;  2RI9 A;  1H13 A;  1XWT A;  3QPF A;  3GT5 A;  3S4C A;  3W7S A;  1X9D A;  2JJB A;  1G9J A;  3H7L A;  1H14 A;  2Z07 A;  3W5N A;  1TF4 A;  4AYQ A;  2FV0 A;  1WU5 A;  1KRE A;  4Z4L A;  3WUX A;  4J5T A;  2AHF A;  2F6D A;  2CQS A;  2ZBL A;  3T33 A;  1KKT A;  3E73 A;  2A8Z A;  5M7Y A;  1V7V A;  3RRS A;  3W7X A;  1XWQ A;  3WIQ A;  4ZG8 A;  3WIW A;  1KWF A;  1ULV A;  3QFZ A;  3S4A A;  1KRF A;  2FBA A;  1JS4 A;  1XW2 A;  3QXQ A;  2RGK A;  4CJ0 A;  3QRY A;  2EAC A;  1WU4 A;  3ON6 A;  1F9D A;  2EAE A;  1FCE A;  3AFJ A;  4DOD A;  3W5M A;  1AYX A;  2NVP A;  2ZZR A;  1HCU A;  4CE7 A;  3TF4 A;  2FV1 A;  1GA2 A;  1G6I A;  1K72 A;  3ACT A;  3H2W A;  3CIH A;  3QT3 A;  2AHG A;  1FAE A;  4WVA A;  1L2A A;  2VN4 A;  1V7W A;  2DRS A;  3D3I A;  3WKH A;  2YIK A;  4AYR A;  2WYN A;  3H3K A;  1FO3 A;  5M7I A;  3ANJ A;  1KFG A;  1LF6 A;  4CJ1 A;  4XUV A;  1WU6 A;  3P2C A;  2JF4 A;  1FP3 A;  1UG9 A;  2D5J A;  3ACS A;  1KS8 A;  4FUS A;  5GW7 A;  3QWT A;  4DOE A;  3RX7 A;  3W7U A;  5E2J A;  1DOG A;  2JG0 A;  1H12 A;  3WKI A;  5GY3 A;  3GZK A;  3QXF A;  4TF4 A;  3RX8 A;  1KSD A;  1LF9 A;  4Q88 A;  4TXT A;  3WKG A;  3QDE A;  4EL8 A;  3K11 A;  1V5D A;  5KKB A;  5MEH A;  4WU0 A;  1GLM A;  2CQT A;  2B4F A;  1L1Y A;  2RI8 A;  4KTP A;  2GZ6 A;  2D8L A;  1NC5 A;  1GAI A;  1DL2 A;  3EZ8 A;  1KSC A;  1IA6 A;  2QNO A;  1IA7 A;  3QSP A;  4Z4J A;  3X17 A;  3PMM A; 
#chains in the Genus database with same CATH topology
 3P5R A;  1HZF A;  1NXC A;  1R76 A;  1GXN A;  2EAB A;  3Q79 B;  1G87 A;  1RW9 A;  1X1I A;  2XFG A;  3WC3 A;  4L6X A;  5EAS A;  2BRP A;  2AFA A;  2DRR A;  2OKX A;  3QG0 A;  1FBO A;  1SA4 B;  1LXM A;  1HMW A;  2P0V A;  4ZH5 A;  2VN7 A;  4AYP A;  1N1B A;  3E80 A;  3E33 B;  4D4B A;  3REN A;  1J0N A;  3M71 A;  4F13 A;  2ZIR B;  1X1J A;  3A0O A;  3WIR A;  1FBW A;  3OXU A;  4GTS B;  3VSM A;  3PYB A;  2GH4 A;  3W7T A;  1RWF A;  2BRW A;  3VXD A;  4EL8 A;  3ANK A;  3WUX A;  3QPF A;  1OJO A;  2XQW A;  3EUV B;  3PZ1 B;  2Z07 A;  5FOB B;  1KRE A;  3DSS B;  3G4D A;  1KKT A;  2A8Z A;  5IM1 A;  4KKI A;  4GTQ B;  4MBG B;  1OJM A;  1HXC A;  4OZW A;  1GXM A;  3SFX B;  2FBA A;  2RGK A;  4CJ0 A;  4V1S A;  2EAC A;  5AGD A;  3AFJ A;  3TF4 A;  2WCO A;  2FV1 A;  3E37 B;  1O6H A;  2WDA A;  3H2W A;  1HN0 A;  3PYA A;  3PZ4 B;  5ILJ A;  1V7W A;  1O6R A;  2ONH A;  4FXG B;  3DST B;  1KFG A;  1LF6 A;  3KSL B;  2FUQ A;  3P2C A;  3KLS A;  3ACS A;  5GW7 A;  1KS8 A;  4FUS A;  4E1Y A;  4OK4 A;  5GY3 A;  4TF4 A;  3WKG A;  5MEH A;  1I8Q A;  1KZP B;  5GZK A;  3RJ3 A;  4D4D A;  2SQC A;  1L1Y A;  2XWB B;  1TNZ B;  4GTV B;  1DL2 A;  1W3Y A;  3M72 A;  1QBQ B;  3EU5 B;  3PMM A;  1N95 B;  2WY7 A;  4WVC A;  1N23 A;  3G6J B;  1OJP A;  3VW5 A;  5CA3 A;  1VD5 A;  4WVB A;  3QT9 A;  1CEM A;  2FUZ A;  3KQ4 A;  1G9G A;  1DCE B;  5EAT A;  2E24 A;  2X03 A;  4GTT B;  3Q75 B;  4KTR A;  3W7W A;  1GAH A;  5CD2 A;  1IS9 A;  1X81 B;  5IL8 A;  1N7Q A;  3VSN A;  2A73 B;  1N4R B;  3E6U A;  1V5C A;  4JJJ A;  1H54 A;  1WZZ A;  2RI9 A;  1C3D A;  5DHI A;  1H39 A;  4QT9 A;  1X9D A;  2JJB A;  3H7L A;  1H14 A;  1N20 A;  1H36 A;  1TNY B;  1J0M A;  1WU5 A;  3E30 B;  4ZRP A;  1RWC A;  5DHK A;  1W6J A;  2F6D A;  2CQS A;  1CB8 A;  2ZBL A;  4GTP B;  3E73 A;  3T33 A;  5M7Y A;  1V7V A;  5ILY A;  4GTR B;  5IK9 A;  1ULV A;  1N94 B;  4C1S A;  4D94 A;  1JS4 A;  1TN7 B;  3HXE B;  1N4S B;  3QXQ A;  1H35 A;  1H3B A;  2F0Y B;  1LD8 B;  4RNQ A;  1RWH A;  3ON6 A;  2V8I A;  1AYX A;  3E34 B;  2V3N A;  1HCU A;  3M7C A;  3G4F A;  1RWG A;  2V3P A;  1N7R A;  3K7X A;  1O5M B;  1FAE A;  2ZIS B;  3M00 A;  2PN5 A;  2VN4 A;  3D3I A;  4GL3 A;  4BOJ A;  2YIK A;  5EAU A;  2WYN A;  1FO3 A;  5M7I A;  3ANJ A;  2Q1F A;  1JCS B;  1UG9 A;  1N4Q B;  3M73 A;  1DOG A;  2BBC A;  5IKA A;  1QAZ A;  1LF9 A;  3QDE A;  3M77 A;  5IKH A;  1N22 A;  1O79 A;  3NFV A;  4YCR A;  4MMH A;  2IEJ B;  4KTP A;  5FO9 B;  5ILK A;  3SAE A;  1NC5 A;  5JPN B;  3M7L A;  1IA6 A;  2QNO A;  5ILI A;  3SDV A;  1IA7 A;  1LXK A;  2E22 A;  1FPP B;  3QSP A;  3X17 A;  1O1R B;  4F10 A;  1N9A B;  1HX9 A;  4ZH1 A;  4DI5 A;  1W6K A;  1S64 B;  3RX5 A;  5CZL A;  3S4B A;  2B39 A;  3DSU B;  1LTX B;  2GOX A;  1RQ5 A;  3Q7A B;  3QFY A;  3PZ2 B;  3D5S A;  1HXA A;  3S4D A;  5IL3 A;  1FO2 A;  1HM2 A;  5DGQ A;  1AGM A;  4YDE B;  1FMI A;  3HXD B;  2DRQ A;  4FJQ A;  4ZRQ A;  1QSJ A;  3EQA A;  1LD7 B;  4FXK B;  3M78 A;  4Q2B A;  3C72 B;  5JMF A;  1UT9 A;  1H13 A;  1XWT A;  3GT5 A;  2BB6 A;  1TN8 B;  3W7S A;  4D4A A;  1G9J A;  3W5N A;  1TF4 A;  3P5P A;  2R2L B;  3M75 A;  4Z4L A;  3HXC B;  1N21 A;  1HMU A;  3Q73 B;  2WY8 A;  2I07 B;  3RRS A;  3W7X A;  3WIW A;  1KWF A;  3CU7 A;  5ILZ A;  3PZ3 B;  4GAX A;  1KRF A;  1NI1 B;  3HXB B;  4ONT A;  3QRY A;  1WU4 A;  1F9D A;  1FCE A;  4DOD A;  3SDU A;  4LNG B;  2NVP A;  2ZZR A;  4GTM B;  1GA2 A;  4MU9 A;  1K72 A;  3SDR A;  4MMI A;  3M74 A;  3ACT A;  1RWA A;  3CIH A;  3QT3 A;  2AHG A;  4V1R A;  1H37 A;  4YDO B;  4WVA A;  1GXO A;  3Q7F B;  1X1H A;  3DRA B;  2DRS A;  3WKH A;  5FO7 B;  1N1Z A;  1TNO B;  4XUV A;  1OJN A;  3M02 A;  4OJZ A;  1UMP A;  3M01 A;  1H3A A;  2D5J A;  3RX7 A;  2JG0 A;  1H12 A;  3WKI A;  1D8D B;  3M7E A;  2V8K A;  3SQC A;  4LNB B;  3RX8 A;  4Q88 A;  4TXT A;  1FT2 B;  1V5D A;  1GLM A;  5JPM B;  3DSW B;  2B4F A;  2RI8 A;  3SFY B;  2WII B;  2D8L A;  5FO8 B;  3EZ8 A;  4Z4J A;  3Q78 B;  3DSX B;  2V8J A;  2ONG A;  1JCR B;  4AYO A;  3E7J A;  2EAD A;  1LOH A;  4LIX A;  3GLY A;  4LNV A;  4D4C A;  3D5R A;  4GTO B;  3RSY A;  1NL4 B;  1QQF A;  4OZV A;  3ANI A;  3DSV B;  5DGR A;  4EHM B;  1F9O A;  1V7X A;  1TN6 B;  2DRO A;  2H6G B;  1TNU B;  3AFL A;  3NNB A;  1HV6 A;  1MZC B;  1SA5 B;  4M76 A;  5ILD A;  1F9G A;  4NEI A;  3DPY B;  2H6H B;  1H3C A;  1CLC A;  5ILH A;  4L0G A;  3WKF A;  2WIN B;  3A3V A;  5IK6 A;  1N7O A;  3S4C A;  3N0G A;  4AYQ A;  2FV0 A;  1EGU A;  1HXG A;  2BRV X;  2FUT A;  4J5T A;  2AHF A;  3M76 A;  1N4P B;  1FT1 B;  1C82 A;  1O1T B;  3OED A;  1XWQ A;  3WIQ A;  4ZG8 A;  1SQC A;  1GSZ A;  3QFZ A;  3S4A A;  1XW2 A;  2G02 A;  3EU8 A;  2EAE A;  5JMD A;  3W5M A;  2H6I B;  4CE7 A;  1G6I A;  5IK0 A;  1O6Q A;  3KSQ B;  3SDQ A;  5C05 A;  3S9V A;  2XWJ B;  3E32 B;  3N0F A;  1L2A A;  4AYR A;  2BED B;  3H3K A;  2NOJ A;  4CJ1 A;  1JCQ B;  1WU6 A;  2G0D A;  2JF4 A;  4L9P B;  1FP3 A;  3M7B A;  3QWT A;  1HM3 A;  4DOE A;  4BOK A;  3W7U A;  5E2J A;  4OK2 A;  1GHQ A;  1S63 B;  2PMV A;  4KKJ A;  2J5C A;  3GZK A;  3QXF A;  2BB5 A;  3LZ9 A;  1KSD A;  3SDT A;  1D8E B;  5KKB A;  1F1S A;  3K11 A;  4FNV A;  1O1S B;  4WU0 A;  2CQT A;  2H6F B;  2GZ6 A;  1KZO B;  1GAI A;  3HXF B;  1N7N A;  1KSC A;  1N24 A;  1N7P A;  1TNB B; 
#chains in the Genus database with same CATH homology
 3P5R A;  1HZF A;  1NXC A;  1R76 A;  1GXN A;  2EAB A;  3Q79 B;  1G87 A;  2XFG A;  3WC3 A;  4L6X A;  2AFA A;  2DRR A;  2OKX A;  3QG0 A;  1FBO A;  1SA4 B;  2P0V A;  4ZH5 A;  2VN7 A;  4AYP A;  3E33 B;  4D4B A;  3REN A;  3M71 A;  2ZIR B;  3WIR A;  1FBW A;  3OXU A;  4GTS B;  3PYB A;  2GH4 A;  3W7T A;  3VXD A;  4EL8 A;  3ANK A;  3WUX A;  3QPF A;  2XQW A;  3EUV B;  3PZ1 B;  2Z07 A;  5FOB B;  1KRE A;  3DSS B;  1KKT A;  2A8Z A;  4KKI A;  4GTQ B;  4MBG B;  1GXM A;  3SFX B;  2FBA A;  2RGK A;  4CJ0 A;  4V1S A;  2EAC A;  5AGD A;  3AFJ A;  3TF4 A;  2FV1 A;  3E37 B;  1O6H A;  3H2W A;  3PYA A;  3PZ4 B;  1V7W A;  1O6R A;  4FXG B;  3DST B;  1KFG A;  1LF6 A;  3KSL B;  3P2C A;  3KLS A;  3ACS A;  5GW7 A;  1KS8 A;  4FUS A;  5GY3 A;  4TF4 A;  3WKG A;  5MEH A;  1KZP B;  5GZK A;  3RJ3 A;  4D4D A;  2SQC A;  1L1Y A;  2XWB B;  1TNZ B;  4GTV B;  1DL2 A;  3M72 A;  1QBQ B;  3EU5 B;  3PMM A;  1N95 B;  2WY7 A;  4WVC A;  3G6J B;  3VW5 A;  5CA3 A;  1VD5 A;  4WVB A;  3QT9 A;  1CEM A;  2FUZ A;  3KQ4 A;  1G9G A;  1DCE B;  4GTT B;  3Q75 B;  4KTR A;  3W7W A;  1GAH A;  5CD2 A;  1IS9 A;  1X81 B;  2A73 B;  1N4R B;  3E6U A;  1V5C A;  4JJJ A;  1H54 A;  1WZZ A;  2RI9 A;  1C3D A;  1H39 A;  4QT9 A;  1X9D A;  2JJB A;  3H7L A;  1H14 A;  1H36 A;  1TNY B;  1WU5 A;  3E30 B;  4ZRP A;  1W6J A;  2F6D A;  2CQS A;  2ZBL A;  4GTP B;  3T33 A;  3E73 A;  5M7Y A;  1V7V A;  4GTR B;  1ULV A;  1N94 B;  4C1S A;  4D94 A;  1JS4 A;  1TN7 B;  3HXE B;  1N4S B;  3QXQ A;  1H35 A;  1H3B A;  2F0Y B;  1LD8 B;  3ON6 A;  2V8I A;  1AYX A;  3E34 B;  2V3N A;  1HCU A;  3M7C A;  2V3P A;  3K7X A;  1O5M B;  1FAE A;  2ZIS B;  2PN5 A;  2VN4 A;  3D3I A;  4GL3 A;  4BOJ A;  2YIK A;  2WYN A;  1FO3 A;  5M7I A;  3ANJ A;  1JCS B;  1UG9 A;  1N4Q B;  3M73 A;  1DOG A;  2BBC A;  1LF9 A;  3QDE A;  3M77 A;  1O79 A;  4YCR A;  2IEJ B;  4KTP A;  5FO9 B;  3SAE A;  1NC5 A;  5JPN B;  3M7L A;  1IA6 A;  2QNO A;  3SDV A;  1IA7 A;  1FPP B;  3QSP A;  3X17 A;  1O1R B;  1N9A B;  4ZH1 A;  1W6K A;  1S64 B;  3RX5 A;  5CZL A;  3S4B A;  2B39 A;  3DSU B;  1LTX B;  2GOX A;  1RQ5 A;  3Q7A B;  3QFY A;  3PZ2 B;  3D5S A;  3S4D A;  1FO2 A;  5DGQ A;  1AGM A;  4YDE B;  1FMI A;  3HXD B;  2DRQ A;  4ZRQ A;  1QSJ A;  3EQA A;  1LD7 B;  4FXK B;  3M78 A;  4Q2B A;  3C72 B;  1UT9 A;  1H13 A;  1XWT A;  3GT5 A;  2BB6 A;  1TN8 B;  3W7S A;  4D4A A;  1G9J A;  3W5N A;  1TF4 A;  3P5P A;  2R2L B;  3M75 A;  4Z4L A;  3HXC B;  3Q73 B;  2WY8 A;  2I07 B;  3RRS A;  3W7X A;  3WIW A;  1KWF A;  3CU7 A;  3PZ3 B;  1KRF A;  1NI1 B;  3HXB B;  4ONT A;  3QRY A;  1WU4 A;  1F9D A;  1FCE A;  4DOD A;  3SDU A;  4LNG B;  2NVP A;  2ZZR A;  4GTM B;  1GA2 A;  4MU9 A;  1K72 A;  3SDR A;  3M74 A;  3ACT A;  3CIH A;  3QT3 A;  2AHG A;  4V1R A;  1H37 A;  4YDO B;  4WVA A;  1GXO A;  3Q7F B;  3DRA B;  2DRS A;  3WKH A;  5FO7 B;  1TNO B;  4XUV A;  1UMP A;  1H3A A;  2D5J A;  3RX7 A;  2JG0 A;  1H12 A;  3WKI A;  1D8D B;  3M7E A;  2V8K A;  3SQC A;  4LNB B;  3RX8 A;  4Q88 A;  4TXT A;  1FT2 B;  1V5D A;  1GLM A;  5JPM B;  3DSW B;  2B4F A;  2RI8 A;  3SFY B;  2WII B;  2D8L A;  5FO8 B;  3EZ8 A;  4Z4J A;  3Q78 B;  3DSX B;  2V8J A;  1JCR B;  4AYO A;  2EAD A;  4LIX A;  3GLY A;  4LNV A;  4D4C A;  3D5R A;  4GTO B;  3RSY A;  1NL4 B;  1QQF A;  3ANI A;  3DSV B;  5DGR A;  4EHM B;  1F9O A;  1V7X A;  1TN6 B;  2DRO A;  2H6G B;  1TNU B;  1MZC B;  1SA5 B;  4M76 A;  3DPY B;  2H6H B;  1H3C A;  1CLC A;  4L0G A;  3WKF A;  2WIN B;  3A3V A;  3S4C A;  4AYQ A;  2FV0 A;  4J5T A;  2AHF A;  3M76 A;  1N4P B;  1FT1 B;  1O1T B;  3OED A;  1XWQ A;  3WIQ A;  4ZG8 A;  1SQC A;  1GSZ A;  3QFZ A;  3S4A A;  1XW2 A;  2G02 A;  3EU8 A;  2EAE A;  3W5M A;  2H6I B;  4CE7 A;  1G6I A;  1O6Q A;  3KSQ B;  3SDQ A;  3S9V A;  2XWJ B;  3E32 B;  1L2A A;  4AYR A;  2BED B;  3H3K A;  2NOJ A;  4CJ1 A;  1JCQ B;  1WU6 A;  2G0D A;  2JF4 A;  4L9P B;  1FP3 A;  3M7B A;  3QWT A;  4DOE A;  4BOK A;  3W7U A;  5E2J A;  1GHQ A;  1S63 B;  2PMV A;  4KKJ A;  3GZK A;  3QXF A;  2BB5 A;  1KSD A;  3SDT A;  1D8E B;  5KKB A;  3K11 A;  1O1S B;  4WU0 A;  2CQT A;  2H6F B;  2GZ6 A;  1KZO B;  1GAI A;  3HXF B;  1KSC A;  1TNB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...