3T33A

Crystal structure of arabidopsis gcr2
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
407
structure length
407
Chain Sequence
RFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein receptor
molecule keywords G protein coupled receptor
publication title Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
rcsb
source organism Arabidopsis thaliana
total genus 154
structure length 407
sequence length 407
ec nomenclature
pdb deposition date 2011-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3t33A00
3H3KA 2ZBLA 1AYXA 3RENA 4CJ1A 3A3VA 3W5NA 1FAEA 1VD5A 1WZZA 1H54A 2OKXA 4WVBA 2FBAA 1H13A 2A8ZA 3VXDA 4AYQA 1IA7A 3RX7A 5GW7A 1F9DA 3QPFA 1FBOA 1G6IA 1DOGA 4DODA 3AFJA 2DRRA 4JJJA 3EQAA 2Z07A 3QRYA 5DGQA 2WYNA 3ANIA 2EAEA 1KKTA 1GAIA 2QNOA 5M7IA 5CA3A 3RX5A 2AFAA 3X17A 2P0VA 2JG0A 2EABA 1FP3A 5DGRA 3RX8A 2D5JA 3S4AA 3WUXA 1TF4A 3QWTA 3QSPA 4L6XA 1KSDA 5KKBA 2FV0A 3WKGA 3W7UA 3ANKA 4KTPA 1L1YA 1GA2A 2RI9A 4EL8A 3ACSA 4AYRA 3D3IA 1RQ5A 1G87A 1V7XA 2D8LA 2VN4A 3VW5A 1V7WA 1XW2A 1H12A 4AYOA 1IS9A 3QFZA 3ON6A 1HCUA 3WKIA 1G9JA 1KSCA 2B4FA 4WVAA 1WU5A 2RGKA 3W7SA 3P2CA 1L2AA 4Q88A 1H14A 3S4DA 5GY3A 4TF4A 3EZ8A 5M7YA 3W7XA 3QFYA 2EADA 2CQSA 4J5TA 1KREA 1KS8A 4WU0A 5CZLA 3W5MA 3QXQA 1FCEA 1NC5A 3GLYA 2F6DA 1LF9A 4DOEA 4ZG8A 4Q2BA 4CJ0A 5MEHA 1FO3A 1JS4A 2JF4A 4AYPA 4KTRA 3K11A 2FV1A 3ANJA 2NVPA 3S4CA 4ZH5A 3QT3A 1KFGA 3PMMA 1FMIA 1FO2A 2DROA 1DL2A 1V5CA 1UG9A 4Z4JA 3WKFA 3S4BA 3GT5A 2AHGA 3WIRA 3WC3A 2FUZA 2VN7A 3QXFA 2DRQA 1XWTA 1K72A 3ACTA 3QG0A 1AGMA 3QT9A 2GZ6A 4Z4LA 1V5DA 3E6UA 2JJBA 1KWFA 1V7VA 2EACA 3H2WA 1LF6A 1FBWA 3H7LA 1CLCA 1GAHA 4FUSA 3WKHA 1G9GA 1XWQA 3CIHA 3W7WA 3TF4A 1CEMA 2ZZRA 3RRSA 1WU4A 3E73A 3WIQA 1UT9A 4XUVA 1KRFA 5E2JA 2CQTA 2XFGA 2YIKA 4L0GA 1WU6A 1GLMA 1IA6A 1ULVA 2GH4A 2RI8A 3W7TA 1X9DA 2AHFA 1NXCA 4WVCA 3RSYA 3T33A 3WIWA 3GZKA 3QDEA 5CD2A 4CE7A 1F9OA 4TXTA 2DRSA
chains in the Genus database with same CATH superfamily
1KZPB 1AYXA 2H6FB 3RJ3A 1H39A 3AFLA 4LNGB 3VSNA 3N0GA 3CU7A 1H54A 2OKXA 3P5PA 3KLSA 4YDEB 1IA7A 4LNBB 3RX7A 4GTRB 1F9DA 1N7NA 5IKHA 1G6IA 1DOGA 3AFJA 2WYNA 3DPYB 5ILDA 1HMWA 1GAIA 2QNOA 3G6JB 5CA3A 3EU8A 2AFAA 2JG0A 4DI5A 1N7QA 1N7PA 3WUXA 2ZISB 5ILJA 5KKBA 3ANKA 5DHIA 1G87A 1V7XA 2A73B 3ON6A 1W6KA 2XWBB 1KSCA 3P2CA 1L2AA 1HXAA 3E80A 1TN6B 3DSSB 1H3CA 1KS8A 1GHQA 3P5RA 3QXQA 4OK2A 4BOKA 3SAEA 1LF9A 1O6QA 4D94A 1UMPA 2FV1A 1CB8A 4EHMB 3M73A 1FO2A 2DROA 1HN0A 1V5CA 1UG9A 4Z4JA 3GT5A 2AHGA 1F1SA 2VN7A 3ACTA 1R76A 1XWTA 4ZRPA 1AGMA 1QSJA 1RWCA 2JJBA 2V8JA 3M71A 1V7VA 4D4DA 1DCEB 1FBWA 3H7LA 1CLCA 1GAHA 5JMFA 2WIIB 2PMVA 5EATA 3TF4A 2NOJA 1LXKA 3M02A 3RRSA 1N24A 2Q1FA 1WU4A 3DSWB 3E73A 3WIQA 1UT9A 3DRAB 1O6RA 4FJQA 4F13A 1HM3A 2FUTA 2YIKA 3SDQA 1WU6A 2RI8A 3W7TA 3SQCA 5FO7B 3RSYA 3T33A 1RWGA 1HV6A 3GZKA 3QDEA 3E37B 2WINB 1F9OA 3SFXB 1X81B 1N9AB 3Q73B 4ONTA 4CJ1A 3PZ2B 3W5NA 1TNBB 1W3YA 4BOJA 1WZZA 4M76A 5FO8B 5C05A 4D4AA 1JCQB 1RWHA 2H6IB 3SDTA 4WVBA 1H13A 3VXDA 3EUVB 3QPFA 3HXFB 2Z07A 4YCRA 5IL3A 1N23A 1RWAA 2EAEA 1KKTA 4OZWA 4KKIA 2XQWA 3NNBA 4GTMB 2BRWA 3X17A 2EABA 1FP3A 4LIXA 1C82A 3DSUB 5DGRA 5DHKA 1X1IA 5ILKA 2J5CA 1TF4A 3M01A 2IEJB 3W7UA 1N7RA 4KTPA 1GA2A 4EL8A 4AYRA 1EGUA 1RQ5A 2BBCA 2E24A 5JPMB 1O1SB 1GSZA 1HCUA 2V3PA 2WDAA 3WKIA 1G9JA 1H35A 2B4FA 3PZ1B 4GTQB 3W7SA 1O6HA 3VSMA 1LD8B 4TF4A 3EZ8A 5GY3A 3W7XA 2EADA 5GZKA 4J5TA 1KREA 5CZLA 4GTVB 1HMUA 4CJ0A 1SA4B 1SA5B 4KTRA 2NVPA 5ILZA 1RWFA 1O1TB 3PMMA 1DL2A 2ONGA 2ONHA 3WKFA 3S4BA 1J0NA 3EU5B 1X1JA 3QXFA 3OXUA 2GZ6A 1N22A 3M75A 1N21A 3E6UA 1SQCA 4MU9A 1NI1B 4FXKB 4FUSA 1G9GA 1XWQA 2ZZRA 1X1HA 4L9PB 5IL8A 1KRFA 3Q75B 1OJOA 2CQTA 1HXGA 4L0GA 3E7JA 1O79A 4WVCA 2GOXA 5CD2A 1TNZB 1N1ZA 4L6XA 3H3KA 2ZBLA 2X03A 1GXMA 3RENA 3A3VA 1HZFA 1FAEA 1TNUB 3M00A 4LNVA 1N4RB 4RNQA 4D4BA 4AYQA 2A8ZA 4C1SA 3M7LA 3SDVA 4DODA 4JJJA 2XWJB 3QRYA 5DGQA 2BRPA 4ZRQA 3Q78B 3Q79B 3HXEB 1N20A 1N95B 2BRVX 3RX5A 2SQCA 1MZCB 3SDUA 2B39A 2D5JA 3S4AA 2R2LB 3E34B 1H3AA 3Q7AB 1N4SB 1LOHA 2RI9A 3ACSA 3D5RA 1LXMA 3M74A 4AYOA 3VW5A 1V7WA 1IS9A 1TN8B 3M78A 3QFZA 2I07B 2H6HB 3N0FA 3NFVA 4QT9A 4Q88A 1H14A 3D5SA 3S4DA 5M7YA 4OZVA 3QFYA 2CQSA 3E33B 1OJPA 4WU0A 2V8KA 1FCEA 1F9GA 2F6DA 3G4DA 1LTXB 1HXCA 4DOEA 4ZG8A 3KQ4A 4Q2BA 4ZH1A 4V1SA 1J0MA 2JF4A 3SDRA 4AYPA 2WCOA 1FT2B 4ZH5A 1LD7B 3QT3A 1FMIA 1I8QA 1TN7B 5IKAA 3E32B 3M7CA 3WIRA 1H36A 2FUZA 4Z4LA 3QG0A 1RW9A 1V5DA 2FUQA 1O5MB 1KWFA 2EACA 1JCSB 1HX9A 1H37A 1S64B 2E22A 4D4CA 1OJNA 3G4FA 3M76A 4XUVA 1TNYB 5E2JA 3KSLB 1IA6A 3K7XA 3S9VA 5ILHA 2AHFA 1NXCA 1O1RB 3PYAA 2WY7A 4TXTA 3OEDA 1N7OA 4GAXA 4YDOB 2WY8A 2BB5A 1VD5A 1N1BA 5JMDA 2BB6A 1C3DA 1D8DB 3HXBB 2PN5A 4FNVA 4FXGB 2FBAA 5GW7A 5IK0A 1FBOA 2DRRA 3EQAA 5JPNB 3ANIA 5M7IA 1H3BA 1FPPB 1W6JA 5EASA 2P0VA 4KKJA 5FO9B 1KZOB 3PYBA 3E30B 3RX8A 3QWTA 1N94B 3QSPA 1KSDA 2FV0A 3SFYB 3WKGA 1L1YA 5ILIA 4MMIA 3D3IA 2D8LA 1FT1B 2VN4A 1XW2A 4MBGB 1H12A 5IK9A 3PZ3B 4OJZA 1GXNA 1D8EB 1OJMA 5ILYA 2F0YB 2G0DA 3HXCB 4WVAA 5IM1A 1WU5A 3Q7FB 2RGKA 3M72A 1N4PB 4V1RA 3W5MA 2ZIRB 2V8IA 1NC5A 3GLYA 4NEIA 4MMHA 5MEHA 1FO3A 1GXOA 4GTTB 1JS4A 3K11A 4GL3A 1JCRB 3ANJA 3S4CA 5IK6A 4GTOB 1QBQB 4E1YA 1QAZA 1KFGA 4GTSB 3M7BA 5FOBB 3WC3A 5AGDA 4OK4A 2DRQA 1K72A 3QT9A 3DSXB 5EAUA 1HM2A 3C72B 2G02A 3H2WA 1LF6A 3M77A 1NL4B 4F10A 3WKHA 1S63B 1N4QB 2H6GB 3HXDB 3CIHA 3LZ9A 3W7WA 1CEMA 3M7EA 4GTPB 3DSVB 3PZ4B 2V3NA 1QQFA 2BEDB 2XFGA 1GLMA 1ULVA 2GH4A 3DSTB 3A0OA 1X9DA 3KSQB 3WIWA 4CE7A 1TNOB 2DRSA
chains in the Genus database with same CATH topology
1KZPB 1AYXA 2H6FB 3RJ3A 1H39A 4LNGB 3CU7A 1H54A 2OKXA 3P5PA 3KLSA 4YDEB 1IA7A 4LNBB 3RX7A 4GTRB 1F9DA 1G6IA 1DOGA 3AFJA 2WYNA 3DPYB 1GAIA 2QNOA 3G6JB 5CA3A 3EU8A 2AFAA 2JG0A 3WUXA 2ZISB 5KKBA 3ANKA 1G87A 1V7XA 2A73B 3ON6A 1W6KA 2XWBB 1KSCA 3P2CA 1L2AA 1TN6B 3DSSB 1H3CA 1KS8A 1GHQA 3P5RA 3QXQA 3SAEA 4BOKA 1LF9A 1O6QA 4D94A 1UMPA 2FV1A 4EHMB 3M73A 1FO2A 2DROA 1V5CA 1UG9A 4Z4JA 3GT5A 2AHGA 2VN7A 3ACTA 1R76A 1XWTA 4ZRPA 1AGMA 1QSJA 2JJBA 2V8JA 3M71A 1V7VA 4D4DA 1DCEB 1FBWA 3H7LA 1CLCA 1GAHA 2WIIB 2PMVA 3TF4A 2NOJA 3RRSA 1WU4A 3DSWB 3E73A 3WIQA 1UT9A 3DRAB 1O6RA 2YIKA 3SDQA 1WU6A 2RI8A 3W7TA 3SQCA 5FO7B 3RSYA 3T33A 3GZKA 3QDEA 3E37B 2WINB 1F9OA 3SFXB 1X81B 1N9AB 3Q73B 4ONTA 4CJ1A 3PZ2B 3W5NA 1TNBB 4BOJA 1WZZA 4M76A 5FO8B 4D4AA 1JCQB 2H6IB 3SDTA 4WVBA 1H13A 3VXDA 3EUVB 3QPFA 3HXFB 2Z07A 4YCRA 2EAEA 1KKTA 4KKIA 2XQWA 4GTMB 3X17A 2EABA 1FP3A 4LIXA 3DSUB 5DGRA 1TF4A 2IEJB 3W7UA 4KTPA 1GA2A 4EL8A 4AYRA 1RQ5A 2BBCA 5JPMB 1O1SB 1GSZA 1HCUA 2V3PA 3WKIA 1G9JA 1H35A 2B4FA 3PZ1B 4GTQB 3W7SA 1O6HA 1LD8B 4TF4A 3EZ8A 5GY3A 3W7XA 2EADA 5GZKA 4J5TA 1KREA 5CZLA 4GTVB 4CJ0A 1SA4B 1SA5B 4KTRA 2NVPA 1O1TB 3PMMA 1DL2A 3WKFA 3S4BA 3EU5B 3QXFA 3OXUA 2GZ6A 3M75A 1SQCA 3E6UA 4MU9A 1NI1B 4FXKB 4FUSA 1G9GA 1XWQA 2ZZRA 4L9PB 1KRFA 3Q75B 2CQTA 4L0GA 1O79A 4WVCA 2GOXA 5CD2A 1TNZB 4L6XA 3H3KA 2ZBLA 1GXMA 3RENA 3A3VA 1HZFA 1FAEA 1TNUB 4LNVA 1N4RB 4D4BA 4AYQA 2A8ZA 4C1SA 3M7LA 3SDVA 4DODA 4JJJA 2XWJB 3QRYA 5DGQA 4ZRQA 3Q78B 3Q79B 3HXEB 1N95B 3RX5A 2SQCA 1MZCB 3SDUA 2B39A 2D5JA 3S4AA 2R2LB 3E34B 1H3AA 3Q7AB 1N4SB 2RI9A 3ACSA 3D5RA 3M74A 4AYOA 3VW5A 1V7WA 3QFZA 1IS9A 1TN8B 3M78A 2I07B 2H6HB 4QT9A 4Q88A 1H14A 3D5SA 3S4DA 5M7YA 3QFYA 2CQSA 3E33B 4WU0A 2V8KA 1FCEA 2F6DA 1LTXB 4DOEA 4ZG8A 3KQ4A 4Q2BA 4ZH1A 4V1SA 2JF4A 3SDRA 4AYPA 1FT2B 4ZH5A 1LD7B 3QT3A 1FMIA 1TN7B 3E32B 3M7CA 3WIRA 1H36A 2FUZA 4Z4LA 3QG0A 1V5DA 1O5MB 1KWFA 2EACA 1JCSB 1H37A 1S64B 4D4CA 3M76A 4XUVA 1TNYB 5E2JA 3KSLB 1IA6A 3K7XA 3S9VA 2AHFA 1NXCA 1O1RB 3PYAA 2WY7A 4TXTA 3OEDA 4YDOB 2WY8A 2BB5A 1VD5A 2BB6A 1C3DA 1D8DB 3HXBB 2PN5A 4FXGB 2FBAA 5GW7A 1FBOA 2DRRA 3EQAA 5JPNB 3ANIA 5M7IA 1H3BA 1FPPB 1W6JA 2P0VA 4KKJA 5FO9B 1KZOB 3PYBA 3E30B 3RX8A 3QWTA 1N94B 3QSPA 1KSDA 2FV0A 3SFYB 3WKGA 1L1YA 3D3IA 2D8LA 1FT1B 2VN4A 1XW2A 4MBGB 1H12A 3PZ3B 1GXNA 1D8EB 2F0YB 2G0DA 3HXCB 4WVAA 1WU5A 3Q7FB 2RGKA 3M72A 1N4PB 4V1RA 3W5MA 2ZIRB 2V8IA 1NC5A 3GLYA 5MEHA 1FO3A 1GXOA 4GTTB 1JS4A 3K11A 4GL3A 1JCRB 3ANJA 3S4CA 4GTOB 1QBQB 1KFGA 4GTSB 3M7BA 5FOBB 3WC3A 5AGDA 2DRQA 1K72A 3QT9A 3DSXB 3C72B 2G02A 3H2WA 1LF6A 3M77A 1NL4B 3WKHA 1S63B 1N4QB 2H6GB 3HXDB 3CIHA 3W7WA 1CEMA 3M7EA 4GTPB 3DSVB 3PZ4B 2V3NA 1QQFA 2BEDB 2XFGA 1GLMA 1ULVA 2GH4A 3DSTB 1X9DA 3KSQB 3WIWA 4CE7A 1TNOB 2DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3K A;  2ZBL A;  1AYX A;  3REN A;  4CJ1 A;  3A3V A;  3W5N A;  1FAE A;  1VD5 A;  1WZZ A;  1H54 A;  2OKX A;  4WVB A;  2FBA A;  1H13 A;  2A8Z A;  3VXD A;  4AYQ A;  1IA7 A;  3RX7 A;  5GW7 A;  1F9D A;  3QPF A;  1FBO A;  1G6I A;  1DOG A;  4DOD A;  3AFJ A;  2DRR A;  4JJJ A;  3EQA A;  2Z07 A;  3QRY A;  5DGQ A;  2WYN A;  3ANI A;  2EAE A;  1KKT A;  1GAI A;  2QNO A;  5M7I A;  5CA3 A;  3RX5 A;  2AFA A;  3X17 A;  2P0V A;  2JG0 A;  2EAB A;  1FP3 A;  5DGR A;  3RX8 A;  2D5J A;  3S4A A;  3WUX A;  1TF4 A;  3QWT A;  3QSP A;  4L6X A;  1KSD A;  5KKB A;  2FV0 A;  3WKG A;  3W7U A;  3ANK A;  4KTP A;  1L1Y A;  1GA2 A;  2RI9 A;  4EL8 A;  3ACS A;  4AYR A;  3D3I A;  1RQ5 A;  1G87 A;  1V7X A;  2D8L A;  2VN4 A;  3VW5 A;  1V7W A;  1XW2 A;  1H12 A;  4AYO A;  1IS9 A;  3QFZ A;  3ON6 A;  1HCU A;  3WKI A;  1G9J A;  1KSC A;  2B4F A;  4WVA A;  1WU5 A;  2RGK A;  3W7S A;  3P2C A;  1L2A A;  4Q88 A;  1H14 A;  3S4D A;  5GY3 A;  4TF4 A;  3EZ8 A;  5M7Y A;  3W7X A;  3QFY A;  2EAD A;  2CQS A;  4J5T A;  1KRE A;  1KS8 A;  4WU0 A;  5CZL A;  3W5M A;  3QXQ A;  1FCE A;  1NC5 A;  3GLY A;  2F6D A;  1LF9 A;  4DOE A;  4ZG8 A;  4Q2B A;  4CJ0 A;  5MEH A;  1FO3 A;  1JS4 A;  2JF4 A;  4AYP A;  4KTR A;  3K11 A;  2FV1 A;  3ANJ A;  2NVP A;  3S4C A;  4ZH5 A;  3QT3 A;  1KFG A;  3PMM A;  1FMI A;  1FO2 A;  2DRO A;  1DL2 A;  1V5C A;  1UG9 A;  4Z4J A;  3WKF A;  3S4B A;  3GT5 A;  2AHG A;  3WIR A;  3WC3 A;  2FUZ A;  2VN7 A;  3QXF A;  2DRQ A;  1XWT A;  1K72 A;  3ACT A;  3QG0 A;  1AGM A;  3QT9 A;  2GZ6 A;  4Z4L A;  1V5D A;  3E6U A;  2JJB A;  1KWF A;  1V7V A;  2EAC A;  3H2W A;  1LF6 A;  1FBW A;  3H7L A;  1CLC A;  1GAH A;  4FUS A;  3WKH A;  1G9G A;  1XWQ A;  3CIH A;  3W7W A;  3TF4 A;  1CEM A;  2ZZR A;  3RRS A;  1WU4 A;  3E73 A;  3WIQ A;  1UT9 A;  4XUV A;  1KRF A;  5E2J A;  2CQT A;  2XFG A;  2YIK A;  4L0G A;  1WU6 A;  1GLM A;  1IA6 A;  1ULV A;  2GH4 A;  2RI8 A;  3W7T A;  1X9D A;  2AHF A;  1NXC A;  4WVC A;  3RSY A;  3T33 A;  3WIW A;  3GZK A;  3QDE A;  5CD2 A;  4CE7 A;  1F9O A;  4TXT A;  2DRS A; 
#chains in the Genus database with same CATH topology
 1KZP B;  1AYX A;  2H6F B;  3RJ3 A;  1H39 A;  3AFL A;  4LNG B;  3VSN A;  3N0G A;  3CU7 A;  1H54 A;  2OKX A;  3P5P A;  3KLS A;  4YDE B;  1IA7 A;  4LNB B;  3RX7 A;  4GTR B;  1F9D A;  1N7N A;  5IKH A;  1G6I A;  1DOG A;  3AFJ A;  2WYN A;  3DPY B;  5ILD A;  1HMW A;  1GAI A;  2QNO A;  3G6J B;  5CA3 A;  3EU8 A;  2AFA A;  2JG0 A;  4DI5 A;  1N7Q A;  1N7P A;  3WUX A;  2ZIS B;  5ILJ A;  5KKB A;  3ANK A;  5DHI A;  1G87 A;  1V7X A;  2A73 B;  3ON6 A;  1W6K A;  2XWB B;  1KSC A;  3P2C A;  1L2A A;  1HXA A;  3E80 A;  1TN6 B;  3DSS B;  1H3C A;  1KS8 A;  1GHQ A;  3P5R A;  3QXQ A;  4OK2 A;  4BOK A;  3SAE A;  1LF9 A;  1O6Q A;  4D94 A;  1UMP A;  2FV1 A;  1CB8 A;  4EHM B;  3M73 A;  1FO2 A;  2DRO A;  1HN0 A;  1V5C A;  1UG9 A;  4Z4J A;  3GT5 A;  2AHG A;  1F1S A;  2VN7 A;  3ACT A;  1R76 A;  1XWT A;  4ZRP A;  1AGM A;  1QSJ A;  1RWC A;  2JJB A;  2V8J A;  3M71 A;  1V7V A;  4D4D A;  1DCE B;  1FBW A;  3H7L A;  1CLC A;  1GAH A;  5JMF A;  2WII B;  2PMV A;  5EAT A;  3TF4 A;  2NOJ A;  1LXK A;  3M02 A;  3RRS A;  1N24 A;  2Q1F A;  1WU4 A;  3DSW B;  3E73 A;  3WIQ A;  1UT9 A;  3DRA B;  1O6R A;  4FJQ A;  4F13 A;  1HM3 A;  2FUT A;  2YIK A;  3SDQ A;  1WU6 A;  2RI8 A;  3W7T A;  3SQC A;  5FO7 B;  3RSY A;  3T33 A;  1RWG A;  1HV6 A;  3GZK A;  3QDE A;  3E37 B;  2WIN B;  1F9O A;  3SFX B;  1X81 B;  1N9A B;  3Q73 B;  4ONT A;  4CJ1 A;  3PZ2 B;  3W5N A;  1TNB B;  1W3Y A;  4BOJ A;  1WZZ A;  4M76 A;  5FO8 B;  5C05 A;  4D4A A;  1JCQ B;  1RWH A;  2H6I B;  3SDT A;  4WVB A;  1H13 A;  3VXD A;  3EUV B;  3QPF A;  3HXF B;  2Z07 A;  4YCR A;  5IL3 A;  1N23 A;  1RWA A;  2EAE A;  1KKT A;  4OZW A;  4KKI A;  2XQW A;  3NNB A;  4GTM B;  2BRW A;  3X17 A;  2EAB A;  1FP3 A;  4LIX A;  1C82 A;  3DSU B;  5DGR A;  5DHK A;  1X1I A;  5ILK A;  2J5C A;  1TF4 A;  3M01 A;  2IEJ B;  3W7U A;  1N7R A;  4KTP A;  1GA2 A;  4EL8 A;  4AYR A;  1EGU A;  1RQ5 A;  2BBC A;  2E24 A;  5JPM B;  1O1S B;  1GSZ A;  1HCU A;  2V3P A;  2WDA A;  3WKI A;  1G9J A;  1H35 A;  2B4F A;  3PZ1 B;  4GTQ B;  3W7S A;  1O6H A;  3VSM A;  1LD8 B;  4TF4 A;  3EZ8 A;  5GY3 A;  3W7X A;  2EAD A;  5GZK A;  4J5T A;  1KRE A;  5CZL A;  4GTV B;  1HMU A;  4CJ0 A;  1SA4 B;  1SA5 B;  4KTR A;  2NVP A;  5ILZ A;  1RWF A;  1O1T B;  3PMM A;  1DL2 A;  2ONG A;  2ONH A;  3WKF A;  3S4B A;  1J0N A;  3EU5 B;  1X1J A;  3QXF A;  3OXU A;  2GZ6 A;  1N22 A;  3M75 A;  1N21 A;  3E6U A;  1SQC A;  4MU9 A;  1NI1 B;  4FXK B;  4FUS A;  1G9G A;  1XWQ A;  2ZZR A;  1X1H A;  4L9P B;  5IL8 A;  1KRF A;  3Q75 B;  1OJO A;  2CQT A;  1HXG A;  4L0G A;  3E7J A;  1O79 A;  4WVC A;  2GOX A;  5CD2 A;  1TNZ B;  1N1Z A;  4L6X A;  3H3K A;  2ZBL A;  2X03 A;  1GXM A;  3REN A;  3A3V A;  1HZF A;  1FAE A;  1TNU B;  3M00 A;  4LNV A;  1N4R B;  4RNQ A;  4D4B A;  4AYQ A;  2A8Z A;  4C1S A;  3M7L A;  3SDV A;  4DOD A;  4JJJ A;  2XWJ B;  3QRY A;  5DGQ A;  2BRP A;  4ZRQ A;  3Q78 B;  3Q79 B;  3HXE B;  1N20 A;  1N95 B;  2BRV X;  3RX5 A;  2SQC A;  1MZC B;  3SDU A;  2B39 A;  2D5J A;  3S4A A;  2R2L B;  3E34 B;  1H3A A;  3Q7A B;  1N4S B;  1LOH A;  2RI9 A;  3ACS A;  3D5R A;  1LXM A;  3M74 A;  4AYO A;  3VW5 A;  1V7W A;  1IS9 A;  1TN8 B;  3M78 A;  3QFZ A;  2I07 B;  2H6H B;  3N0F A;  3NFV A;  4QT9 A;  4Q88 A;  1H14 A;  3D5S A;  3S4D A;  5M7Y A;  4OZV A;  3QFY A;  2CQS A;  3E33 B;  1OJP A;  4WU0 A;  2V8K A;  1FCE A;  1F9G A;  2F6D A;  3G4D A;  1LTX B;  1HXC A;  4DOE A;  4ZG8 A;  3KQ4 A;  4Q2B A;  4ZH1 A;  4V1S A;  1J0M A;  2JF4 A;  3SDR A;  4AYP A;  2WCO A;  1FT2 B;  4ZH5 A;  1LD7 B;  3QT3 A;  1FMI A;  1I8Q A;  1TN7 B;  5IKA A;  3E32 B;  3M7C A;  3WIR A;  1H36 A;  2FUZ A;  4Z4L A;  3QG0 A;  1RW9 A;  1V5D A;  2FUQ A;  1O5M B;  1KWF A;  2EAC A;  1JCS B;  1HX9 A;  1H37 A;  1S64 B;  2E22 A;  4D4C A;  1OJN A;  3G4F A;  3M76 A;  4XUV A;  1TNY B;  5E2J A;  3KSL B;  1IA6 A;  3K7X A;  3S9V A;  5ILH A;  2AHF A;  1NXC A;  1O1R B;  3PYA A;  2WY7 A;  4TXT A;  3OED A;  1N7O A;  4GAX A;  4YDO B;  2WY8 A;  2BB5 A;  1VD5 A;  1N1B A;  5JMD A;  2BB6 A;  1C3D A;  1D8D B;  3HXB B;  2PN5 A;  4FNV A;  4FXG B;  2FBA A;  5GW7 A;  5IK0 A;  1FBO A;  2DRR A;  3EQA A;  5JPN B;  3ANI A;  5M7I A;  1H3B A;  1FPP B;  1W6J A;  5EAS A;  2P0V A;  4KKJ A;  5FO9 B;  1KZO B;  3PYB A;  3E30 B;  3RX8 A;  3QWT A;  1N94 B;  3QSP A;  1KSD A;  2FV0 A;  3SFY B;  3WKG A;  1L1Y A;  5ILI A;  4MMI A;  3D3I A;  2D8L A;  1FT1 B;  2VN4 A;  1XW2 A;  4MBG B;  1H12 A;  5IK9 A;  3PZ3 B;  4OJZ A;  1GXN A;  1D8E B;  1OJM A;  5ILY A;  2F0Y B;  2G0D A;  3HXC B;  4WVA A;  5IM1 A;  1WU5 A;  3Q7F B;  2RGK A;  3M72 A;  1N4P B;  4V1R A;  3W5M A;  2ZIR B;  2V8I A;  1NC5 A;  3GLY A;  4NEI A;  4MMH A;  5MEH A;  1FO3 A;  1GXO A;  4GTT B;  1JS4 A;  3K11 A;  4GL3 A;  1JCR B;  3ANJ A;  3S4C A;  5IK6 A;  4GTO B;  1QBQ B;  4E1Y A;  1QAZ A;  1KFG A;  4GTS B;  3M7B A;  5FOB B;  3WC3 A;  5AGD A;  4OK4 A;  2DRQ A;  1K72 A;  3QT9 A;  3DSX B;  5EAU A;  1HM2 A;  3C72 B;  2G02 A;  3H2W A;  1LF6 A;  3M77 A;  1NL4 B;  4F10 A;  3WKH A;  1S63 B;  1N4Q B;  2H6G B;  3HXD B;  3CIH A;  3LZ9 A;  3W7W A;  1CEM A;  3M7E A;  4GTP B;  3DSV B;  3PZ4 B;  2V3N A;  1QQF A;  2BED B;  2XFG A;  1GLM A;  1ULV A;  2GH4 A;  3DST B;  3A0O A;  1X9D A;  3KSQ B;  3WIW A;  4CE7 A;  1TNO B;  2DRS A; 
#chains in the Genus database with same CATH homology
 1KZP B;  1AYX A;  2H6F B;  3RJ3 A;  1H39 A;  4LNG B;  3CU7 A;  1H54 A;  2OKX A;  3P5P A;  3KLS A;  4YDE B;  1IA7 A;  4LNB B;  3RX7 A;  4GTR B;  1F9D A;  1G6I A;  1DOG A;  3AFJ A;  2WYN A;  3DPY B;  1GAI A;  2QNO A;  3G6J B;  5CA3 A;  3EU8 A;  2AFA A;  2JG0 A;  3WUX A;  2ZIS B;  5KKB A;  3ANK A;  1G87 A;  1V7X A;  2A73 B;  3ON6 A;  1W6K A;  2XWB B;  1KSC A;  3P2C A;  1L2A A;  1TN6 B;  3DSS B;  1H3C A;  1KS8 A;  1GHQ A;  3P5R A;  3QXQ A;  3SAE A;  4BOK A;  1LF9 A;  1O6Q A;  4D94 A;  1UMP A;  2FV1 A;  4EHM B;  3M73 A;  1FO2 A;  2DRO A;  1V5C A;  1UG9 A;  4Z4J A;  3GT5 A;  2AHG A;  2VN7 A;  3ACT A;  1R76 A;  1XWT A;  4ZRP A;  1AGM A;  1QSJ A;  2JJB A;  2V8J A;  3M71 A;  1V7V A;  4D4D A;  1DCE B;  1FBW A;  3H7L A;  1CLC A;  1GAH A;  2WII B;  2PMV A;  3TF4 A;  2NOJ A;  3RRS A;  1WU4 A;  3DSW B;  3E73 A;  3WIQ A;  1UT9 A;  3DRA B;  1O6R A;  2YIK A;  3SDQ A;  1WU6 A;  2RI8 A;  3W7T A;  3SQC A;  5FO7 B;  3RSY A;  3T33 A;  3GZK A;  3QDE A;  3E37 B;  2WIN B;  1F9O A;  3SFX B;  1X81 B;  1N9A B;  3Q73 B;  4ONT A;  4CJ1 A;  3PZ2 B;  3W5N A;  1TNB B;  4BOJ A;  1WZZ A;  4M76 A;  5FO8 B;  4D4A A;  1JCQ B;  2H6I B;  3SDT A;  4WVB A;  1H13 A;  3VXD A;  3EUV B;  3QPF A;  3HXF B;  2Z07 A;  4YCR A;  2EAE A;  1KKT A;  4KKI A;  2XQW A;  4GTM B;  3X17 A;  2EAB A;  1FP3 A;  4LIX A;  3DSU B;  5DGR A;  1TF4 A;  2IEJ B;  3W7U A;  4KTP A;  1GA2 A;  4EL8 A;  4AYR A;  1RQ5 A;  2BBC A;  5JPM B;  1O1S B;  1GSZ A;  1HCU A;  2V3P A;  3WKI A;  1G9J A;  1H35 A;  2B4F A;  3PZ1 B;  4GTQ B;  3W7S A;  1O6H A;  1LD8 B;  4TF4 A;  3EZ8 A;  5GY3 A;  3W7X A;  2EAD A;  5GZK A;  4J5T A;  1KRE A;  5CZL A;  4GTV B;  4CJ0 A;  1SA4 B;  1SA5 B;  4KTR A;  2NVP A;  1O1T B;  3PMM A;  1DL2 A;  3WKF A;  3S4B A;  3EU5 B;  3QXF A;  3OXU A;  2GZ6 A;  3M75 A;  1SQC A;  3E6U A;  4MU9 A;  1NI1 B;  4FXK B;  4FUS A;  1G9G A;  1XWQ A;  2ZZR A;  4L9P B;  1KRF A;  3Q75 B;  2CQT A;  4L0G A;  1O79 A;  4WVC A;  2GOX A;  5CD2 A;  1TNZ B;  4L6X A;  3H3K A;  2ZBL A;  1GXM A;  3REN A;  3A3V A;  1HZF A;  1FAE A;  1TNU B;  4LNV A;  1N4R B;  4D4B A;  4AYQ A;  2A8Z A;  4C1S A;  3M7L A;  3SDV A;  4DOD A;  4JJJ A;  2XWJ B;  3QRY A;  5DGQ A;  4ZRQ A;  3Q78 B;  3Q79 B;  3HXE B;  1N95 B;  3RX5 A;  2SQC A;  1MZC B;  3SDU A;  2B39 A;  2D5J A;  3S4A A;  2R2L B;  3E34 B;  1H3A A;  3Q7A B;  1N4S B;  2RI9 A;  3ACS A;  3D5R A;  3M74 A;  4AYO A;  3VW5 A;  1V7W A;  3QFZ A;  1IS9 A;  1TN8 B;  3M78 A;  2I07 B;  2H6H B;  4QT9 A;  4Q88 A;  1H14 A;  3D5S A;  3S4D A;  5M7Y A;  3QFY A;  2CQS A;  3E33 B;  4WU0 A;  2V8K A;  1FCE A;  2F6D A;  1LTX B;  4DOE A;  4ZG8 A;  3KQ4 A;  4Q2B A;  4ZH1 A;  4V1S A;  2JF4 A;  3SDR A;  4AYP A;  1FT2 B;  4ZH5 A;  1LD7 B;  3QT3 A;  1FMI A;  1TN7 B;  3E32 B;  3M7C A;  3WIR A;  1H36 A;  2FUZ A;  4Z4L A;  3QG0 A;  1V5D A;  1O5M B;  1KWF A;  2EAC A;  1JCS B;  1H37 A;  1S64 B;  4D4C A;  3M76 A;  4XUV A;  1TNY B;  5E2J A;  3KSL B;  1IA6 A;  3K7X A;  3S9V A;  2AHF A;  1NXC A;  1O1R B;  3PYA A;  2WY7 A;  4TXT A;  3OED A;  4YDO B;  2WY8 A;  2BB5 A;  1VD5 A;  2BB6 A;  1C3D A;  1D8D B;  3HXB B;  2PN5 A;  4FXG B;  2FBA A;  5GW7 A;  1FBO A;  2DRR A;  3EQA A;  5JPN B;  3ANI A;  5M7I A;  1H3B A;  1FPP B;  1W6J A;  2P0V A;  4KKJ A;  5FO9 B;  1KZO B;  3PYB A;  3E30 B;  3RX8 A;  3QWT A;  1N94 B;  3QSP A;  1KSD A;  2FV0 A;  3SFY B;  3WKG A;  1L1Y A;  3D3I A;  2D8L A;  1FT1 B;  2VN4 A;  1XW2 A;  4MBG B;  1H12 A;  3PZ3 B;  1GXN A;  1D8E B;  2F0Y B;  2G0D A;  3HXC B;  4WVA A;  1WU5 A;  3Q7F B;  2RGK A;  3M72 A;  1N4P B;  4V1R A;  3W5M A;  2ZIR B;  2V8I A;  1NC5 A;  3GLY A;  5MEH A;  1FO3 A;  1GXO A;  4GTT B;  1JS4 A;  3K11 A;  4GL3 A;  1JCR B;  3ANJ A;  3S4C A;  4GTO B;  1QBQ B;  1KFG A;  4GTS B;  3M7B A;  5FOB B;  3WC3 A;  5AGD A;  2DRQ A;  1K72 A;  3QT9 A;  3DSX B;  3C72 B;  2G02 A;  3H2W A;  1LF6 A;  3M77 A;  1NL4 B;  3WKH A;  1S63 B;  1N4Q B;  2H6G B;  3HXD B;  3CIH A;  3W7W A;  1CEM A;  3M7E A;  4GTP B;  3DSV B;  3PZ4 B;  2V3N A;  1QQF A;  2BED B;  2XFG A;  1GLM A;  1ULV A;  2GH4 A;  3DST B;  1X9D A;  3KSQ B;  3WIW A;  4CE7 A;  1TNO B;  2DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...