1QSJA

N-terminally truncated c3dg fragment
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
276
structure length
276
Chain Sequence
CGEQNMIGMTPTVIAVHYLDQTEQWEKFGLEKRQEALELIKKGYTQQLAFKQPISAYAAFNNRPPSTWLTAYVSRVFSLAANLIAIDSQVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNTKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYLEASYLNLQRPYTVAIAGYALALMNKLEEPYLTKFLNTAKDRNRWEEPGQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNDERYYGGGYGSTQATFMVFQALAQYRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT C3 PRECURSOR
publication title Structure at 1.44 A resolution of an N-terminally truncated form of the rat serum complement C3d fragment.
pubmed doi rcsb
molecule tags Immune system
total genus 107
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1qsjA00
1N4RB 2I07B 3DSWB 4L9PB 3E37B 1TNZB 1KZOB 3D5SA 1O1SB 2H6HB 3DPYB 1X81B 4LNBB 3SQCA 2IEJB 4YDEB 2GOXA 2BB6A 1H37A 1TNOB 3RJ3A 5AGDA 2R2LB 1O6HA 1TNUB 2F0YB 1SA4B 4KKJA 2ZIRB 4GTSB 4D4DA 4D4CA 1N4QB 3Q78B 1O6QA 1QSJA 4D4BA 1UMPA 2H6GB 1D8DB 2WIIB 4V1SA 3OXUA 1H35A 4ZH1A 4MBGB 1GXMA 4LNVA 2WY8A 1H36A 4GTQB 1H39A 2V8IA 5JPMB 3DSTB 4LNGB 3DRAB 1S63B 1TN6B 4FXKB 1C3DA 1D8EB 4ZRQA 1O1TB 2A73B 1QQFA 2V3NA 2PMVA 3KQ4A 3OEDA 3EU5B 3PZ3B 1KZPB 2XWBB 1N4PB 3KLSA 2V3PA 5FO8B 1LD7B 1GSZA 4EHMB 1DCEB 4GTOB 3HXEB 1S64B 4GTPB 5JPNB 2WY7A 3PZ2B 4YDOB 4GTVB 1SQCA 4BOJA 1FT2B 1H3BA 3HXBB 3DSUB 3Q7FB 3E34B 3Q75B 3EUVB 4MU9A 2B39A 2XQWA 4KKIA 4ONTA 2BEDB 2G0DA 1H3AA 3KSLB 5FO7B 1LTXB 2BB5A 1MZCB 4M76A 3D5RA 3G6JB 1GHQA 5FOBB 4V1RA 1FT1B 5FO9B 4GTMB 1N9AB 3DSXB 4ZRPA 2XWJB 1O5MB 4C1SA 3KSQB 3HXCB 1TN7B 1JCQB 3PZ4B 3DSVB 1QBQB 1TNYB 3Q7AB 2PN5A 2V8KA 1R76A 2H6IB 3SFYB 3HXFB 3E33B 3DSSB 3PZ1B 3CU7A 1JCSB 2SQCA 1SA5B 1JCRB 1FPPB 1N4SB 3Q79B 1GXNA 1LD8B 2ZISB 3Q73B 3C72B 4FXGB 3SFXB 4BOKA 4D4AA 3E32B 1HZFA 1H3CA 1W6JA 4GTRB 3HXDB 1GXOA 1N95B 1W6KA 1O1RB 3K7XA 2BBCA 4D94A 2H6FB 3E30B 1NI1B 1O79A 1TNBB 1TN8B 2V8JA 4GTTB 1NL4B 1O6RA 2G02A 1N94B 2NOJA 2WINB
chains in the Genus database with same CATH superfamily
1N4RB 5M7IA 1VD5A 1V5DA 2I07B 3DSWB 2H6HB 2ZZRA 3QDEA 1IA7A 1OJPA 4Z4JA 5EASA 4D4DA 4GTSB 4Q2BA 3S4CA 2H6GB 1D8DB 1GAHA 2BRWA 3OXUA 4V1SA 5IK0A 4QT9A 4ZH1A 1X1IA 3W5NA 5JMFA 3H7LA 3PYBA 1GA2A 1HXAA 1H39A 3WIRA 2E22A 2FUZA 1N1BA 1TN6B 1OJMA 1WU5A 1D8EB 4ZRQA 4FNVA 1QQFA 2B4FA 2FBAA 3PZ3B 2V3PA 1GSZA 4J5TA 1RWGA 1LXMA 3M02A 3HXEB 1S64B 4GTPB 1RQ5A 4YDOB 4GTVB 4GL3A 1RWHA 3H2WA 3DSUB 4FUSA 1NC5A 3EUVB 5ILDA 4MU9A 2XQWA 2BEDB 3S4AA 3QXQA 3RSYA 2CQSA 3ANIA 1LTXB 3M7LA 1MZCB 1KSDA 3RX5A 3TF4A 1RW9A 4DI5A 4V1RA 1FCEA 2RI8A 3DSXB 4WVCA 1UG9A 3PZ4B 2V8KA 3SFYB 4MMHA 4KTRA 1KWFA 3CU7A 1JCSB 4F13A 5DGQA 1FPPB 1W3YA 1LD8B 4FXGB 2XFGA 4BOKA 2RGKA 3E32B 5CD2A 1DL2A 1H3CA 3EQAA 1G9JA 1XW2A 1NI1B 2Q1FA 1TNBB 3SDQA 5IK9A 3QFYA 4E1YA 1O6RA 2G02A 3W7XA 1N94B 1RWCA 3M78A 4AYPA 4L9PB 3P5RA 4L6XA 3PYAA 2IEJB 1HXGA 2GOXA 1TNOB 3RJ3A 3RX8A 2J5CA 1IS9A 2F0YB 2ZIRB 4D4CA 4OZVA 2CQTA 1O6QA 1QSJA 3T33A 1UMPA 5KKBA 1H35A 1HXCA 2A8ZA 4MBGB 4LNVA 3GZKA 3W5MA 1H36A 2AHGA 3AFJA 1GAIA 3M76A 5DHIA 1DOGA 2DROA 1F9DA 2V8IA 3M7BA 5JPMB 5IL3A 1X9DA 1KKTA 4LIXA 4LNGB 5CZLA 2BRPA 3G4DA 3VW5A 3X17A 4FXKB 1O1TB 1CEMA 2PMVA 3KQ4A 1KS8A 2XWBB 1N4PB 3KLSA 5GY3A 1DCEB 1JS4A 4YCRA 5JPNB 1SQCA 4BOJA 3M72A 1KSCA 1H3BA 2DRSA 4KKIA 1FP3A 3QT3A 5E2JA 2OKXA 4TF4A 2BB5A 3G6JB 1GHQA 1H13A 4GTMB 1EGUA 2JJBA 5DGRA 4C1SA 3P5PA 1CB8A 3KSQB 4MMIA 1L2AA 4JJJA 1JCQB 1G9GA 3WKGA 2RI9A 3DSVB 1QAZA 5IK6A 3RENA 3Q7AB 1GLMA 1R76A 3M74A 1N7RA 1HN0A 3QRYA 3RX7A 3HXFB 5ILKA 1JCRB 3SDRA 4DOEA 3QWTA 2ONGA 4D4AA 1N1ZA 3S4BA 1HZFA 1W6JA 1W6KA 1FBWA 3K7XA 1O79A 1TN8B 2V8JA 2WDAA 4GTTB 2JF4A 1RWFA 3K11A 2WINB 1H54A 1K72A 2F6DA 3WKIA 2EAEA 1TNZB 1KZOB 1O1SB 2GH4A 4LNBB 4WVBA 4YDEB 1LOHA 2BB6A 2R2LB 1HM3A 5EAUA 1HMUA 2QNOA 3SDVA 3G4FA 1N4QB 3Q78B 2FV0A 3N0FA 2WIIB 1UT9A 3H3KA 5C05A 3SDTA 5GZKA 1GXMA 5IKAA 2EADA 1X1JA 2EABA 1LXKA 2WY8A 4TXTA 5EATA 4GTQB 2FUTA 1N22A 1IA6A 5CA3A 1AGMA 2WYNA 4ZH5A 4CJ1A 1WU6A 3N0GA 1S63B 4WU0A 1C3DA 2P0VA 1XWTA 1WU4A 3OEDA 3SDUA 3M71A 1LD7B 3WIWA 4EHMB 3W7WA 4GTOB 3GLYA 1N7OA 1I8QA 3PZ2B 5JMDA 1FT2B 3HXBB 2FV1A 3GT5A 3M01A 3E34B 3Q75B 2VN4A 4OK4A 2B39A 1KREA 1F9GA 1WZZA 2JG0A 4ONTA 2D5JA 2NVPA 2G0DA 1H3AA 3NNBA 1N21A 1RWAA 1NXCA 2DRQA 5ILZA 5FO7B 3WKFA 1N7NA 1H12A 1FT1B 5FO9B 1J0NA 1FAEA 2AFAA 1N9AB 1H14A 1OJOA 2WCOA 4RNQA 2XWJB 2FUQA 1HMWA 1AYXA 3QPFA 3HXCB 2ONHA 1TNYB 3PMMA 4AYOA 3EU8A 1N7PA 3DSSB 1FO2A 3QT9A 1L1YA 3ANJA 2SQCA 1CLCA 1LF9A 1HV6A 1SA5B 3M77A 3QSPA 2EACA 1V7XA 1G87A 3WKHA 2ZISB 3C72B 3WUXA 4F10A 3AFLA 1X1HA 1N24A 2X03A 2YIKA 1ULVA 1GXOA 1N95B 1O1RB 4OK2A 1N23A 1FMIA 2BBCA 3E30B 3E80A 3W7SA 3RRSA 3E6UA 3NFVA 1NL4B 4AYQA 3ACTA 3D3IA 4FJQA 1OJNA 3VSMA 5MEHA 4Q88A 1HX9A 1C82A 3W7UA 1TF4A 3E37B 4WVAA 3D5SA 4Z4LA 2AHFA 3DPYB 1X81B 3LZ9A 3SQCA 1F1SA 1H37A 3WC3A 5AGDA 1N7QA 3QG0A 1O6HA 1TNUB 4KKJA 1SA4B 4ZG8A 4D4BA 3A3VA 3P2CA 3VXDA 5ILYA 3E7JA 4NEIA 1J0MA 1XWQA 3SAEA 2GZ6A 4OJZA 4XUVA 5ILJA 4KTPA 3DSTB 1N20A 3DRAB 4CE7A 2Z07A 2A73B 2V3NA 5IM1A 3EU5B 1KZPB 3M75A 5FO8B 1HCUA 1FO3A 5M7YA 3QXFA 3W7TA 2WY7A 1V5CA 3VSNA 2BRVX 3Q7FB 3ANKA 4EL8A 3ON6A 4L0GA 4CJ0A 2D8LA 1LF6A 3KSLB 4DODA 3EZ8A 3D5RA 4M76A 5FOBB 1KRFA 3M00A 3QFZA 5GW7A 3CIHA 4ZRPA 3M7CA 1O5MB 5IL8A 1TN7B 5ILIA 1KFGA 1QBQB 3WIQA 2PN5A 2H6IB 3M7EA 3E73A 5IKHA 3S4DA 1G6IA 2E24A 3E33B 1V7VA 1F9OA 3PZ1B 1V7WA 4AYRA 1N4SB 3S9VA 2VN7A 3ACSA 3Q79B 1GXNA 3Q73B 1FBOA 5DHKA 3SFXB 5ILHA 3M73A 4GTRB 3A0OA 3HXDB 2DRRA 4D94A 2H6FB 4GAXA 4OZWA 1HM2A 2ZBLA 2NOJA
chains in the Genus database with same CATH topology
1N4RB 5M7IA 1VD5A 1V5DA 2I07B 3DSWB 2H6HB 2ZZRA 3QDEA 1IA7A 4Z4JA 4D4DA 4GTSB 4Q2BA 3S4CA 2H6GB 1D8DB 1GAHA 4V1SA 3OXUA 4QT9A 4ZH1A 3W5NA 3H7LA 3PYBA 1GA2A 1H39A 3WIRA 2FUZA 1TN6B 1WU5A 1D8EB 4ZRQA 1QQFA 2B4FA 2FBAA 3PZ3B 2V3PA 1GSZA 4J5TA 3HXEB 1S64B 4GTPB 1RQ5A 4YDOB 4GTVB 4GL3A 3H2WA 3DSUB 4FUSA 1NC5A 3EUVB 4MU9A 2XQWA 2BEDB 3S4AA 3QXQA 3RSYA 2CQSA 3ANIA 1LTXB 3M7LA 1MZCB 1KSDA 3RX5A 3TF4A 4V1RA 1FCEA 2RI8A 3DSXB 4WVCA 1UG9A 3PZ4B 2V8KA 3SFYB 4KTRA 1KWFA 3CU7A 1JCSB 5DGQA 1FPPB 1LD8B 4FXGB 2XFGA 4BOKA 2RGKA 3E32B 5CD2A 1DL2A 1H3CA 3EQAA 1G9JA 1XW2A 1NI1B 1TNBB 3SDQA 3QFYA 1O6RA 2G02A 3W7XA 1N94B 3M78A 4AYPA 4L9PB 3P5RA 4L6XA 3PYAA 2IEJB 2GOXA 1TNOB 3RJ3A 3RX8A 1IS9A 2F0YB 2ZIRB 4D4CA 2CQTA 1O6QA 1QSJA 3T33A 1UMPA 5KKBA 1H35A 2A8ZA 4MBGB 4LNVA 3GZKA 3W5MA 1H36A 2AHGA 3AFJA 1GAIA 3M76A 1DOGA 2DROA 1F9DA 2V8IA 3M7BA 5JPMB 1X9DA 1KKTA 4LIXA 4LNGB 5CZLA 3VW5A 3X17A 4FXKB 1O1TB 1CEMA 2PMVA 3KQ4A 1KS8A 2XWBB 1N4PB 3KLSA 5GY3A 1DCEB 1JS4A 4YCRA 5JPNB 1SQCA 4BOJA 3M72A 1KSCA 1H3BA 2DRSA 4KKIA 1FP3A 3QT3A 5E2JA 2OKXA 4TF4A 2BB5A 3G6JB 1GHQA 1H13A 4GTMB 2JJBA 5DGRA 4C1SA 3P5PA 3KSQB 1L2AA 4JJJA 1JCQB 1G9GA 3WKGA 2RI9A 3DSVB 3RENA 3Q7AB 1GLMA 1R76A 3M74A 3QRYA 3RX7A 3HXFB 1JCRB 3SDRA 4DOEA 3QWTA 4D4AA 3S4BA 1HZFA 1W6JA 1W6KA 1FBWA 3K7XA 1O79A 1TN8B 2V8JA 4GTTB 2JF4A 3K11A 2WINB 1H54A 1K72A 2F6DA 3WKIA 2EAEA 1TNZB 1KZOB 1O1SB 2GH4A 4LNBB 4WVBA 4YDEB 2BB6A 2R2LB 2QNOA 3SDVA 1N4QB 3Q78B 2FV0A 2WIIB 1UT9A 3H3KA 3SDTA 5GZKA 1GXMA 2EADA 2EABA 2WY8A 4TXTA 4GTQB 1IA6A 5CA3A 1AGMA 2WYNA 4ZH5A 4CJ1A 1WU6A 1S63B 4WU0A 1C3DA 2P0VA 1XWTA 1WU4A 3OEDA 3SDUA 3M71A 1LD7B 3WIWA 4EHMB 3W7WA 4GTOB 3GLYA 3PZ2B 1FT2B 3HXBB 2FV1A 3GT5A 3E34B 3Q75B 2VN4A 2B39A 1KREA 1WZZA 2JG0A 4ONTA 2D5JA 2NVPA 2G0DA 1H3AA 2DRQA 1NXCA 5FO7B 3WKFA 1H12A 1FT1B 5FO9B 1FAEA 2AFAA 1N9AB 1H14A 2XWJB 1AYXA 3QPFA 3HXCB 1TNYB 3PMMA 4AYOA 3EU8A 3DSSB 1FO2A 3QT9A 1L1YA 3ANJA 2SQCA 1CLCA 1LF9A 1SA5B 3M77A 3QSPA 2EACA 1V7XA 1G87A 3WKHA 2ZISB 3C72B 3WUXA 2YIKA 1ULVA 1GXOA 1N95B 1O1RB 2BBCA 1FMIA 3E30B 3W7SA 3RRSA 3E6UA 1NL4B 4AYQA 3ACTA 3D3IA 5MEHA 4Q88A 3W7UA 1TF4A 3E37B 4WVAA 3D5SA 4Z4LA 2AHFA 3DPYB 1X81B 3SQCA 1H37A 3WC3A 5AGDA 3QG0A 1O6HA 1TNUB 4KKJA 1SA4B 4ZG8A 4D4BA 3A3VA 3P2CA 3VXDA 1XWQA 3SAEA 2GZ6A 4XUVA 4KTPA 3DSTB 3DRAB 4CE7A 2Z07A 2A73B 2V3NA 3EU5B 1KZPB 3M75A 5FO8B 1HCUA 1FO3A 5M7YA 3QXFA 3W7TA 2WY7A 1V5CA 3Q7FB 3ANKA 4EL8A 3ON6A 4L0GA 4CJ0A 2D8LA 1LF6A 3KSLB 4DODA 3EZ8A 3D5RA 4M76A 5FOBB 1KRFA 3QFZA 5GW7A 3CIHA 4ZRPA 3M7CA 1O5MB 1TN7B 1KFGA 1QBQB 3WIQA 2PN5A 2H6IB 3M7EA 3E73A 3S4DA 1G6IA 3E33B 1V7VA 1F9OA 3PZ1B 1V7WA 4AYRA 1N4SB 3S9VA 2VN7A 3ACSA 3Q79B 1GXNA 3Q73B 1FBOA 3SFXB 3M73A 4GTRB 3HXDB 2DRRA 4D94A 2H6FB 2ZBLA 2NOJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4R B;  2I07 B;  3DSW B;  4L9P B;  3E37 B;  1TNZ B;  1KZO B;  3D5S A;  1O1S B;  2H6H B;  3DPY B;  1X81 B;  4LNB B;  3SQC A;  2IEJ B;  4YDE B;  2GOX A;  2BB6 A;  1H37 A;  1TNO B;  3RJ3 A;  5AGD A;  2R2L B;  1O6H A;  1TNU B;  2F0Y B;  1SA4 B;  4KKJ A;  2ZIR B;  4GTS B;  4D4D A;  4D4C A;  1N4Q B;  3Q78 B;  1O6Q A;  1QSJ A;  4D4B A;  1UMP A;  2H6G B;  1D8D B;  2WII B;  4V1S A;  3OXU A;  1H35 A;  4ZH1 A;  4MBG B;  1GXM A;  4LNV A;  2WY8 A;  1H36 A;  4GTQ B;  1H39 A;  2V8I A;  5JPM B;  3DST B;  4LNG B;  3DRA B;  1S63 B;  1TN6 B;  4FXK B;  1C3D A;  1D8E B;  4ZRQ A;  1O1T B;  2A73 B;  1QQF A;  2V3N A;  2PMV A;  3KQ4 A;  3OED A;  3EU5 B;  3PZ3 B;  1KZP B;  2XWB B;  1N4P B;  3KLS A;  2V3P A;  5FO8 B;  1LD7 B;  1GSZ A;  4EHM B;  1DCE B;  4GTO B;  3HXE B;  1S64 B;  4GTP B;  5JPN B;  2WY7 A;  3PZ2 B;  4YDO B;  4GTV B;  1SQC A;  4BOJ A;  1FT2 B;  1H3B A;  3HXB B;  3DSU B;  3Q7F B;  3E34 B;  3Q75 B;  3EUV B;  4MU9 A;  2B39 A;  2XQW A;  4KKI A;  4ONT A;  2BED B;  2G0D A;  1H3A A;  3KSL B;  5FO7 B;  1LTX B;  2BB5 A;  1MZC B;  4M76 A;  3D5R A;  3G6J B;  1GHQ A;  5FOB B;  4V1R A;  1FT1 B;  5FO9 B;  4GTM B;  1N9A B;  3DSX B;  4ZRP A;  2XWJ B;  1O5M B;  4C1S A;  3KSQ B;  3HXC B;  1TN7 B;  1JCQ B;  3PZ4 B;  3DSV B;  1QBQ B;  1TNY B;  3Q7A B;  2PN5 A;  2V8K A;  1R76 A;  2H6I B;  3SFY B;  3HXF B;  3E33 B;  3DSS B;  3PZ1 B;  3CU7 A;  1JCS B;  2SQC A;  1SA5 B;  1JCR B;  1FPP B;  1N4S B;  3Q79 B;  1GXN A;  1LD8 B;  2ZIS B;  3Q73 B;  3C72 B;  4FXG B;  3SFX B;  4BOK A;  4D4A A;  3E32 B;  1HZF A;  1H3C A;  1W6J A;  4GTR B;  3HXD B;  1GXO A;  1N95 B;  1W6K A;  1O1R B;  3K7X A;  2BBC A;  4D94 A;  2H6F B;  3E30 B;  1NI1 B;  1O79 A;  1TNB B;  1TN8 B;  2V8J A;  4GTT B;  1NL4 B;  1O6R A;  2G02 A;  1N94 B;  2NOJ A;  2WIN B; 
#chains in the Genus database with same CATH topology
 1N4R B;  5M7I A;  1VD5 A;  1V5D A;  2I07 B;  3DSW B;  2H6H B;  2ZZR A;  3QDE A;  1IA7 A;  1OJP A;  4Z4J A;  5EAS A;  4D4D A;  4GTS B;  4Q2B A;  3S4C A;  2H6G B;  1D8D B;  1GAH A;  2BRW A;  3OXU A;  4V1S A;  5IK0 A;  4QT9 A;  4ZH1 A;  1X1I A;  3W5N A;  5JMF A;  3H7L A;  3PYB A;  1GA2 A;  1HXA A;  1H39 A;  3WIR A;  2E22 A;  2FUZ A;  1N1B A;  1TN6 B;  1OJM A;  1WU5 A;  1D8E B;  4ZRQ A;  4FNV A;  1QQF A;  2B4F A;  2FBA A;  3PZ3 B;  2V3P A;  1GSZ A;  4J5T A;  1RWG A;  1LXM A;  3M02 A;  3HXE B;  1S64 B;  4GTP B;  1RQ5 A;  4YDO B;  4GTV B;  4GL3 A;  1RWH A;  3H2W A;  3DSU B;  4FUS A;  1NC5 A;  3EUV B;  5ILD A;  4MU9 A;  2XQW A;  2BED B;  3S4A A;  3QXQ A;  3RSY A;  2CQS A;  3ANI A;  1LTX B;  3M7L A;  1MZC B;  1KSD A;  3RX5 A;  3TF4 A;  1RW9 A;  4DI5 A;  4V1R A;  1FCE A;  2RI8 A;  3DSX B;  4WVC A;  1UG9 A;  3PZ4 B;  2V8K A;  3SFY B;  4MMH A;  4KTR A;  1KWF A;  3CU7 A;  1JCS B;  4F13 A;  5DGQ A;  1FPP B;  1W3Y A;  1LD8 B;  4FXG B;  2XFG A;  4BOK A;  2RGK A;  3E32 B;  5CD2 A;  1DL2 A;  1H3C A;  3EQA A;  1G9J A;  1XW2 A;  1NI1 B;  2Q1F A;  1TNB B;  3SDQ A;  5IK9 A;  3QFY A;  4E1Y A;  1O6R A;  2G02 A;  3W7X A;  1N94 B;  1RWC A;  3M78 A;  4AYP A;  4L9P B;  3P5R A;  4L6X A;  3PYA A;  2IEJ B;  1HXG A;  2GOX A;  1TNO B;  3RJ3 A;  3RX8 A;  2J5C A;  1IS9 A;  2F0Y B;  2ZIR B;  4D4C A;  4OZV A;  2CQT A;  1O6Q A;  1QSJ A;  3T33 A;  1UMP A;  5KKB A;  1H35 A;  1HXC A;  2A8Z A;  4MBG B;  4LNV A;  3GZK A;  3W5M A;  1H36 A;  2AHG A;  3AFJ A;  1GAI A;  3M76 A;  5DHI A;  1DOG A;  2DRO A;  1F9D A;  2V8I A;  3M7B A;  5JPM B;  5IL3 A;  1X9D A;  1KKT A;  4LIX A;  4LNG B;  5CZL A;  2BRP A;  3G4D A;  3VW5 A;  3X17 A;  4FXK B;  1O1T B;  1CEM A;  2PMV A;  3KQ4 A;  1KS8 A;  2XWB B;  1N4P B;  3KLS A;  5GY3 A;  1DCE B;  1JS4 A;  4YCR A;  5JPN B;  1SQC A;  4BOJ A;  3M72 A;  1KSC A;  1H3B A;  2DRS A;  4KKI A;  1FP3 A;  3QT3 A;  5E2J A;  2OKX A;  4TF4 A;  2BB5 A;  3G6J B;  1GHQ A;  1H13 A;  4GTM B;  1EGU A;  2JJB A;  5DGR A;  4C1S A;  3P5P A;  1CB8 A;  3KSQ B;  4MMI A;  1L2A A;  4JJJ A;  1JCQ B;  1G9G A;  3WKG A;  2RI9 A;  3DSV B;  1QAZ A;  5IK6 A;  3REN A;  3Q7A B;  1GLM A;  1R76 A;  3M74 A;  1N7R A;  1HN0 A;  3QRY A;  3RX7 A;  3HXF B;  5ILK A;  1JCR B;  3SDR A;  4DOE A;  3QWT A;  2ONG A;  4D4A A;  1N1Z A;  3S4B A;  1HZF A;  1W6J A;  1W6K A;  1FBW A;  3K7X A;  1O79 A;  1TN8 B;  2V8J A;  2WDA A;  4GTT B;  2JF4 A;  1RWF A;  3K11 A;  2WIN B;  1H54 A;  1K72 A;  2F6D A;  3WKI A;  2EAE A;  1TNZ B;  1KZO B;  1O1S B;  2GH4 A;  4LNB B;  4WVB A;  4YDE B;  1LOH A;  2BB6 A;  2R2L B;  1HM3 A;  5EAU A;  1HMU A;  2QNO A;  3SDV A;  3G4F A;  1N4Q B;  3Q78 B;  2FV0 A;  3N0F A;  2WII B;  1UT9 A;  3H3K A;  5C05 A;  3SDT A;  5GZK A;  1GXM A;  5IKA A;  2EAD A;  1X1J A;  2EAB A;  1LXK A;  2WY8 A;  4TXT A;  5EAT A;  4GTQ B;  2FUT A;  1N22 A;  1IA6 A;  5CA3 A;  1AGM A;  2WYN A;  4ZH5 A;  4CJ1 A;  1WU6 A;  3N0G A;  1S63 B;  4WU0 A;  1C3D A;  2P0V A;  1XWT A;  1WU4 A;  3OED A;  3SDU A;  3M71 A;  1LD7 B;  3WIW A;  4EHM B;  3W7W A;  4GTO B;  3GLY A;  1N7O A;  1I8Q A;  3PZ2 B;  5JMD A;  1FT2 B;  3HXB B;  2FV1 A;  3GT5 A;  3M01 A;  3E34 B;  3Q75 B;  2VN4 A;  4OK4 A;  2B39 A;  1KRE A;  1F9G A;  1WZZ A;  2JG0 A;  4ONT A;  2D5J A;  2NVP A;  2G0D A;  1H3A A;  3NNB A;  1N21 A;  1RWA A;  1NXC A;  2DRQ A;  5ILZ A;  5FO7 B;  3WKF A;  1N7N A;  1H12 A;  1FT1 B;  5FO9 B;  1J0N A;  1FAE A;  2AFA A;  1N9A B;  1H14 A;  1OJO A;  2WCO A;  4RNQ A;  2XWJ B;  2FUQ A;  1HMW A;  1AYX A;  3QPF A;  3HXC B;  2ONH A;  1TNY B;  3PMM A;  4AYO A;  3EU8 A;  1N7P A;  3DSS B;  1FO2 A;  3QT9 A;  1L1Y A;  3ANJ A;  2SQC A;  1CLC A;  1LF9 A;  1HV6 A;  1SA5 B;  3M77 A;  3QSP A;  2EAC A;  1V7X A;  1G87 A;  3WKH A;  2ZIS B;  3C72 B;  3WUX A;  4F10 A;  3AFL A;  1X1H A;  1N24 A;  2X03 A;  2YIK A;  1ULV A;  1GXO A;  1N95 B;  1O1R B;  4OK2 A;  1N23 A;  1FMI A;  2BBC A;  3E30 B;  3E80 A;  3W7S A;  3RRS A;  3E6U A;  3NFV A;  1NL4 B;  4AYQ A;  3ACT A;  3D3I A;  4FJQ A;  1OJN A;  3VSM A;  5MEH A;  4Q88 A;  1HX9 A;  1C82 A;  3W7U A;  1TF4 A;  3E37 B;  4WVA A;  3D5S A;  4Z4L A;  2AHF A;  3DPY B;  1X81 B;  3LZ9 A;  3SQC A;  1F1S A;  1H37 A;  3WC3 A;  5AGD A;  1N7Q A;  3QG0 A;  1O6H A;  1TNU B;  4KKJ A;  1SA4 B;  4ZG8 A;  4D4B A;  3A3V A;  3P2C A;  3VXD A;  5ILY A;  3E7J A;  4NEI A;  1J0M A;  1XWQ A;  3SAE A;  2GZ6 A;  4OJZ A;  4XUV A;  5ILJ A;  4KTP A;  3DST B;  1N20 A;  3DRA B;  4CE7 A;  2Z07 A;  2A73 B;  2V3N A;  5IM1 A;  3EU5 B;  1KZP B;  3M75 A;  5FO8 B;  1HCU A;  1FO3 A;  5M7Y A;  3QXF A;  3W7T A;  2WY7 A;  1V5C A;  3VSN A;  2BRV X;  3Q7F B;  3ANK A;  4EL8 A;  3ON6 A;  4L0G A;  4CJ0 A;  2D8L A;  1LF6 A;  3KSL B;  4DOD A;  3EZ8 A;  3D5R A;  4M76 A;  5FOB B;  1KRF A;  3M00 A;  3QFZ A;  5GW7 A;  3CIH A;  4ZRP A;  3M7C A;  1O5M B;  5IL8 A;  1TN7 B;  5ILI A;  1KFG A;  1QBQ B;  3WIQ A;  2PN5 A;  2H6I B;  3M7E A;  3E73 A;  5IKH A;  3S4D A;  1G6I A;  2E24 A;  3E33 B;  1V7V A;  1F9O A;  3PZ1 B;  1V7W A;  4AYR A;  1N4S B;  3S9V A;  2VN7 A;  3ACS A;  3Q79 B;  1GXN A;  3Q73 B;  1FBO A;  5DHK A;  3SFX B;  5ILH A;  3M73 A;  4GTR B;  3A0O A;  3HXD B;  2DRR A;  4D94 A;  2H6F B;  4GAX A;  4OZW A;  1HM2 A;  2ZBL A;  2NOJ A; 
#chains in the Genus database with same CATH homology
 1N4R B;  5M7I A;  1VD5 A;  1V5D A;  2I07 B;  3DSW B;  2H6H B;  2ZZR A;  3QDE A;  1IA7 A;  4Z4J A;  4D4D A;  4GTS B;  4Q2B A;  3S4C A;  2H6G B;  1D8D B;  1GAH A;  4V1S A;  3OXU A;  4QT9 A;  4ZH1 A;  3W5N A;  3H7L A;  3PYB A;  1GA2 A;  1H39 A;  3WIR A;  2FUZ A;  1TN6 B;  1WU5 A;  1D8E B;  4ZRQ A;  1QQF A;  2B4F A;  2FBA A;  3PZ3 B;  2V3P A;  1GSZ A;  4J5T A;  3HXE B;  1S64 B;  4GTP B;  1RQ5 A;  4YDO B;  4GTV B;  4GL3 A;  3H2W A;  3DSU B;  4FUS A;  1NC5 A;  3EUV B;  4MU9 A;  2XQW A;  2BED B;  3S4A A;  3QXQ A;  3RSY A;  2CQS A;  3ANI A;  1LTX B;  3M7L A;  1MZC B;  1KSD A;  3RX5 A;  3TF4 A;  4V1R A;  1FCE A;  2RI8 A;  3DSX B;  4WVC A;  1UG9 A;  3PZ4 B;  2V8K A;  3SFY B;  4KTR A;  1KWF A;  3CU7 A;  1JCS B;  5DGQ A;  1FPP B;  1LD8 B;  4FXG B;  2XFG A;  4BOK A;  2RGK A;  3E32 B;  5CD2 A;  1DL2 A;  1H3C A;  3EQA A;  1G9J A;  1XW2 A;  1NI1 B;  1TNB B;  3SDQ A;  3QFY A;  1O6R A;  2G02 A;  3W7X A;  1N94 B;  3M78 A;  4AYP A;  4L9P B;  3P5R A;  4L6X A;  3PYA A;  2IEJ B;  2GOX A;  1TNO B;  3RJ3 A;  3RX8 A;  1IS9 A;  2F0Y B;  2ZIR B;  4D4C A;  2CQT A;  1O6Q A;  1QSJ A;  3T33 A;  1UMP A;  5KKB A;  1H35 A;  2A8Z A;  4MBG B;  4LNV A;  3GZK A;  3W5M A;  1H36 A;  2AHG A;  3AFJ A;  1GAI A;  3M76 A;  1DOG A;  2DRO A;  1F9D A;  2V8I A;  3M7B A;  5JPM B;  1X9D A;  1KKT A;  4LIX A;  4LNG B;  5CZL A;  3VW5 A;  3X17 A;  4FXK B;  1O1T B;  1CEM A;  2PMV A;  3KQ4 A;  1KS8 A;  2XWB B;  1N4P B;  3KLS A;  5GY3 A;  1DCE B;  1JS4 A;  4YCR A;  5JPN B;  1SQC A;  4BOJ A;  3M72 A;  1KSC A;  1H3B A;  2DRS A;  4KKI A;  1FP3 A;  3QT3 A;  5E2J A;  2OKX A;  4TF4 A;  2BB5 A;  3G6J B;  1GHQ A;  1H13 A;  4GTM B;  2JJB A;  5DGR A;  4C1S A;  3P5P A;  3KSQ B;  1L2A A;  4JJJ A;  1JCQ B;  1G9G A;  3WKG A;  2RI9 A;  3DSV B;  3REN A;  3Q7A B;  1GLM A;  1R76 A;  3M74 A;  3QRY A;  3RX7 A;  3HXF B;  1JCR B;  3SDR A;  4DOE A;  3QWT A;  4D4A A;  3S4B A;  1HZF A;  1W6J A;  1W6K A;  1FBW A;  3K7X A;  1O79 A;  1TN8 B;  2V8J A;  4GTT B;  2JF4 A;  3K11 A;  2WIN B;  1H54 A;  1K72 A;  2F6D A;  3WKI A;  2EAE A;  1TNZ B;  1KZO B;  1O1S B;  2GH4 A;  4LNB B;  4WVB A;  4YDE B;  2BB6 A;  2R2L B;  2QNO A;  3SDV A;  1N4Q B;  3Q78 B;  2FV0 A;  2WII B;  1UT9 A;  3H3K A;  3SDT A;  5GZK A;  1GXM A;  2EAD A;  2EAB A;  2WY8 A;  4TXT A;  4GTQ B;  1IA6 A;  5CA3 A;  1AGM A;  2WYN A;  4ZH5 A;  4CJ1 A;  1WU6 A;  1S63 B;  4WU0 A;  1C3D A;  2P0V A;  1XWT A;  1WU4 A;  3OED A;  3SDU A;  3M71 A;  1LD7 B;  3WIW A;  4EHM B;  3W7W A;  4GTO B;  3GLY A;  3PZ2 B;  1FT2 B;  3HXB B;  2FV1 A;  3GT5 A;  3E34 B;  3Q75 B;  2VN4 A;  2B39 A;  1KRE A;  1WZZ A;  2JG0 A;  4ONT A;  2D5J A;  2NVP A;  2G0D A;  1H3A A;  2DRQ A;  1NXC A;  5FO7 B;  3WKF A;  1H12 A;  1FT1 B;  5FO9 B;  1FAE A;  2AFA A;  1N9A B;  1H14 A;  2XWJ B;  1AYX A;  3QPF A;  3HXC B;  1TNY B;  3PMM A;  4AYO A;  3EU8 A;  3DSS B;  1FO2 A;  3QT9 A;  1L1Y A;  3ANJ A;  2SQC A;  1CLC A;  1LF9 A;  1SA5 B;  3M77 A;  3QSP A;  2EAC A;  1V7X A;  1G87 A;  3WKH A;  2ZIS B;  3C72 B;  3WUX A;  2YIK A;  1ULV A;  1GXO A;  1N95 B;  1O1R B;  2BBC A;  1FMI A;  3E30 B;  3W7S A;  3RRS A;  3E6U A;  1NL4 B;  4AYQ A;  3ACT A;  3D3I A;  5MEH A;  4Q88 A;  3W7U A;  1TF4 A;  3E37 B;  4WVA A;  3D5S A;  4Z4L A;  2AHF A;  3DPY B;  1X81 B;  3SQC A;  1H37 A;  3WC3 A;  5AGD A;  3QG0 A;  1O6H A;  1TNU B;  4KKJ A;  1SA4 B;  4ZG8 A;  4D4B A;  3A3V A;  3P2C A;  3VXD A;  1XWQ A;  3SAE A;  2GZ6 A;  4XUV A;  4KTP A;  3DST B;  3DRA B;  4CE7 A;  2Z07 A;  2A73 B;  2V3N A;  3EU5 B;  1KZP B;  3M75 A;  5FO8 B;  1HCU A;  1FO3 A;  5M7Y A;  3QXF A;  3W7T A;  2WY7 A;  1V5C A;  3Q7F B;  3ANK A;  4EL8 A;  3ON6 A;  4L0G A;  4CJ0 A;  2D8L A;  1LF6 A;  3KSL B;  4DOD A;  3EZ8 A;  3D5R A;  4M76 A;  5FOB B;  1KRF A;  3QFZ A;  5GW7 A;  3CIH A;  4ZRP A;  3M7C A;  1O5M B;  1TN7 B;  1KFG A;  1QBQ B;  3WIQ A;  2PN5 A;  2H6I B;  3M7E A;  3E73 A;  3S4D A;  1G6I A;  3E33 B;  1V7V A;  1F9O A;  3PZ1 B;  1V7W A;  4AYR A;  1N4S B;  3S9V A;  2VN7 A;  3ACS A;  3Q79 B;  1GXN A;  3Q73 B;  1FBO A;  3SFX B;  3M73 A;  4GTR B;  3HXD B;  2DRR A;  4D94 A;  2H6F B;  2ZBL A;  2NOJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...