1QSJA

N-terminally truncated c3dg fragment
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
276
structure length
276
Chain Sequence
CGEQNMIGMTPTVIAVHYLDQTEQWEKFGLEKRQEALELIKKGYTQQLAFKQPISAYAAFNNRPPSTWLTAYVSRVFSLAANLIAIDSQVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNTKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYLEASYLNLQRPYTVAIAGYALALMNKLEEPYLTKFLNTAKDRNRWEEPGQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNDERYYGGGYGSTQATFMVFQALAQYRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords COMPLEMENT C3 PRECURSOR
publication title Structure at 1.44 A resolution of an N-terminally truncated form of the rat serum complement C3d fragment.
pubmed doi rcsb
total genus 107
structure length 276
sequence length 276
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-06-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1qsjA00
3DSUB 3HXCB 4GTOB 1H3AA 1W6JA 5JPMB 2I07B 1O1TB 1NL4B 1SA5B 4GTPB 4LNGB 2NOJA 2XWBB 3E37B 1TNYB 2R2LB 3DSWB 1QSJA 2V8JA 3Q78B 1N4SB 3Q73B 4GTMB 4BOJA 2V8IA 2PMVA 3DRAB 3DSTB 4GTVB 4GTSB 4BOKA 1O1RB 1SQCA 4D4DA 1O79A 2SQCA 1D8EB 1GHQA 3EU5B 3DPYB 2G0DA 1GSZA 4MU9A 3KSQB 4D94A 5JPNB 4ONTA 3KLSA 5FO8B 2V8KA 4MBGB 4YDEB 1FPPB 1TNOB 1H3CA 2F0YB 1TNBB 3KQ4A 5FO9B 5FOBB 1NI1B 2V3NA 2WY8A 2WY7A 4V1RA 2BB5A 1HZFA 3SFXB 4GTTB 4C1SA 3CU7A 1DCEB 2H6FB 3E32B 3D5RA 1FT2B 4D4AA 1D8DB 3DSVB 4ZRPA 3E34B 4GTQB 2H6IB 3OEDA 4YDOB 1FT1B 4D4BA 1LTXB 1X81B 1TN6B 1UMPA 1N95B 2WINB 3PZ3B 3PZ4B 4GTRB 3OXUA 4M76A 1KZOB 3RJ3A 4ZRQA 2WIIB 3C72B 1H36A 1W6KA 1N4PB 2BEDB 1JCRB 3HXEB 2ZISB 3HXDB 1TNUB 3SFYB 2IEJB 4V1SA 1JCSB 3Q7FB 1LD7B 1N4QB 1R76A 3PZ2B 1TN7B 4KKJA 2BBCA 4FXGB 5AGDA 1O1SB 2H6HB 2A73B 2PN5A 1N94B 1GXMA 4KKIA 1H3BA 3HXBB 1O5MB 4ZH1A 1O6RA 1QQFA 3SQCA 3Q79B 1QBQB 1GXNA 1C3DA 1N9AB 1O6HA 1S63B 3EUVB 1H35A 1TN8B 2XWJB 3G6JB 1H37A 3D5SA 1TNZB 3DSXB 1KZPB 2G02A 3HXFB 1MZCB 4L9PB 2V3PA 2XQWA 3DSSB 2GOXA 5FO7B 3Q7AB 3Q75B 3KSLB 4LNVA 3E30B 3K7XA 1N4RB 4LNBB 1GXOA 1LD8B 1S64B 3PZ1B 1JCQB 1O6QA 3E33B 4D4CA 1H39A 2BB6A 2ZIRB 4FXKB 1SA4B 2B39A 4EHMB 2H6GB
chains in the Genus database with same CATH superfamily
3E7JA 1H3AA 5JPMB 1WU6A 4YCRA 2D5JA 3SDRA 1HXCA 1G9GA 1AYXA 4MMHA 4WVAA 1H14A 1N20A 3M00A 3Q73B 3W7TA 3N0GA 3RX8A 4AYOA 2PMVA 4BOKA 4Z4JA 1L1YA 4AYQA 4F10A 1V5CA 2XFGA 4MU9A 4WU0A 3A3VA 2RI8A 3QXFA 5FO8B 3QFZA 4Q88A 2V8KA 5EATA 3S4BA 5IM1A 2GH4A 3KQ4A 2WYNA 5DGRA 1HV6A 1F9GA 3M02A 1WU5A 2BRWA 1WZZA 1QAZA 1V7VA 1UT9A 2E24A 2H6FB 1FT2B 2JG0A 3CIHA 3E80A 5C05A 3DSVB 4ZRPA 4LIXA 1J0NA 4GTQB 3ANIA 2FBAA 4GAXA 1RW9A 4F13A 1FP3A 4CE7A 2WINB 4GTRB 1HM3A 1KZOB 3RJ3A 2EAEA 2WIIB 3H3KA 1H36A 5E2JA 1V7XA 1H54A 5ILZA 1RWFA 1XWQA 1JCSB 2FV1A 3Q7FB 1NC5A 1N7QA 5ILJA 1N1ZA 4KKJA 5IKAA 3M7BA 1FCEA 5AGDA 1HXAA 3M7CA 1G6IA 1QQFA 3Q79B 1GXNA 3M73A 1N9AB 3SDUA 4E1YA 1S63B 5IKHA 1RQ5A 2XWJB 4ZG8A 1LF9A 1KFGA 3DSXB 2G02A 2DROA 2V3PA 1JS4A 2XQWA 5ILKA 3QWTA 2RI9A 3P2CA 3QPFA 3Q7AB 1N23A 3WKGA 1F9DA 2BRPA 4D4CA 1K72A 3QT9A 1H39A 2ZIRB 5GZKA 4KTPA 3QDEA 1OJNA 1HMWA 2D8LA 4WVCA 4GTOB 4OZWA 5ILHA 1NL4B 2WDAA 3A0OA 1CB8A 2NOJA 1I8QA 5JMDA 4MMIA 2CQSA 3X17A 1DL2A 3ANJA 5CZLA 4BOJA 4GTVB 3DSTB 4GL3A 1FBWA 1O1RB 1SQCA 1KRFA 1O79A 3H7LA 2SQCA 1D8EB 1IA7A 1IS9A 3D3IA 3EU5B 3G4DA 4D94A 1FMIA 2GZ6A 1OJMA 1FBOA 3NNBA 4MBGB 1CEMA 4L0GA 2F0YB 1H3CA 1X1JA 3S4CA 2Z07A 3ON6A 2WY7A 1VD5A 1IA6A 2BB5A 3M74A 2OKXA 1HZFA 3SFXB 2DRQA 4C1SA 1RWHA 4RNQA 2ONGA 1C82A 4D4AA 1HX9A 3QRYA 2H6IB 3OEDA 4YDOB 5GW7A 3W7WA 1LXKA 3M75A 1LTXB 1KSDA 2FUQA 1F9OA 1KSCA 3PZ4B 3OXUA 1OJOA 4AYRA 2QNOA 3E6UA 3M7LA 2RGKA 4ZRQA 1W6KA 3GT5A 4AYPA 3HXEB 3SFYB 1FO3A 1LD7B 1N24A 1TN7B 3VW5A 1RWAA 2PN5A 2A8ZA 1N7RA 1H3BA 2DRSA 3EQAA 5ILIA 3WC3A 4DODA 5M7IA 2ONHA 1CLCA 3W7XA 1LOHA 1QBQB 3G4FA 4J5TA 3S4AA 1H35A 3WIRA 3D5SA 2GOXA 1N21A 4KTRA 5FO7B 3Q75B 3KSLB 5CD2A 1N7NA 3E30B 4LNBB 1LD8B 1JCQB 2BB6A 4JJJA 4FXKB 4WVBA 4OK4A 1HM2A 4TXTA 3DSUB 2EABA 3HXCB 5DHKA 2CQTA 2JF4A 1O1TB 1SA5B 4L6XA 2EACA 2XWBB 3TF4A 1XW2A 3QT3A 3DSWB 4FNVA 2V8JA 1G87A 4OZVA 3SDTA 1X1HA 1N1BA 1N4SB 4GTMB 2VN4A 1LF6A 1N7OA 2JJBA 3DRAB 2FV0A 2X03A 4D4DA 2FUTA 1GHQA 1XWTA 4OK2A 1N7PA 3W7SA 1GSZA 5JPNB 3M72A 4ONTA 3KLSA 3S4DA 4YDEB 2FUZA 1FPPB 1TNOB 5EAUA 5ILYA 1G9JA 2F6DA 1NI1B 2V3NA 5DHIA 2WY8A 4V1RA 2VN7A 4Q2BA 3SDVA 3SAEA 1LXMA 1DCEB 4CJ1A 3E32B 3D5RA 3PYBA 1EGUA 3T33A 3E34B 5JMFA 1FT1B 4D4BA 3RRSA 1X81B 1UMPA 4QT9A 2AHGA 1N95B 3PZ3B 2ZBLA 3C72B 1KS8A 3QG0A 3RSYA 3K11A 1N4PB 3E73A 2BEDB 1JCRB 2ZISB 1TNUB 2IEJB 3M7EA 4V1SA 5IL3A 1R76A 3PZ2B 3RX5A 2BBCA 3GLYA 3LZ9A 4FXGB 2BRVX 2H6HB 1F1SA 3PMMA 4KKIA 5IL8A 1RWCA 3SQCA 2B4FA 1X1IA 1C3DA 1O6HA 2DRRA 3EUVB 3G6JB 1H37A 1KZPB 1MZCB 1WU4A 3DSSB 1KKTA 3K7XA 1N4RB 3PZ1B 1O6QA 2EADA 3E33B 3EZ8A 3NFVA 3WKHA 2B39A 4EHMB 2H6GB 2WCOA 3P5RA 1HMUA 5DGQA 5CA3A 1W6JA 5M7YA 2I07B 1N22A 3AFJA 4GTPB 3QSPA 4LNGB 3WIWA 1TNYB 2R2LB 5KKBA 1QSJA 2P0VA 1AGMA 5IK6A 3Q78B 3EU8A 3WUXA 3ACTA 2V8IA 3H2WA 4TF4A 4GTSB 2NVPA 1HXGA 4FJQA 1UG9A 3P5PA 3DPYB 2G0DA 3KSQB 4ZH5A 5IK0A 2E22A 3SDQA 3ACSA 1TNBB 3QFYA 5FO9B 1J0MA 3W5NA 3M78A 4OJZA 5FOBB 1GA2A 1KREA 2ZZRA 4EL8A 5GY3A 1V5DA 4GTTB 3CU7A 1RWGA 1GAIA 3M01A 3N0FA 4DI5A 1KWFA 1D8DB 3WKFA 1FO2A 3VSNA 5ILDA 1TN6B 1H12A 2AHFA 4M76A 1X9DA 3WIQA 3M76A 3RX7A 2J5CA 4XUVA 3VSMA 1L2AA 3M77A 3HXDB 3WKIA 3W5MA 1HCUA 1N4QB 3VXDA 3GZKA 1HN0A 5MEHA 3M71A 4Z4LA 2Q1FA 1ULVA 1O1SB 2A73B 1GXMA 1N94B 3S9VA 1NXCA 3HXBB 1O5MB 4ZH1A 1O6RA 1GLMA 5IK9A 1V7WA 3ANKA 1W3YA 3AFLA 1FAEA 1TN8B 3PYAA 3RENA 4CJ0A 3QXQA 1TNZB 3HXFB 4L9PB 4FUSA 1GAHA 2YIKA 4LNVA 1OJPA 2AFAA 1GXOA 1S64B 4DOEA 3W7UA 1DOGA 1H13A 1TF4A 5EASA 1SA4B 3E37B 4NEIA
chains in the Genus database with same CATH topology
1H3AA 5JPMB 1WU6A 4YCRA 2D5JA 3SDRA 1G9GA 1AYXA 4WVAA 1H14A 3Q73B 3W7TA 3RX8A 4AYOA 2PMVA 4BOKA 4Z4JA 1L1YA 4AYQA 1V5CA 2XFGA 4MU9A 4WU0A 3A3VA 2RI8A 3QXFA 5FO8B 3QFZA 4Q88A 2V8KA 3S4BA 2GH4A 3KQ4A 2WYNA 5DGRA 1WU5A 1WZZA 1V7VA 1UT9A 2H6FB 1FT2B 2JG0A 3CIHA 3DSVB 4ZRPA 4LIXA 4GTQB 3ANIA 2FBAA 1FP3A 4CE7A 2WINB 4GTRB 1KZOB 3RJ3A 2EAEA 2WIIB 3H3KA 1H36A 5E2JA 1V7XA 1H54A 1XWQA 1JCSB 2FV1A 3Q7FB 1NC5A 4KKJA 3M7BA 1FCEA 5AGDA 3M7CA 1G6IA 1QQFA 3Q79B 1GXNA 3M73A 1N9AB 3SDUA 1S63B 1RQ5A 2XWJB 4ZG8A 1LF9A 1KFGA 3DSXB 2G02A 2DROA 2V3PA 1JS4A 2XQWA 3QWTA 2RI9A 3P2CA 3QPFA 3Q7AB 3WKGA 1F9DA 4D4CA 1K72A 3QT9A 1H39A 2ZIRB 5GZKA 4KTPA 3QDEA 2D8LA 4WVCA 4GTOB 1NL4B 2NOJA 2CQSA 3X17A 1DL2A 3ANJA 5CZLA 4BOJA 4GTVB 3DSTB 4GL3A 1FBWA 1O1RB 1SQCA 1KRFA 1O79A 3H7LA 2SQCA 1D8EB 1IA7A 1IS9A 3D3IA 3EU5B 4D94A 1FMIA 2GZ6A 1FBOA 4MBGB 1CEMA 4L0GA 2F0YB 1H3CA 3S4CA 2Z07A 3ON6A 2WY7A 1VD5A 1IA6A 2BB5A 3M74A 2OKXA 1HZFA 3SFXB 2DRQA 4C1SA 4D4AA 3QRYA 2H6IB 3OEDA 4YDOB 5GW7A 3W7WA 3M75A 1LTXB 1KSDA 1F9OA 1KSCA 3PZ4B 3OXUA 4AYRA 2QNOA 3E6UA 3M7LA 2RGKA 4ZRQA 1W6KA 3GT5A 4AYPA 3HXEB 3SFYB 1FO3A 1LD7B 1TN7B 3VW5A 2PN5A 2A8ZA 2DRSA 1H3BA 3EQAA 3WC3A 4DODA 5M7IA 3W7XA 1CLCA 1QBQB 4J5TA 3S4AA 1H35A 3WIRA 3D5SA 2GOXA 4KTRA 5FO7B 3Q75B 3KSLB 5CD2A 3E30B 4LNBB 1LD8B 1JCQB 2BB6A 4JJJA 4FXKB 4WVBA 4TXTA 3DSUB 2EABA 3HXCB 2CQTA 2JF4A 1O1TB 1SA5B 4L6XA 2EACA 2XWBB 3TF4A 1XW2A 3QT3A 3DSWB 2V8JA 1G87A 3SDTA 1N4SB 4GTMB 2VN4A 1LF6A 2JJBA 3DRAB 2FV0A 4D4DA 1GHQA 1XWTA 3W7SA 1GSZA 5JPNB 3M72A 4ONTA 3KLSA 3S4DA 4YDEB 2FUZA 1FPPB 1TNOB 1G9JA 2F6DA 1NI1B 2V3NA 2WY8A 4V1RA 2VN7A 4Q2BA 3SDVA 3SAEA 1DCEB 4CJ1A 3E32B 3D5RA 3PYBA 3T33A 3E34B 1FT1B 4D4BA 3RRSA 1X81B 1UMPA 4QT9A 2AHGA 1N95B 3PZ3B 2ZBLA 3C72B 1KS8A 3QG0A 3RSYA 3K11A 1N4PB 3E73A 2BEDB 1JCRB 2ZISB 1TNUB 2IEJB 3M7EA 4V1SA 1R76A 3PZ2B 3RX5A 2BBCA 3GLYA 4FXGB 2H6HB 3PMMA 4KKIA 3SQCA 2B4FA 1C3DA 1O6HA 2DRRA 3EUVB 3G6JB 1H37A 1KZPB 1MZCB 1WU4A 3DSSB 1KKTA 3K7XA 1N4RB 3PZ1B 1O6QA 2EADA 3E33B 3EZ8A 3WKHA 2B39A 4EHMB 2H6GB 3P5RA 5DGQA 5CA3A 1W6JA 5M7YA 2I07B 3AFJA 4GTPB 3QSPA 4LNGB 3WIWA 1TNYB 2R2LB 5KKBA 1QSJA 2P0VA 1AGMA 3Q78B 3EU8A 3WUXA 3ACTA 2V8IA 3H2WA 4TF4A 4GTSB 2NVPA 1UG9A 3P5PA 3DPYB 2G0DA 3KSQB 4ZH5A 3SDQA 3ACSA 1TNBB 3QFYA 5FO9B 3W5NA 3M78A 5FOBB 1GA2A 1KREA 2ZZRA 4EL8A 5GY3A 1V5DA 4GTTB 3CU7A 1GAIA 1KWFA 1D8DB 3WKFA 1FO2A 1TN6B 1H12A 2AHFA 4M76A 1X9DA 3WIQA 3M76A 3RX7A 4XUVA 1L2AA 3M77A 3HXDB 3WKIA 3W5MA 1HCUA 1N4QB 3VXDA 3GZKA 5MEHA 3M71A 4Z4LA 1ULVA 1O1SB 2A73B 1GXMA 1N94B 3S9VA 1NXCA 3HXBB 1O5MB 4ZH1A 1O6RA 1GLMA 1V7WA 3ANKA 1FAEA 1TN8B 3PYAA 3RENA 4CJ0A 3QXQA 1TNZB 3HXFB 4L9PB 4FUSA 1GAHA 2YIKA 4LNVA 2AFAA 1GXOA 1S64B 4DOEA 3W7UA 1DOGA 1H13A 1TF4A 1SA4B 3E37B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSU B;  3HXC B;  4GTO B;  1H3A A;  1W6J A;  5JPM B;  2I07 B;  1O1T B;  1NL4 B;  1SA5 B;  4GTP B;  4LNG B;  2NOJ A;  2XWB B;  3E37 B;  1TNY B;  2R2L B;  3DSW B;  1QSJ A;  2V8J A;  3Q78 B;  1N4S B;  3Q73 B;  4GTM B;  4BOJ A;  2V8I A;  2PMV A;  3DRA B;  3DST B;  4GTV B;  4GTS B;  4BOK A;  1O1R B;  1SQC A;  4D4D A;  1O79 A;  2SQC A;  1D8E B;  1GHQ A;  3EU5 B;  3DPY B;  2G0D A;  1GSZ A;  4MU9 A;  3KSQ B;  4D94 A;  5JPN B;  4ONT A;  3KLS A;  5FO8 B;  2V8K A;  4MBG B;  4YDE B;  1FPP B;  1TNO B;  1H3C A;  2F0Y B;  1TNB B;  3KQ4 A;  5FO9 B;  5FOB B;  1NI1 B;  2V3N A;  2WY8 A;  2WY7 A;  4V1R A;  2BB5 A;  1HZF A;  3SFX B;  4GTT B;  4C1S A;  3CU7 A;  1DCE B;  2H6F B;  3E32 B;  3D5R A;  1FT2 B;  4D4A A;  1D8D B;  3DSV B;  4ZRP A;  3E34 B;  4GTQ B;  2H6I B;  3OED A;  4YDO B;  1FT1 B;  4D4B A;  1LTX B;  1X81 B;  1TN6 B;  1UMP A;  1N95 B;  2WIN B;  3PZ3 B;  3PZ4 B;  4GTR B;  3OXU A;  4M76 A;  1KZO B;  3RJ3 A;  4ZRQ A;  2WII B;  3C72 B;  1H36 A;  1W6K A;  1N4P B;  2BED B;  1JCR B;  3HXE B;  2ZIS B;  3HXD B;  1TNU B;  3SFY B;  2IEJ B;  4V1S A;  1JCS B;  3Q7F B;  1LD7 B;  1N4Q B;  1R76 A;  3PZ2 B;  1TN7 B;  4KKJ A;  2BBC A;  4FXG B;  5AGD A;  1O1S B;  2H6H B;  2A73 B;  2PN5 A;  1N94 B;  1GXM A;  4KKI A;  1H3B A;  3HXB B;  1O5M B;  4ZH1 A;  1O6R A;  1QQF A;  3SQC A;  3Q79 B;  1QBQ B;  1GXN A;  1C3D A;  1N9A B;  1O6H A;  1S63 B;  3EUV B;  1H35 A;  1TN8 B;  2XWJ B;  3G6J B;  1H37 A;  3D5S A;  1TNZ B;  3DSX B;  1KZP B;  2G02 A;  3HXF B;  1MZC B;  4L9P B;  2V3P A;  2XQW A;  3DSS B;  2GOX A;  5FO7 B;  3Q7A B;  3Q75 B;  3KSL B;  4LNV A;  3E30 B;  3K7X A;  1N4R B;  4LNB B;  1GXO A;  1LD8 B;  1S64 B;  3PZ1 B;  1JCQ B;  1O6Q A;  3E33 B;  4D4C A;  1H39 A;  2BB6 A;  2ZIR B;  4FXK B;  1SA4 B;  2B39 A;  4EHM B;  2H6G B; 
#chains in the Genus database with same CATH topology
 3E7J A;  1H3A A;  5JPM B;  1WU6 A;  4YCR A;  2D5J A;  3SDR A;  1HXC A;  1G9G A;  1AYX A;  4MMH A;  4WVA A;  1H14 A;  1N20 A;  3M00 A;  3Q73 B;  3W7T A;  3N0G A;  3RX8 A;  4AYO A;  2PMV A;  4BOK A;  4Z4J A;  1L1Y A;  4AYQ A;  4F10 A;  1V5C A;  2XFG A;  4MU9 A;  4WU0 A;  3A3V A;  2RI8 A;  3QXF A;  5FO8 B;  3QFZ A;  4Q88 A;  2V8K A;  5EAT A;  3S4B A;  5IM1 A;  2GH4 A;  3KQ4 A;  2WYN A;  5DGR A;  1HV6 A;  1F9G A;  3M02 A;  1WU5 A;  2BRW A;  1WZZ A;  1QAZ A;  1V7V A;  1UT9 A;  2E24 A;  2H6F B;  1FT2 B;  2JG0 A;  3CIH A;  3E80 A;  5C05 A;  3DSV B;  4ZRP A;  4LIX A;  1J0N A;  4GTQ B;  3ANI A;  2FBA A;  4GAX A;  1RW9 A;  4F13 A;  1FP3 A;  4CE7 A;  2WIN B;  4GTR B;  1HM3 A;  1KZO B;  3RJ3 A;  2EAE A;  2WII B;  3H3K A;  1H36 A;  5E2J A;  1V7X A;  1H54 A;  5ILZ A;  1RWF A;  1XWQ A;  1JCS B;  2FV1 A;  3Q7F B;  1NC5 A;  1N7Q A;  5ILJ A;  1N1Z A;  4KKJ A;  5IKA A;  3M7B A;  1FCE A;  5AGD A;  1HXA A;  3M7C A;  1G6I A;  1QQF A;  3Q79 B;  1GXN A;  3M73 A;  1N9A B;  3SDU A;  4E1Y A;  1S63 B;  5IKH A;  1RQ5 A;  2XWJ B;  4ZG8 A;  1LF9 A;  1KFG A;  3DSX B;  2G02 A;  2DRO A;  2V3P A;  1JS4 A;  2XQW A;  5ILK A;  3QWT A;  2RI9 A;  3P2C A;  3QPF A;  3Q7A B;  1N23 A;  3WKG A;  1F9D A;  2BRP A;  4D4C A;  1K72 A;  3QT9 A;  1H39 A;  2ZIR B;  5GZK A;  4KTP A;  3QDE A;  1OJN A;  1HMW A;  2D8L A;  4WVC A;  4GTO B;  4OZW A;  5ILH A;  1NL4 B;  2WDA A;  3A0O A;  1CB8 A;  2NOJ A;  1I8Q A;  5JMD A;  4MMI A;  2CQS A;  3X17 A;  1DL2 A;  3ANJ A;  5CZL A;  4BOJ A;  4GTV B;  3DST B;  4GL3 A;  1FBW A;  1O1R B;  1SQC A;  1KRF A;  1O79 A;  3H7L A;  2SQC A;  1D8E B;  1IA7 A;  1IS9 A;  3D3I A;  3EU5 B;  3G4D A;  4D94 A;  1FMI A;  2GZ6 A;  1OJM A;  1FBO A;  3NNB A;  4MBG B;  1CEM A;  4L0G A;  2F0Y B;  1H3C A;  1X1J A;  3S4C A;  2Z07 A;  3ON6 A;  2WY7 A;  1VD5 A;  1IA6 A;  2BB5 A;  3M74 A;  2OKX A;  1HZF A;  3SFX B;  2DRQ A;  4C1S A;  1RWH A;  4RNQ A;  2ONG A;  1C82 A;  4D4A A;  1HX9 A;  3QRY A;  2H6I B;  3OED A;  4YDO B;  5GW7 A;  3W7W A;  1LXK A;  3M75 A;  1LTX B;  1KSD A;  2FUQ A;  1F9O A;  1KSC A;  3PZ4 B;  3OXU A;  1OJO A;  4AYR A;  2QNO A;  3E6U A;  3M7L A;  2RGK A;  4ZRQ A;  1W6K A;  3GT5 A;  4AYP A;  3HXE B;  3SFY B;  1FO3 A;  1LD7 B;  1N24 A;  1TN7 B;  3VW5 A;  1RWA A;  2PN5 A;  2A8Z A;  1N7R A;  1H3B A;  2DRS A;  3EQA A;  5ILI A;  3WC3 A;  4DOD A;  5M7I A;  2ONH A;  1CLC A;  3W7X A;  1LOH A;  1QBQ B;  3G4F A;  4J5T A;  3S4A A;  1H35 A;  3WIR A;  3D5S A;  2GOX A;  1N21 A;  4KTR A;  5FO7 B;  3Q75 B;  3KSL B;  5CD2 A;  1N7N A;  3E30 B;  4LNB B;  1LD8 B;  1JCQ B;  2BB6 A;  4JJJ A;  4FXK B;  4WVB A;  4OK4 A;  1HM2 A;  4TXT A;  3DSU B;  2EAB A;  3HXC B;  5DHK A;  2CQT A;  2JF4 A;  1O1T B;  1SA5 B;  4L6X A;  2EAC A;  2XWB B;  3TF4 A;  1XW2 A;  3QT3 A;  3DSW B;  4FNV A;  2V8J A;  1G87 A;  4OZV A;  3SDT A;  1X1H A;  1N1B A;  1N4S B;  4GTM B;  2VN4 A;  1LF6 A;  1N7O A;  2JJB A;  3DRA B;  2FV0 A;  2X03 A;  4D4D A;  2FUT A;  1GHQ A;  1XWT A;  4OK2 A;  1N7P A;  3W7S A;  1GSZ A;  5JPN B;  3M72 A;  4ONT A;  3KLS A;  3S4D A;  4YDE B;  2FUZ A;  1FPP B;  1TNO B;  5EAU A;  5ILY A;  1G9J A;  2F6D A;  1NI1 B;  2V3N A;  5DHI A;  2WY8 A;  4V1R A;  2VN7 A;  4Q2B A;  3SDV A;  3SAE A;  1LXM A;  1DCE B;  4CJ1 A;  3E32 B;  3D5R A;  3PYB A;  1EGU A;  3T33 A;  3E34 B;  5JMF A;  1FT1 B;  4D4B A;  3RRS A;  1X81 B;  1UMP A;  4QT9 A;  2AHG A;  1N95 B;  3PZ3 B;  2ZBL A;  3C72 B;  1KS8 A;  3QG0 A;  3RSY A;  3K11 A;  1N4P B;  3E73 A;  2BED B;  1JCR B;  2ZIS B;  1TNU B;  2IEJ B;  3M7E A;  4V1S A;  5IL3 A;  1R76 A;  3PZ2 B;  3RX5 A;  2BBC A;  3GLY A;  3LZ9 A;  4FXG B;  2BRV X;  2H6H B;  1F1S A;  3PMM A;  4KKI A;  5IL8 A;  1RWC A;  3SQC A;  2B4F A;  1X1I A;  1C3D A;  1O6H A;  2DRR A;  3EUV B;  3G6J B;  1H37 A;  1KZP B;  1MZC B;  1WU4 A;  3DSS B;  1KKT A;  3K7X A;  1N4R B;  3PZ1 B;  1O6Q A;  2EAD A;  3E33 B;  3EZ8 A;  3NFV A;  3WKH A;  2B39 A;  4EHM B;  2H6G B;  2WCO A;  3P5R A;  1HMU A;  5DGQ A;  5CA3 A;  1W6J A;  5M7Y A;  2I07 B;  1N22 A;  3AFJ A;  4GTP B;  3QSP A;  4LNG B;  3WIW A;  1TNY B;  2R2L B;  5KKB A;  1QSJ A;  2P0V A;  1AGM A;  5IK6 A;  3Q78 B;  3EU8 A;  3WUX A;  3ACT A;  2V8I A;  3H2W A;  4TF4 A;  4GTS B;  2NVP A;  1HXG A;  4FJQ A;  1UG9 A;  3P5P A;  3DPY B;  2G0D A;  3KSQ B;  4ZH5 A;  5IK0 A;  2E22 A;  3SDQ A;  3ACS A;  1TNB B;  3QFY A;  5FO9 B;  1J0M A;  3W5N A;  3M78 A;  4OJZ A;  5FOB B;  1GA2 A;  1KRE A;  2ZZR A;  4EL8 A;  5GY3 A;  1V5D A;  4GTT B;  3CU7 A;  1RWG A;  1GAI A;  3M01 A;  3N0F A;  4DI5 A;  1KWF A;  1D8D B;  3WKF A;  1FO2 A;  3VSN A;  5ILD A;  1TN6 B;  1H12 A;  2AHF A;  4M76 A;  1X9D A;  3WIQ A;  3M76 A;  3RX7 A;  2J5C A;  4XUV A;  3VSM A;  1L2A A;  3M77 A;  3HXD B;  3WKI A;  3W5M A;  1HCU A;  1N4Q B;  3VXD A;  3GZK A;  1HN0 A;  5MEH A;  3M71 A;  4Z4L A;  2Q1F A;  1ULV A;  1O1S B;  2A73 B;  1GXM A;  1N94 B;  3S9V A;  1NXC A;  3HXB B;  1O5M B;  4ZH1 A;  1O6R A;  1GLM A;  5IK9 A;  1V7W A;  3ANK A;  1W3Y A;  3AFL A;  1FAE A;  1TN8 B;  3PYA A;  3REN A;  4CJ0 A;  3QXQ A;  1TNZ B;  3HXF B;  4L9P B;  4FUS A;  1GAH A;  2YIK A;  4LNV A;  1OJP A;  2AFA A;  1GXO A;  1S64 B;  4DOE A;  3W7U A;  1DOG A;  1H13 A;  1TF4 A;  5EAS A;  1SA4 B;  3E37 B;  4NEI A; 
#chains in the Genus database with same CATH homology
 1H3A A;  5JPM B;  1WU6 A;  4YCR A;  2D5J A;  3SDR A;  1G9G A;  1AYX A;  4WVA A;  1H14 A;  3Q73 B;  3W7T A;  3RX8 A;  4AYO A;  2PMV A;  4BOK A;  4Z4J A;  1L1Y A;  4AYQ A;  1V5C A;  2XFG A;  4MU9 A;  4WU0 A;  3A3V A;  2RI8 A;  3QXF A;  5FO8 B;  3QFZ A;  4Q88 A;  2V8K A;  3S4B A;  2GH4 A;  3KQ4 A;  2WYN A;  5DGR A;  1WU5 A;  1WZZ A;  1V7V A;  1UT9 A;  2H6F B;  1FT2 B;  2JG0 A;  3CIH A;  3DSV B;  4ZRP A;  4LIX A;  4GTQ B;  3ANI A;  2FBA A;  1FP3 A;  4CE7 A;  2WIN B;  4GTR B;  1KZO B;  3RJ3 A;  2EAE A;  2WII B;  3H3K A;  1H36 A;  5E2J A;  1V7X A;  1H54 A;  1XWQ A;  1JCS B;  2FV1 A;  3Q7F B;  1NC5 A;  4KKJ A;  3M7B A;  1FCE A;  5AGD A;  3M7C A;  1G6I A;  1QQF A;  3Q79 B;  1GXN A;  3M73 A;  1N9A B;  3SDU A;  1S63 B;  1RQ5 A;  2XWJ B;  4ZG8 A;  1LF9 A;  1KFG A;  3DSX B;  2G02 A;  2DRO A;  2V3P A;  1JS4 A;  2XQW A;  3QWT A;  2RI9 A;  3P2C A;  3QPF A;  3Q7A B;  3WKG A;  1F9D A;  4D4C A;  1K72 A;  3QT9 A;  1H39 A;  2ZIR B;  5GZK A;  4KTP A;  3QDE A;  2D8L A;  4WVC A;  4GTO B;  1NL4 B;  2NOJ A;  2CQS A;  3X17 A;  1DL2 A;  3ANJ A;  5CZL A;  4BOJ A;  4GTV B;  3DST B;  4GL3 A;  1FBW A;  1O1R B;  1SQC A;  1KRF A;  1O79 A;  3H7L A;  2SQC A;  1D8E B;  1IA7 A;  1IS9 A;  3D3I A;  3EU5 B;  4D94 A;  1FMI A;  2GZ6 A;  1FBO A;  4MBG B;  1CEM A;  4L0G A;  2F0Y B;  1H3C A;  3S4C A;  2Z07 A;  3ON6 A;  2WY7 A;  1VD5 A;  1IA6 A;  2BB5 A;  3M74 A;  2OKX A;  1HZF A;  3SFX B;  2DRQ A;  4C1S A;  4D4A A;  3QRY A;  2H6I B;  3OED A;  4YDO B;  5GW7 A;  3W7W A;  3M75 A;  1LTX B;  1KSD A;  1F9O A;  1KSC A;  3PZ4 B;  3OXU A;  4AYR A;  2QNO A;  3E6U A;  3M7L A;  2RGK A;  4ZRQ A;  1W6K A;  3GT5 A;  4AYP A;  3HXE B;  3SFY B;  1FO3 A;  1LD7 B;  1TN7 B;  3VW5 A;  2PN5 A;  2A8Z A;  2DRS A;  1H3B A;  3EQA A;  3WC3 A;  4DOD A;  5M7I A;  3W7X A;  1CLC A;  1QBQ B;  4J5T A;  3S4A A;  1H35 A;  3WIR A;  3D5S A;  2GOX A;  4KTR A;  5FO7 B;  3Q75 B;  3KSL B;  5CD2 A;  3E30 B;  4LNB B;  1LD8 B;  1JCQ B;  2BB6 A;  4JJJ A;  4FXK B;  4WVB A;  4TXT A;  3DSU B;  2EAB A;  3HXC B;  2CQT A;  2JF4 A;  1O1T B;  1SA5 B;  4L6X A;  2EAC A;  2XWB B;  3TF4 A;  1XW2 A;  3QT3 A;  3DSW B;  2V8J A;  1G87 A;  3SDT A;  1N4S B;  4GTM B;  2VN4 A;  1LF6 A;  2JJB A;  3DRA B;  2FV0 A;  4D4D A;  1GHQ A;  1XWT A;  3W7S A;  1GSZ A;  5JPN B;  3M72 A;  4ONT A;  3KLS A;  3S4D A;  4YDE B;  2FUZ A;  1FPP B;  1TNO B;  1G9J A;  2F6D A;  1NI1 B;  2V3N A;  2WY8 A;  4V1R A;  2VN7 A;  4Q2B A;  3SDV A;  3SAE A;  1DCE B;  4CJ1 A;  3E32 B;  3D5R A;  3PYB A;  3T33 A;  3E34 B;  1FT1 B;  4D4B A;  3RRS A;  1X81 B;  1UMP A;  4QT9 A;  2AHG A;  1N95 B;  3PZ3 B;  2ZBL A;  3C72 B;  1KS8 A;  3QG0 A;  3RSY A;  3K11 A;  1N4P B;  3E73 A;  2BED B;  1JCR B;  2ZIS B;  1TNU B;  2IEJ B;  3M7E A;  4V1S A;  1R76 A;  3PZ2 B;  3RX5 A;  2BBC A;  3GLY A;  4FXG B;  2H6H B;  3PMM A;  4KKI A;  3SQC A;  2B4F A;  1C3D A;  1O6H A;  2DRR A;  3EUV B;  3G6J B;  1H37 A;  1KZP B;  1MZC B;  1WU4 A;  3DSS B;  1KKT A;  3K7X A;  1N4R B;  3PZ1 B;  1O6Q A;  2EAD A;  3E33 B;  3EZ8 A;  3WKH A;  2B39 A;  4EHM B;  2H6G B;  3P5R A;  5DGQ A;  5CA3 A;  1W6J A;  5M7Y A;  2I07 B;  3AFJ A;  4GTP B;  3QSP A;  4LNG B;  3WIW A;  1TNY B;  2R2L B;  5KKB A;  1QSJ A;  2P0V A;  1AGM A;  3Q78 B;  3EU8 A;  3WUX A;  3ACT A;  2V8I A;  3H2W A;  4TF4 A;  4GTS B;  2NVP A;  1UG9 A;  3P5P A;  3DPY B;  2G0D A;  3KSQ B;  4ZH5 A;  3SDQ A;  3ACS A;  1TNB B;  3QFY A;  5FO9 B;  3W5N A;  3M78 A;  5FOB B;  1GA2 A;  1KRE A;  2ZZR A;  4EL8 A;  5GY3 A;  1V5D A;  4GTT B;  3CU7 A;  1GAI A;  1KWF A;  1D8D B;  3WKF A;  1FO2 A;  1TN6 B;  1H12 A;  2AHF A;  4M76 A;  1X9D A;  3WIQ A;  3M76 A;  3RX7 A;  4XUV A;  1L2A A;  3M77 A;  3HXD B;  3WKI A;  3W5M A;  1HCU A;  1N4Q B;  3VXD A;  3GZK A;  5MEH A;  3M71 A;  4Z4L A;  1ULV A;  1O1S B;  2A73 B;  1GXM A;  1N94 B;  3S9V A;  1NXC A;  3HXB B;  1O5M B;  4ZH1 A;  1O6R A;  1GLM A;  1V7W A;  3ANK A;  1FAE A;  1TN8 B;  3PYA A;  3REN A;  4CJ0 A;  3QXQ A;  1TNZ B;  3HXF B;  4L9P B;  4FUS A;  1GAH A;  2YIK A;  4LNV A;  2AFA A;  1GXO A;  1S64 B;  4DOE A;  3W7U A;  1DOG A;  1H13 A;  1TF4 A;  1SA4 B;  3E37 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...