5M7IA

Crystal structure of gh125 1,6-alpha-mannosidase mutant from clostridium perfringens in complex with 1,6-alpha-mannobiose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
425
structure length
425
Chain Sequence
SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSNDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords exo-alpha-1,6-mannosidase
publication title Computational Design of Experiment Unveils the Conformational Reaction Coordinate of GH125 alpha-Mannosidases.
pubmed doi rcsb
source organism Clostridium perfringens (strain 13 / type a)
molecule tags Hydrolase
total genus 161
structure length 425
sequence length 425
ec nomenclature
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5m7iA01
5M7IA 1XW2A 3W7UA 1FP3A 3ANJA 3GLYA 3QFZA 3WKHA 2GZ6A 4WU0A 3WIRA 3QRYA 1FBWA 1DL2A 3AFJA 1WU4A 4Z4JA 1FO3A 1KRFA 4KTPA 2DRQA 2D5JA 2DRSA 2EAEA 2FUZA 2RI9A 1LF6A 1XWQA 1DOGA 1H13A 2YIKA 3CIHA 5DGQA 5CZLA 3QPFA 4JJJA 3ACTA 4ZH5A 4ZG8A 3W7SA 3GZKA 5KKBA 2VN7A 1KKTA 5CD2A 2ZZRA 1F9DA 1K72A 2EABA 3X17A 1IA7A 1UG9A 2A8ZA 3D3IA 3H3KA 3P2CA 5M7YA 4DODA 5CA3A 1FBOA 1V5CA 1AGMA 3QXQA 1KSCA 4CE7A 3TF4A 1GAIA 3QFYA 3S4DA 4AYRA 2WYNA 2Z07A 4CJ1A 4J5TA 2JJBA 3H2WA 3ANIA 4WVBA 1CLCA 1V7WA 3ON6A 1IA6A 1GA2A 1H12A 3S4CA 4TF4A 4AYQA 1V7XA 4WVAA 5GW7A 4AYPA 1WU6A 3W7XA 2F6DA 2DRRA 2OKXA 2AFAA 4CJ0A 4DOEA 1WZZA 1UT9A 1FCEA 3WKFA 1NXCA 3VW5A 4Q2BA 3QT3A 3QT9A 2FV1A 2FV0A 1H14A 3VXDA 3WIQA 3WKIA 1HCUA 1KFGA 2CQSA 4L6XA 3W5MA 4FUSA 2JF4A 3RRSA 3T33A 3RX7A 1AYXA 4Q88A 3ACSA 4Z4LA 3RX5A 2RGKA 2AHFA 3S4AA 3RX8A 4TXTA 2AHGA 2ZBLA 3WIWA 3H7LA 2P0VA 1X9DA 1JS4A 1H54A 5DGRA 2NVPA 1L1YA 3GT5A 4EL8A 5E2JA 2DROA 3K11A 4AYOA 1KS8A 3WUXA 3RSYA 1LF9A 2VN4A 1G9GA 1F9OA 3QWTA 2GH4A 1KWFA 3RENA 1GLMA 3EQAA 2CQTA 1FO2A 1WU5A 2EADA 2JG0A 2QNOA 3QSPA 2D8LA 2B4FA 1ULVA 1G6IA 3E6UA 5MEHA 3QG0A 1G9JA 3ANKA 1RQ5A 3A3VA 2FBAA 1NC5A 3S4BA 5GY3A 3PMMA 3WKGA 3W7WA 3EZ8A 1KSDA 1VD5A 3E73A 4WVCA 4KTRA 1FMIA 4XUVA 1V7VA 1IS9A 1TF4A 3QDEA 1V5DA 1FAEA 2RI8A 3W5NA 3W7TA 3WC3A 1XWTA 4L0GA 1GAHA 2XFGA 2EACA 1L2AA 3QXFA 1KREA 1G87A 1CEMA
chains in the Genus database with same CATH superfamily
1DCEB 1H35A 1N7PA 1N23A 1HMUA 3M71A 1N4PB 3ANJA 3GLYA 3QFZA 3WKHA 4OZVA 4MMHA 3WIRA 1KRFA 1LTXB 1W6JA 2D5JA 2DRSA 3A0OA 2RI9A 3PYBA 2YIKA 3CIHA 2WY7A 3QPFA 3E33B 2VN7A 1KKTA 4M76A 1F9DA 1K72A 2EABA 3SDTA 3P2CA 1V5CA 1N1BA 4D4AA 3M02A 3S4DA 4AYRA 1HV6A 4CJ1A 4EHMB 5GZKA 2BBCA 3ON6A 1IA6A 3E32B 3SFXB 1SA5B 4D4DA 4WVAA 3W7XA 2H6GB 2OKXA 3EU5B 2BRPA 5ILHA 2H6IB 4OJZA 1QQFA 1UT9A 1MZCB 3QT9A 2FV0A 2V3PA 4LIXA 3P5PA 3VXDA 4GTTB 1W3YA 1N24A 5IK0A 3RRSA 2JF4A 3DPYB 3M77A 4F10A 3RX5A 3SAEA 3S4AA 4TXTA 2AHGA 1X9DA 5E2JA 3M7CA 3G4DA 2F0YB 3PZ3B 3RSYA 4OZWA 1G9GA 1SA4B 1GLMA 1N4RB 2CQTA 3DSSB 2EADA 1HX9A 3G4FA 5ILYA 3E6UA 2ZIRB 3OXUA 4D4BA 3ANKA 2FBAA 1GHQA 3PMMA 2Q1FA 1KSDA 1RWAA 4KTRA 3KSQB 5FO8B 1V5DA 1FAEA 1N4SB 1F9GA 2RI8A 1I8QA 3W7TA 3WC3A 3W5NA 1HXAA 2V8IA 1TN8B 1H3CA 5JPMB 1X81B 3HXFB 4ONTA 3N0FA 4QT9A 1RWCA 3W7UA 4GTPB 1N4QB 3SDUA 1RWHA 1FBWA 3VSNA 1WU4A 2B39A 4KTPA 1CB8A 2DRQA 2EAEA 2WINB 1O6HA 1QBQB 1TNZB 1XWQA 2WCOA 3M00A 3NFVA 2J5CA 1N20A 5CZLA 1GXOA 2I07B 1JCRB 1JCSB 2BRVX 1SQCA 5CD2A 3E37B 3X17A 3D3IA 5EATA 5CA3A 3M01A 4GTQB 1AGMA 1KSCA 5IKHA 1EGUA 4CE7A 1O1RB 3QFYA 1N1ZA 1O5MB 2Z07A 4WVBA 1V7WA 5FO9B 4AYPA 1QSJA 4CJ0A 3EUVB 2WY8A 1LXMA 3HXEB 1FCEA 3WKFA 1UMPA 4BOJA 4Q2BA 1HCUA 3E7JA 4L6XA 3W5MA 3N0GA 3G6JB 3RX7A 2G0DA 3ACSA 3M74A 2SQCA 1OJPA 1TNBB 3H7LA 4V1SA 1JS4A 1H54A 2X03A 1L1YA 3M7BA 4EL8A 1O6QA 4YCRA 1LD7B 3K11A 1KS8A 4AYOA 1D8DB 1LF9A 1NL4B 1F9OA 3P5RA 1HXGA 1O79A 3RENA 2H6FB 2ONGA 2V8KA 3Q7FB 2QNOA 5JPNB 1G6IA 1C3DA 1O6RA 1G9JA 4GAXA 2V8JA 4NEIA 4E1YA 3A3VA 1FPPB 1HZFA 4GTVB 4YDOB 1NC5A 4ZRQA 3S4BA 5GY3A 2E24A 1NI1B 3W7WA 5ILZA 2FUQA 3E73A 4KKJA 4GTRB 1FMIA 1N22A 1V7VA 1S64B 3QDEA 1N7QA 2NOJA 4V1RA 1GAHA 2EACA 5EASA 3SFYB 3M7EA 1L2AA 3DSWB 1N7NA 5ILKA 1G87A 3M75A 3PYAA 1HM2A 5C05A 1XW2A 1OJOA 2XWJB 1FP3A 3HXCB 1H36A 2GZ6A 4WU0A 3QRYA 1DL2A 3AFJA 4Z4JA 4MU9A 2FUZA 1LF6A 3D5RA 1RWFA 1H13A 2ONHA 5EAUA 3AFLA 1TNYB 4JJJA 4ZH5A 1O1TB 3GZKA 5IL3A 4FJQA 2ZZRA 1H3AA 5IK6A 4MBGB 2A8ZA 3DSVB 3H3KA 5M7YA 1FBOA 3E30B 3QXQA 3SDRA 3TF4A 3E34B 3Q75B 2JJBA 3H2WA 3ANIA 1GA2A 1H12A 3S4CA 4BOKA 3LZ9A 4TF4A 4AYQA 1V7XA 3KLSA 1HXCA 1WU6A 2G02A 2F6DA 2ZISB 5DHKA 4DOEA 3OEDA 1NXCA 3VW5A 2FUTA 3HXDB 4D4CA 2FV1A 3WIQA 3WKIA 1KFGA 2CQSA 3E80A 4FUSA 1TNUB 3Q78B 1AYXA 1N94B 1N7OA 1J0MA 2E22A 3PZ1B 2RGKA 2AHFA 3SDVA 1C82A 2ZBLA 1H39A 1N7RA 5DGRA 2NVPA 3GT5A 2GOXA 1LXKA 4C1SA 3SQCA 1X1HA 2DROA 1OJMA 2V3NA 3Q73B 2VN4A 2XWBB 2GH4A 1KWFA 3QWTA 1GSZA 3EQAA 1TNOB 1WU5A 2JG0A 1FT1B 3QSPA 2D8LA 3SDQA 1H37A 2B4FA 1ULVA 5ILJA 3S9VA 1N95B 3VSMA 1RQ5A 1J0NA 1JCQB 4F13A 3KQ4A 5FO7B 3WKGA 3EZ8A 4WVCA 4GTOB 1TF4A 5IL8A 1X1IA 5ILIA 2A73B 4GTMB 3K7XA 5FOBB 1F1SA 2XFGA 1TN7B 3QXFA 2WIIB 3DRAB 1KZOB 1HN0A 1HM3A 1TN6B 2R2LB 5M7IA 5DHIA 3Q79B 3Q7AB 2IEJB 1KZPB 3PZ2B 4GTSB 2BRWA 4LNBB 3DSTB 3M73A 1FO3A 1O1SB 3PZ4B 4FXKB 1DOGA 4LNGB 5DGQA 5IK9A 5JMDA 3ACTA 4ZG8A 3W7SA 5KKBA 2BEDB 1IA7A 1UG9A 4DODA 3M78A 3HXBB 3D5SA 1GAIA 5ILDA 1S63B 2WYNA 4J5TA 5IKAA 1D8EB 1CLCA 1LD8B 2PMVA 4LNVA 5GW7A 4YDEB 2DRRA 4FNVA 2AFAA 1RWGA 1W6KA 3C72B 5JMFA 1WZZA 3EU8A 3M72A 3QT3A 4RNQA 1R76A 1H14A 4OK4A 4DI5A 5AGDA 3T33A 4Q88A 4Z4LA 4KKIA 1HMWA 3CU7A 3RX8A 1RW9A 2BB5A 1GXMA 3WIWA 1OJNA 2P0VA 1LOHA 3KSLB 3WUXA 1X1JA 4ZRPA 3DSUB 4GL3A 1FO2A 4OK2A 4D94A 5MEHA 3QG0A 2BB6A 4FXGB 1N21A 5IM1A 1GXNA 1VD5A 4XUVA 4ZH1A 3DSXB 3M7LA 1IS9A 2H6HB 1QAZA 4MMIA 3RJ3A 1XWTA 3NNBA 2WDAA 4L0GA 4L9PB 1H3BA 2XQWA 1KREA 1FT2B 1N9AB 3M76A 1CEMA 2PN5A
chains in the Genus database with same CATH topology
1DCEB 1H35A 3M71A 3QFZA 1N4PB 3ANJA 3GLYA 3WKHA 3WIRA 1KRFA 1LTXB 1W6JA 2D5JA 2DRSA 2RI9A 3PYBA 2YIKA 3CIHA 2WY7A 3QPFA 3E33B 2VN7A 1KKTA 4M76A 1F9DA 1K72A 2EABA 3SDTA 3P2CA 1V5CA 4D4AA 3S4DA 4AYRA 4CJ1A 4EHMB 5GZKA 2BBCA 3ON6A 1IA6A 3E32B 3SFXB 1SA5B 4D4DA 4WVAA 3W7XA 2H6GB 2OKXA 3EU5B 2H6IB 1QQFA 1UT9A 1MZCB 3QT9A 2FV0A 2V3PA 4LIXA 3P5PA 3VXDA 4GTTB 3RRSA 2JF4A 3DPYB 3M77A 3RX5A 3SAEA 3S4AA 4TXTA 2AHGA 1X9DA 5E2JA 3M7CA 2F0YB 3PZ3B 3RSYA 1G9GA 1SA4B 1GLMA 1N4RB 2CQTA 3DSSB 2EADA 3E6UA 2ZIRB 3OXUA 4D4BA 3ANKA 2FBAA 1GHQA 3PMMA 1KSDA 4KTRA 3KSQB 5FO8B 1V5DA 1FAEA 1N4SB 2RI8A 3W5NA 3W7TA 3WC3A 2V8IA 1TN8B 1H3CA 5JPMB 1X81B 3HXFB 4ONTA 4QT9A 3W7UA 4GTPB 1N4QB 3SDUA 1FBWA 1WU4A 2B39A 4KTPA 2DRQA 2EAEA 2WINB 1O6HA 1QBQB 1TNZB 1XWQA 5CZLA 1GXOA 2I07B 1JCRB 1JCSB 1SQCA 5CD2A 3E37B 3X17A 3D3IA 5CA3A 4GTQB 1AGMA 1KSCA 4CE7A 1O1RB 3QFYA 1O5MB 2Z07A 4WVBA 1V7WA 5FO9B 4AYPA 1QSJA 4CJ0A 3EUVB 2WY8A 3HXEB 1FCEA 3WKFA 1UMPA 4BOJA 4Q2BA 1HCUA 4L6XA 3W5MA 3G6JB 3RX7A 2G0DA 3ACSA 3M74A 2SQCA 1TNBB 3H7LA 4V1SA 1JS4A 1H54A 1L1YA 3M7BA 4EL8A 1O6QA 4YCRA 1LD7B 3K11A 1KS8A 4AYOA 1D8DB 1LF9A 1NL4B 1F9OA 3P5RA 1O79A 3RENA 2H6FB 3Q7FB 2V8KA 2QNOA 5JPNB 1G6IA 1C3DA 1O6RA 1G9JA 2V8JA 3A3VA 1FPPB 1HZFA 4GTVB 4YDOB 1NC5A 4ZRQA 3S4BA 5GY3A 1NI1B 3W7WA 3E73A 4KKJA 4GTRB 1FMIA 1V7VA 1S64B 3QDEA 2NOJA 4V1RA 1GAHA 2EACA 3SFYB 3M7EA 1L2AA 3DSWB 3PYAA 3M75A 1G87A 1XW2A 2XWJB 1FP3A 3HXCB 1H36A 2GZ6A 4WU0A 3QRYA 1DL2A 3AFJA 4Z4JA 4MU9A 2FUZA 1LF6A 3D5RA 1H13A 4JJJA 1TNYB 4ZH5A 1O1TB 3GZKA 2ZZRA 1H3AA 4MBGB 2A8ZA 3DSVB 3H3KA 5M7YA 1FBOA 3E30B 3QXQA 3SDRA 3TF4A 3E34B 3Q75B 2JJBA 3H2WA 3ANIA 1GA2A 1H12A 3S4CA 4BOKA 4TF4A 4AYQA 1V7XA 3KLSA 1WU6A 2G02A 2F6DA 2ZISB 4DOEA 3OEDA 1NXCA 3VW5A 3HXDB 4D4CA 2FV1A 3WIQA 3WKIA 1KFGA 2CQSA 4FUSA 1TNUB 3Q78B 1AYXA 1N94B 3PZ1B 2RGKA 2AHFA 3SDVA 2ZBLA 1H39A 5DGRA 2NVPA 3GT5A 2GOXA 4C1SA 3SQCA 2DROA 2V3NA 3Q73B 2VN4A 2XWBB 2GH4A 1KWFA 3QWTA 1GSZA 3EQAA 1TNOB 1WU5A 2JG0A 1FT1B 3QSPA 2D8LA 3SDQA 1H37A 2B4FA 1ULVA 3S9VA 1N95B 1RQ5A 1JCQB 3KQ4A 5FO7B 3WKGA 3EZ8A 4WVCA 4GTOB 1TF4A 2A73B 4GTMB 3K7XA 5FOBB 2XFGA 1TN7B 3QXFA 2WIIB 3DRAB 1KZOB 1TN6B 2R2LB 5M7IA 3Q79B 3Q7AB 2IEJB 1KZPB 3PZ2B 4GTSB 4LNBB 3DSTB 3M73A 1FO3A 1O1SB 3PZ4B 4FXKB 1DOGA 4LNGB 5DGQA 3ACTA 4ZG8A 3W7SA 5KKBA 2BEDB 1IA7A 1UG9A 4DODA 3M78A 3HXBB 3D5SA 1GAIA 1S63B 2WYNA 4J5TA 1D8EB 1CLCA 1LD8B 2PMVA 4LNVA 5GW7A 4YDEB 2DRRA 2AFAA 1W6KA 3C72B 1WZZA 3EU8A 3M72A 3QT3A 1R76A 1H14A 5AGDA 3T33A 4Q88A 4Z4LA 4KKIA 3CU7A 3RX8A 2BB5A 1GXMA 3WIWA 2P0VA 3KSLB 3WUXA 4ZRPA 3DSUB 4GL3A 1FO2A 4D94A 5MEHA 3QG0A 2BB6A 4FXGB 1GXNA 1VD5A 4XUVA 4ZH1A 3DSXB 3M7LA 1IS9A 2H6HB 3RJ3A 1XWTA 4L9PB 4L0GA 1H3BA 2XQWA 1KREA 1FT2B 1N9AB 3M76A 1CEMA 2PN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M7I A;  1XW2 A;  3W7U A;  1FP3 A;  3ANJ A;  3GLY A;  3QFZ A;  3WKH A;  2GZ6 A;  4WU0 A;  3WIR A;  3QRY A;  1FBW A;  1DL2 A;  3AFJ A;  1WU4 A;  4Z4J A;  1FO3 A;  1KRF A;  4KTP A;  2DRQ A;  2D5J A;  2DRS A;  2EAE A;  2FUZ A;  2RI9 A;  1LF6 A;  1XWQ A;  1DOG A;  1H13 A;  2YIK A;  3CIH A;  5DGQ A;  5CZL A;  3QPF A;  4JJJ A;  3ACT A;  4ZH5 A;  4ZG8 A;  3W7S A;  3GZK A;  5KKB A;  2VN7 A;  1KKT A;  5CD2 A;  2ZZR A;  1F9D A;  1K72 A;  2EAB A;  3X17 A;  1IA7 A;  1UG9 A;  2A8Z A;  3D3I A;  3H3K A;  3P2C A;  5M7Y A;  4DOD A;  5CA3 A;  1FBO A;  1V5C A;  1AGM A;  3QXQ A;  1KSC A;  4CE7 A;  3TF4 A;  1GAI A;  3QFY A;  3S4D A;  4AYR A;  2WYN A;  2Z07 A;  4CJ1 A;  4J5T A;  2JJB A;  3H2W A;  3ANI A;  4WVB A;  1CLC A;  1V7W A;  3ON6 A;  1IA6 A;  1GA2 A;  1H12 A;  3S4C A;  4TF4 A;  4AYQ A;  1V7X A;  4WVA A;  5GW7 A;  4AYP A;  1WU6 A;  3W7X A;  2F6D A;  2DRR A;  2OKX A;  2AFA A;  4CJ0 A;  4DOE A;  1WZZ A;  1UT9 A;  1FCE A;  3WKF A;  1NXC A;  3VW5 A;  4Q2B A;  3QT3 A;  3QT9 A;  2FV1 A;  2FV0 A;  1H14 A;  3VXD A;  3WIQ A;  3WKI A;  1HCU A;  1KFG A;  2CQS A;  4L6X A;  3W5M A;  4FUS A;  2JF4 A;  3RRS A;  3T33 A;  3RX7 A;  1AYX A;  4Q88 A;  3ACS A;  4Z4L A;  3RX5 A;  2RGK A;  2AHF A;  3S4A A;  3RX8 A;  4TXT A;  2AHG A;  2ZBL A;  3WIW A;  3H7L A;  2P0V A;  1X9D A;  1JS4 A;  1H54 A;  5DGR A;  2NVP A;  1L1Y A;  3GT5 A;  4EL8 A;  5E2J A;  2DRO A;  3K11 A;  4AYO A;  1KS8 A;  3WUX A;  3RSY A;  1LF9 A;  2VN4 A;  1G9G A;  1F9O A;  3QWT A;  2GH4 A;  1KWF A;  3REN A;  1GLM A;  3EQA A;  2CQT A;  1FO2 A;  1WU5 A;  2EAD A;  2JG0 A;  2QNO A;  3QSP A;  2D8L A;  2B4F A;  1ULV A;  1G6I A;  3E6U A;  5MEH A;  3QG0 A;  1G9J A;  3ANK A;  1RQ5 A;  3A3V A;  2FBA A;  1NC5 A;  3S4B A;  5GY3 A;  3PMM A;  3WKG A;  3W7W A;  3EZ8 A;  1KSD A;  1VD5 A;  3E73 A;  4WVC A;  4KTR A;  1FMI A;  4XUV A;  1V7V A;  1IS9 A;  1TF4 A;  3QDE A;  1V5D A;  1FAE A;  2RI8 A;  3W5N A;  3W7T A;  3WC3 A;  1XWT A;  4L0G A;  1GAH A;  2XFG A;  2EAC A;  1L2A A;  3QXF A;  1KRE A;  1G87 A;  1CEM A; 
#chains in the Genus database with same CATH topology
 1DCE B;  1H35 A;  1N7P A;  1N23 A;  1HMU A;  3M71 A;  1N4P B;  3ANJ A;  3GLY A;  3QFZ A;  3WKH A;  4OZV A;  4MMH A;  3WIR A;  1KRF A;  1LTX B;  1W6J A;  2D5J A;  2DRS A;  3A0O A;  2RI9 A;  3PYB A;  2YIK A;  3CIH A;  2WY7 A;  3QPF A;  3E33 B;  2VN7 A;  1KKT A;  4M76 A;  1F9D A;  1K72 A;  2EAB A;  3SDT A;  3P2C A;  1V5C A;  1N1B A;  4D4A A;  3M02 A;  3S4D A;  4AYR A;  1HV6 A;  4CJ1 A;  4EHM B;  5GZK A;  2BBC A;  3ON6 A;  1IA6 A;  3E32 B;  3SFX B;  1SA5 B;  4D4D A;  4WVA A;  3W7X A;  2H6G B;  2OKX A;  3EU5 B;  2BRP A;  5ILH A;  2H6I B;  4OJZ A;  1QQF A;  1UT9 A;  1MZC B;  3QT9 A;  2FV0 A;  2V3P A;  4LIX A;  3P5P A;  3VXD A;  4GTT B;  1W3Y A;  1N24 A;  5IK0 A;  3RRS A;  2JF4 A;  3DPY B;  3M77 A;  4F10 A;  3RX5 A;  3SAE A;  3S4A A;  4TXT A;  2AHG A;  1X9D A;  5E2J A;  3M7C A;  3G4D A;  2F0Y B;  3PZ3 B;  3RSY A;  4OZW A;  1G9G A;  1SA4 B;  1GLM A;  1N4R B;  2CQT A;  3DSS B;  2EAD A;  1HX9 A;  3G4F A;  5ILY A;  3E6U A;  2ZIR B;  3OXU A;  4D4B A;  3ANK A;  2FBA A;  1GHQ A;  3PMM A;  2Q1F A;  1KSD A;  1RWA A;  4KTR A;  3KSQ B;  5FO8 B;  1V5D A;  1FAE A;  1N4S B;  1F9G A;  2RI8 A;  1I8Q A;  3W7T A;  3WC3 A;  3W5N A;  1HXA A;  2V8I A;  1TN8 B;  1H3C A;  5JPM B;  1X81 B;  3HXF B;  4ONT A;  3N0F A;  4QT9 A;  1RWC A;  3W7U A;  4GTP B;  1N4Q B;  3SDU A;  1RWH A;  1FBW A;  3VSN A;  1WU4 A;  2B39 A;  4KTP A;  1CB8 A;  2DRQ A;  2EAE A;  2WIN B;  1O6H A;  1QBQ B;  1TNZ B;  1XWQ A;  2WCO A;  3M00 A;  3NFV A;  2J5C A;  1N20 A;  5CZL A;  1GXO A;  2I07 B;  1JCR B;  1JCS B;  2BRV X;  1SQC A;  5CD2 A;  3E37 B;  3X17 A;  3D3I A;  5EAT A;  5CA3 A;  3M01 A;  4GTQ B;  1AGM A;  1KSC A;  5IKH A;  1EGU A;  4CE7 A;  1O1R B;  3QFY A;  1N1Z A;  1O5M B;  2Z07 A;  4WVB A;  1V7W A;  5FO9 B;  4AYP A;  1QSJ A;  4CJ0 A;  3EUV B;  2WY8 A;  1LXM A;  3HXE B;  1FCE A;  3WKF A;  1UMP A;  4BOJ A;  4Q2B A;  1HCU A;  3E7J A;  4L6X A;  3W5M A;  3N0G A;  3G6J B;  3RX7 A;  2G0D A;  3ACS A;  3M74 A;  2SQC A;  1OJP A;  1TNB B;  3H7L A;  4V1S A;  1JS4 A;  1H54 A;  2X03 A;  1L1Y A;  3M7B A;  4EL8 A;  1O6Q A;  4YCR A;  1LD7 B;  3K11 A;  1KS8 A;  4AYO A;  1D8D B;  1LF9 A;  1NL4 B;  1F9O A;  3P5R A;  1HXG A;  1O79 A;  3REN A;  2H6F B;  2ONG A;  2V8K A;  3Q7F B;  2QNO A;  5JPN B;  1G6I A;  1C3D A;  1O6R A;  1G9J A;  4GAX A;  2V8J A;  4NEI A;  4E1Y A;  3A3V A;  1FPP B;  1HZF A;  4GTV B;  4YDO B;  1NC5 A;  4ZRQ A;  3S4B A;  5GY3 A;  2E24 A;  1NI1 B;  3W7W A;  5ILZ A;  2FUQ A;  3E73 A;  4KKJ A;  4GTR B;  1FMI A;  1N22 A;  1V7V A;  1S64 B;  3QDE A;  1N7Q A;  2NOJ A;  4V1R A;  1GAH A;  2EAC A;  5EAS A;  3SFY B;  3M7E A;  1L2A A;  3DSW B;  1N7N A;  5ILK A;  1G87 A;  3M75 A;  3PYA A;  1HM2 A;  5C05 A;  1XW2 A;  1OJO A;  2XWJ B;  1FP3 A;  3HXC B;  1H36 A;  2GZ6 A;  4WU0 A;  3QRY A;  1DL2 A;  3AFJ A;  4Z4J A;  4MU9 A;  2FUZ A;  1LF6 A;  3D5R A;  1RWF A;  1H13 A;  2ONH A;  5EAU A;  3AFL A;  1TNY B;  4JJJ A;  4ZH5 A;  1O1T B;  3GZK A;  5IL3 A;  4FJQ A;  2ZZR A;  1H3A A;  5IK6 A;  4MBG B;  2A8Z A;  3DSV B;  3H3K A;  5M7Y A;  1FBO A;  3E30 B;  3QXQ A;  3SDR A;  3TF4 A;  3E34 B;  3Q75 B;  2JJB A;  3H2W A;  3ANI A;  1GA2 A;  1H12 A;  3S4C A;  4BOK A;  3LZ9 A;  4TF4 A;  4AYQ A;  1V7X A;  3KLS A;  1HXC A;  1WU6 A;  2G02 A;  2F6D A;  2ZIS B;  5DHK A;  4DOE A;  3OED A;  1NXC A;  3VW5 A;  2FUT A;  3HXD B;  4D4C A;  2FV1 A;  3WIQ A;  3WKI A;  1KFG A;  2CQS A;  3E80 A;  4FUS A;  1TNU B;  3Q78 B;  1AYX A;  1N94 B;  1N7O A;  1J0M A;  2E22 A;  3PZ1 B;  2RGK A;  2AHF A;  3SDV A;  1C82 A;  2ZBL A;  1H39 A;  1N7R A;  5DGR A;  2NVP A;  3GT5 A;  2GOX A;  1LXK A;  4C1S A;  3SQC A;  1X1H A;  2DRO A;  1OJM A;  2V3N A;  3Q73 B;  2VN4 A;  2XWB B;  2GH4 A;  1KWF A;  3QWT A;  1GSZ A;  3EQA A;  1TNO B;  1WU5 A;  2JG0 A;  1FT1 B;  3QSP A;  2D8L A;  3SDQ A;  1H37 A;  2B4F A;  1ULV A;  5ILJ A;  3S9V A;  1N95 B;  3VSM A;  1RQ5 A;  1J0N A;  1JCQ B;  4F13 A;  3KQ4 A;  5FO7 B;  3WKG A;  3EZ8 A;  4WVC A;  4GTO B;  1TF4 A;  5IL8 A;  1X1I A;  5ILI A;  2A73 B;  4GTM B;  3K7X A;  5FOB B;  1F1S A;  2XFG A;  1TN7 B;  3QXF A;  2WII B;  3DRA B;  1KZO B;  1HN0 A;  1HM3 A;  1TN6 B;  2R2L B;  5M7I A;  5DHI A;  3Q79 B;  3Q7A B;  2IEJ B;  1KZP B;  3PZ2 B;  4GTS B;  2BRW A;  4LNB B;  3DST B;  3M73 A;  1FO3 A;  1O1S B;  3PZ4 B;  4FXK B;  1DOG A;  4LNG B;  5DGQ A;  5IK9 A;  5JMD A;  3ACT A;  4ZG8 A;  3W7S A;  5KKB A;  2BED B;  1IA7 A;  1UG9 A;  4DOD A;  3M78 A;  3HXB B;  3D5S A;  1GAI A;  5ILD A;  1S63 B;  2WYN A;  4J5T A;  5IKA A;  1D8E B;  1CLC A;  1LD8 B;  2PMV A;  4LNV A;  5GW7 A;  4YDE B;  2DRR A;  4FNV A;  2AFA A;  1RWG A;  1W6K A;  3C72 B;  5JMF A;  1WZZ A;  3EU8 A;  3M72 A;  3QT3 A;  4RNQ A;  1R76 A;  1H14 A;  4OK4 A;  4DI5 A;  5AGD A;  3T33 A;  4Q88 A;  4Z4L A;  4KKI A;  1HMW A;  3CU7 A;  3RX8 A;  1RW9 A;  2BB5 A;  1GXM A;  3WIW A;  1OJN A;  2P0V A;  1LOH A;  3KSL B;  3WUX A;  1X1J A;  4ZRP A;  3DSU B;  4GL3 A;  1FO2 A;  4OK2 A;  4D94 A;  5MEH A;  3QG0 A;  2BB6 A;  4FXG B;  1N21 A;  5IM1 A;  1GXN A;  1VD5 A;  4XUV A;  4ZH1 A;  3DSX B;  3M7L A;  1IS9 A;  2H6H B;  1QAZ A;  4MMI A;  3RJ3 A;  1XWT A;  3NNB A;  2WDA A;  4L0G A;  4L9P B;  1H3B A;  2XQW A;  1KRE A;  1FT2 B;  1N9A B;  3M76 A;  1CEM A;  2PN5 A; 
#chains in the Genus database with same CATH homology
 1DCE B;  1H35 A;  3M71 A;  3QFZ A;  1N4P B;  3ANJ A;  3GLY A;  3WKH A;  3WIR A;  1KRF A;  1LTX B;  1W6J A;  2D5J A;  2DRS A;  2RI9 A;  3PYB A;  2YIK A;  3CIH A;  2WY7 A;  3QPF A;  3E33 B;  2VN7 A;  1KKT A;  4M76 A;  1F9D A;  1K72 A;  2EAB A;  3SDT A;  3P2C A;  1V5C A;  4D4A A;  3S4D A;  4AYR A;  4CJ1 A;  4EHM B;  5GZK A;  2BBC A;  3ON6 A;  1IA6 A;  3E32 B;  3SFX B;  1SA5 B;  4D4D A;  4WVA A;  3W7X A;  2H6G B;  2OKX A;  3EU5 B;  2H6I B;  1QQF A;  1UT9 A;  1MZC B;  3QT9 A;  2FV0 A;  2V3P A;  4LIX A;  3P5P A;  3VXD A;  4GTT B;  3RRS A;  2JF4 A;  3DPY B;  3M77 A;  3RX5 A;  3SAE A;  3S4A A;  4TXT A;  2AHG A;  1X9D A;  5E2J A;  3M7C A;  2F0Y B;  3PZ3 B;  3RSY A;  1G9G A;  1SA4 B;  1GLM A;  1N4R B;  2CQT A;  3DSS B;  2EAD A;  3E6U A;  2ZIR B;  3OXU A;  4D4B A;  3ANK A;  2FBA A;  1GHQ A;  3PMM A;  1KSD A;  4KTR A;  3KSQ B;  5FO8 B;  1V5D A;  1FAE A;  1N4S B;  2RI8 A;  3W5N A;  3W7T A;  3WC3 A;  2V8I A;  1TN8 B;  1H3C A;  5JPM B;  1X81 B;  3HXF B;  4ONT A;  4QT9 A;  3W7U A;  4GTP B;  1N4Q B;  3SDU A;  1FBW A;  1WU4 A;  2B39 A;  4KTP A;  2DRQ A;  2EAE A;  2WIN B;  1O6H A;  1QBQ B;  1TNZ B;  1XWQ A;  5CZL A;  1GXO A;  2I07 B;  1JCR B;  1JCS B;  1SQC A;  5CD2 A;  3E37 B;  3X17 A;  3D3I A;  5CA3 A;  4GTQ B;  1AGM A;  1KSC A;  4CE7 A;  1O1R B;  3QFY A;  1O5M B;  2Z07 A;  4WVB A;  1V7W A;  5FO9 B;  4AYP A;  1QSJ A;  4CJ0 A;  3EUV B;  2WY8 A;  3HXE B;  1FCE A;  3WKF A;  1UMP A;  4BOJ A;  4Q2B A;  1HCU A;  4L6X A;  3W5M A;  3G6J B;  3RX7 A;  2G0D A;  3ACS A;  3M74 A;  2SQC A;  1TNB B;  3H7L A;  4V1S A;  1JS4 A;  1H54 A;  1L1Y A;  3M7B A;  4EL8 A;  1O6Q A;  4YCR A;  1LD7 B;  3K11 A;  1KS8 A;  4AYO A;  1D8D B;  1LF9 A;  1NL4 B;  1F9O A;  3P5R A;  1O79 A;  3REN A;  2H6F B;  3Q7F B;  2V8K A;  2QNO A;  5JPN B;  1G6I A;  1C3D A;  1O6R A;  1G9J A;  2V8J A;  3A3V A;  1FPP B;  1HZF A;  4GTV B;  4YDO B;  1NC5 A;  4ZRQ A;  3S4B A;  5GY3 A;  1NI1 B;  3W7W A;  3E73 A;  4KKJ A;  4GTR B;  1FMI A;  1V7V A;  1S64 B;  3QDE A;  2NOJ A;  4V1R A;  1GAH A;  2EAC A;  3SFY B;  3M7E A;  1L2A A;  3DSW B;  3PYA A;  3M75 A;  1G87 A;  1XW2 A;  2XWJ B;  1FP3 A;  3HXC B;  1H36 A;  2GZ6 A;  4WU0 A;  3QRY A;  1DL2 A;  3AFJ A;  4Z4J A;  4MU9 A;  2FUZ A;  1LF6 A;  3D5R A;  1H13 A;  4JJJ A;  1TNY B;  4ZH5 A;  1O1T B;  3GZK A;  2ZZR A;  1H3A A;  4MBG B;  2A8Z A;  3DSV B;  3H3K A;  5M7Y A;  1FBO A;  3E30 B;  3QXQ A;  3SDR A;  3TF4 A;  3E34 B;  3Q75 B;  2JJB A;  3H2W A;  3ANI A;  1GA2 A;  1H12 A;  3S4C A;  4BOK A;  4TF4 A;  4AYQ A;  1V7X A;  3KLS A;  1WU6 A;  2G02 A;  2F6D A;  2ZIS B;  4DOE A;  3OED A;  1NXC A;  3VW5 A;  3HXD B;  4D4C A;  2FV1 A;  3WIQ A;  3WKI A;  1KFG A;  2CQS A;  4FUS A;  1TNU B;  3Q78 B;  1AYX A;  1N94 B;  3PZ1 B;  2RGK A;  2AHF A;  3SDV A;  2ZBL A;  1H39 A;  5DGR A;  2NVP A;  3GT5 A;  2GOX A;  4C1S A;  3SQC A;  2DRO A;  2V3N A;  3Q73 B;  2VN4 A;  2XWB B;  2GH4 A;  1KWF A;  3QWT A;  1GSZ A;  3EQA A;  1TNO B;  1WU5 A;  2JG0 A;  1FT1 B;  3QSP A;  2D8L A;  3SDQ A;  1H37 A;  2B4F A;  1ULV A;  3S9V A;  1N95 B;  1RQ5 A;  1JCQ B;  3KQ4 A;  5FO7 B;  3WKG A;  3EZ8 A;  4WVC A;  4GTO B;  1TF4 A;  2A73 B;  4GTM B;  3K7X A;  5FOB B;  2XFG A;  1TN7 B;  3QXF A;  2WII B;  3DRA B;  1KZO B;  1TN6 B;  2R2L B;  5M7I A;  3Q79 B;  3Q7A B;  2IEJ B;  1KZP B;  3PZ2 B;  4GTS B;  4LNB B;  3DST B;  3M73 A;  1FO3 A;  1O1S B;  3PZ4 B;  4FXK B;  1DOG A;  4LNG B;  5DGQ A;  3ACT A;  4ZG8 A;  3W7S A;  5KKB A;  2BED B;  1IA7 A;  1UG9 A;  4DOD A;  3M78 A;  3HXB B;  3D5S A;  1GAI A;  1S63 B;  2WYN A;  4J5T A;  1D8E B;  1CLC A;  1LD8 B;  2PMV A;  4LNV A;  5GW7 A;  4YDE B;  2DRR A;  2AFA A;  1W6K A;  3C72 B;  1WZZ A;  3EU8 A;  3M72 A;  3QT3 A;  1R76 A;  1H14 A;  5AGD A;  3T33 A;  4Q88 A;  4Z4L A;  4KKI A;  3CU7 A;  3RX8 A;  2BB5 A;  1GXM A;  3WIW A;  2P0V A;  3KSL B;  3WUX A;  4ZRP A;  3DSU B;  4GL3 A;  1FO2 A;  4D94 A;  5MEH A;  3QG0 A;  2BB6 A;  4FXG B;  1GXN A;  1VD5 A;  4XUV A;  4ZH1 A;  3DSX B;  3M7L A;  1IS9 A;  2H6H B;  3RJ3 A;  1XWT A;  4L9P B;  4L0G A;  1H3B A;  2XQW A;  1KRE A;  1FT2 B;  1N9A B;  3M76 A;  1CEM A;  2PN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...