5M7IA

Crystal structure of gh125 1,6-alpha-mannosidase mutant from clostridium perfringens in complex with 1,6-alpha-mannobiose
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
425
structure length
425
Chain Sequence
SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSNDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords exo-alpha-1,6-mannosidase
publication title Computational Design of Experiment Unveils the Conformational Reaction Coordinate of GH125 alpha-Mannosidases.
pubmed doi rcsb
source organism Clostridium perfringens (strain 13 / type a)
total genus 161
structure length 425
sequence length 425
ec nomenclature
pdb deposition date 2016-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5m7iA01
3QXQA 3E6UA 3H3KA 2P0VA 3QT9A 3W7TA 1V7VA 3T33A 3QXFA 3RX7A 4AYOA 3RX5A 3W7XA 3H2WA 3QT3A 4TF4A 2DRQA 1TF4A 3WKGA 1DL2A 5GY3A 4ZG8A 2D5JA 3W7SA 1FO2A 1GAIA 2EADA 3ANJA 2EAEA 1FCEA 4J5TA 1H13A 3GZKA 1KFGA 4AYQA 4DOEA 2GZ6A 3ANIA 1FO3A 5DGRA 4CE7A 2AFAA 1RQ5A 1FBOA 2RGKA 3QWTA 3S4BA 1WU6A 1NC5A 3E73A 2WYNA 1UG9A 4WVBA 1KSCA 5GW7A 5E2JA 4Q88A 5CD2A 1DOGA 2YIKA 1KRFA 3GLYA 1VD5A 1FAEA 2DROA 4EL8A 4FUSA 2DRSA 3ACTA 1KKTA 2AHGA 2FV1A 2JJBA 1JS4A 1V7XA 1AGMA 2A8ZA 2ZBLA 2ZZRA 3WIRA 3S4DA 3WC3A 1WZZA 1FP3A 1X9DA 1KS8A 2RI8A 3VW5A 1FBWA 2EABA 3WKIA 3W7UA 1IA7A 1KSDA 1XWTA 5CA3A 1IA6A 1LF9A 3QDEA 3PMMA 1KREA 3W5MA 3QFYA 2DRRA 1NXCA 3WUXA 1KWFA 1FMIA 1IS9A 3QRYA 1G6IA 1AYXA 3D3IA 3TF4A 3ACSA 1G87A 3VXDA 3ON6A 1UT9A 3AFJA 4KTRA 2VN7A 3WIQA 1LF6A 3A3VA 4AYRA 2CQSA 3RSYA 3P2CA 1V5CA 2RI9A 2FV0A 3WKFA 3WIWA 1L2AA 1K72A 5CZLA 2GH4A 3EZ8A 1XWQA 4WVCA 2CQTA 2JF4A 2AHFA 2OKXA 4JJJA 3RX8A 1XW2A 3GT5A 2XFGA 4L6XA 3QPFA 2Z07A 1H12A 2D8LA 1G9GA 4WU0A 1L1YA 5MEHA 3RENA 2F6DA 3S4AA 2FUZA 1H54A 4Z4LA 1F9DA 1GAHA 3RRSA 1GA2A 4XUVA 4DODA 5KKBA 1WU4A 4KTPA 1V7WA 4Q2BA 5M7IA 3K11A 4L0GA 3QSPA 4TXTA 3EQAA 2B4FA 4Z4JA 1V5DA 3QFZA 1F9OA 2VN4A 1WU5A 4WVAA 1HCUA 2JG0A 2QNOA 3ANKA 1ULVA 4ZH5A 2NVPA 3WKHA 5M7YA 3W5NA 4AYPA 1GLMA 1CEMA 3S4CA 5DGQA 4CJ0A 2EACA 1G9JA 3QG0A 4CJ1A 1H14A 3CIHA 3H7LA 1CLCA 3X17A 2FBAA 3W7WA
chains in the Genus database with same CATH superfamily
3H3KA 1HMWA 3RX5A 3M7BA 4TF4A 4OK2A 3E30B 2EADA 1FPPB 4J5TA 1SQCA 1O5MB 1H13A 1KZPB 3ANIA 1FO3A 1WU6A 5ILKA 1NC5A 4D4DA 3DPYB 3E73A 5IKHA 3KLSA 4KKIA 4FXGB 3DSTB 4GTOB 3G4FA 5ILHA 1LD8B 1X1IA 2B39A 1RW9A 3GLYA 4GL3A 2V8IA 1JCQB 4FUSA 1FT2B 5FO7B 3PZ1B 1KKTA 3E33B 4MU9A 2A8ZA 2ZBLA 3RJ3A 1WZZA 1X9DA 4MBGB 2EABA 2BRPA 4QT9A 1XWTA 1HXCA 4GTTB 3QDEA 1NL4B 4D4AA 3DSSB 1NXCA 3WUXA 1TN6B 3D3IA 1N1BA 3VXDA 1HXAA 5IM1A 1UT9A 1GXMA 2VN7A 4LNVA 3D5SA 2WINB 2WDAA 4AYRA 2CQSA 1N7RA 1D8DB 1V5CA 3OXUA 1QSJA 3WKFA 5ILZA 2GH4A 3EZ8A 1N4RB 1X1HA 1W6KA 2FUQA 1XW2A 2XFGA 2Z07A 1H12A 1N23A 4WU0A 1N7PA 5IL8A 3OEDA 4GTRB 1O1SB 3S4AA 3SDQA 5ILYA 4D4CA 3M02A 3G4DA 1SA4B 4KTPA 3QSPA 4TXTA 3EQAA 1F9OA 2VN4A 1WU5A 1ULVA 3W5NA 1QBQB 3M73A 1GHQA 5M7YA 4LIXA 5DGQA 5C05A 3M00A 1G9JA 1HX9A 4V1SA 4ZH1A 1HV6A 3HXCB 3KQ4A 3E6UA 3QXQA 1KZOB 3SQCA 1H3BA 4OK4A 1V7VA 2F0YB 3RX7A 2BRVX 1TF4A 2IEJB 1DL2A 5GY3A 2D5JA 1GAIA 3ANJA 2XQWA 1HN0A 2EAEA 4AYQA 1KFGA 2NOJA 4DOEA 2GZ6A 1F9GA 1RQ5A 1FBOA 2AFAA 2H6GB 3Q79B 2XWJB 3HXBB 2H6HB 4OZVA 2WYNA 1UG9A 1TNBB 3E32B 4WVBA 2BBCA 1N7OA 1N21A 1C3DA 3M75A 2WCOA 3CU7A 5ILDA 1DOGA 1KRFA 1VD5A 3D5RA 2V3PA 5FO8B 2DROA 3HXFB 1H37A 1I8QA 1X81B 3S9VA 1X1JA 3VSMA 2DRSA 3PZ3B 3LZ9A 2FUTA 1H3CA 3HXEB 1V7XA 1AGMA 3WIRA 4RNQA 3S4DA 1NI1B 1TNZB 1FP3A 2ONHA 1KS8A 3W7UA 1KSDA 2ONGA 3P5PA 1GXOA 5JMFA 3KSQB 4KKJA 1LF9A 1N20A 3PMMA 1KREA 2G02A 1RWGA 1KWFA 2ZISB 5AGDA 1G87A 1EGUA 3SDRA 3SFYB 1TNUB 2PN5A 3PZ4B 2FV0A 3PYBA 5EAUA 5EATA 3KSLB 1XWQA 5EASA 1HXGA 1RWCA 3GT5A 3QPFA 2D8LA 1L1YA 3DSXB 2G0DA 3RENA 5FOBB 3EU5B 2WY8A 4FJQA 5JPNB 1GAHA 3RRSA 3NFVA 1GA2A 3DSWB 1WU4A 4F13A 5DHIA 1N7QA 5M7IA 3K11A 1OJPA 3N0GA 4YCRA 5IKAA 3PZ2B 4WVAA 3M77A 1LXMA 3EU8A 4ZH5A 3WKHA 2SQCA 4AYPA 1GLMA 1C82A 3VSNA 2EACA 4CJ0A 3M7EA 4CJ1A 1TN8B 4LNGB 1H14A 3H7LA 3X17A 1H39A 2FBAA 1LXKA 1RWHA 3Q75B 2P0VA 3QT9A 4C1SA 3W7XA 1HZFA 2E24A 3M78A 1LD7B 2DRQA 2V8KA 3WKGA 1N22A 4ZG8A 1TN7B 3HXDB 3W7SA 1W3YA 1FCEA 1H35A 3M74A 1D8EB 5DGRA 4OJZA 1OJOA 2I07B 1DCEB 2RGKA 5IK9A 3Q73B 1N7NA 4GTPB 2PMVA 2V3NA 4ZRQA 3EUVB 3M71A 2BEDB 1FAEA 3DRAB 4EL8A 1SA5B 2E22A 4LNBB 3ACTA 1HM2A 4MMHA 4GAXA 2AHGA 1F1SA 2JJBA 1JS4A 2ZZRA 3WC3A 3M01A 1N4SB 3WKIA 2RI8A 1IA7A 1MZCB 2H6IB 1IA6A 1N24A 4ONTA 1HM3A 4EHMB 3QFYA 4L9PB 2DRRA 1LTXB 1FMIA 4D4BA 4FXKB 3M7LA 3E37B 5IK0A 1N94B 3AFJA 4KTRA 3WIQA 4ZRPA 1LF6A 3A3VA 3N0FA 1O1TB 3RSYA 2RI9A 3SFXB 1RWAA 1O6QA 2JF4A 2AHFA 1N4PB 4JJJA 2OKXA 4L6XA 5JPMB 4GTSB 1G9GA 3C72B 2BB5A 2GOXA 2F6DA 1S64B 4Z4LA 1F9DA 3PYAA 4DODA 5GZKA 1O1RB 2BRWA 3DSUB 1GXNA 4L0GA 2B4FA 1V5DA 3QFZA 1N9AB 1H36A 1R76A 3ANKA 2NVPA 4GTQB 1N4QB 1OJNA 4BOKA 3QG0A 1J0NA 3G6JB 1N95B 3K7XA 3W7TA 3T33A 3QXFA 4BOJA 4AYOA 3H2WA 3QT3A 3E34B 3SAEA 3Q7AB 1TNOB 1FO2A 4DI5A 5ILIA 1TNYB 3NNBA 3GZKA 3E80A 2XWBB 4CE7A 4FNVA 3QWTA 3S4BA 1S63B 4YDEB 1LOHA 2Q1FA 1O79A 1W6JA 4D94A 2J5CA 4MMIA 3SDUA 1KSCA 5FO9B 5GW7A 1GSZA 5E2JA 4Q88A 5IK6A 5CD2A 3SDVA 2YIKA 5JMDA 1J0MA 3E7JA 2WIIB 1OJMA 3AFLA 2BB6A 2FV1A 1QQFA 1O6RA 1N1ZA 3VW5A 1FBWA 3M7CA 1FT1B 2X03A 5CA3A 3SDTA 3W5MA 3Q7FB 1IS9A 3QRYA 1G6IA 1AYXA 3TF4A 3ACSA 1JCRB 1H3AA 2A73B 3ON6A 4NEIA 3P2CA 4YDOB 3WIWA 1L2AA 1K72A 5CZLA 3A0OA 4WVCA 1O6HA 2CQTA 2ZIRB 3RX8A 2V8JA 4E1YA 3P5RA 5MEHA 3DSVB 2WY7A 2FUZA 1HMUA 1H54A 1UMPA 1QAZA 4F10A 2H6FB 4XUVA 5KKBA 4V1RA 1V7WA 3M72A 4Q2BA 4GTMB 2R2LB 4Z4JA 3Q78B 1JCSB 3M76A 5ILJA 5DHKA 1HCUA 4GTVB 2JG0A 5IL3A 2QNOA 4OZWA 1RWFA 4M76A 1CB8A 1CEMA 3S4CA 3CIHA 1CLCA 3W7WA
chains in the Genus database with same CATH topology
3H3KA 3RX5A 3M7BA 4TF4A 3E30B 2EADA 1FPPB 4J5TA 1SQCA 1O5MB 1H13A 1KZPB 3ANIA 1FO3A 1WU6A 1NC5A 4D4DA 3DPYB 3E73A 3KLSA 4KKIA 4FXGB 3DSTB 4GTOB 1LD8B 2B39A 3GLYA 4GL3A 2V8IA 1JCQB 4FUSA 1FT2B 5FO7B 3PZ1B 1KKTA 3E33B 4MU9A 2A8ZA 2ZBLA 3RJ3A 1WZZA 1X9DA 4MBGB 2EABA 4QT9A 1XWTA 4GTTB 3QDEA 1NL4B 4D4AA 3DSSB 1NXCA 3WUXA 1TN6B 3D3IA 3VXDA 1UT9A 1GXMA 2VN7A 4LNVA 3D5SA 2WINB 4AYRA 2CQSA 1D8DB 1V5CA 3OXUA 1QSJA 3WKFA 2GH4A 3EZ8A 1N4RB 1W6KA 1XW2A 2XFGA 2Z07A 1H12A 4WU0A 3OEDA 4GTRB 1O1SB 3S4AA 3SDQA 4D4CA 1SA4B 4KTPA 3QSPA 4TXTA 3EQAA 1F9OA 2VN4A 1WU5A 1ULVA 3W5NA 1QBQB 3M73A 1GHQA 5M7YA 4LIXA 5DGQA 1G9JA 4V1SA 4ZH1A 3KQ4A 3QXQA 3E6UA 3HXCB 1KZOB 3SQCA 1H3BA 1V7VA 2F0YB 3RX7A 1TF4A 2IEJB 1DL2A 5GY3A 2D5JA 1GAIA 3ANJA 2XQWA 2EAEA 4AYQA 1KFGA 2NOJA 4DOEA 2GZ6A 1RQ5A 1FBOA 2AFAA 2H6GB 3Q79B 2XWJB 3HXBB 2H6HB 2WYNA 1UG9A 1TNBB 3E32B 4WVBA 2BBCA 1C3DA 3M75A 3CU7A 1DOGA 1KRFA 1VD5A 3D5RA 2V3PA 5FO8B 2DROA 3HXFB 1H37A 1X81B 3S9VA 2DRSA 3PZ3B 1H3CA 3HXEB 1V7XA 1AGMA 3WIRA 3S4DA 1NI1B 1TNZB 1FP3A 1KS8A 3W7UA 1KSDA 3P5PA 1GXOA 3KSQB 4KKJA 1LF9A 3PMMA 1KREA 2G02A 1KWFA 2ZISB 5AGDA 1G87A 3SDRA 3SFYB 1TNUB 2PN5A 3PZ4B 2FV0A 3PYBA 3KSLB 1XWQA 3GT5A 3QPFA 2D8LA 1L1YA 3DSXB 2G0DA 3RENA 5FOBB 3EU5B 2WY8A 5JPNB 1GAHA 3RRSA 1GA2A 3DSWB 1WU4A 5M7IA 3K11A 4YCRA 3PZ2B 4WVAA 3M77A 3EU8A 4ZH5A 3WKHA 2SQCA 4AYPA 1GLMA 4CJ0A 2EACA 3M7EA 4CJ1A 1TN8B 4LNGB 1H14A 3H7LA 3X17A 1H39A 2FBAA 3Q75B 2P0VA 3QT9A 4C1SA 3W7XA 1HZFA 3M78A 1LD7B 2DRQA 2V8KA 3WKGA 4ZG8A 1TN7B 3HXDB 3W7SA 1FCEA 1H35A 3M74A 1D8EB 5DGRA 2I07B 2RGKA 1DCEB 3Q73B 4GTPB 2PMVA 2V3NA 4ZRQA 3EUVB 3M71A 2BEDB 1FAEA 3DRAB 4EL8A 1SA5B 4LNBB 3ACTA 2AHGA 2JJBA 1JS4A 2ZZRA 3WC3A 1N4SB 3WKIA 2RI8A 1IA7A 1MZCB 2H6IB 1IA6A 4ONTA 4EHMB 3QFYA 4L9PB 2DRRA 1LTXB 1FMIA 4D4BA 4FXKB 3M7LA 3E37B 1N94B 3AFJA 4KTRA 3WIQA 4ZRPA 1LF6A 3A3VA 1O1TB 3RSYA 2RI9A 3SFXB 1O6QA 2JF4A 2AHFA 1N4PB 4JJJA 2OKXA 4L6XA 5JPMB 4GTSB 1G9GA 3C72B 2BB5A 2GOXA 2F6DA 1S64B 4Z4LA 1F9DA 3PYAA 4DODA 5GZKA 1O1RB 3DSUB 1GXNA 4L0GA 2B4FA 1V5DA 3QFZA 1N9AB 1H36A 1R76A 3ANKA 2NVPA 4GTQB 1N4QB 4BOKA 3QG0A 3G6JB 1N95B 3K7XA 3W7TA 3T33A 3QXFA 4BOJA 4AYOA 3H2WA 3QT3A 3E34B 3SAEA 3Q7AB 1TNOB 1FO2A 1TNYB 3GZKA 2XWBB 4CE7A 3QWTA 3S4BA 1S63B 4YDEB 1O79A 1W6JA 4D94A 3SDUA 1KSCA 5FO9B 5GW7A 1GSZA 5E2JA 4Q88A 5CD2A 3SDVA 2YIKA 2WIIB 2BB6A 2FV1A 1QQFA 1O6RA 3VW5A 1FBWA 3M7CA 1FT1B 5CA3A 3SDTA 3W5MA 3Q7FB 1IS9A 3QRYA 1G6IA 1AYXA 3TF4A 3ACSA 1JCRB 1H3AA 2A73B 3ON6A 3P2CA 4YDOB 3WIWA 1L2AA 1K72A 5CZLA 4WVCA 1O6HA 2CQTA 2ZIRB 3RX8A 2V8JA 3P5RA 5MEHA 3DSVB 2WY7A 2FUZA 1H54A 1UMPA 2H6FB 4XUVA 5KKBA 4V1RA 1V7WA 3M72A 4Q2BA 4GTMB 2R2LB 4Z4JA 3Q78B 1JCSB 3M76A 1HCUA 4GTVB 2JG0A 2QNOA 4M76A 1CEMA 3S4CA 3CIHA 1CLCA 3W7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QXQ A;  3E6U A;  3H3K A;  2P0V A;  3QT9 A;  3W7T A;  1V7V A;  3T33 A;  3QXF A;  3RX7 A;  4AYO A;  3RX5 A;  3W7X A;  3H2W A;  3QT3 A;  4TF4 A;  2DRQ A;  1TF4 A;  3WKG A;  1DL2 A;  5GY3 A;  4ZG8 A;  2D5J A;  3W7S A;  1FO2 A;  1GAI A;  2EAD A;  3ANJ A;  2EAE A;  1FCE A;  4J5T A;  1H13 A;  3GZK A;  1KFG A;  4AYQ A;  4DOE A;  2GZ6 A;  3ANI A;  1FO3 A;  5DGR A;  4CE7 A;  2AFA A;  1RQ5 A;  1FBO A;  2RGK A;  3QWT A;  3S4B A;  1WU6 A;  1NC5 A;  3E73 A;  2WYN A;  1UG9 A;  4WVB A;  1KSC A;  5GW7 A;  5E2J A;  4Q88 A;  5CD2 A;  1DOG A;  2YIK A;  1KRF A;  3GLY A;  1VD5 A;  1FAE A;  2DRO A;  4EL8 A;  4FUS A;  2DRS A;  3ACT A;  1KKT A;  2AHG A;  2FV1 A;  2JJB A;  1JS4 A;  1V7X A;  1AGM A;  2A8Z A;  2ZBL A;  2ZZR A;  3WIR A;  3S4D A;  3WC3 A;  1WZZ A;  1FP3 A;  1X9D A;  1KS8 A;  2RI8 A;  3VW5 A;  1FBW A;  2EAB A;  3WKI A;  3W7U A;  1IA7 A;  1KSD A;  1XWT A;  5CA3 A;  1IA6 A;  1LF9 A;  3QDE A;  3PMM A;  1KRE A;  3W5M A;  3QFY A;  2DRR A;  1NXC A;  3WUX A;  1KWF A;  1FMI A;  1IS9 A;  3QRY A;  1G6I A;  1AYX A;  3D3I A;  3TF4 A;  3ACS A;  1G87 A;  3VXD A;  3ON6 A;  1UT9 A;  3AFJ A;  4KTR A;  2VN7 A;  3WIQ A;  1LF6 A;  3A3V A;  4AYR A;  2CQS A;  3RSY A;  3P2C A;  1V5C A;  2RI9 A;  2FV0 A;  3WKF A;  3WIW A;  1L2A A;  1K72 A;  5CZL A;  2GH4 A;  3EZ8 A;  1XWQ A;  4WVC A;  2CQT A;  2JF4 A;  2AHF A;  2OKX A;  4JJJ A;  3RX8 A;  1XW2 A;  3GT5 A;  2XFG A;  4L6X A;  3QPF A;  2Z07 A;  1H12 A;  2D8L A;  1G9G A;  4WU0 A;  1L1Y A;  5MEH A;  3REN A;  2F6D A;  3S4A A;  2FUZ A;  1H54 A;  4Z4L A;  1F9D A;  1GAH A;  3RRS A;  1GA2 A;  4XUV A;  4DOD A;  5KKB A;  1WU4 A;  4KTP A;  1V7W A;  4Q2B A;  5M7I A;  3K11 A;  4L0G A;  3QSP A;  4TXT A;  3EQA A;  2B4F A;  4Z4J A;  1V5D A;  3QFZ A;  1F9O A;  2VN4 A;  1WU5 A;  4WVA A;  1HCU A;  2JG0 A;  2QNO A;  3ANK A;  1ULV A;  4ZH5 A;  2NVP A;  3WKH A;  5M7Y A;  3W5N A;  4AYP A;  1GLM A;  1CEM A;  3S4C A;  5DGQ A;  4CJ0 A;  2EAC A;  1G9J A;  3QG0 A;  4CJ1 A;  1H14 A;  3CIH A;  3H7L A;  1CLC A;  3X17 A;  2FBA A;  3W7W A; 
#chains in the Genus database with same CATH topology
 3H3K A;  1HMW A;  3RX5 A;  3M7B A;  4TF4 A;  4OK2 A;  3E30 B;  2EAD A;  1FPP B;  4J5T A;  1SQC A;  1O5M B;  1H13 A;  1KZP B;  3ANI A;  1FO3 A;  1WU6 A;  5ILK A;  1NC5 A;  4D4D A;  3DPY B;  3E73 A;  5IKH A;  3KLS A;  4KKI A;  4FXG B;  3DST B;  4GTO B;  3G4F A;  5ILH A;  1LD8 B;  1X1I A;  2B39 A;  1RW9 A;  3GLY A;  4GL3 A;  2V8I A;  1JCQ B;  4FUS A;  1FT2 B;  5FO7 B;  3PZ1 B;  1KKT A;  3E33 B;  4MU9 A;  2A8Z A;  2ZBL A;  3RJ3 A;  1WZZ A;  1X9D A;  4MBG B;  2EAB A;  2BRP A;  4QT9 A;  1XWT A;  1HXC A;  4GTT B;  3QDE A;  1NL4 B;  4D4A A;  3DSS B;  1NXC A;  3WUX A;  1TN6 B;  3D3I A;  1N1B A;  3VXD A;  1HXA A;  5IM1 A;  1UT9 A;  1GXM A;  2VN7 A;  4LNV A;  3D5S A;  2WIN B;  2WDA A;  4AYR A;  2CQS A;  1N7R A;  1D8D B;  1V5C A;  3OXU A;  1QSJ A;  3WKF A;  5ILZ A;  2GH4 A;  3EZ8 A;  1N4R B;  1X1H A;  1W6K A;  2FUQ A;  1XW2 A;  2XFG A;  2Z07 A;  1H12 A;  1N23 A;  4WU0 A;  1N7P A;  5IL8 A;  3OED A;  4GTR B;  1O1S B;  3S4A A;  3SDQ A;  5ILY A;  4D4C A;  3M02 A;  3G4D A;  1SA4 B;  4KTP A;  3QSP A;  4TXT A;  3EQA A;  1F9O A;  2VN4 A;  1WU5 A;  1ULV A;  3W5N A;  1QBQ B;  3M73 A;  1GHQ A;  5M7Y A;  4LIX A;  5DGQ A;  5C05 A;  3M00 A;  1G9J A;  1HX9 A;  4V1S A;  4ZH1 A;  1HV6 A;  3HXC B;  3KQ4 A;  3E6U A;  3QXQ A;  1KZO B;  3SQC A;  1H3B A;  4OK4 A;  1V7V A;  2F0Y B;  3RX7 A;  2BRV X;  1TF4 A;  2IEJ B;  1DL2 A;  5GY3 A;  2D5J A;  1GAI A;  3ANJ A;  2XQW A;  1HN0 A;  2EAE A;  4AYQ A;  1KFG A;  2NOJ A;  4DOE A;  2GZ6 A;  1F9G A;  1RQ5 A;  1FBO A;  2AFA A;  2H6G B;  3Q79 B;  2XWJ B;  3HXB B;  2H6H B;  4OZV A;  2WYN A;  1UG9 A;  1TNB B;  3E32 B;  4WVB A;  2BBC A;  1N7O A;  1N21 A;  1C3D A;  3M75 A;  2WCO A;  3CU7 A;  5ILD A;  1DOG A;  1KRF A;  1VD5 A;  3D5R A;  2V3P A;  5FO8 B;  2DRO A;  3HXF B;  1H37 A;  1I8Q A;  1X81 B;  3S9V A;  1X1J A;  3VSM A;  2DRS A;  3PZ3 B;  3LZ9 A;  2FUT A;  1H3C A;  3HXE B;  1V7X A;  1AGM A;  3WIR A;  4RNQ A;  3S4D A;  1NI1 B;  1TNZ B;  1FP3 A;  2ONH A;  1KS8 A;  3W7U A;  1KSD A;  2ONG A;  3P5P A;  1GXO A;  5JMF A;  3KSQ B;  4KKJ A;  1LF9 A;  1N20 A;  3PMM A;  1KRE A;  2G02 A;  1RWG A;  1KWF A;  2ZIS B;  5AGD A;  1G87 A;  1EGU A;  3SDR A;  3SFY B;  1TNU B;  2PN5 A;  3PZ4 B;  2FV0 A;  3PYB A;  5EAU A;  5EAT A;  3KSL B;  1XWQ A;  5EAS A;  1HXG A;  1RWC A;  3GT5 A;  3QPF A;  2D8L A;  1L1Y A;  3DSX B;  2G0D A;  3REN A;  5FOB B;  3EU5 B;  2WY8 A;  4FJQ A;  5JPN B;  1GAH A;  3RRS A;  3NFV A;  1GA2 A;  3DSW B;  1WU4 A;  4F13 A;  5DHI A;  1N7Q A;  5M7I A;  3K11 A;  1OJP A;  3N0G A;  4YCR A;  5IKA A;  3PZ2 B;  4WVA A;  3M77 A;  1LXM A;  3EU8 A;  4ZH5 A;  3WKH A;  2SQC A;  4AYP A;  1GLM A;  1C82 A;  3VSN A;  2EAC A;  4CJ0 A;  3M7E A;  4CJ1 A;  1TN8 B;  4LNG B;  1H14 A;  3H7L A;  3X17 A;  1H39 A;  2FBA A;  1LXK A;  1RWH A;  3Q75 B;  2P0V A;  3QT9 A;  4C1S A;  3W7X A;  1HZF A;  2E24 A;  3M78 A;  1LD7 B;  2DRQ A;  2V8K A;  3WKG A;  1N22 A;  4ZG8 A;  1TN7 B;  3HXD B;  3W7S A;  1W3Y A;  1FCE A;  1H35 A;  3M74 A;  1D8E B;  5DGR A;  4OJZ A;  1OJO A;  2I07 B;  1DCE B;  2RGK A;  5IK9 A;  3Q73 B;  1N7N A;  4GTP B;  2PMV A;  2V3N A;  4ZRQ A;  3EUV B;  3M71 A;  2BED B;  1FAE A;  3DRA B;  4EL8 A;  1SA5 B;  2E22 A;  4LNB B;  3ACT A;  1HM2 A;  4MMH A;  4GAX A;  2AHG A;  1F1S A;  2JJB A;  1JS4 A;  2ZZR A;  3WC3 A;  3M01 A;  1N4S B;  3WKI A;  2RI8 A;  1IA7 A;  1MZC B;  2H6I B;  1IA6 A;  1N24 A;  4ONT A;  1HM3 A;  4EHM B;  3QFY A;  4L9P B;  2DRR A;  1LTX B;  1FMI A;  4D4B A;  4FXK B;  3M7L A;  3E37 B;  5IK0 A;  1N94 B;  3AFJ A;  4KTR A;  3WIQ A;  4ZRP A;  1LF6 A;  3A3V A;  3N0F A;  1O1T B;  3RSY A;  2RI9 A;  3SFX B;  1RWA A;  1O6Q A;  2JF4 A;  2AHF A;  1N4P B;  4JJJ A;  2OKX A;  4L6X A;  5JPM B;  4GTS B;  1G9G A;  3C72 B;  2BB5 A;  2GOX A;  2F6D A;  1S64 B;  4Z4L A;  1F9D A;  3PYA A;  4DOD A;  5GZK A;  1O1R B;  2BRW A;  3DSU B;  1GXN A;  4L0G A;  2B4F A;  1V5D A;  3QFZ A;  1N9A B;  1H36 A;  1R76 A;  3ANK A;  2NVP A;  4GTQ B;  1N4Q B;  1OJN A;  4BOK A;  3QG0 A;  1J0N A;  3G6J B;  1N95 B;  3K7X A;  3W7T A;  3T33 A;  3QXF A;  4BOJ A;  4AYO A;  3H2W A;  3QT3 A;  3E34 B;  3SAE A;  3Q7A B;  1TNO B;  1FO2 A;  4DI5 A;  5ILI A;  1TNY B;  3NNB A;  3GZK A;  3E80 A;  2XWB B;  4CE7 A;  4FNV A;  3QWT A;  3S4B A;  1S63 B;  4YDE B;  1LOH A;  2Q1F A;  1O79 A;  1W6J A;  4D94 A;  2J5C A;  4MMI A;  3SDU A;  1KSC A;  5FO9 B;  5GW7 A;  1GSZ A;  5E2J A;  4Q88 A;  5IK6 A;  5CD2 A;  3SDV A;  2YIK A;  5JMD A;  1J0M A;  3E7J A;  2WII B;  1OJM A;  3AFL A;  2BB6 A;  2FV1 A;  1QQF A;  1O6R A;  1N1Z A;  3VW5 A;  1FBW A;  3M7C A;  1FT1 B;  2X03 A;  5CA3 A;  3SDT A;  3W5M A;  3Q7F B;  1IS9 A;  3QRY A;  1G6I A;  1AYX A;  3TF4 A;  3ACS A;  1JCR B;  1H3A A;  2A73 B;  3ON6 A;  4NEI A;  3P2C A;  4YDO B;  3WIW A;  1L2A A;  1K72 A;  5CZL A;  3A0O A;  4WVC A;  1O6H A;  2CQT A;  2ZIR B;  3RX8 A;  2V8J A;  4E1Y A;  3P5R A;  5MEH A;  3DSV B;  2WY7 A;  2FUZ A;  1HMU A;  1H54 A;  1UMP A;  1QAZ A;  4F10 A;  2H6F B;  4XUV A;  5KKB A;  4V1R A;  1V7W A;  3M72 A;  4Q2B A;  4GTM B;  2R2L B;  4Z4J A;  3Q78 B;  1JCS B;  3M76 A;  5ILJ A;  5DHK A;  1HCU A;  4GTV B;  2JG0 A;  5IL3 A;  2QNO A;  4OZW A;  1RWF A;  4M76 A;  1CB8 A;  1CEM A;  3S4C A;  3CIH A;  1CLC A;  3W7W A; 
#chains in the Genus database with same CATH homology
 3H3K A;  3RX5 A;  3M7B A;  4TF4 A;  3E30 B;  2EAD A;  1FPP B;  4J5T A;  1SQC A;  1O5M B;  1H13 A;  1KZP B;  3ANI A;  1FO3 A;  1WU6 A;  1NC5 A;  4D4D A;  3DPY B;  3E73 A;  3KLS A;  4KKI A;  4FXG B;  3DST B;  4GTO B;  1LD8 B;  2B39 A;  3GLY A;  4GL3 A;  2V8I A;  1JCQ B;  4FUS A;  1FT2 B;  5FO7 B;  3PZ1 B;  1KKT A;  3E33 B;  4MU9 A;  2A8Z A;  2ZBL A;  3RJ3 A;  1WZZ A;  1X9D A;  4MBG B;  2EAB A;  4QT9 A;  1XWT A;  4GTT B;  3QDE A;  1NL4 B;  4D4A A;  3DSS B;  1NXC A;  3WUX A;  1TN6 B;  3D3I A;  3VXD A;  1UT9 A;  1GXM A;  2VN7 A;  4LNV A;  3D5S A;  2WIN B;  4AYR A;  2CQS A;  1D8D B;  1V5C A;  3OXU A;  1QSJ A;  3WKF A;  2GH4 A;  3EZ8 A;  1N4R B;  1W6K A;  1XW2 A;  2XFG A;  2Z07 A;  1H12 A;  4WU0 A;  3OED A;  4GTR B;  1O1S B;  3S4A A;  3SDQ A;  4D4C A;  1SA4 B;  4KTP A;  3QSP A;  4TXT A;  3EQA A;  1F9O A;  2VN4 A;  1WU5 A;  1ULV A;  3W5N A;  1QBQ B;  3M73 A;  1GHQ A;  5M7Y A;  4LIX A;  5DGQ A;  1G9J A;  4V1S A;  4ZH1 A;  3KQ4 A;  3QXQ A;  3E6U A;  3HXC B;  1KZO B;  3SQC A;  1H3B A;  1V7V A;  2F0Y B;  3RX7 A;  1TF4 A;  2IEJ B;  1DL2 A;  5GY3 A;  2D5J A;  1GAI A;  3ANJ A;  2XQW A;  2EAE A;  4AYQ A;  1KFG A;  2NOJ A;  4DOE A;  2GZ6 A;  1RQ5 A;  1FBO A;  2AFA A;  2H6G B;  3Q79 B;  2XWJ B;  3HXB B;  2H6H B;  2WYN A;  1UG9 A;  1TNB B;  3E32 B;  4WVB A;  2BBC A;  1C3D A;  3M75 A;  3CU7 A;  1DOG A;  1KRF A;  1VD5 A;  3D5R A;  2V3P A;  5FO8 B;  2DRO A;  3HXF B;  1H37 A;  1X81 B;  3S9V A;  2DRS A;  3PZ3 B;  1H3C A;  3HXE B;  1V7X A;  1AGM A;  3WIR A;  3S4D A;  1NI1 B;  1TNZ B;  1FP3 A;  1KS8 A;  3W7U A;  1KSD A;  3P5P A;  1GXO A;  3KSQ B;  4KKJ A;  1LF9 A;  3PMM A;  1KRE A;  2G02 A;  1KWF A;  2ZIS B;  5AGD A;  1G87 A;  3SDR A;  3SFY B;  1TNU B;  2PN5 A;  3PZ4 B;  2FV0 A;  3PYB A;  3KSL B;  1XWQ A;  3GT5 A;  3QPF A;  2D8L A;  1L1Y A;  3DSX B;  2G0D A;  3REN A;  5FOB B;  3EU5 B;  2WY8 A;  5JPN B;  1GAH A;  3RRS A;  1GA2 A;  3DSW B;  1WU4 A;  5M7I A;  3K11 A;  4YCR A;  3PZ2 B;  4WVA A;  3M77 A;  3EU8 A;  4ZH5 A;  3WKH A;  2SQC A;  4AYP A;  1GLM A;  4CJ0 A;  2EAC A;  3M7E A;  4CJ1 A;  1TN8 B;  4LNG B;  1H14 A;  3H7L A;  3X17 A;  1H39 A;  2FBA A;  3Q75 B;  2P0V A;  3QT9 A;  4C1S A;  3W7X A;  1HZF A;  3M78 A;  1LD7 B;  2DRQ A;  2V8K A;  3WKG A;  4ZG8 A;  1TN7 B;  3HXD B;  3W7S A;  1FCE A;  1H35 A;  3M74 A;  1D8E B;  5DGR A;  2I07 B;  2RGK A;  1DCE B;  3Q73 B;  4GTP B;  2PMV A;  2V3N A;  4ZRQ A;  3EUV B;  3M71 A;  2BED B;  1FAE A;  3DRA B;  4EL8 A;  1SA5 B;  4LNB B;  3ACT A;  2AHG A;  2JJB A;  1JS4 A;  2ZZR A;  3WC3 A;  1N4S B;  3WKI A;  2RI8 A;  1IA7 A;  1MZC B;  2H6I B;  1IA6 A;  4ONT A;  4EHM B;  3QFY A;  4L9P B;  2DRR A;  1LTX B;  1FMI A;  4D4B A;  4FXK B;  3M7L A;  3E37 B;  1N94 B;  3AFJ A;  4KTR A;  3WIQ A;  4ZRP A;  1LF6 A;  3A3V A;  1O1T B;  3RSY A;  2RI9 A;  3SFX B;  1O6Q A;  2JF4 A;  2AHF A;  1N4P B;  4JJJ A;  2OKX A;  4L6X A;  5JPM B;  4GTS B;  1G9G A;  3C72 B;  2BB5 A;  2GOX A;  2F6D A;  1S64 B;  4Z4L A;  1F9D A;  3PYA A;  4DOD A;  5GZK A;  1O1R B;  3DSU B;  1GXN A;  4L0G A;  2B4F A;  1V5D A;  3QFZ A;  1N9A B;  1H36 A;  1R76 A;  3ANK A;  2NVP A;  4GTQ B;  1N4Q B;  4BOK A;  3QG0 A;  3G6J B;  1N95 B;  3K7X A;  3W7T A;  3T33 A;  3QXF A;  4BOJ A;  4AYO A;  3H2W A;  3QT3 A;  3E34 B;  3SAE A;  3Q7A B;  1TNO B;  1FO2 A;  1TNY B;  3GZK A;  2XWB B;  4CE7 A;  3QWT A;  3S4B A;  1S63 B;  4YDE B;  1O79 A;  1W6J A;  4D94 A;  3SDU A;  1KSC A;  5FO9 B;  5GW7 A;  1GSZ A;  5E2J A;  4Q88 A;  5CD2 A;  3SDV A;  2YIK A;  2WII B;  2BB6 A;  2FV1 A;  1QQF A;  1O6R A;  3VW5 A;  1FBW A;  3M7C A;  1FT1 B;  5CA3 A;  3SDT A;  3W5M A;  3Q7F B;  1IS9 A;  3QRY A;  1G6I A;  1AYX A;  3TF4 A;  3ACS A;  1JCR B;  1H3A A;  2A73 B;  3ON6 A;  3P2C A;  4YDO B;  3WIW A;  1L2A A;  1K72 A;  5CZL A;  4WVC A;  1O6H A;  2CQT A;  2ZIR B;  3RX8 A;  2V8J A;  3P5R A;  5MEH A;  3DSV B;  2WY7 A;  2FUZ A;  1H54 A;  1UMP A;  2H6F B;  4XUV A;  5KKB A;  4V1R A;  1V7W A;  3M72 A;  4Q2B A;  4GTM B;  2R2L B;  4Z4J A;  3Q78 B;  1JCS B;  3M76 A;  1HCU A;  4GTV B;  2JG0 A;  2QNO A;  4M76 A;  1CEM A;  3S4C A;  3CIH A;  1CLC A;  3W7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...