2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
1N4PB 1GXMA 1R76A 3PZ2B 1JCRB 3PZ1B 1H3BA 4GTMB 5JPNB 3G6JB 1GHQA 1UMPA 3KSLB 3E32B 1O1TB 3Q73B 1NI1B 1O1SB 3SFXB 2G0DA 4FXGB 5FO9B 3PZ3B 5FOBB 1QSJA 3E33B 4D4DA 2PMVA 3Q79B 4LNGB 3DPYB 2A73B 4L9PB 3HXFB 2WY8A 1MZCB 1LD8B 3DSSB 1SA5B 4C1SA 1D8DB 3E30B 3D5SA 3Q75B 4YDOB 1W6KA 2GOXA 5JPMB 1GSZA 2G02A 1TNZB 2V8KA 2XQWA 1FT2B 3DSUB 2WY7A 4MBGB 4BOKA 2H6FB 3HXCB 5AGDA 1NL4B 1TNYB 3DSXB 1TN7B 2H6GB 2V8IA 1FT1B 1C3DA 3OXUA 4GTPB 1KZPB 1SA4B 2NOJA 1N94B 3DSTB 3DSWB 3EUVB 1JCSB 1O6HA 3KSQB 5FO7B 3U7ZA 2H6IB 4ZRPA 1SQCA 2I07B 4GTQB 1LD7B 1QBQB 2PN5A 1TNUB 1KZOB 3C72B 1N4SB 4LNBB 2IEJB 1H3AA 1H39A 4ZRQA 4V1SA 4BOJA 1W6JA 4GTRB 3D5RA 2ZISB 1N4RB 2BB6A 3Q7AB 3OEDA 4D4CA 3KQ4A 4GTOB 2R2LB 1H3CA 1S64B 1FPPB 1N95B 4KKIA 1S63B 1H37A 2XWJB 3PZ4B 1GXNA 3Q7FB 3SFYB 2BB5A 3Q78B 4D4BA 1O1RB 3E34B 3EU5B 1DCEB 2V3NA 4MU9A 3RJ3A 1TN6B 1JCQB 1QQFA 4LNVA 3DSVB 1X81B 4KKJA 4GTTB 2V3PA 4D94A 2XWBB 4ONTA 2BEDB 2ZIRB 2B39A 4EHMB 3KLSA 4ZH1A 3K7XA 1N4QB 4D4AA 3CU7A 1GXOA 1LTXB 3E37B 1H35A 2SQCA 3HXDB 1TNOB 1TN8B 3DRAB 2F0YB 4YDEB 2V8JA 4GTSB 3HXBB 1O79A 1O6RA 4FXKB 2WINB 2WIIB 1N9AB 4M76A 3HXEB 1HZFA 1TNBB 2H6HB 4GTVB 1O5MB 2BBCA 4V1RA 1O6QA 1D8EB 5FO8B 3SQCA 1H36A
chains in the Genus database with same CATH superfamily
1QLBB 2NPTB 4YSZB 3DBHB 2KQ4X 1JWUD 2Z0EB 1E0ZA 1KS8A 3SAEA 5DHIA 2C60A 3EECA 1XCTL 1JALA 1GJZA 5HG2A 4PS7A 1FD6A 1QOFA 3QC8B 5FOBB 3E7JA 4P6VF 4DXGA 4K1RB 2A73B 2QEJC 1F9DA 3N1ZC 3U30A 2KMCA 5JZEB 3DBRI 4GB9A 3X0WA 3AI5A 2WY7A 2NTTA 3AE3B 4MH0E 5D3IB 5JH5C 1TN7B 1UBQA 3WAOA 3OXUA 2IPKD 1SA4B 3AULA 5G5HA 1WM2A 5CHFA 1N61A 2R61A 1TIFA 1ZUD2 2K9XA 3V61A 1V5TA 2KQ7A 3X23A 1RRBA 2GZ6A 4ZRQA 3N1XC 3I3TB 2A4ZA 1KSCA 3D32A 1MI0A 4GLSC 2WLBA 3N3KB 2R2LB 2IGHA 1GB1A 4A20A 1C4AA 2ZZPB 1ENFA 4YL8A 1R7SA 4KDIC 5C1ZA 4NNJB 4W9EA 3CSFA 4LNOA 4FUSA 1QILA 3PO0A 1E8XA 4K3BA 4G3XB 4KX6B 2PTLA 2RSUA 1GLMA 1DGJA 4DI5A 2XWBB 1H13A 2M0AA 2JQRB 3RYTA 3ZIMA 5J2RA 1N22A 3P4PB 3QT3A 2KWUB 4JX1C 4ZRKA 3M02A 2KXJA 3QA8A 1K72A 4Z4LA 2WNMA 3W2DA 4N58A 2A5UA 1VRAB 4I6NB 2MA9B 3G4DA 1KJTA 4NJ6A 3ZTDA 3BIID 1RQ5A 3N1YC 1UWMA 3VRBB 1B1ZA 5IP4D 1J7AA 3SQCA 1QF6A 3SDVA 3PZ2B 2G4DB 5IL3A 1RM6C 1XWQA 2PVGC 3RNGC 3ZXVA 3OJ3A 3A4SC 4F7ZA 2INNE 1WGGA 1D4BA 2WGSA 1GNUA 4BKSA 3M01A 3NHEB 2INCC 4X57B 4XE0A 1GAQB 2NR2A 4DHZE 1FCEA 1LD8B 5M7IA 3ZXRA 1AYFA 4NZLB 3NOBA 4CQNA 1VCBA 1GSZA 4NY0A 3RX7A 2JZ3B 1FT2B 4FA6A 4W9IA 2EADA 4MM3A 4QAYA 1JCSB 2W55A 3C8YA 3EFCA 1UELA 2IY0B 2N0SB 3NS1A 1QBQB 2JVCA 2KJRA 1T0SC 1N5XA 1TNUB 3DVNV 3PREA 5CTRC 4LNBB 1WIAA 1J7BA 4XYCA 4ZHOA 2MBOA 4V1SA 3P4SB 2LXAA 2LZ6A 2MQJA 2L7RA 1WFYA 2RDHA 2L1AA 4KGSA 1SGHA 4AJYB 2WCOA 2PIAA 4JWUC 2PEAA 3VTUA 2KTRB 2VZKB 1FPPB 5IK6A 3DBLB 3NVVA 4PYUA 2FUQA 1AGMA 5JHAA 4K81A 3M63B 2KVRA 1OJPA 5J18A 1H12A 2BRPA 4II3B 4LNVA 3D3IA 3H7PA 3NVWA 4F13A 2WXLA 3RZFA 1F1SA 2C5LC 2KDBA 3N9YC 5G2NA 2AYOB 3WKIA 2DYMA 3MC0B 4FJVB 2P0VA 5JMFA 2L05A 2RMMA 3M72A 1WU5A 1EO6A 2V3SA 2V8JA 4FXKB 4GDKB 4URKA 1L2NA 3DCGA 3N0GA 3VH3B 2KK8A 1IYFA 1TKEA 3Q6BA 2AHFA 3ZUNA 2H89B 3AB5A 1HQRD 5J17A 2AWTA 1P1AA 1H14A 4PS8A 4HXDA 1Q5WB 4LTUA 3RN9C 1C1YB 3A33B 2JSVX 2WXKA 3BWUD 2I2YA 3JW0X 1UBIA 4NJ7A 1GHQA 1XLQA 2NMQA 4EUTA 1OFFA 2PJHA 2JG0A 1NI1B 2DWQA 2R2QA 1D5XC 3MJ5A 4ZDVA 2QHOA 3W7WA 4G11A 1DYQA 4RGNA 4MGKE 3E30B 2K0PA 2MW5A 2E24A 2FCNA 1N63A 1WX8A 3HVDA 4BKGA 4N9F4 2WU5B 4OZBA 1RWHA 5E6NA 4FADA 3TEWA 4O1NA 2D3AA 1E10A 4GTPB 3TBLD 4FJYA 4N59A 3NFVA 3Q3MC 3V6EB 2K8CA 4EOYA 2GOWA 3FAHA 2X8XX 1X1HA 3IXSA 4B0EA 2IEJB 1WM3A 2FCSA 3HK0A 4M01A 1VDVA 1D5ZC 2KOXA 2AQ1B 2DHZA 1CZPA 3Q7AB 3FILA 4DHZB 1Z2MA 3IT6B 3Q8FA 4AYQA 1SSNA 5GW7A 2RPVA 3GT5A 3ZJVA 1SJHD 4KGTA 1XWTA 1TJEA 1GXNA 1HZ6A 3R8BA 2DRQA 4IWPA 3WKGA 3EU5B 3DBHI 5AZFA 2WWZA 1SJED 1F9GA 1FNVA 4AP4C 4FLHA 1K8RB 3M95A 1HZ5A 3M75A 1MJDA 3M7CA 3WIWA 1J7CA 2Z8LA 2JF5A 2J0JA 4YCRA 3ANKA 2DYOA 4F10A 1MPEA 2PE9A 2ZVNA 3CIRB 4YSXB 1WJ4A 1TBEA 1N24A 1RWFA 5G5GA 3AU5A 1WH3A 2J0MA 1IA7A 1MVKA 2HE7A 2KC1A 3AE4B 5FO8B 1I35A 2L00B 1HM2A 4OJZA 2UYZB 3SFEB 2C7NB 2OOBB 4ASWC 4GTMB 4MGIE 4RNAA 3EZ8A 3W7TA 1ZE3D 5M7YA 1H54A 3E32B 5GY3A 3SFXB 2G0DA 2F6DA 2M0XA 2LASA 2WXHA 4D4DA 4NAMA 1FMAD 2FV1A 4GU2A 1YN5A 3CIHA 2XBBC 2K39A 2KAJA 4HCNB 3ZTCA 3PMMA 4YDOB 3EU8A 3QQ8B 1A70A 3MHZA 3DBLI 4MDKE 3RRSA 4DXAB 4OW0A 4BOZB 5AGDA 1HCUA 5IKAA 3U7ZA 2GBRA 2LD9A 2Z59B 3T33A 1I7HA 3OAWA 1HX9A 3M73A 1E8YA 5BMGA 1IP9A 3RENA 1DOGA 2EMTA 1RFKA 1GC6A 2WXRA 4W9HA 3KQ4A 1DOYA 2JYEA 2X38A 5LNK1 3OG5A 3P5PA 4ZG8A 1X1JA 1N7QA 2GI9A 1M4VA 1FCLA 4B6WA 1NDDA 1HXGA 2C7MB 4EZKA 1LXDA 3R2TA 3QFZA 1I4GA 4WJOA 3ANIA 1RWCA 2IO1B 2W3RA 4C80A 3GZNB 1WXAA 3RD2A 3H7SA 1NVID 4GXBA 4JQWC 2OHFA 2LRWA 4OHJA 4ARCA 3MFGA 1L6VA 3PLVA 3QWZB 3VRAB 3ACTA 1LXKA 4OK2A 3W7XA 5BMIA 3E37B 3IT4B 3WUXA 1TNOB 3QRYA 3VSNA 2N1VA 4B0MA 2D8LA 3A0OA 4XDCA 5JMDA 3SDUA 1Y56A 3TMPB 3U2SC 2K22A 4HDOA 1Z5SB 2WXPA 1V7XA 5ILJA 4HVBA 4GSWA 3K11A 2D07B 1UG9A 5CHVC 2DBYA 4MGYE 3KYCD 1TKGA 3MC8A 2AFAA 1JCRB 3VXWA 2IO0B 3WIQA 4CO7A 2K6DB 2BS4B 4LDTB 1NXCA 3ENEA 2DROA 2FCQA 4J6IA 3P4RB 2DENB 1V1PB 2O6VB 2M8SA 1RWSA 2IDYA 1CEMA 3RFZB 3IVFA 2ZBLA 2ZW0A 4AYOA 1C79A 1E90A 3VDZA 3RMKC 1XW2A 4K3CA 1K53A 4JLCA 3M78A 1I4HA 4KIKA 2XK5B 5EE1A 2NS5A 2H6GB 1NEKB 1N20A 3ECIA 3LZ9A 3EUVB 2RDBC 1DOXA 3V05A 3SD5A 3W5MA 3I57A 3LXFA 1LD7B 2BGFA 3C72B 2DZKA 2GBMA 4IM3A 1R4MB 4GDLB 2FUG1 1E7PB 2GMIC 1EGUA 3T8MA 3ALBA 4E74A 2IJ0A 3VTWA 3U4EG 2EKIA 1UD7A 4L1BA 1KH0A 4S17A 3LYYA 5D2MB 2PVOD 3AEBB 4D4BA 4WJQA 2W3SA 3PRZA 1DCEB 2BKFA 1YJ1A 3PRMB 1MG4A 3AE8B 2V3PA 2WHIA 2N9EB 2K5PA 2WDQB 2BT6A 2O2VB 2CJOA 1RW9A 4EL8A 2AX5A 3H9DA 4A9AA 4EKUA 3VUXA 3DHGC 1P9DU 3HXDB 2FUTA 5G55A 4DDGD 3LJ3A 1EU3A 2B3AA 3VAWA 1OJOA 2XN9C 4ZRJA 3APFA 2BYFA 4A3PA 3TSSA 1FNWA 1NBFC 2OKXA 1XCQL 3U8ZA 1KKTA 1NENB 3IHPC 4W9GA 2BS3B 1OEYA 4YTNB 3OJ4B 3RX5A 2V1YA 1WZ0A 2I38A 4DK5A 4KDLB 3ETRA 2MJEA 5CHWA 1TTNA 4G0NB 1G9JA 3H1UA 1JROA 3EQAA 1FXTB 3SDRA 1FXAA 1K51A 3AFJA 4MJSA 2MP2A 1SXTA 4HWIB 1GAIA 2MJDA 3W1SC 2KN5A 3PZ3B 1QSJA 3W9CB 3QAQA 4AWJA 2IYDB 5ILIA 1UGMA 1XEEA 3H8HA 3PZDA 3Q8AA 3ZLZA 3R7QA 1WR6E 4L2YA 3IAS1 4PS3A 5D3DA 5AZGA 2ONHA 2V4IB 2L0TA 1VZ6A 1F1HA 3RNCC 2FAZA 3PSEB 3BZDB 2KLCA 4II2B 4RF0A 2INDC 2AQ3B 3Q8BA 3DSTB 2NTSA 3V62A 2WYQA 1V86A 1X1IA 1UF0A 1N4SB 1TS4A 1PUTA 1WR1A 1W6JA 3W1SA 1L0XB 4WWNA 4D4CA 5FR3A 4FHKA 3S4AA 3AH7A 3I5JC 4C7ZA 1H3CA 1HE8A 4MH8A 3ANJA 3KYDD 5LLIA 3DOWA 2KJ6A 1V7VA 1YQ3B 5AZHA 2N4FA 2Q1FA 1QT9A 2KKCA 2MSED 2DLBA 3RUIB 2C7HA 2CJNA 2EELA 3A1QA 1WXQA 3DWMA 2BRWA 4N6EB 2JU6X 4EHMB 4W9DA 2KVZA 2J5CA 3SR6A 3T3NA 1F52A 1VD2A 2LGSA 1I4QA 3VSMA 2LJIA 3B0AA 4XC2A 2JZZA 3PPAA 3P1MA 2FE8A 2JYTA 3HXEB 2WXNA 2KN4A 5EE0A 1ROEA 2DZJA 1OGWA 4CHKA 4V1RA 1BMLC 3MTNB 2JJBA 4XZ4A 3A1QB 3P5RA 2KZRA 2WXGA 3U7DA 3PT2B 1PGAA 2TSSA 1F77A 1Q0WB 5LXIB 4LLGM 2WXMA 3B1LX 1AYXA 3ZNZB 1H3BA 3QSPA 4ICVA 2L32A 3G6JB 3QK0A 3RNAC 4J3OD 3OLMD 1N7RA 1N60A 1V5DA 1I42A 4P1BC 1C77A 1KRFA 3M76A 3AV8A 1NI3A 3EGRA 3TEZA 1ZP0B 4YSYB 1C82A 4XDDA 1JWSD 2D3GA 3PRPB 4F1SA 1CK1A 3WANA 4LJPB 3E80A 4KGRA 4MJSB 3WCQA 1WGHA 3PZ7A 4FULA 1JCKB 2N9KA 2CKHB 3UINB 3QX1A 4C4VA 5IKCM 2HDEA 1O6HA 2NVPA 4MT5A 1N21A 1E8ZA 2KANA 4KTPA 2M4NA 3TF4A 3GOEA 1WF9A 5EE3A 1KZOB 3GE8C 4NEIA 2UU7A 1KREA 1V6EA 1N4RB 3VUWA 3ONSA 5EDSA 4L6XA 5FK9C 1FMIA 3S9VA 2EAEA 3Q3NC 4FN2A 2GLSA 1XD3B 2XWJB 1HTQA 2LUMA 3ZYYX 3BY4B 4DQOC 2NBVB 4FJZA 3GZKA 5EAUA 1F9OA 2JRIB 2KWVB 1G9GA 4LNNA 1L2AA 4A3OA 4ZYSA 5MPOA 2IY1B 4TQ0A 1HMUA 4E1YA 2HTHA 1JWMD 1P7EA 2V0GA 4C4VB 1FRRA 3CU7A 1SEBD 1GAHA 1ZPSA 3L4PA 3DRAB 1IPGA 1I4XA 2DAFA 1WJUA 4MSMB 2BWFA 3IBEA 1RYJA 3GLYA 2H6HB 3B2FA 4IW0A 1WY8A 2LFIA 2ACZB 1JRPA 4Z4JA 1OTRB 2WDAA 1SE3A 1HEZE 1C78A 2BVCA 3JYUA 4RH6A 3AEGB 1UH6A 3L17A 2LEKA 4WVCA 3PZ1B 4KZCA 5DGRA 2DZIA 1TS2A 1M94A 4KSKC 1YMHE 2ZCBA 2MWSB 3Q73B 1EF5A 3M7LA 2RI8A 4AS1A 5FO9B 3GP7A 3TCAA 2MLBA 4HPPA 3ZJTA 4LNGB 1FO4A 3HXFB 2Z07A 1FRDA 3D5SA 1F9JA 1UUPA 5ILDA 2KWDA 2XQWA 1G6JA 3PYAA 2INPE 4BOKA 1P0RA 1GG3A 3TIXA 1C3DA 4GDKA 3NRZA 2LXCA 3ZRFA 1XQQA 2H88B 3BVMA 2AL3A 3P4QB 4JL9A 3P2CA 1WRIA 1OJNA 4W9JA 4MSQB 1QOBA 1DL2A 5GXGB 2PE6B 2SAKA 4IOIE 2E3TA 4M0WA 2AEHA 1N1BA 3K9PB 2IO2B 3AECB 3PZ8A 1WWTA 1V7WA 3E73A 3S4BA 1PGBA 3QCAA 5L95C 4QT9A 1I4RA 1UNSA 4FXCA 5IO9A 1GPXA 2BYTA 4A8XC 5H8YE 4GMVA 1X1MA 3VTVA 1LO5D 2W82A 4ONTA 3SHQA 2IGDA 1QAZA 3RZWC 2WS3B 3EFUA 4KSLC 4ZH5A 5D6JB 1QQRA 1KLGD 2DAJA 3MJWA 4JWSC 1WI0A 1IS9A 2JXXA 1O5MB 1C76A 3TEYA 2WDRB 4HDQA 1C4PA 5IOIA 1FCCC 1LOHA 3KUDB 1JMLA 4OVVA 2N9LA 4WU0A 2CHWA 3R66C 1O1TB 2LMCA 3NS8A 4LNKA 1YNTE 1JWAD 3NUHB 3EUB2 3PYBA 4WVAA 1SB3C 2ZEQA 4HJKA 3U52E 2KDFB 2D3CA 5HFYA 4US9A 3M62B 4US8A 1L5PA 1W3YA 1Q10A 5DPSA 5FKAC 1T0QC 1KLUD 2PLPA 1FFUA 3KWLA 1NL4B 1FT1B 3NNBA 2NOJA 3KVFB 3TL5A 1T0RC 2D5GA 3H2WA 3ZKJC 1P98A 1EM7A 4WQOB 3M00A 2M56B 1HN0A 2ZVOA 4OZVA 3ZQ4A 2ZPYA 2D11A 1H39A 3E6UA 1T0YA 5I4DA 4BOJA 1YN3A 2KLGA 2QMTA 4KVGB 2NBUA 1WGRA 5GZKA 4MELA 3A4RA 4REZA 2BYEA 3ABVB 2FBAA 4LNIA 1E6EB 2RPQA 4AJWA 3FILB 2N9XA 2REXA 4DXFA 5CA3A 1P3QU 4RFBA 2VN7A 1VR9A 4TQ1A 2JPHA 2FBWB 4DBGA 3RJ3A 1YQBA 1JCQB 3H7PB 1H4RA 3DPDA 1X81B 1KM7A 2KD0A 2LHEA 4GTTB 5FR6A 5BYSA 2JZPA 3BYYB 4IM0A 1MHXA 5DCNA 2B39A 2SEBD 3KLSA 3QJZA 4MGZE 2OJWA 1JW9D 1L1YA 4PK1A 1V5OA 4C56C 4WQMA 1N5WA 1ZDXA 4YDEB 2C9WB 1GA2A 3DHIC 1L4ZB 2KDIA 1O79A 4XWWA 2WIIB 3WAMA 3AEDB 1XLOA 2V9HA 3NVZA 5DHKA 3ZNGC 1FEHA 3UI3A 4L23A 2WXIA 4GL3A 5ILKA 5HHDG 3QWTA 5E6JA 1D8EB 2CS4A 3ZGZA 4EZJA 1N4PB 4PYZA 3ML8A 2WX1A 4BBNF 3HUIA 2JY6A 1AWDA 1ZKHA 2LGDA 2W54A 1WYWB 3O13A 3GE3C 4ITKA 2PMVA 3Q79B 2M19A 1IUEA 4AYRA 4GOCA 3VR8B 1D8DB 3IG3A 3Q75B 2EABA 2BPSA 4IDIA 2XK5A 3N32A 3NVYA 1AW7A 1SE4A 1OQQA 2KACA 3JSVB 3UQAA 1XXGA 3PGEA 3R7RA 1VZ7A 1G87A 1P7FA 4ZRPA 5AUKA 1F2RI 1EUVB 5E6PA 2N7JA 5H92C 1RFAA 2KQSA 4ZOHC 4ANVA 2KFJA 3S4CA 3AE2B 1PFDA 3PVLA 3QPFA 4YXDB 1S64B 1ESFA 1MFWA 3CMMB 1CQVA 3RULA 4WWOA 4HEA1 4WAAA 3SFDB 4JE3B 3HRDD 1UWXA 2BB5A 1J0NA 4AYPA 2KDEB 2BQQA 3E34B 3HHMA 3APDA 5TSSA 3SDTA 4KKJA 4IM2A 1GUAB 2WDVB 3AEAB 2WXOA 4WIPA 2KT7A 2KWCA 2AQ2B 1U4AA 1ZXHA 2L76A 3Q3JA 4GAXA 2WXQA 3O65B 1TKYA 1LM8B 2OEDA 2WDTB 4K7WA 1XO3A 4DWFA 2KTFA 1N7PA 1N9AB 2BWES 3M7BA 2LUEA 3KWVA 3CWIA 2D2QA 2BBCA 3AE1B 4CYEA 1L0YB 1RLFA 1MG8A 3RPFC 2NPTA 2JWUA 1PGXA 1Q1OA 4RM8A 3Q3OC 2QILA 1WZ3A 3A9JA 2D10A 3B08A 4BAXA 2KDMA 5EE9A 1O1SB 3R3MA 1D6EC 2ZW1A 1N6ZA 4W9KA 4L9PB 2DZMA 2YIKA 1BUIC 2QJLA 3DBSA 4EE2A 3IFWB 2RDGA 1SA5B 1RAXA 3C19A 4OZAA 4OVUA 2MH7A 3BINA 4EFOA 4TMAB 1HV6A 1VLBA 3LB8C 1E7VA 4GN1A 5CX3A 5BO4B 1LGRA 3WA0A 2L3ZA 3DVGX 4LDTD 2PKOA 2QDFA 1ACCA 1KZPB 4FJQA 2I07B 2M1MA 2J42A 5IL8A 1KWFA 3W5NA 3PLUA 3EA6A 2KX0A 2BF8B 4GTRB 2L0FA 1WRDB 3WALA 1IBXB 4OZWA 2FCMA 5BMHA 1E5WA 4GTOB 4DHJD 4MACA 3L54A 5HKHA 3N20C 3QG0A 3DVGY 5L83A 4WWMA 4ZRIA 1FAEA 1O1RB 2LVQA 2V3NA 2WU2B 4WH4A 4LCDE 3P2BA 5TR5A 4EEWA 2MBHA 1TZ1A 2BEDB 3BK1A 2J4XA 1XLNA 1L6UA 5ILHA 3A9KA 2KFKB 1EU4A 2F0YB 3W7UA 4BOSC 4MEMA 1CJEA 1AARA 3HXBB 2N7DA 3H6NA 2VRRB 1FXIA 1G6IA 3Q3FA 1TNBB 4TXTA 2X03A 3AEEB 5JXVA 3Q8EA 2E6XA 1V2YA 3KLSX 4KV2A 4M8NA 1ET9A 1SBBB 3DBRB 4R3DA 4RGTA 4USAA 3QT9A 1SIJA 3ZRCA 2LWPA 1YIWA 1UMPA 3KSLB 1J8CA 3PHWB 4DDID 3PS6A 4A6QA 3HM6X 4DHJB 2O6VD 4EZLA 2LGIA 3M74A 1HXCA 2RR9A 3APCA 3UF8A 1NC5A 2FIFA 1CMXB 4JJJA 3TUOA 3V60A 3GB1A 2CQTA 1W6KA 3QFYA 1KSDA 3HIZA 2FIDA 2V8KA 4MBGB 4M02A 1HM3A 1IBXA 3MC9A 3VR9B 5MEHA 5ILZA 2EMSA 1WXSA 4W9FA 2VZKD 4HROA 4ANWA 5KHOA 4FHJA 1B9RA 4GTQB 3FKYA 3TEXA 1NYQA 1N62A 4Q2BA 4TKNA 3GS2A 2CR5A 1KF6B 1FPYA 3AFLA 3ZJUA 4CE7A 3UIPB 3QIJA 3OEDA 1E7UA 1LF6A 2ASQA 3S2AA 2KHWB 4W9CA 5C3JB 2KO3A 1H37A 3PZ4B 2AL6A 2KFKA 1PQSA 2K8BA 4ACFA 2RGKA 2K6QA 3BK2A 4H2AA 3E9SA 3MHSD 1TN6B 1QQFA 1JQ4A 3URYA 3RNFC 3DQVA 2JT4B 3X17A 1TF4A 2ZIRB 2Q5WD 5EATA 1ISNA 3NY5A 3JVZX 2NCNA 1RWAA 3Q14C 2KMMA 2JRHA 3CF6E 2D5JA 1VJKA 1V1PA 1O6RA 5KKBA 2YVCA 4IWQA 2HTME 1F2RC 1O6QA 1PYWD 4JIOU 1WX9A 1BXTA 3AEFB 1J0GA 1H36A 5D7GA 2KX3A 4M00A 2MP2B 1FNUA 2V4LA 2DNFA 2YLMA 3H7LA 4IWOA 5IK0A 1L7YA 1HMWA 4ARIA 3QARA 3E33B 4LK0M 1WMHA 2RD0A 2IZVB 2L52A 4C00A 2WY8A 1MZCB 4ANUA 1HXYD 3DSSB 3P63A 3A3VA 4B9KA 2VH2A 3RNEC 1V8CA 4IG7B 2JXTA 1OQYA 3ON6A 2LVPA 3ZNHB 2ONQA 2H6FB 3HXCB 3DSXB 4AUQC 5LXHA 2V8IA 3WIRA 2ONGA 2J52A 2Y3AA 3RT3B 1BT0A 3QHTA 3EC8A 1HXAA 5IK9A 1TS3A 1EF1A 2LGXA 3VFKA 3AE9B 2LGYA 5GMVA 2ZNVB 1YX6B 3KUZA 1CLCA 1H3AA 2CHXA 1WMHB 3I63C 2NBWB 3IAM1 3M3JA 4BKTA 2ZISB 1YOVB 5DGQA 2WXJA 2A8ZA 2BB6A 1UT9A 1JRUA 1TS5A 2BW2A 2LRUA 3B2GA 3DHHC 1KFGA 2OJRA 5IA7A 3AMZA 4LIXA 3DDCB 4KIKB 3VVWB 4L0GA 4KKIA 4BKSD 2MCNB 1F0ZA 3Q7FB 3BVGA 1X9DA 5EASA 3SEBA 1C4CA 3N30A 4MU9A 1ULVA 3HVZA 1WJNA 5CZLA 4KTRA 3SDQA 3DSVB 4HLEA 4G50A 1Y8RC 3T3OA 4JPSA 4D94A 1XT9B 1OEYJ 3V3XA 3ML9A 1QZEA 1YQ4B 1YJJA 2WQYB 1HA5A 2EACA 4CJ0A 1V9JA 2O2VA 3A9KB 4D4AA 3VHTC 2SQCA 1MHHE 1TN8B 3VW5A 3RSYA 2CU1A 3EHVA 2IBIB 2IO3B 4NQKE 2WINB 1WYGA 4WURA 4E71A 1ZDVA 3NZ3A 1HZFA 4NAWA 1K52A 2R2OA 1TY0A 5IN7A 4S0RA 4GTVB 1WE6A 1KRHA 3DVNU 4LJOB 4HKZE 5IAAC 2XFGA 1FM0D 2XEWA 2DRRA 3RNBC 3P42A 2GBJA 1FO2A 5CD2A 1OJMA 5D94A 1J19A 2HJ8A 1FIQA 3VUYA 2MJ3A 2L8JA 1WXMA 4NPNA 1L0VB 4ANXA 3RX8A 5BYRA 1V80A 2LJ5A 4IUMB 1T3QA 1IGCA 4FXGB 4UDUC 3UIOB 1HTOA 3DPYB 1TGZB 1TT5B 3BYTB 1C3TA 4ZHPA 2BRVX 1WX7A 4OZCA 2MBBB 4C1SA 2GH4A 2KMAA 3KUCB 4RCOA 1WJ6A 4HPMB 2B76B 3Q8CA 1TNZB 4CJ1A 4E3CA 2I1JA 1TNYB 2GBNA 5HI1A 4K7UA 2FUZA 3KSQB 5FO7B 4XGAB 3ZDMC 1SQCA 4P7IA 2K8HA 4B95A 1I8QA 3FC4A 5DPTA 3E56A 3QDEA 4F8CB 3R2IA 3NZSA 4KZ0A 4AQ7A 1SE2A 1YN4A 2G9HD 3PV1A 5C23A 2PPHA 1TYGB 1DOIA 4I6LB 3KH0A 4DOEA 2N7EA 3AXCA 3ZVVA 3KW5B 3A9JB 2FNJB 2LVOA 2Y5CA 2Y5PA 4TF4A 2JF4A 3SFYB 2D3BA 4IC7B 1KLVA 2BTEA 2ZCCA 2K25A 2RI9A 1FBOA 2MBEA 4J5TA 4WVBA 2K1FA 4GDLA 2L83A 2CHZA 2ZZRA 2G4SA 1SE9A 1YD8U 4TSSA 4ZH1A 4RGMA 3K7XA 1WGKA 1N4QB 1GC7A 1LTXB 3NG0A 1QKZA 4RMAA 4GTSB 2M17A 2DX5B 1UGJA 1SF0A 1FFVA 1S1QB 3AM9A 1L4DB 4MMHA 4D2KA 1ZXIA 1LQBA 2MHJA 4HCPB 4HK2A 2AHGA 1JS4A 5C2TB 4RM9A 3WIMA 1GXMA 4WJNA 2HJ1A 1V5CA 2K3UA 2ZNVC 3VQIA 1WU6A 5JPNB 1YJIA 2WXFA 4TUUA 2VN4A 1FO3A 1VD5A 1WGDA 3GZNI 5C05A 1WXVA 1KTKA 3ZO5B 3L16A 4ZYNA 5IKHA 1LFDA 1FBWA 3B9JA 3LDZE 1WZZA 3ACSA 5JPMB 4Q88A 5BYQA 3DSUB 4Q2JA 1E9MA 1QOGA 4NJCA 2JWZA 3DSWB 4RNQA 3AE7B 1N94B 2ICIA 4HKQA 3J9CA 1EWCA 1TY2A 2DRSA 4XUVA 4TV3A 4JGHB 2EKEC 1IA6A 2MEKA 1V49A 2QSDA 1IGDA 3QXFA 3W7SA 4HJGE 1TZOA 2RGFA 3CSTA 3BVZA 3W5VB 4AOFA 2GB1A 4M8MA 2HD5B 4P1CC 2ZPNA 1NYRA 3JSVA 2BYVE 3NZUA 3Q78B 5DPRA 2WX0A 3HM3A 5JHBA 2JX5A 2NVUI 4FNVA 1R4MI 3SDLC 1STEA 2MX2A 1JWBD 5AEKB 4C7YA 4GIVA 4BFRA 5E2JA 1ET6A 3M71A 2ZJDA 4IKGA 2VH1A 5E6OA 2BKRB 1GXOA 1XLPA 1J0MA 3PTFC 1H35A 1H8CA 1T5XD 1ZOYB 2O6VA 3PHXB 4M0WB 4YTMB 5ILYA 1FP3A 1GB4A 3OWEB 3T9LA 4DODA 2KYWA 2FUHB 4P16A 2CQSA 4A55A 1YX5B 3DWGC 4W9LA 1OQRA 2MRPA 1T6BX 1R76A 3AN1A 3TJPA 1R4NI 1WSPA 4BZAA 1LXMA 4BVUC 1K50A 4K7SA 2GRIA 2QIEB 1N7NA 2E22A 2LI5A 3L08A 4WAFA 2J7QB 2J53A 1AN8A 1R4NB 2CU3A 4OK4A 4OVZA 3W1YA 2GOXA 2YEPB 1UZXB 5IM1A 1KFYB 3C0RB 2G02A 2PW9A 1RWGA 2G1EA 3ZW3A 1SIFA 2KTRA 3VXDA 2KC2A 2LHDA 3ZNID 2N9PC 2N1WA 2ON8A 3M77A 3G4FA 1I4PA 2WP9B 2KNBA 4RGOS 2H6IB 1V97A 1WU4A 1ZW7A 1E8WA 1GOZA 2PN5A 4YTPB 2QC8A 1ZGUB 3ZDTA 2W9NA 3NJTA 1WE7A 3MP9A 3D5RA 1EWYC 3L13A 1VZ8A 2QNOA 4XX5A 3WAPA 2DYBA 3AE6B 4LNFA 2UWQA 2B4FA 3WKHA 2GBKA 2YEPF 1A5RA 3WKFA 4ICUA 2XNAC 1N95B 1S63B 2Z0DB 4RF1A 3W5UB 4NAWB 4GGQA 1QOAA 4HRSA 1NI2A 3VH4B 3L0WB 4NQLB 1D5MC 1N1ZA 3AE5B 3N0FA 1V1OA 2I1KA 1N7OA 2KJHB 3I9V1 3Q69A 3QXQA 5AUIA 1C9FA 3UQBA 1KOTA 1PDXA 1S3SG 5DPWA 1N23A 1V81A 4MMIA 2WYNA 2BS2B 3AU4A 3S4DA 5KHQA 3SU8X 4MM3B 4A90A 4BBNC 2JUOA 3M7EA 2J0KA 4I6PA 2Y5BB 4XWTA 4FBJB 1WGYA 3K9OB 3H3KA 2G3QB 3L10B 2FV0A 4WWPA 1XF5L 4YT0B 5T8IA 1CB8A 1LF9A 4M76A 2G45B 4WJPA 4YWGG 2QCZA 3V6CB 1D3ZA 2IGGA 4HPLB 3RI7C 3RCZA 3Q2AC 3WC3A 2MBQA 4PT5A 3UGBB
chains in the Genus database with same CATH topology
1QLBB 5D7GA 2AFAA 1JCRB 1JMLA 4YSZB 3WIQA 2KQ4X 1FNUA 1JWUD 2N9LA 1E0ZA 1KS8A 4WU0A 3SAEA 1O1TB 3H7LA 2BS4B 1XCTL 2LMCA 1JALA 1NXCA 2DROA 5HG2A 1YNTE 1JWAD 3NUHB 4ARIA 1QOFA 3EUB2 3PYBA 3P4RB 4WVAA 5FOBB 1V1PB 3E33B 4LK0M 4P6VF 4DXGA 1SB3C 1RWSA 2IDYA 3U52E 2A73B 1CEMA 3RFZB 2L52A 2QEJC 2WY8A 1F9DA 1MZCB 2ZBLA 1HXYD 2ZW0A 3DSSB 3P63A 3A3VA 4AYOA 1C79A 5HFYA 4US9A 1V8CA 4US8A 1L5PA 1XW2A 1Q10A 1K53A 2JXTA 5FKAC 3M78A 1I4HA 1KLUD 3ON6A 2PLPA 2WY7A 1FFUA 2NTTA 3AE3B 2ONQA 3KWLA 5D3IB 2H6FB 3HXCB 1NL4B 3DSXB 5EE1A 1TN7B 2H6GB 2V8IA 1NEKB 3WIRA 1FT1B 2J52A 2Y3AA 3OXUA 2IPKD 1SA4B 2NOJA 3EUVB 1DOXA 3V05A 2D5GA 1TS3A 3H2WA 5G5HA 3W5MA 1EM7A 3AE9B 3I57A 3LXFA 1N61A 2M56B 2R61A 1LD7B 1ZUD2 3C72B 2K9XA 3ZQ4A 1CLCA 1H3AA 1H39A 3E6UA 2GZ6A 4ZRQA 5I4DA 3IAM1 4BOJA 1YN3A 2QMTA 4GDLB 2ZISB 2WXJA 1KSCA 5DGQA 2A8ZA 5GZKA 2FUG1 2BB6A 1MI0A 4REZA 1E7PB 1UT9A 3ABVB 2FBAA 4GLSC 1TS5A 2BW2A 2IJ0A 1E6EB 2WLBA 3B2GA 3FILB 1KFGA 2R2LB 2IGHA 3U4EG 3AMZA 4LIXA 1GB1A 2EKIA 4L0GA 4KKIA 1C4AA 4L1BA 1ENFA 1KH0A 4DXFA 5CA3A 4RFBA 4TQ1A 2VN7A 3Q7FB 1R7SA 1VR9A 3BVGA 3LYYA 1F0ZA 1X9DA 2PVOD 3AEBB 4D4BA 2W3SA 3SEBA 1C4CA 2FBWB 1DCEB 4MU9A 1ULVA 3RJ3A 3HVZA 4FUSA 5CZLA 1QILA 3PO0A 1JCQB 4KTRA 3SDQA 3DSVB 1X81B 2LHEA 4KX6B 4GTTB 2PTLA 5BYSA 3T3OA 2JZPA 3AE8B 2V3PA 1GLMA 4D94A 1DGJA 2K5PA 1MHXA 2WDQB 2XWBB 1H13A 1YQ4B 2JQRB 2BT6A 2M0AA 1YJJA 2B39A 2WQYB 2SEBD 3KLSA 1HA5A 3P4PB 2EACA 2CJOA 4CJ0A 4EL8A 1JW9D 3QT3A 1L1YA 2AX5A 4D4AA 4JX1C 4A9AA 4C56C 2SQCA 1MHHE 3HXDB 4WQMA 1TN8B 1N5WA 1ZDXA 3VW5A 1K72A 4YDEB 4Z4LA 1GA2A 3RSYA 1L4ZB 2WNMA 1O79A 1EU3A 3W2DA 4N58A 4XWWA 1VRAB 2WINB 1WYGA 2XN9C 4WURA 2WIIB 1ZDVA 3TSSA 1FNWA 3AEDB 3NZ3A 1HZFA 2OKXA 1K52A 1TY0A 1XCQL 1KKTA 1XLOA 3NVZA 4GTVB 1FEHA 1KRHA 1NENB 1RQ5A 3BIID 2BS3B 4L23A 1UWMA 3UI3A 2WXIA 3VRBB 4GL3A 1B1ZA 4HKZE 4YTNB 3RX5A 2XFGA 1FM0D 3QWTA 5E6JA 1J7AA 5HHDG 1D8EB 2DRRA 2I38A 3SQCA 2MJEA 3ETRA 3ZGZA 3P42A 1QF6A 1FO2A 1N4PB 3PZ2B 5CD2A 3SDVA 1G9JA 1JROA 3EQAA 1FIQA 2MJ3A 1RM6C 1XWQA 2PVGC 3SDRA 3HUIA 1AWDA 1FXAA 1L0VB 3RX8A 3AFJA 1K51A 5BYRA 2INNE 1D4BA 2W54A 1SXTA 1T3QA 1IGCA 1GAIA 4FXGB 2MJDA 3O13A 4UDUC 3PZ3B 1QSJA 3W9CB 4ITKA 2PMVA 3Q79B 1XEEA 3DPYB 1GAQB 3BYTB 3H8HA 3Q8AA 4XE0A 2M19A 1IUEA 4AYRA 4ZHPA 1FCEA 1LD8B 4OZCA 4L2YA 3VR8B 5M7IA 4C1SA 1D8DB 1AYFA 4NZLB 3IAS1 3Q75B 2EABA 2GH4A 4RCOA 4CQNA 4IDIA 5D3DA 2V4IB 2B76B 3Q8CA 1GSZA 1TNZB 1VZ6A 3RX7A 4CJ1A 1FT2B 3NVYA 1AW7A 3BZDB 1SE4A 1TNYB 5HI1A 1OQQA 2KACA 4RF0A 2EADA 1XXGA 2AQ3B 3Q8BA 2FUZA 3DSTB 1VZ7A 2NTSA 1JCSB 3KSQB 1G87A 5FO7B 1P7FA 2W55A 3C8YA 4ZRPA 1SQCA 5AUKA 1F2RI 2N0SB 3NS1A 1QBQB 3FC4A 3E56A 1N5XA 1TNUB 3QDEA 4LNBB 1N4SB 2N7JA 3R2IA 1J7BA 5H92C 4ZHOA 1TS4A 4AQ7A 4V1SA 1PUTA 3P4SB 4ZOHC 1W6JA 1SE2A 1YN4A 3W1SA 2G9HD 3S4CA 1DOIA 1L0XB 1TYGB 2L1AA 2RDHA 4KGSA 3AE2B 4DOEA 1PFDA 4D4CA 1FD6A 5FR3A 2PIAA 3S4AA 3QPFA 3AH7A 4JWUC 4C7ZA 4YXDB 1H3CA 1S64B 1ESFA 4MH8A 1CQVA 3ANJA 2VZKB 4HEA1 1FPPB 3NVVA 2Y5CA 1V7VA 1YQ3B 2Y5PA 4TF4A 3SFDB 1AGMA 2JF4A 3SFYB 3HRDD 1UWXA 2BB5A 4JE3B 1QT9A 4AYPA 2BTEA 2DLBA 3E34B 2RI9A 2CJNA 1FBOA 1H12A 4J5TA 4WVBA 2EELA 5TSSA 3SDTA 4LNVA 3D3IA 4KKJA 3NVWA 2L83A 2WDVB 1WXQA 2WXOA 3AEAB 3DWMA 4WIPA 4N6EB 2JU6X 2ZZRA 4EHMB 2AQ2B 4TSSA 4ZH1A 2WXLA 1ZXHA 3K7XA 1WGKA 1N4QB 4RGMA 3N9YC 2DYMA 3WKIA 3MC0B 1LTXB 2P0VA 2WXQA 2RMMA 3SR6A 1QKZA 1TKYA 1WU5A 3M72A 3T3NA 2OEDA 1I4QA 2V8JA 4GTSB 4FXKB 1UGJA 2LJIA 4GDKB 1XO3A 1SF0A 1FFVA 3P1MA 2FE8A 1N9AB 2JYTA 3HXEB 3M7BA 1L4DB 2KN4A 2WXNA 3AM9A 1TKEA 3KWVA 1ZXIA 3CWIA 4D2KA 5EE0A 1ROEA 2BBCA 4V1RA 1BMLC 2AHFA 3AE1B 2H89B 3AB5A 2JJBA 3P5RA 1HQRD 2WXGA 1L0YB 1H14A 1PGAA 2TSSA 2AHGA 1JS4A 1F77A 5C2TB 3RPFC 4LLGM 4LTUA 2JWUA 1GXMA 2WXMA 2JSVX 1PGXA 1AYXA 2WXKA 3BWUD 2I2YA 1V5CA 1H3BA 2K3UA 3VQIA 1WU6A 3QSPA 2QILA 5JPNB 2L32A 3G6JB 1GHQA 1XLQA 1YJIA 2NMQA 4J3OD 2WXFA 2KDMA 1OFFA 5EE9A 2JG0A 1NI1B 1O1SB 2VN4A 1FO3A 1D5XC 1N60A 2DWQA 1VD5A 1V5DA 1C77A 1KRFA 3M76A 1D6EC 2ZW1A 3AV8A 3MJ5A 1KTKA 4L9PB 3W7WA 1NI3A 2YIKA 3EGRA 3TEZA 1BUIC 1ZP0B 2QJLA 4YSYB 1DYQA 4EE2A 4RGNA 2RDGA 1SA5B 4XDDA 3B9JA 3E30B 1FBWA 4OZAA 2K0PA 1JWSD 1WZZA 2MH7A 3ACSA 5JPMB 1CK1A 4Q88A 5BYQA 1N63A 3HVDA 4TMAB 3DSUB 2WU5B 1VLBA 3LB8C 4Q2JA 4OZBA 1E9MA 4KGRA 1QOGA 4NJCA 3WCQA 3PZ7A 1JCKB 4O1NA 3TEWA 2PKOA 2N9KA 1E10A 4GTPB 1ACCA 1KZPB 3DSWB 3AE7B 1N94B 4N59A 2ICIA 2HDEA 1O6HA 2NVPA 4MT5A 4HKQA 3J9CA 2I07B 1EWCA 1TY2A 3FAHA 4KTPA 2DRSA 4XUVA 2J42A 3TF4A 3IXSA 1IA6A 1KWFA 1KZOB 3W5NA 5EE3A 3V3XA 2IEJB 2MEKA 4B0EA 1KREA 2QSDA 1IGDA 3EA6A 3QXFA 4GTRB 3W7SA 4HJGE 1N4RB 1VDVA 1TZOA 1D5ZC 1IBXB 3BVZA 2AQ1B 4L6XA 1CZPA 3W5VB 3Q7AB 3FILA 5FK9C 5BMHA 3IT6B 4GTOB 3Q8FA 1FMIA 3S9VA 2EAEA 4AYQA 5GW7A 1SSNA 2GB1A 4MACA 2RPVA 3GT5A 1NYRA 3ZJVA 1SJHD 3QG0A 3R2TA 4KGTA 2XWJB 1XWTA 1TJEA 1GXNA 4WWMA 1HZ6A 3R8BA 3Q78B 2DRQA 1FAEA 1O1RB 3WKGA 2JX5A 3EU5B 2LUMA 2V3NA 3ZYYX 1STEA 1JWBD 4DQOC 1SJED 2WU2B 4WH4A 1FNVA 4C7YA 3GZKA 1F9OA 5E2JA 1ET6A 1G9GA 1L2AA 4ZYSA 5MPOA 3M71A 1HZ5A 4TQ0A 2BEDB 3M75A 3BK1A 2J4XA 3M7CA 3WIWA 1XLNA 1JWMD 1P7EA 4IKGA 1J7CA 2V0GA 1FRRA 3CU7A 1L6UA 1GXOA 1SEBD 1XLPA 2Z8LA 1H35A 4YCRA 1GAHA 1ZPSA 3L4PA 3DRAB 3ANKA 2F0YB 1EU4A 3W7UA 1I4XA 1T5XD 1ZOYB 1MPEA 1CJEA 2DYOA 3HXBB 4YTMB 3CIRB 1RYJA 1FXIA 4YSXB 1G6IA 1FP3A 3GLYA 1TNBB 1GB4A 2H6HB 3B2FA 4TXTA 2LFIA 3AEEB 4DODA 1JRPA 4Z4JA 2ACZB 3OWEB 3Q8EA 5G5GA 1IA7A 1MVKA 2E6XA 1SE3A 1HEZE 1C78A 4P16A 2CQSA 3KLSX 4A55A 3DWGC 4RH6A 1ET9A 3AE4B 5FO8B 3AEGB 1OQRA 1SBBB 1T6BX 4R3DA 2LEKA 4RGTA 1R76A 3AN1A 4WVCA 4USAA 3PZ1B 3QT9A 3SFEB 5DGRA 1WSPA 1TS2A 4GTMB 4RNAA 3EZ8A 1SIJA 3W7TA 1ZE3D 1UMPA 3KSLB 1H54A 3E32B 5M7YA 1YMHE 1K50A 3Q73B 5GY3A 3SFXB 2G0DA 2GRIA 3M7LA 2RI8A 2F6DA 2QIEB 5FO9B 4A6QA 4AS1A 2LGIA 3M74A 2WXHA 3GP7A 4D4DA 4NAMA 1FMAD 4WAFA 2FV1A 1NC5A 2J53A 3ZJTA 4LNGB 4JJJA 1YN5A 1AN8A 1FO4A 3HXFB 3CIHA 2CU3A 3TUOA 2Z07A 2KAJA 3GB1A 1FRDA 2CQTA 3PMMA 3D5SA 4YDOB 4OVZA 3EU8A 1W6KA 2GOXA 3QFYA 1KSDA 2YEPB 1A70A 1UUPA 1KFYB 2KWDA 3MHZA 2G02A 2XQWA 2V8KA 2G1EA 2PW9A 3PYAA 4MBGB 3RRSA 2INPE 1IBXA 4BOKA 4OW0A 3VXDA 2LHDA 5AGDA 1HCUA 3VR9B 5MEHA 1C3DA 2ON8A 3M77A 1I4PA 3NRZA 2WP9B 2VZKD 4RGOS 3U7ZA 2H6IB 1V97A 4HROA 1WU4A 1B9RA 4GTQB 1GOZA 2H88B 3BVMA 3TEXA 2PN5A 1NYQA 4YTPB 1N62A 3T33A 1I7HA 3P4QB 4Q2BA 3GS2A 3M73A 3P2CA 1WRIA 5BMGA 3MP9A 3D5RA 3RENA 1EWYC 1KF6B 1DOGA 1VZ8A 2QNOA 1RFKA 3ZJUA 4CE7A 1QOBA 3OEDA 2WXRA 3AE6B 1DL2A 1LF6A 3KQ4A 5GXGB 1DOYA 2B4FA 3WKHA 2JYEA 2SAKA 2YEPF 5C3JB 3WKFA 4IOIE 2E3TA 2X38A 2XNAC 1N95B 5LNK1 1S63B 4M0WA 1H37A 3P5PA 3PZ4B 4ZG8A 3AECB 3PZ8A 1WWTA 2GI9A 1V7WA 3E73A 4RF1A 1M4VA 2RGKA 4NAWB 3W5UB 1TKGA 1QOAA 4HRSA 1FCLA 3BK2A 4H2AA 3S4BA 3E9SA 1D5MC 3QFZA 1I4GA 1PGBA 3AE5B 1TN6B 3ANIA 4QT9A 1QQFA 1I4RA 1UNSA 1V1OA 2W3RA 4FXCA 3URYA 4C80A 1JQ4A 1GPXA 2BYTA 3I9V1 3Q69A 3QXQA 1NVID 5AUIA 5H8YE 3X17A 4A8XC 1C9FA 2OHFA 4OHJA 1LO5D 1TF4A 1PDXA 2W82A 4ONTA 2ZIRB 1L6VA 2Q5WD 3MFGA 4ARCA 3VRAB 3ACTA 2WYNA 2IGDA 2BS2B 3W7XA 3BYYB 3S4DA 5JXVA 4A90A 4MM3B 5BMIA 2KMMA 3E37B 3IT4B 3M7EA 3WUXA 1TNOB 2WS3B 4XWTA 3QRYA 2D5JA 3H3KA 1VJKA 1V1PA 4ZH5A 1O6RA 4B0MA 2D8LA 5KKBA 4XDCA 2FV0A 1QQRA 1XF5L 4YT0B 5T8IA 1KLGD 4JPSA 1Y56A 3SDUA 3U2SC 4JWSC 1LF9A 4M76A 2K22A 4YWGG 2HTME 1IS9A 1F2RC 2WXPA 1V7XA 1O5MB 1C76A 2IGGA 3TEYA 1O6QA 1PYWD 2WDRB 1C4PA 3K11A 1BXTA 3AEFB 1UG9A 3WC3A 2DBYA 4PT5A 1H36A 1FCCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4P B;  1GXM A;  1R76 A;  3PZ2 B;  1JCR B;  3PZ1 B;  1H3B A;  4GTM B;  5JPN B;  3G6J B;  1GHQ A;  1UMP A;  3KSL B;  3E32 B;  1O1T B;  3Q73 B;  1NI1 B;  1O1S B;  3SFX B;  2G0D A;  4FXG B;  5FO9 B;  3PZ3 B;  5FOB B;  1QSJ A;  3E33 B;  4D4D A;  2PMV A;  3Q79 B;  4LNG B;  3DPY B;  2A73 B;  4L9P B;  3HXF B;  2WY8 A;  1MZC B;  1LD8 B;  3DSS B;  1SA5 B;  4C1S A;  1D8D B;  3E30 B;  3D5S A;  3Q75 B;  4YDO B;  1W6K A;  2GOX A;  5JPM B;  1GSZ A;  2G02 A;  1TNZ B;  2V8K A;  2XQW A;  1FT2 B;  3DSU B;  2WY7 A;  4MBG B;  4BOK A;  2H6F B;  3HXC B;  5AGD A;  1NL4 B;  1TNY B;  3DSX B;  1TN7 B;  2H6G B;  2V8I A;  1FT1 B;  1C3D A;  3OXU A;  4GTP B;  1KZP B;  1SA4 B;  2NOJ A;  1N94 B;  3DST B;  3DSW B;  3EUV B;  1JCS B;  1O6H A;  3KSQ B;  5FO7 B;  3U7Z A;  2H6I B;  4ZRP A;  1SQC A;  2I07 B;  4GTQ B;  1LD7 B;  1QBQ B;  2PN5 A;  1TNU B;  1KZO B;  3C72 B;  1N4S B;  4LNB B;  2IEJ B;  1H3A A;  1H39 A;  4ZRQ A;  4V1S A;  4BOJ A;  1W6J A;  4GTR B;  3D5R A;  2ZIS B;  1N4R B;  2BB6 A;  3Q7A B;  3OED A;  4D4C A;  3KQ4 A;  4GTO B;  2R2L B;  1H3C A;  1S64 B;  1FPP B;  1N95 B;  4KKI A;  1S63 B;  1H37 A;  2XWJ B;  3PZ4 B;  1GXN A;  3Q7F B;  3SFY B;  2BB5 A;  3Q78 B;  4D4B A;  1O1R B;  3E34 B;  3EU5 B;  1DCE B;  2V3N A;  4MU9 A;  3RJ3 A;  1TN6 B;  1JCQ B;  1QQF A;  4LNV A;  3DSV B;  1X81 B;  4KKJ A;  4GTT B;  2V3P A;  4D94 A;  2XWB B;  4ONT A;  2BED B;  2ZIR B;  2B39 A;  4EHM B;  3KLS A;  4ZH1 A;  3K7X A;  1N4Q B;  4D4A A;  3CU7 A;  1GXO A;  1LTX B;  3E37 B;  1H35 A;  2SQC A;  3HXD B;  1TNO B;  1TN8 B;  3DRA B;  2F0Y B;  4YDE B;  2V8J A;  4GTS B;  3HXB B;  1O79 A;  1O6R A;  4FXK B;  2WIN B;  2WII B;  1N9A B;  4M76 A;  3HXE B;  1HZF A;  1TNB B;  2H6H B;  4GTV B;  1O5M B;  2BBC A;  4V1R A;  1O6Q A;  1D8E B;  5FO8 B;  3SQC A;  1H36 A; 
#chains in the Genus database with same CATH topology
 1QLB B;  2NPT B;  4YSZ B;  3DBH B;  2KQ4 X;  1JWU D;  2Z0E B;  1E0Z A;  1KS8 A;  3SAE A;  5DHI A;  2C60 A;  3EEC A;  1XCT L;  1JAL A;  1GJZ A;  5HG2 A;  4PS7 A;  1FD6 A;  1QOF A;  3QC8 B;  5FOB B;  3E7J A;  4P6V F;  4DXG A;  4K1R B;  2A73 B;  2QEJ C;  1F9D A;  3N1Z C;  3U30 A;  2KMC A;  5JZE B;  3DBR I;  4GB9 A;  3X0W A;  3AI5 A;  2WY7 A;  2NTT A;  3AE3 B;  4MH0 E;  5D3I B;  5JH5 C;  1TN7 B;  1UBQ A;  3WAO A;  3OXU A;  2IPK D;  1SA4 B;  3AUL A;  5G5H A;  1WM2 A;  5CHF A;  1N61 A;  2R61 A;  1TIF A;  1ZUD 2;  2K9X A;  3V61 A;  1V5T A;  2KQ7 A;  3X23 A;  1RRB A;  2GZ6 A;  4ZRQ A;  3N1X C;  3I3T B;  2A4Z A;  1KSC A;  3D32 A;  1MI0 A;  4GLS C;  2WLB A;  3N3K B;  2R2L B;  2IGH A;  1GB1 A;  4A20 A;  1C4A A;  2ZZP B;  1ENF A;  4YL8 A;  1R7S A;  4KDI C;  5C1Z A;  4NNJ B;  4W9E A;  3CSF A;  4LNO A;  4FUS A;  1QIL A;  3PO0 A;  1E8X A;  4K3B A;  4G3X B;  4KX6 B;  2PTL A;  2RSU A;  1GLM A;  1DGJ A;  4DI5 A;  2XWB B;  1H13 A;  2M0A A;  2JQR B;  3RYT A;  3ZIM A;  5J2R A;  1N22 A;  3P4P B;  3QT3 A;  2KWU B;  4JX1 C;  4ZRK A;  3M02 A;  2KXJ A;  3QA8 A;  1K72 A;  4Z4L A;  2WNM A;  3W2D A;  4N58 A;  2A5U A;  1VRA B;  4I6N B;  2MA9 B;  3G4D A;  1KJT A;  4NJ6 A;  3ZTD A;  3BII D;  1RQ5 A;  3N1Y C;  1UWM A;  3VRB B;  1B1Z A;  5IP4 D;  1J7A A;  3SQC A;  1QF6 A;  3SDV A;  3PZ2 B;  2G4D B;  5IL3 A;  1RM6 C;  1XWQ A;  2PVG C;  3RNG C;  3ZXV A;  3OJ3 A;  3A4S C;  4F7Z A;  2INN E;  1WGG A;  1D4B A;  2WGS A;  1GNU A;  4BKS A;  3M01 A;  3NHE B;  2INC C;  4X57 B;  4XE0 A;  1GAQ B;  2NR2 A;  4DHZ E;  1FCE A;  1LD8 B;  5M7I A;  3ZXR A;  1AYF A;  4NZL B;  3NOB A;  4CQN A;  1VCB A;  1GSZ A;  4NY0 A;  3RX7 A;  2JZ3 B;  1FT2 B;  4FA6 A;  4W9I A;  2EAD A;  4MM3 A;  4QAY A;  1JCS B;  2W55 A;  3C8Y A;  3EFC A;  1UEL A;  2IY0 B;  2N0S B;  3NS1 A;  1QBQ B;  2JVC A;  2KJR A;  1T0S C;  1N5X A;  1TNU B;  3DVN V;  3PRE A;  5CTR C;  4LNB B;  1WIA A;  1J7B A;  4XYC A;  4ZHO A;  2MBO A;  4V1S A;  3P4S B;  2LXA A;  2LZ6 A;  2MQJ A;  2L7R A;  1WFY A;  2RDH A;  2L1A A;  4KGS A;  1SGH A;  4AJY B;  2WCO A;  2PIA A;  4JWU C;  2PEA A;  3VTU A;  2KTR B;  2VZK B;  1FPP B;  5IK6 A;  3DBL B;  3NVV A;  4PYU A;  2FUQ A;  1AGM A;  5JHA A;  4K81 A;  3M63 B;  2KVR A;  1OJP A;  5J18 A;  1H12 A;  2BRP A;  4II3 B;  4LNV A;  3D3I A;  3H7P A;  3NVW A;  4F13 A;  2WXL A;  3RZF A;  1F1S A;  2C5L C;  2KDB A;  3N9Y C;  5G2N A;  2AYO B;  3WKI A;  2DYM A;  3MC0 B;  4FJV B;  2P0V A;  5JMF A;  2L05 A;  2RMM A;  3M72 A;  1WU5 A;  1EO6 A;  2V3S A;  2V8J A;  4FXK B;  4GDK B;  4URK A;  1L2N A;  3DCG A;  3N0G A;  3VH3 B;  2KK8 A;  1IYF A;  1TKE A;  3Q6B A;  2AHF A;  3ZUN A;  2H89 B;  3AB5 A;  1HQR D;  5J17 A;  2AWT A;  1P1A A;  1H14 A;  4PS8 A;  4HXD A;  1Q5W B;  4LTU A;  3RN9 C;  1C1Y B;  3A33 B;  2JSV X;  2WXK A;  3BWU D;  2I2Y A;  3JW0 X;  1UBI A;  4NJ7 A;  1GHQ A;  1XLQ A;  2NMQ A;  4EUT A;  1OFF A;  2PJH A;  2JG0 A;  1NI1 B;  2DWQ A;  2R2Q A;  1D5X C;  3MJ5 A;  4ZDV A;  2QHO A;  3W7W A;  4G11 A;  1DYQ A;  4RGN A;  4MGK E;  3E30 B;  2K0P A;  2MW5 A;  2E24 A;  2FCN A;  1N63 A;  1WX8 A;  3HVD A;  4BKG A;  4N9F 4;  2WU5 B;  4OZB A;  1RWH A;  5E6N A;  4FAD A;  3TEW A;  4O1N A;  2D3A A;  1E10 A;  4GTP B;  3TBL D;  4FJY A;  4N59 A;  3NFV A;  3Q3M C;  3V6E B;  2K8C A;  4EOY A;  2GOW A;  3FAH A;  2X8X X;  1X1H A;  3IXS A;  4B0E A;  2IEJ B;  1WM3 A;  2FCS A;  3HK0 A;  4M01 A;  1VDV A;  1D5Z C;  2KOX A;  2AQ1 B;  2DHZ A;  1CZP A;  3Q7A B;  3FIL A;  4DHZ B;  1Z2M A;  3IT6 B;  3Q8F A;  4AYQ A;  1SSN A;  5GW7 A;  2RPV A;  3GT5 A;  3ZJV A;  1SJH D;  4KGT A;  1XWT A;  1TJE A;  1GXN A;  1HZ6 A;  3R8B A;  2DRQ A;  4IWP A;  3WKG A;  3EU5 B;  3DBH I;  5AZF A;  2WWZ A;  1SJE D;  1F9G A;  1FNV A;  4AP4 C;  4FLH A;  1K8R B;  3M95 A;  1HZ5 A;  3M75 A;  1MJD A;  3M7C A;  3WIW A;  1J7C A;  2Z8L A;  2JF5 A;  2J0J A;  4YCR A;  3ANK A;  2DYO A;  4F10 A;  1MPE A;  2PE9 A;  2ZVN A;  3CIR B;  4YSX B;  1WJ4 A;  1TBE A;  1N24 A;  1RWF A;  5G5G A;  3AU5 A;  1WH3 A;  2J0M A;  1IA7 A;  1MVK A;  2HE7 A;  2KC1 A;  3AE4 B;  5FO8 B;  1I35 A;  2L00 B;  1HM2 A;  4OJZ A;  2UYZ B;  3SFE B;  2C7N B;  2OOB B;  4ASW C;  4GTM B;  4MGI E;  4RNA A;  3EZ8 A;  3W7T A;  1ZE3 D;  5M7Y A;  1H54 A;  3E32 B;  5GY3 A;  3SFX B;  2G0D A;  2F6D A;  2M0X A;  2LAS A;  2WXH A;  4D4D A;  4NAM A;  1FMA D;  2FV1 A;  4GU2 A;  1YN5 A;  3CIH A;  2XBB C;  2K39 A;  2KAJ A;  4HCN B;  3ZTC A;  3PMM A;  4YDO B;  3EU8 A;  3QQ8 B;  1A70 A;  3MHZ A;  3DBL I;  4MDK E;  3RRS A;  4DXA B;  4OW0 A;  4BOZ B;  5AGD A;  1HCU A;  5IKA A;  3U7Z A;  2GBR A;  2LD9 A;  2Z59 B;  3T33 A;  1I7H A;  3OAW A;  1HX9 A;  3M73 A;  1E8Y A;  5BMG A;  1IP9 A;  3REN A;  1DOG A;  2EMT A;  1RFK A;  1GC6 A;  2WXR A;  4W9H A;  3KQ4 A;  1DOY A;  2JYE A;  2X38 A;  5LNK 1;  3OG5 A;  3P5P A;  4ZG8 A;  1X1J A;  1N7Q A;  2GI9 A;  1M4V A;  1FCL A;  4B6W A;  1NDD A;  1HXG A;  2C7M B;  4EZK A;  1LXD A;  3R2T A;  3QFZ A;  1I4G A;  4WJO A;  3ANI A;  1RWC A;  2IO1 B;  2W3R A;  4C80 A;  3GZN B;  1WXA A;  3RD2 A;  3H7S A;  1NVI D;  4GXB A;  4JQW C;  2OHF A;  2LRW A;  4OHJ A;  4ARC A;  3MFG A;  1L6V A;  3PLV A;  3QWZ B;  3VRA B;  3ACT A;  1LXK A;  4OK2 A;  3W7X A;  5BMI A;  3E37 B;  3IT4 B;  3WUX A;  1TNO B;  3QRY A;  3VSN A;  2N1V A;  4B0M A;  2D8L A;  3A0O A;  4XDC A;  5JMD A;  3SDU A;  1Y56 A;  3TMP B;  3U2S C;  2K22 A;  4HDO A;  1Z5S B;  2WXP A;  1V7X A;  5ILJ A;  4HVB A;  4GSW A;  3K11 A;  2D07 B;  1UG9 A;  5CHV C;  2DBY A;  4MGY E;  3KYC D;  1TKG A;  3MC8 A;  2AFA A;  1JCR B;  3VXW A;  2IO0 B;  3WIQ A;  4CO7 A;  2K6D B;  2BS4 B;  4LDT B;  1NXC A;  3ENE A;  2DRO A;  2FCQ A;  4J6I A;  3P4R B;  2DEN B;  1V1P B;  2O6V B;  2M8S A;  1RWS A;  2IDY A;  1CEM A;  3RFZ B;  3IVF A;  2ZBL A;  2ZW0 A;  4AYO A;  1C79 A;  1E90 A;  3VDZ A;  3RMK C;  1XW2 A;  4K3C A;  1K53 A;  4JLC A;  3M78 A;  1I4H A;  4KIK A;  2XK5 B;  5EE1 A;  2NS5 A;  2H6G B;  1NEK B;  1N20 A;  3ECI A;  3LZ9 A;  3EUV B;  2RDB C;  1DOX A;  3V05 A;  3SD5 A;  3W5M A;  3I57 A;  3LXF A;  1LD7 B;  2BGF A;  3C72 B;  2DZK A;  2GBM A;  4IM3 A;  1R4M B;  4GDL B;  2FUG 1;  1E7P B;  2GMI C;  1EGU A;  3T8M A;  3ALB A;  4E74 A;  2IJ0 A;  3VTW A;  3U4E G;  2EKI A;  1UD7 A;  4L1B A;  1KH0 A;  4S17 A;  3LYY A;  5D2M B;  2PVO D;  3AEB B;  4D4B A;  4WJQ A;  2W3S A;  3PRZ A;  1DCE B;  2BKF A;  1YJ1 A;  3PRM B;  1MG4 A;  3AE8 B;  2V3P A;  2WHI A;  2N9E B;  2K5P A;  2WDQ B;  2BT6 A;  2O2V B;  2CJO A;  1RW9 A;  4EL8 A;  2AX5 A;  3H9D A;  4A9A A;  4EKU A;  3VUX A;  3DHG C;  1P9D U;  3HXD B;  2FUT A;  5G55 A;  4DDG D;  3LJ3 A;  1EU3 A;  2B3A A;  3VAW A;  1OJO A;  2XN9 C;  4ZRJ A;  3APF A;  2BYF A;  4A3P A;  3TSS A;  1FNW A;  1NBF C;  2OKX A;  1XCQ L;  3U8Z A;  1KKT A;  1NEN B;  3IHP C;  4W9G A;  2BS3 B;  1OEY A;  4YTN B;  3OJ4 B;  3RX5 A;  2V1Y A;  1WZ0 A;  2I38 A;  4DK5 A;  4KDL B;  3ETR A;  2MJE A;  5CHW A;  1TTN A;  4G0N B;  1G9J A;  3H1U A;  1JRO A;  3EQA A;  1FXT B;  3SDR A;  1FXA A;  1K51 A;  3AFJ A;  4MJS A;  2MP2 A;  1SXT A;  4HWI B;  1GAI A;  2MJD A;  3W1S C;  2KN5 A;  3PZ3 B;  1QSJ A;  3W9C B;  3QAQ A;  4AWJ A;  2IYD B;  5ILI A;  1UGM A;  1XEE A;  3H8H A;  3PZD A;  3Q8A A;  3ZLZ A;  3R7Q A;  1WR6 E;  4L2Y A;  3IAS 1;  4PS3 A;  5D3D A;  5AZG A;  2ONH A;  2V4I B;  2L0T A;  1VZ6 A;  1F1H A;  3RNC C;  2FAZ A;  3PSE B;  3BZD B;  2KLC A;  4II2 B;  4RF0 A;  2IND C;  2AQ3 B;  3Q8B A;  3DST B;  2NTS A;  3V62 A;  2WYQ A;  1V86 A;  1X1I A;  1UF0 A;  1N4S B;  1TS4 A;  1PUT A;  1WR1 A;  1W6J A;  3W1S A;  1L0X B;  4WWN A;  4D4C A;  5FR3 A;  4FHK A;  3S4A A;  3AH7 A;  3I5J C;  4C7Z A;  1H3C A;  1HE8 A;  4MH8 A;  3ANJ A;  3KYD D;  5LLI A;  3DOW A;  2KJ6 A;  1V7V A;  1YQ3 B;  5AZH A;  2N4F A;  2Q1F A;  1QT9 A;  2KKC A;  2MSE D;  2DLB A;  3RUI B;  2C7H A;  2CJN A;  2EEL A;  3A1Q A;  1WXQ A;  3DWM A;  2BRW A;  4N6E B;  2JU6 X;  4EHM B;  4W9D A;  2KVZ A;  2J5C A;  3SR6 A;  3T3N A;  1F52 A;  1VD2 A;  2LGS A;  1I4Q A;  3VSM A;  2LJI A;  3B0A A;  4XC2 A;  2JZZ A;  3PPA A;  3P1M A;  2FE8 A;  2JYT A;  3HXE B;  2WXN A;  2KN4 A;  5EE0 A;  1ROE A;  2DZJ A;  1OGW A;  4CHK A;  4V1R A;  1BML C;  3MTN B;  2JJB A;  4XZ4 A;  3A1Q B;  3P5R A;  2KZR A;  2WXG A;  3U7D A;  3PT2 B;  1PGA A;  2TSS A;  1F77 A;  1Q0W B;  5LXI B;  4LLG M;  2WXM A;  3B1L X;  1AYX A;  3ZNZ B;  1H3B A;  3QSP A;  4ICV A;  2L32 A;  3G6J B;  3QK0 A;  3RNA C;  4J3O D;  3OLM D;  1N7R A;  1N60 A;  1V5D A;  1I42 A;  4P1B C;  1C77 A;  1KRF A;  3M76 A;  3AV8 A;  1NI3 A;  3EGR A;  3TEZ A;  1ZP0 B;  4YSY B;  1C82 A;  4XDD A;  1JWS D;  2D3G A;  3PRP B;  4F1S A;  1CK1 A;  3WAN A;  4LJP B;  3E80 A;  4KGR A;  4MJS B;  3WCQ A;  1WGH A;  3PZ7 A;  4FUL A;  1JCK B;  2N9K A;  2CKH B;  3UIN B;  3QX1 A;  4C4V A;  5IKC M;  2HDE A;  1O6H A;  2NVP A;  4MT5 A;  1N21 A;  1E8Z A;  2KAN A;  4KTP A;  2M4N A;  3TF4 A;  3GOE A;  1WF9 A;  5EE3 A;  1KZO B;  3GE8 C;  4NEI A;  2UU7 A;  1KRE A;  1V6E A;  1N4R B;  3VUW A;  3ONS A;  5EDS A;  4L6X A;  5FK9 C;  1FMI A;  3S9V A;  2EAE A;  3Q3N C;  4FN2 A;  2GLS A;  1XD3 B;  2XWJ B;  1HTQ A;  2LUM A;  3ZYY X;  3BY4 B;  4DQO C;  2NBV B;  4FJZ A;  3GZK A;  5EAU A;  1F9O A;  2JRI B;  2KWV B;  1G9G A;  4LNN A;  1L2A A;  4A3O A;  4ZYS A;  5MPO A;  2IY1 B;  4TQ0 A;  1HMU A;  4E1Y A;  2HTH A;  1JWM D;  1P7E A;  2V0G A;  4C4V B;  1FRR A;  3CU7 A;  1SEB D;  1GAH A;  1ZPS A;  3L4P A;  3DRA B;  1IPG A;  1I4X A;  2DAF A;  1WJU A;  4MSM B;  2BWF A;  3IBE A;  1RYJ A;  3GLY A;  2H6H B;  3B2F A;  4IW0 A;  1WY8 A;  2LFI A;  2ACZ B;  1JRP A;  4Z4J A;  1OTR B;  2WDA A;  1SE3 A;  1HEZ E;  1C78 A;  2BVC A;  3JYU A;  4RH6 A;  3AEG B;  1UH6 A;  3L17 A;  2LEK A;  4WVC A;  3PZ1 B;  4KZC A;  5DGR A;  2DZI A;  1TS2 A;  1M94 A;  4KSK C;  1YMH E;  2ZCB A;  2MWS B;  3Q73 B;  1EF5 A;  3M7L A;  2RI8 A;  4AS1 A;  5FO9 B;  3GP7 A;  3TCA A;  2MLB A;  4HPP A;  3ZJT A;  4LNG B;  1FO4 A;  3HXF B;  2Z07 A;  1FRD A;  3D5S A;  1F9J A;  1UUP A;  5ILD A;  2KWD A;  2XQW A;  1G6J A;  3PYA A;  2INP E;  4BOK A;  1P0R A;  1GG3 A;  3TIX A;  1C3D A;  4GDK A;  3NRZ A;  2LXC A;  3ZRF A;  1XQQ A;  2H88 B;  3BVM A;  2AL3 A;  3P4Q B;  4JL9 A;  3P2C A;  1WRI A;  1OJN A;  4W9J A;  4MSQ B;  1QOB A;  1DL2 A;  5GXG B;  2PE6 B;  2SAK A;  4IOI E;  2E3T A;  4M0W A;  2AEH A;  1N1B A;  3K9P B;  2IO2 B;  3AEC B;  3PZ8 A;  1WWT A;  1V7W A;  3E73 A;  3S4B A;  1PGB A;  3QCA A;  5L95 C;  4QT9 A;  1I4R A;  1UNS A;  4FXC A;  5IO9 A;  1GPX A;  2BYT A;  4A8X C;  5H8Y E;  4GMV A;  1X1M A;  3VTV A;  1LO5 D;  2W82 A;  4ONT A;  3SHQ A;  2IGD A;  1QAZ A;  3RZW C;  2WS3 B;  3EFU A;  4KSL C;  4ZH5 A;  5D6J B;  1QQR A;  1KLG D;  2DAJ A;  3MJW A;  4JWS C;  1WI0 A;  1IS9 A;  2JXX A;  1O5M B;  1C76 A;  3TEY A;  2WDR B;  4HDQ A;  1C4P A;  5IOI A;  1FCC C;  1LOH A;  3KUD B;  1JML A;  4OVV A;  2N9L A;  4WU0 A;  2CHW A;  3R66 C;  1O1T B;  2LMC A;  3NS8 A;  4LNK A;  1YNT E;  1JWA D;  3NUH B;  3EUB 2;  3PYB A;  4WVA A;  1SB3 C;  2ZEQ A;  4HJK A;  3U52 E;  2KDF B;  2D3C A;  5HFY A;  4US9 A;  3M62 B;  4US8 A;  1L5P A;  1W3Y A;  1Q10 A;  5DPS A;  5FKA C;  1T0Q C;  1KLU D;  2PLP A;  1FFU A;  3KWL A;  1NL4 B;  1FT1 B;  3NNB A;  2NOJ A;  3KVF B;  3TL5 A;  1T0R C;  2D5G A;  3H2W A;  3ZKJ C;  1P98 A;  1EM7 A;  4WQO B;  3M00 A;  2M56 B;  1HN0 A;  2ZVO A;  4OZV A;  3ZQ4 A;  2ZPY A;  2D11 A;  1H39 A;  3E6U A;  1T0Y A;  5I4D A;  4BOJ A;  1YN3 A;  2KLG A;  2QMT A;  4KVG B;  2NBU A;  1WGR A;  5GZK A;  4MEL A;  3A4R A;  4REZ A;  2BYE A;  3ABV B;  2FBA A;  4LNI A;  1E6E B;  2RPQ A;  4AJW A;  3FIL B;  2N9X A;  2REX A;  4DXF A;  5CA3 A;  1P3Q U;  4RFB A;  2VN7 A;  1VR9 A;  4TQ1 A;  2JPH A;  2FBW B;  4DBG A;  3RJ3 A;  1YQB A;  1JCQ B;  3H7P B;  1H4R A;  3DPD A;  1X81 B;  1KM7 A;  2KD0 A;  2LHE A;  4GTT B;  5FR6 A;  5BYS A;  2JZP A;  3BYY B;  4IM0 A;  1MHX A;  5DCN A;  2B39 A;  2SEB D;  3KLS A;  3QJZ A;  4MGZ E;  2OJW A;  1JW9 D;  1L1Y A;  4PK1 A;  1V5O A;  4C56 C;  4WQM A;  1N5W A;  1ZDX A;  4YDE B;  2C9W B;  1GA2 A;  3DHI C;  1L4Z B;  2KDI A;  1O79 A;  4XWW A;  2WII B;  3WAM A;  3AED B;  1XLO A;  2V9H A;  3NVZ A;  5DHK A;  3ZNG C;  1FEH A;  3UI3 A;  4L23 A;  2WXI A;  4GL3 A;  5ILK A;  5HHD G;  3QWT A;  5E6J A;  1D8E B;  2CS4 A;  3ZGZ A;  4EZJ A;  1N4P B;  4PYZ A;  3ML8 A;  2WX1 A;  4BBN F;  3HUI A;  2JY6 A;  1AWD A;  1ZKH A;  2LGD A;  2W54 A;  1WYW B;  3O13 A;  3GE3 C;  4ITK A;  2PMV A;  3Q79 B;  2M19 A;  1IUE A;  4AYR A;  4GOC A;  3VR8 B;  1D8D B;  3IG3 A;  3Q75 B;  2EAB A;  2BPS A;  4IDI A;  2XK5 A;  3N32 A;  3NVY A;  1AW7 A;  1SE4 A;  1OQQ A;  2KAC A;  3JSV B;  3UQA A;  1XXG A;  3PGE A;  3R7R A;  1VZ7 A;  1G87 A;  1P7F A;  4ZRP A;  5AUK A;  1F2R I;  1EUV B;  5E6P A;  2N7J A;  5H92 C;  1RFA A;  2KQS A;  4ZOH C;  4ANV A;  2KFJ A;  3S4C A;  3AE2 B;  1PFD A;  3PVL A;  3QPF A;  4YXD B;  1S64 B;  1ESF A;  1MFW A;  3CMM B;  1CQV A;  3RUL A;  4WWO A;  4HEA 1;  4WAA A;  3SFD B;  4JE3 B;  3HRD D;  1UWX A;  2BB5 A;  1J0N A;  4AYP A;  2KDE B;  2BQQ A;  3E34 B;  3HHM A;  3APD A;  5TSS A;  3SDT A;  4KKJ A;  4IM2 A;  1GUA B;  2WDV B;  3AEA B;  2WXO A;  4WIP A;  2KT7 A;  2KWC A;  2AQ2 B;  1U4A A;  1ZXH A;  2L76 A;  3Q3J A;  4GAX A;  2WXQ A;  3O65 B;  1TKY A;  1LM8 B;  2OED A;  2WDT B;  4K7W A;  1XO3 A;  4DWF A;  2KTF A;  1N7P A;  1N9A B;  2BWE S;  3M7B A;  2LUE A;  3KWV A;  3CWI A;  2D2Q A;  2BBC A;  3AE1 B;  4CYE A;  1L0Y B;  1RLF A;  1MG8 A;  3RPF C;  2NPT A;  2JWU A;  1PGX A;  1Q1O A;  4RM8 A;  3Q3O C;  2QIL A;  1WZ3 A;  3A9J A;  2D10 A;  3B08 A;  4BAX A;  2KDM A;  5EE9 A;  1O1S B;  3R3M A;  1D6E C;  2ZW1 A;  1N6Z A;  4W9K A;  4L9P B;  2DZM A;  2YIK A;  1BUI C;  2QJL A;  3DBS A;  4EE2 A;  3IFW B;  2RDG A;  1SA5 B;  1RAX A;  3C19 A;  4OZA A;  4OVU A;  2MH7 A;  3BIN A;  4EFO A;  4TMA B;  1HV6 A;  1VLB A;  3LB8 C;  1E7V A;  4GN1 A;  5CX3 A;  5BO4 B;  1LGR A;  3WA0 A;  2L3Z A;  3DVG X;  4LDT D;  2PKO A;  2QDF A;  1ACC A;  1KZP B;  4FJQ A;  2I07 B;  2M1M A;  2J42 A;  5IL8 A;  1KWF A;  3W5N A;  3PLU A;  3EA6 A;  2KX0 A;  2BF8 B;  4GTR B;  2L0F A;  1WRD B;  3WAL A;  1IBX B;  4OZW A;  2FCM A;  5BMH A;  1E5W A;  4GTO B;  4DHJ D;  4MAC A;  3L54 A;  5HKH A;  3N20 C;  3QG0 A;  3DVG Y;  5L83 A;  4WWM A;  4ZRI A;  1FAE A;  1O1R B;  2LVQ A;  2V3N A;  2WU2 B;  4WH4 A;  4LCD E;  3P2B A;  5TR5 A;  4EEW A;  2MBH A;  1TZ1 A;  2BED B;  3BK1 A;  2J4X A;  1XLN A;  1L6U A;  5ILH A;  3A9K A;  2KFK B;  1EU4 A;  2F0Y B;  3W7U A;  4BOS C;  4MEM A;  1CJE A;  1AAR A;  3HXB B;  2N7D A;  3H6N A;  2VRR B;  1FXI A;  1G6I A;  3Q3F A;  1TNB B;  4TXT A;  2X03 A;  3AEE B;  5JXV A;  3Q8E A;  2E6X A;  1V2Y A;  3KLS X;  4KV2 A;  4M8N A;  1ET9 A;  1SBB B;  3DBR B;  4R3D A;  4RGT A;  4USA A;  3QT9 A;  1SIJ A;  3ZRC A;  2LWP A;  1YIW A;  1UMP A;  3KSL B;  1J8C A;  3PHW B;  4DDI D;  3PS6 A;  4A6Q A;  3HM6 X;  4DHJ B;  2O6V D;  4EZL A;  2LGI A;  3M74 A;  1HXC A;  2RR9 A;  3APC A;  3UF8 A;  1NC5 A;  2FIF A;  1CMX B;  4JJJ A;  3TUO A;  3V60 A;  3GB1 A;  2CQT A;  1W6K A;  3QFY A;  1KSD A;  3HIZ A;  2FID A;  2V8K A;  4MBG B;  4M02 A;  1HM3 A;  1IBX A;  3MC9 A;  3VR9 B;  5MEH A;  5ILZ A;  2EMS A;  1WXS A;  4W9F A;  2VZK D;  4HRO A;  4ANW A;  5KHO A;  4FHJ A;  1B9R A;  4GTQ B;  3FKY A;  3TEX A;  1NYQ A;  1N62 A;  4Q2B A;  4TKN A;  3GS2 A;  2CR5 A;  1KF6 B;  1FPY A;  3AFL A;  3ZJU A;  4CE7 A;  3UIP B;  3QIJ A;  3OED A;  1E7U A;  1LF6 A;  2ASQ A;  3S2A A;  2KHW B;  4W9C A;  5C3J B;  2KO3 A;  1H37 A;  3PZ4 B;  2AL6 A;  2KFK A;  1PQS A;  2K8B A;  4ACF A;  2RGK A;  2K6Q A;  3BK2 A;  4H2A A;  3E9S A;  3MHS D;  1TN6 B;  1QQF A;  1JQ4 A;  3URY A;  3RNF C;  3DQV A;  2JT4 B;  3X17 A;  1TF4 A;  2ZIR B;  2Q5W D;  5EAT A;  1ISN A;  3NY5 A;  3JVZ X;  2NCN A;  1RWA A;  3Q14 C;  2KMM A;  2JRH A;  3CF6 E;  2D5J A;  1VJK A;  1V1P A;  1O6R A;  5KKB A;  2YVC A;  4IWQ A;  2HTM E;  1F2R C;  1O6Q A;  1PYW D;  4JIO U;  1WX9 A;  1BXT A;  3AEF B;  1J0G A;  1H36 A;  5D7G A;  2KX3 A;  4M00 A;  2MP2 B;  1FNU A;  2V4L A;  2DNF A;  2YLM A;  3H7L A;  4IWO A;  5IK0 A;  1L7Y A;  1HMW A;  4ARI A;  3QAR A;  3E33 B;  4LK0 M;  1WMH A;  2RD0 A;  2IZV B;  2L52 A;  4C00 A;  2WY8 A;  1MZC B;  4ANU A;  1HXY D;  3DSS B;  3P63 A;  3A3V A;  4B9K A;  2VH2 A;  3RNE C;  1V8C A;  4IG7 B;  2JXT A;  1OQY A;  3ON6 A;  2LVP A;  3ZNH B;  2ONQ A;  2H6F B;  3HXC B;  3DSX B;  4AUQ C;  5LXH A;  2V8I A;  3WIR A;  2ONG A;  2J52 A;  2Y3A A;  3RT3 B;  1BT0 A;  3QHT A;  3EC8 A;  1HXA A;  5IK9 A;  1TS3 A;  1EF1 A;  2LGX A;  3VFK A;  3AE9 B;  2LGY A;  5GMV A;  2ZNV B;  1YX6 B;  3KUZ A;  1CLC A;  1H3A A;  2CHX A;  1WMH B;  3I63 C;  2NBW B;  3IAM 1;  3M3J A;  4BKT A;  2ZIS B;  1YOV B;  5DGQ A;  2WXJ A;  2A8Z A;  2BB6 A;  1UT9 A;  1JRU A;  1TS5 A;  2BW2 A;  2LRU A;  3B2G A;  3DHH C;  1KFG A;  2OJR A;  5IA7 A;  3AMZ A;  4LIX A;  3DDC B;  4KIK B;  3VVW B;  4L0G A;  4KKI A;  4BKS D;  2MCN B;  1F0Z A;  3Q7F B;  3BVG A;  1X9D A;  5EAS A;  3SEB A;  1C4C A;  3N30 A;  4MU9 A;  1ULV A;  3HVZ A;  1WJN A;  5CZL A;  4KTR A;  3SDQ A;  3DSV B;  4HLE A;  4G50 A;  1Y8R C;  3T3O A;  4JPS A;  4D94 A;  1XT9 B;  1OEY J;  3V3X A;  3ML9 A;  1QZE A;  1YQ4 B;  1YJJ A;  2WQY B;  1HA5 A;  2EAC A;  4CJ0 A;  1V9J A;  2O2V A;  3A9K B;  4D4A A;  3VHT C;  2SQC A;  1MHH E;  1TN8 B;  3VW5 A;  3RSY A;  2CU1 A;  3EHV A;  2IBI B;  2IO3 B;  4NQK E;  2WIN B;  1WYG A;  4WUR A;  4E71 A;  1ZDV A;  3NZ3 A;  1HZF A;  4NAW A;  1K52 A;  2R2O A;  1TY0 A;  5IN7 A;  4S0R A;  4GTV B;  1WE6 A;  1KRH A;  3DVN U;  4LJO B;  4HKZ E;  5IAA C;  2XFG A;  1FM0 D;  2XEW A;  2DRR A;  3RNB C;  3P42 A;  2GBJ A;  1FO2 A;  5CD2 A;  1OJM A;  5D94 A;  1J19 A;  2HJ8 A;  1FIQ A;  3VUY A;  2MJ3 A;  2L8J A;  1WXM A;  4NPN A;  1L0V B;  4ANX A;  3RX8 A;  5BYR A;  1V80 A;  2LJ5 A;  4IUM B;  1T3Q A;  1IGC A;  4FXG B;  4UDU C;  3UIO B;  1HTO A;  3DPY B;  1TGZ B;  1TT5 B;  3BYT B;  1C3T A;  4ZHP A;  2BRV X;  1WX7 A;  4OZC A;  2MBB B;  4C1S A;  2GH4 A;  2KMA A;  3KUC B;  4RCO A;  1WJ6 A;  4HPM B;  2B76 B;  3Q8C A;  1TNZ B;  4CJ1 A;  4E3C A;  2I1J A;  1TNY B;  2GBN A;  5HI1 A;  4K7U A;  2FUZ A;  3KSQ B;  5FO7 B;  4XGA B;  3ZDM C;  1SQC A;  4P7I A;  2K8H A;  4B95 A;  1I8Q A;  3FC4 A;  5DPT A;  3E56 A;  3QDE A;  4F8C B;  3R2I A;  3NZS A;  4KZ0 A;  4AQ7 A;  1SE2 A;  1YN4 A;  2G9H D;  3PV1 A;  5C23 A;  2PPH A;  1TYG B;  1DOI A;  4I6L B;  3KH0 A;  4DOE A;  2N7E A;  3AXC A;  3ZVV A;  3KW5 B;  3A9J B;  2FNJ B;  2LVO A;  2Y5C A;  2Y5P A;  4TF4 A;  2JF4 A;  3SFY B;  2D3B A;  4IC7 B;  1KLV A;  2BTE A;  2ZCC A;  2K25 A;  2RI9 A;  1FBO A;  2MBE A;  4J5T A;  4WVB A;  2K1F A;  4GDL A;  2L83 A;  2CHZ A;  2ZZR A;  2G4S A;  1SE9 A;  1YD8 U;  4TSS A;  4ZH1 A;  4RGM A;  3K7X A;  1WGK A;  1N4Q B;  1GC7 A;  1LTX B;  3NG0 A;  1QKZ A;  4RMA A;  4GTS B;  2M17 A;  2DX5 B;  1UGJ A;  1SF0 A;  1FFV A;  1S1Q B;  3AM9 A;  1L4D B;  4MMH A;  4D2K A;  1ZXI A;  1LQB A;  2MHJ A;  4HCP B;  4HK2 A;  2AHG A;  1JS4 A;  5C2T B;  4RM9 A;  3WIM A;  1GXM A;  4WJN A;  2HJ1 A;  1V5C A;  2K3U A;  2ZNV C;  3VQI A;  1WU6 A;  5JPN B;  1YJI A;  2WXF A;  4TUU A;  2VN4 A;  1FO3 A;  1VD5 A;  1WGD A;  3GZN I;  5C05 A;  1WXV A;  1KTK A;  3ZO5 B;  3L16 A;  4ZYN A;  5IKH A;  1LFD A;  1FBW A;  3B9J A;  3LDZ E;  1WZZ A;  3ACS A;  5JPM B;  4Q88 A;  5BYQ A;  3DSU B;  4Q2J A;  1E9M A;  1QOG A;  4NJC A;  2JWZ A;  3DSW B;  4RNQ A;  3AE7 B;  1N94 B;  2ICI A;  4HKQ A;  3J9C A;  1EWC A;  1TY2 A;  2DRS A;  4XUV A;  4TV3 A;  4JGH B;  2EKE C;  1IA6 A;  2MEK A;  1V49 A;  2QSD A;  1IGD A;  3QXF A;  3W7S A;  4HJG E;  1TZO A;  2RGF A;  3CST A;  3BVZ A;  3W5V B;  4AOF A;  2GB1 A;  4M8M A;  2HD5 B;  4P1C C;  2ZPN A;  1NYR A;  3JSV A;  2BYV E;  3NZU A;  3Q78 B;  5DPR A;  2WX0 A;  3HM3 A;  5JHB A;  2JX5 A;  2NVU I;  4FNV A;  1R4M I;  3SDL C;  1STE A;  2MX2 A;  1JWB D;  5AEK B;  4C7Y A;  4GIV A;  4BFR A;  5E2J A;  1ET6 A;  3M71 A;  2ZJD A;  4IKG A;  2VH1 A;  5E6O A;  2BKR B;  1GXO A;  1XLP A;  1J0M A;  3PTF C;  1H35 A;  1H8C A;  1T5X D;  1ZOY B;  2O6V A;  3PHX B;  4M0W B;  4YTM B;  5ILY A;  1FP3 A;  1GB4 A;  3OWE B;  3T9L A;  4DOD A;  2KYW A;  2FUH B;  4P16 A;  2CQS A;  4A55 A;  1YX5 B;  3DWG C;  4W9L A;  1OQR A;  2MRP A;  1T6B X;  1R76 A;  3AN1 A;  3TJP A;  1R4N I;  1WSP A;  4BZA A;  1LXM A;  4BVU C;  1K50 A;  4K7S A;  2GRI A;  2QIE B;  1N7N A;  2E22 A;  2LI5 A;  3L08 A;  4WAF A;  2J7Q B;  2J53 A;  1AN8 A;  1R4N B;  2CU3 A;  4OK4 A;  4OVZ A;  3W1Y A;  2GOX A;  2YEP B;  1UZX B;  5IM1 A;  1KFY B;  3C0R B;  2G02 A;  2PW9 A;  1RWG A;  2G1E A;  3ZW3 A;  1SIF A;  2KTR A;  3VXD A;  2KC2 A;  2LHD A;  3ZNI D;  2N9P C;  2N1W A;  2ON8 A;  3M77 A;  3G4F A;  1I4P A;  2WP9 B;  2KNB A;  4RGO S;  2H6I B;  1V97 A;  1WU4 A;  1ZW7 A;  1E8W A;  1GOZ A;  2PN5 A;  4YTP B;  2QC8 A;  1ZGU B;  3ZDT A;  2W9N A;  3NJT A;  1WE7 A;  3MP9 A;  3D5R A;  1EWY C;  3L13 A;  1VZ8 A;  2QNO A;  4XX5 A;  3WAP A;  2DYB A;  3AE6 B;  4LNF A;  2UWQ A;  2B4F A;  3WKH A;  2GBK A;  2YEP F;  1A5R A;  3WKF A;  4ICU A;  2XNA C;  1N95 B;  1S63 B;  2Z0D B;  4RF1 A;  3W5U B;  4NAW B;  4GGQ A;  1QOA A;  4HRS A;  1NI2 A;  3VH4 B;  3L0W B;  4NQL B;  1D5M C;  1N1Z A;  3AE5 B;  3N0F A;  1V1O A;  2I1K A;  1N7O A;  2KJH B;  3I9V 1;  3Q69 A;  3QXQ A;  5AUI A;  1C9F A;  3UQB A;  1KOT A;  1PDX A;  1S3S G;  5DPW A;  1N23 A;  1V81 A;  4MMI A;  2WYN A;  2BS2 B;  3AU4 A;  3S4D A;  5KHQ A;  3SU8 X;  4MM3 B;  4A90 A;  4BBN C;  2JUO A;  3M7E A;  2J0K A;  4I6P A;  2Y5B B;  4XWT A;  4FBJ B;  1WGY A;  3K9O B;  3H3K A;  2G3Q B;  3L10 B;  2FV0 A;  4WWP A;  1XF5 L;  4YT0 B;  5T8I A;  1CB8 A;  1LF9 A;  4M76 A;  2G45 B;  4WJP A;  4YWG G;  2QCZ A;  3V6C B;  1D3Z A;  2IGG A;  4HPL B;  3RI7 C;  3RCZ A;  3Q2A C;  3WC3 A;  2MBQ A;  4PT5 A;  3UGB B; 
#chains in the Genus database with same CATH homology
 1QLB B;  5D7G A;  2AFA A;  1JCR B;  1JML A;  4YSZ B;  3WIQ A;  2KQ4 X;  1FNU A;  1JWU D;  2N9L A;  1E0Z A;  1KS8 A;  4WU0 A;  3SAE A;  1O1T B;  3H7L A;  2BS4 B;  1XCT L;  2LMC A;  1JAL A;  1NXC A;  2DRO A;  5HG2 A;  1YNT E;  1JWA D;  3NUH B;  4ARI A;  1QOF A;  3EUB 2;  3PYB A;  3P4R B;  4WVA A;  5FOB B;  1V1P B;  3E33 B;  4LK0 M;  4P6V F;  4DXG A;  1SB3 C;  1RWS A;  2IDY A;  3U52 E;  2A73 B;  1CEM A;  3RFZ B;  2L52 A;  2QEJ C;  2WY8 A;  1F9D A;  1MZC B;  2ZBL A;  1HXY D;  2ZW0 A;  3DSS B;  3P63 A;  3A3V A;  4AYO A;  1C79 A;  5HFY A;  4US9 A;  1V8C A;  4US8 A;  1L5P A;  1XW2 A;  1Q10 A;  1K53 A;  2JXT A;  5FKA C;  3M78 A;  1I4H A;  1KLU D;  3ON6 A;  2PLP A;  2WY7 A;  1FFU A;  2NTT A;  3AE3 B;  2ONQ A;  3KWL A;  5D3I B;  2H6F B;  3HXC B;  1NL4 B;  3DSX B;  5EE1 A;  1TN7 B;  2H6G B;  2V8I A;  1NEK B;  3WIR A;  1FT1 B;  2J52 A;  2Y3A A;  3OXU A;  2IPK D;  1SA4 B;  2NOJ A;  3EUV B;  1DOX A;  3V05 A;  2D5G A;  1TS3 A;  3H2W A;  5G5H A;  3W5M A;  1EM7 A;  3AE9 B;  3I57 A;  3LXF A;  1N61 A;  2M56 B;  2R61 A;  1LD7 B;  1ZUD 2;  3C72 B;  2K9X A;  3ZQ4 A;  1CLC A;  1H3A A;  1H39 A;  3E6U A;  2GZ6 A;  4ZRQ A;  5I4D A;  3IAM 1;  4BOJ A;  1YN3 A;  2QMT A;  4GDL B;  2ZIS B;  2WXJ A;  1KSC A;  5DGQ A;  2A8Z A;  5GZK A;  2FUG 1;  2BB6 A;  1MI0 A;  4REZ A;  1E7P B;  1UT9 A;  3ABV B;  2FBA A;  4GLS C;  1TS5 A;  2BW2 A;  2IJ0 A;  1E6E B;  2WLB A;  3B2G A;  3FIL B;  1KFG A;  2R2L B;  2IGH A;  3U4E G;  3AMZ A;  4LIX A;  1GB1 A;  2EKI A;  4L0G A;  4KKI A;  1C4A A;  4L1B A;  1ENF A;  1KH0 A;  4DXF A;  5CA3 A;  4RFB A;  4TQ1 A;  2VN7 A;  3Q7F B;  1R7S A;  1VR9 A;  3BVG A;  3LYY A;  1F0Z A;  1X9D A;  2PVO D;  3AEB B;  4D4B A;  2W3S A;  3SEB A;  1C4C A;  2FBW B;  1DCE B;  4MU9 A;  1ULV A;  3RJ3 A;  3HVZ A;  4FUS A;  5CZL A;  1QIL A;  3PO0 A;  1JCQ B;  4KTR A;  3SDQ A;  3DSV B;  1X81 B;  2LHE A;  4KX6 B;  4GTT B;  2PTL A;  5BYS A;  3T3O A;  2JZP A;  3AE8 B;  2V3P A;  1GLM A;  4D94 A;  1DGJ A;  2K5P A;  1MHX A;  2WDQ B;  2XWB B;  1H13 A;  1YQ4 B;  2JQR B;  2BT6 A;  2M0A A;  1YJJ A;  2B39 A;  2WQY B;  2SEB D;  3KLS A;  1HA5 A;  3P4P B;  2EAC A;  2CJO A;  4CJ0 A;  4EL8 A;  1JW9 D;  3QT3 A;  1L1Y A;  2AX5 A;  4D4A A;  4JX1 C;  4A9A A;  4C56 C;  2SQC A;  1MHH E;  3HXD B;  4WQM A;  1TN8 B;  1N5W A;  1ZDX A;  3VW5 A;  1K72 A;  4YDE B;  4Z4L A;  1GA2 A;  3RSY A;  1L4Z B;  2WNM A;  1O79 A;  1EU3 A;  3W2D A;  4N58 A;  4XWW A;  1VRA B;  2WIN B;  1WYG A;  2XN9 C;  4WUR A;  2WII B;  1ZDV A;  3TSS A;  1FNW A;  3AED B;  3NZ3 A;  1HZF A;  2OKX A;  1K52 A;  1TY0 A;  1XCQ L;  1KKT A;  1XLO A;  3NVZ A;  4GTV B;  1FEH A;  1KRH A;  1NEN B;  1RQ5 A;  3BII D;  2BS3 B;  4L23 A;  1UWM A;  3UI3 A;  2WXI A;  3VRB B;  4GL3 A;  1B1Z A;  4HKZ E;  4YTN B;  3RX5 A;  2XFG A;  1FM0 D;  3QWT A;  5E6J A;  1J7A A;  5HHD G;  1D8E B;  2DRR A;  2I38 A;  3SQC A;  2MJE A;  3ETR A;  3ZGZ A;  3P42 A;  1QF6 A;  1FO2 A;  1N4P B;  3PZ2 B;  5CD2 A;  3SDV A;  1G9J A;  1JRO A;  3EQA A;  1FIQ A;  2MJ3 A;  1RM6 C;  1XWQ A;  2PVG C;  3SDR A;  3HUI A;  1AWD A;  1FXA A;  1L0V B;  3RX8 A;  3AFJ A;  1K51 A;  5BYR A;  2INN E;  1D4B A;  2W54 A;  1SXT A;  1T3Q A;  1IGC A;  1GAI A;  4FXG B;  2MJD A;  3O13 A;  4UDU C;  3PZ3 B;  1QSJ A;  3W9C B;  4ITK A;  2PMV A;  3Q79 B;  1XEE A;  3DPY B;  1GAQ B;  3BYT B;  3H8H A;  3Q8A A;  4XE0 A;  2M19 A;  1IUE A;  4AYR A;  4ZHP A;  1FCE A;  1LD8 B;  4OZC A;  4L2Y A;  3VR8 B;  5M7I A;  4C1S A;  1D8D B;  1AYF A;  4NZL B;  3IAS 1;  3Q75 B;  2EAB A;  2GH4 A;  4RCO A;  4CQN A;  4IDI A;  5D3D A;  2V4I B;  2B76 B;  3Q8C A;  1GSZ A;  1TNZ B;  1VZ6 A;  3RX7 A;  4CJ1 A;  1FT2 B;  3NVY A;  1AW7 A;  3BZD B;  1SE4 A;  1TNY B;  5HI1 A;  1OQQ A;  2KAC A;  4RF0 A;  2EAD A;  1XXG A;  2AQ3 B;  3Q8B A;  2FUZ A;  3DST B;  1VZ7 A;  2NTS A;  1JCS B;  3KSQ B;  1G87 A;  5FO7 B;  1P7F A;  2W55 A;  3C8Y A;  4ZRP A;  1SQC A;  5AUK A;  1F2R I;  2N0S B;  3NS1 A;  1QBQ B;  3FC4 A;  3E56 A;  1N5X A;  1TNU B;  3QDE A;  4LNB B;  1N4S B;  2N7J A;  3R2I A;  1J7B A;  5H92 C;  4ZHO A;  1TS4 A;  4AQ7 A;  4V1S A;  1PUT A;  3P4S B;  4ZOH C;  1W6J A;  1SE2 A;  1YN4 A;  3W1S A;  2G9H D;  3S4C A;  1DOI A;  1L0X B;  1TYG B;  2L1A A;  2RDH A;  4KGS A;  3AE2 B;  4DOE A;  1PFD A;  4D4C A;  1FD6 A;  5FR3 A;  2PIA A;  3S4A A;  3QPF A;  3AH7 A;  4JWU C;  4C7Z A;  4YXD B;  1H3C A;  1S64 B;  1ESF A;  4MH8 A;  1CQV A;  3ANJ A;  2VZK B;  4HEA 1;  1FPP B;  3NVV A;  2Y5C A;  1V7V A;  1YQ3 B;  2Y5P A;  4TF4 A;  3SFD B;  1AGM A;  2JF4 A;  3SFY B;  3HRD D;  1UWX A;  2BB5 A;  4JE3 B;  1QT9 A;  4AYP A;  2BTE A;  2DLB A;  3E34 B;  2RI9 A;  2CJN A;  1FBO A;  1H12 A;  4J5T A;  4WVB A;  2EEL A;  5TSS A;  3SDT A;  4LNV A;  3D3I A;  4KKJ A;  3NVW A;  2L83 A;  2WDV B;  1WXQ A;  2WXO A;  3AEA B;  3DWM A;  4WIP A;  4N6E B;  2JU6 X;  2ZZR A;  4EHM B;  2AQ2 B;  4TSS A;  4ZH1 A;  2WXL A;  1ZXH A;  3K7X A;  1WGK A;  1N4Q B;  4RGM A;  3N9Y C;  2DYM A;  3WKI A;  3MC0 B;  1LTX B;  2P0V A;  2WXQ A;  2RMM A;  3SR6 A;  1QKZ A;  1TKY A;  1WU5 A;  3M72 A;  3T3N A;  2OED A;  1I4Q A;  2V8J A;  4GTS B;  4FXK B;  1UGJ A;  2LJI A;  4GDK B;  1XO3 A;  1SF0 A;  1FFV A;  3P1M A;  2FE8 A;  1N9A B;  2JYT A;  3HXE B;  3M7B A;  1L4D B;  2KN4 A;  2WXN A;  3AM9 A;  1TKE A;  3KWV A;  1ZXI A;  3CWI A;  4D2K A;  5EE0 A;  1ROE A;  2BBC A;  4V1R A;  1BML C;  2AHF A;  3AE1 B;  2H89 B;  3AB5 A;  2JJB A;  3P5R A;  1HQR D;  2WXG A;  1L0Y B;  1H14 A;  1PGA A;  2TSS A;  2AHG A;  1JS4 A;  1F77 A;  5C2T B;  3RPF C;  4LLG M;  4LTU A;  2JWU A;  1GXM A;  2WXM A;  2JSV X;  1PGX A;  1AYX A;  2WXK A;  3BWU D;  2I2Y A;  1V5C A;  1H3B A;  2K3U A;  3VQI A;  1WU6 A;  3QSP A;  2QIL A;  5JPN B;  2L32 A;  3G6J B;  1GHQ A;  1XLQ A;  1YJI A;  2NMQ A;  4J3O D;  2WXF A;  2KDM A;  1OFF A;  5EE9 A;  2JG0 A;  1NI1 B;  1O1S B;  2VN4 A;  1FO3 A;  1D5X C;  1N60 A;  2DWQ A;  1VD5 A;  1V5D A;  1C77 A;  1KRF A;  3M76 A;  1D6E C;  2ZW1 A;  3AV8 A;  3MJ5 A;  1KTK A;  4L9P B;  3W7W A;  1NI3 A;  2YIK A;  3EGR A;  3TEZ A;  1BUI C;  1ZP0 B;  2QJL A;  4YSY B;  1DYQ A;  4EE2 A;  4RGN A;  2RDG A;  1SA5 B;  4XDD A;  3B9J A;  3E30 B;  1FBW A;  4OZA A;  2K0P A;  1JWS D;  1WZZ A;  2MH7 A;  3ACS A;  5JPM B;  1CK1 A;  4Q88 A;  5BYQ A;  1N63 A;  3HVD A;  4TMA B;  3DSU B;  2WU5 B;  1VLB A;  3LB8 C;  4Q2J A;  4OZB A;  1E9M A;  4KGR A;  1QOG A;  4NJC A;  3WCQ A;  3PZ7 A;  1JCK B;  4O1N A;  3TEW A;  2PKO A;  2N9K A;  1E10 A;  4GTP B;  1ACC A;  1KZP B;  3DSW B;  3AE7 B;  1N94 B;  4N59 A;  2ICI A;  2HDE A;  1O6H A;  2NVP A;  4MT5 A;  4HKQ A;  3J9C A;  2I07 B;  1EWC A;  1TY2 A;  3FAH A;  4KTP A;  2DRS A;  4XUV A;  2J42 A;  3TF4 A;  3IXS A;  1IA6 A;  1KWF A;  1KZO B;  3W5N A;  5EE3 A;  3V3X A;  2IEJ B;  2MEK A;  4B0E A;  1KRE A;  2QSD A;  1IGD A;  3EA6 A;  3QXF A;  4GTR B;  3W7S A;  4HJG E;  1N4R B;  1VDV A;  1TZO A;  1D5Z C;  1IBX B;  3BVZ A;  2AQ1 B;  4L6X A;  1CZP A;  3W5V B;  3Q7A B;  3FIL A;  5FK9 C;  5BMH A;  3IT6 B;  4GTO B;  3Q8F A;  1FMI A;  3S9V A;  2EAE A;  4AYQ A;  5GW7 A;  1SSN A;  2GB1 A;  4MAC A;  2RPV A;  3GT5 A;  1NYR A;  3ZJV A;  1SJH D;  3QG0 A;  3R2T A;  4KGT A;  2XWJ B;  1XWT A;  1TJE A;  1GXN A;  4WWM A;  1HZ6 A;  3R8B A;  3Q78 B;  2DRQ A;  1FAE A;  1O1R B;  3WKG A;  2JX5 A;  3EU5 B;  2LUM A;  2V3N A;  3ZYY X;  1STE A;  1JWB D;  4DQO C;  1SJE D;  2WU2 B;  4WH4 A;  1FNV A;  4C7Y A;  3GZK A;  1F9O A;  5E2J A;  1ET6 A;  1G9G A;  1L2A A;  4ZYS A;  5MPO A;  3M71 A;  1HZ5 A;  4TQ0 A;  2BED B;  3M75 A;  3BK1 A;  2J4X A;  3M7C A;  3WIW A;  1XLN A;  1JWM D;  1P7E A;  4IKG A;  1J7C A;  2V0G A;  1FRR A;  3CU7 A;  1L6U A;  1GXO A;  1SEB D;  1XLP A;  2Z8L A;  1H35 A;  4YCR A;  1GAH A;  1ZPS A;  3L4P A;  3DRA B;  3ANK A;  2F0Y B;  1EU4 A;  3W7U A;  1I4X A;  1T5X D;  1ZOY B;  1MPE A;  1CJE A;  2DYO A;  3HXB B;  4YTM B;  3CIR B;  1RYJ A;  1FXI A;  4YSX B;  1G6I A;  1FP3 A;  3GLY A;  1TNB B;  1GB4 A;  2H6H B;  3B2F A;  4TXT A;  2LFI A;  3AEE B;  4DOD A;  1JRP A;  4Z4J A;  2ACZ B;  3OWE B;  3Q8E A;  5G5G A;  1IA7 A;  1MVK A;  2E6X A;  1SE3 A;  1HEZ E;  1C78 A;  4P16 A;  2CQS A;  3KLS X;  4A55 A;  3DWG C;  4RH6 A;  1ET9 A;  3AE4 B;  5FO8 B;  3AEG B;  1OQR A;  1SBB B;  1T6B X;  4R3D A;  2LEK A;  4RGT A;  1R76 A;  3AN1 A;  4WVC A;  4USA A;  3PZ1 B;  3QT9 A;  3SFE B;  5DGR A;  1WSP A;  1TS2 A;  4GTM B;  4RNA A;  3EZ8 A;  1SIJ A;  3W7T A;  1ZE3 D;  1UMP A;  3KSL B;  1H54 A;  3E32 B;  5M7Y A;  1YMH E;  1K50 A;  3Q73 B;  5GY3 A;  3SFX B;  2G0D A;  2GRI A;  3M7L A;  2RI8 A;  2F6D A;  2QIE B;  5FO9 B;  4A6Q A;  4AS1 A;  2LGI A;  3M74 A;  2WXH A;  3GP7 A;  4D4D A;  4NAM A;  1FMA D;  4WAF A;  2FV1 A;  1NC5 A;  2J53 A;  3ZJT A;  4LNG B;  4JJJ A;  1YN5 A;  1AN8 A;  1FO4 A;  3HXF B;  3CIH A;  2CU3 A;  3TUO A;  2Z07 A;  2KAJ A;  3GB1 A;  1FRD A;  2CQT A;  3PMM A;  3D5S A;  4YDO B;  4OVZ A;  3EU8 A;  1W6K A;  2GOX A;  3QFY A;  1KSD A;  2YEP B;  1A70 A;  1UUP A;  1KFY B;  2KWD A;  3MHZ A;  2G02 A;  2XQW A;  2V8K A;  2G1E A;  2PW9 A;  3PYA A;  4MBG B;  3RRS A;  2INP E;  1IBX A;  4BOK A;  4OW0 A;  3VXD A;  2LHD A;  5AGD A;  1HCU A;  3VR9 B;  5MEH A;  1C3D A;  2ON8 A;  3M77 A;  1I4P A;  3NRZ A;  2WP9 B;  2VZK D;  4RGO S;  3U7Z A;  2H6I B;  1V97 A;  4HRO A;  1WU4 A;  1B9R A;  4GTQ B;  1GOZ A;  2H88 B;  3BVM A;  3TEX A;  2PN5 A;  1NYQ A;  4YTP B;  1N62 A;  3T33 A;  1I7H A;  3P4Q B;  4Q2B A;  3GS2 A;  3M73 A;  3P2C A;  1WRI A;  5BMG A;  3MP9 A;  3D5R A;  3REN A;  1EWY C;  1KF6 B;  1DOG A;  1VZ8 A;  2QNO A;  1RFK A;  3ZJU A;  4CE7 A;  1QOB A;  3OED A;  2WXR A;  3AE6 B;  1DL2 A;  1LF6 A;  3KQ4 A;  5GXG B;  1DOY A;  2B4F A;  3WKH A;  2JYE A;  2SAK A;  2YEP F;  5C3J B;  3WKF A;  4IOI E;  2E3T A;  2X38 A;  2XNA C;  1N95 B;  5LNK 1;  1S63 B;  4M0W A;  1H37 A;  3P5P A;  3PZ4 B;  4ZG8 A;  3AEC B;  3PZ8 A;  1WWT A;  2GI9 A;  1V7W A;  3E73 A;  4RF1 A;  1M4V A;  2RGK A;  4NAW B;  3W5U B;  1TKG A;  1QOA A;  4HRS A;  1FCL A;  3BK2 A;  4H2A A;  3S4B A;  3E9S A;  1D5M C;  3QFZ A;  1I4G A;  1PGB A;  3AE5 B;  1TN6 B;  3ANI A;  4QT9 A;  1QQF A;  1I4R A;  1UNS A;  1V1O A;  2W3R A;  4FXC A;  3URY A;  4C80 A;  1JQ4 A;  1GPX A;  2BYT A;  3I9V 1;  3Q69 A;  3QXQ A;  1NVI D;  5AUI A;  5H8Y E;  3X17 A;  4A8X C;  1C9F A;  2OHF A;  4OHJ A;  1LO5 D;  1TF4 A;  1PDX A;  2W82 A;  4ONT A;  2ZIR B;  1L6V A;  2Q5W D;  3MFG A;  4ARC A;  3VRA B;  3ACT A;  2WYN A;  2IGD A;  2BS2 B;  3W7X A;  3BYY B;  3S4D A;  5JXV A;  4A90 A;  4MM3 B;  5BMI A;  2KMM A;  3E37 B;  3IT4 B;  3M7E A;  3WUX A;  1TNO B;  2WS3 B;  4XWT A;  3QRY A;  2D5J A;  3H3K A;  1VJK A;  1V1P A;  4ZH5 A;  1O6R A;  4B0M A;  2D8L A;  5KKB A;  4XDC A;  2FV0 A;  1QQR A;  1XF5 L;  4YT0 B;  5T8I A;  1KLG D;  4JPS A;  1Y56 A;  3SDU A;  3U2S C;  4JWS C;  1LF9 A;  4M76 A;  2K22 A;  4YWG G;  2HTM E;  1IS9 A;  1F2R C;  2WXP A;  1V7X A;  1O5M B;  1C76 A;  2IGG A;  3TEY A;  1O6Q A;  1PYW D;  2WDR B;  1C4P A;  3K11 A;  1BXT A;  3AEF B;  1UG9 A;  3WC3 A;  2DBY A;  4PT5 A;  1H36 A;  1FCC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...