2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
2BBCA 2R2LB 1S64B 4D4BA 4LNVA 4MU9A 1N9AB 1TNYB 1TN6B 3K7XA 1N4RB 3Q7FB 1X81B 2H6HB 3Q75B 3DSXB 1H37A 2WIIB 2ZISB 3PZ3B 4GTVB 4KKJA 2BB5A 5JPNB 4YDOB 1FPPB 2XWJB 4V1RA 3Q79B 1QQFA 4FXGB 1H3CA 4FXKB 5AGDA 1C3DA 5FO9B 1JCSB 3HXFB 1O6RA 2V3PA 4GTTB 3Q78B 3KSQB 4M76A 3CU7A 2B39A 1GXOA 3PZ2B 1W6KA 1NL4B 1GHQA 3HXEB 3Q7AB 4LNGB 1H3BA 2SQCA 3D5SA 1SA5B 3DPYB 3KLSA 4BOJA 3E32B 4GTMB 4ONTA 4GTRB 4ZH1A 1HZFA 1FT1B 1GSZA 1H36A 1SQCA 1TNOB 1O1TB 2IEJB 1H3AA 2XQWA 4D4CA 2I07B 1KZOB 3KSLB 4D4DA 2H6FB 1TN7B 2V8IA 3EU5B 1H35A 1UMPA 4GTQB 5JPMB 2V8KA 3OEDA 4YDEB 1D8EB 3DSVB 4MBGB 1S63B 4GTSB 1O6HA 4ZRPA 4BOKA 3DRAB 1TNBB 1TNZB 3U7ZA 3DSUB 2WY8A 4L9PB 1FT2B 2BEDB 1O1SB 3E34B 1KZPB 1DCEB 1QBQB 2GOXA 1N4PB 3HXCB 3Q73B 1SA4B 2A73B 3E37B 2G0DA 3HXDB 3EUVB 2H6GB 5FO8B 4GTOB 3PZ1B 2PMVA 3DSWB 1N94B 1GXNA 1R76A 1JCQB 1W6JA 4LNBB 3SFYB 3DSSB 2NOJA 1GXMA 3HXBB 2ZIRB 1O79A 5FO7B 1O5MB 3D5RA 4EHMB 1N4SB 1LTXB 3OXUA 4C1SA 3DSTB 1NI1B 3C72B 3RJ3A 3KQ4A 2PN5A 1MZCB 1LD7B 1TNUB 4D94A 3PZ4B 1TN8B 1LD8B 1QSJA 3SFXB 3G6JB 3SQCA 4KKIA 2XWBB 2F0YB 2BB6A 4D4AA 3E30B 1O1RB 1O6QA 1D8DB 1N4QB 2WY7A 2G02A 4GTPB 1JCRB 1H39A 2V8JA 2WINB 3E33B 4V1SA 2H6IB 5FOBB 4ZRQA 1N95B 2V3NA
chains in the Genus database with same CATH superfamily
1AN8A 5C23A 2DZKA 2G45B 4XDDA 3VRBB 2JU6X 2V3SA 1TN6B 3Q6BA 4HXDA 2H6HB 3H2WA 3FILB 1TF4A 5D6JB 2NPTB 5IL8A 4M00A 4YDOB 3Q3FA 1WXSA 2AFAA 4RM8A 1LGRA 1WSPA 1KTKA 4CHKA 2WXQA 1O6RA 2IGDA 3AE4B 3K11A 5D94A 3VUWA 3RPFC 1EF1A 1FXTB 4IKGA 4IDIA 1WJ4A 2LI5A 3R2TA 1H3BA 3D5SA 1TS2A 1NEKB 4NJ7A 3ZQ4A 2IJ0A 1N63A 4MJSA 2FCSA 2ZW1A 1HZFA 4IWOA 1TNOB 1I4GA 3AM9A 2LMCA 1JWUD 1T6BX 3NOBA 2NTSA 1NDDA 1GC6A 1TN7B 1EU3A 2EKEC 1F1SA 1ULVA 1QKZA 3OEDA 1TTNA 2IO2B 3WIMA 2PJHA 1GAHA 3ZJTA 1SBBB 3E80A 3K9OB 4LDTB 1TNBB 3PVLA 3IAS1 1QF6A 1RFKA 4R3DA 5HFYA 3HUIA 2LRWA 5IK0A 4F7ZA 4HJKA 2B76B 4WURA 4NZLB 1HMUA 1RW9A 3E37B 3RX7A 2RGKA 2NBVB 4AJWA 1Q0WB 4MGYE 1TS5A 3UIOB 3L13A 2K3UA 4WIPA 4WWMA 3AE3B 2ON8A 3HXBB 3SD5A 2QIEB 5AUKA 4EHMB 4W9FA 2VN7A 5GZKA 3DBSA 4DI5A 3Q3MC 3O13A 5LLIA 4TQ0A 3NVZA 1MZCB 4ANWA 2WU2B 4IW0A 4FJVB 3PZ4B 1JWSD 1YN5A 4J3OD 3CWIA 3O65B 1C4PA 4JL9A 4PT5A 1KSCA 3MTNB 2Y5PA 3NJTA 4L23A 1FFUA 1SGHA 3ON6A 1EF5A 1RAXA 1J8CA 2RDBC 4WJNA 4HLEA 3QSPA 4OVUA 2ZEQA 4IM2A 1HA5A 2PTLA 1L1YA 1WE7A 4JIOU 1WXQA 2BKFA 2NVPA 1QOBA 1T3QA 4HKQA 4MEMA 1GG3A 3N0FA 3V6CB 3VSNA 4WQMA 4YWGG 3QQ8B 3VH3B 3T33A 1OQRA 3IXSA 1JCSB 1C77A 3W7TA 3SDLC 2LVQA 2FUZA 1C76A 2CHWA 2TSSA 5IM1A 3E6UA 4GMVA 4KZ0A 4GTMB 3NUHB 1IA7A 5J18A 2O6VB 2HDEA 2F6DA 1TY2A 4P16A 3MC9A 3V3XA 4D4DA 1E7PB 3ACSA 3SDVA 1XLPA 1S1QB 1LXMA 1Y56A 1OJNA 4LK0M 3TJPA 2IBIB 4ANUA 2X03A 5JHAA 3C8YA 2FAZA 4GTSB 1GLMA 4JGHB 1E8ZA 1F1HA 2LVOA 1GUAB 4NPNA 2MJ3A 4OW0A 2KTFA 1YQ4B 1DCEB 5DGRA 1X1IA 2DX5B 2YEPB 1Q10A 3E56A 5I4DA 3DPDA 4OHJA 2KJRA 5FO8B 2PMVA 3DVGX 2JRHA 1JCQB 2Y5BB 3DSSB 2KJHB 4ZG8A 4JX1C 1NI2A 2CHXA 5E6NA 1KM7A 4XE0A 4WVAA 4C80A 3VHTC 2D3CA 1NI1B 2PPHA 1K51A 1LQBA 2Z59B 3DBLI 4YTPB 2OEDA 4GDLB 1M94A 1FEHA 1WI0A 2FV1A 4KKIA 3NS1A 2AHGA 3SDTA 1QZEA 4IWPA 2XK5B 2UWQA 3APFA 2OOBB 4HVBA 5EE1A 4GTPB 1N61A 1QT9A 2MP2B 1F9JA 5G2NA 3VR8B 4YT0B 2H6IB 2UYZB 1N95B 1VCBA 1UZXB 3PYBA 1OEYA 2NBUA 1JWMD 2BYVE 1V8CA 4JQWC 1FRRA 4MGKE 5EE9A 1WU5A 1MFWA 5EDSA 1H4RA 4HROA 4L2YA 2JX5A 2R2OA 3MHSD 3RMKC 4J5TA 4WWOA 3R7QA 1EGUA 4BFRA 2GH4A 3PGEA 1J7CA 3PZ7A 1WGGA 3PZ2B 1CEMA 4FN2A 3S9VA 2IO0B 2MHJA 4YSXB 3ZDTA 1DOXA 3NG0A 1SEBD 1N7OA 1WX8A 2LGSA 1EUVB 3AULA 4BAXA 1C9FA 1E8YA 1WZ3A 3M71A 5D7GA 4ZH1A 1IBXA 2FUTA 2WP9B 3RSYA 3DWGC 3E7JA 1BMLC 3EU5B 3A33B 3VRAB 4GLSC 2PIAA 4MBGB 1UNSA 2V4LA 3AB5A 4B6WA 4AS1A 3W5UB 3ENEA 4EZJA 2BYFA 1F0ZA 2Q5WD 3ZGZA 3W1YA 4IUMB 4EUTA 1EM7A 3FILA 2BS2B 2INNE 2JYTA 2MSED 2NPTA 2XNAC 2JYEA 1LXKA 3AU5A 4FJYA 3T3NA 2IDYA 1DYQA 3P4RB 3I3TB 3AI5A 1N23A 3RUIB 3X23A 3Q3NC 2DENB 5EATA 1G9GA 1IGCA 4AJYB 2G9HD 2W54A 3N1YC 4MM3B 4BVUC 3WKHA 3AEEB 4W9GA 1HE8A 1SF0A 2Y5CA 1QQRA 3ZNID 3P42A 3MC0B 4DDID 4HCPB 1LM8B 4ITKA 3WUXA 1HQRD 1OJMA 2L00B 3DBLB 1NXCA 5CTRC 5DPWA 1N4QB 1E7UA 4E71A 2G02A 2LGDA 3MC8A 3GB1A 1KLGD 2N9PC 3KYDD 3AE2B 4LNVA 1GAIA 1NI3A 1N4RB 1TJEA 4OVVA 1OJOA 4LNIA 1U4AA 4TKNA 3SFDB 4C56C 1V1PB 1AARA 1V9JA 3M7CA 2N7DA 1WXAA 2KT7A 1V5TA 2M0XA 3WIRA 3AEBB 4W9IA 4LNGB 2HD5B 5KHQA 4AYQA 1E8WA 3WANA 2KWUB 4GTRB 4BBNF 1CB8A 1SQCA 2XEWA 4HWIB 2L76A 2L7RA 3R66C 1D6EC 1I4RA 2AQ2B 1JWAD 1KH0A 4B0MA 1GB1A 5ILJA 1RRBA 3ML9A 1WFYA 3IT6B 4JPSA 3ZXRA 3DSVB 3PO0A 1JW9D 2JJBA 4BOKA 5ILZA 3TSSA 2KQ4X 1YX6B 1TNZB 3M75A 2NTTA 2O6VD 1V7WA 3P4PB 3ZVVA 3BVGA 3SFEB 3CSFA 4EKUA 3QPFA 3NZSA 1RFAA 3RNCC 1FO2A 3WIWA 3BYTB 3NS8A 1ZE3D 5IN7A 3MJWA 3JYUA 3H9DA 4EOYA 1N1BA 3BK1A 4GL3A 4C00A 1WE6A 1FRDA 3M78A 4AYRA 4TF4A 3EC8A 1HV6A 1ZP0B 3RRSA 1H13A 2CS4A 4US9A 4J6IA 4K3BA 4ZHOA 4WQOB 2LD9A 3RULA 2WCOA 2J42A 5D3IB 3PRPB 2KDFB 4D4AA 3E30B 4K7WA 2LGXA 1FNWA 3B1LX 1TZ1A 1CJEA 4YSZB 2KDIA 1H54A 4DOEA 2IO1B 1UG9A 2KXJA 2LHEA 5IO9A 2K9XA 1Z2MA 3JW0X 4WVBA 2J7QB 3ACTA 1YN4A 1X81B 1N7QA 4ZOHC 2KFJA 1N24A 1WGRA 3G4DA 3CSTA 4TV3A 1FBWA 3CMMB 2QNOA 3VQIA 2BRPA 4KGTA 5IKHA 2WX0A 1C3TA 2KDMA 2YLMA 3ZTDA 3KSQB 4NQKE 4USAA 1HXCA 3HXEB 1P7EA 3Q7AB 1ET6A 1WGDA 3DPYB 4GDLA 4LLGM 4BOJA 2FCNA 3UQAA 4ACFA 1VRAB 2D2QA 2XK5A 2KN4A 1H3AA 1C82A 2LFIA 2ZZPB 3IAM1 1WYGA 1FNUA 3KYCD 1UMPA 4RGTA 5JPMB 3P5RA 2MP2A 3IBEA 4ZDVA 3H3KA 3SR6A 3WCQA 2XFGA 3EUB2 4HPLB 2FIFA 2HJ1A 4GSWA 3AXCA 3L10B 4HCNB 4AYPA 2KJ6A 1WGYA 2CJNA 5CHWA 3L17A 4S17A 3OJ4B 3DSUB 4W9KA 5E6PA 1J19A 4OZWA 2KK8A 3QARA 3R3MA 4XC2A 3DQVA 2KX3A 2VRRB 4NEIA 1KRFA 2WYNA 4LNOA 1H14A 3A1QB 5E2JA 3DSWB 4ANXA 1TKEA 2EADA 2MRPA 4A9AA 3MHZA 1MI0A 2HTHA 4IOIE 1O79A 1JCKB 1K72A 4XGAB 3HM6X 5CD2A 4GOCA 3A4RA 2WU5B 1X9DA 2C7NB 1N21A 4IWQA 1JS4A 4TQ1A 2BTEA 1SSNA 1ZKHA 2K22A 1RLFA 4P1BC 5IP4D 2DWQA 3SFXB 2JG0A 3U52E 1XEEA 2VZKD 2AQ3B 3ZLZA 1R4MI 1TKGA 3AE8B 4ICVA 1ZGUB 1LOHA 3ZNHB 2M1MA 5DHKA 4TSSA 3WKGA 4HEA1 2WINB 3CIHA 1SB3C 2OKXA 5KHOA 2BBCA 3JSVB 1S64B 2JZ3B 2MW5A 3SDQA 3QX1A 1QILA 2RD0A 4WJQA 3TEWA 4B0EA 2DLBA 4XX5A 3Q79B 1QQFA 4HPMB 4YL8A 4MM3A 4II3B 1P9DU 4ZRIA 1AW7A 4KGSA 4DODA 5IA7A 3P1MA 3W7WA 1UELA 1UD7A 3DWMA 1GXOA 4II2B 4BOZB 1OEYJ 1WWTA 5AUIA 2KYWA 2KN5A 1V7VA 3RZFA 3PHWB 1WU4A 3RNAC 3BYYB 4XDCA 1SE3A 2DBYA 1SE9A 1WR6E 1IP9A 2BGFA 2KWDA 2MWSB 5BO4B 3VW5A 1K53A 2PLPA 3QFYA 1IGDA 5DCNA 4EL8A 3KWVA 2WXRA 2J0JA 4IC7B 2JSVX 4NAMA 2BVCA 4PK1A 3TMPB 2DROA 2VN4A 3E34B 1KZPB 2JZPA 2JVCA 2LUMA 3EUVB 1X1MA 4L0GA 2E22A 4WH4A 1T0YA 1WXVA 3WAOA 4FUSA 2KQ7A 3D5RA 3EU8A 1E8XA 4I6PA 4XWWA 1XW2A 3DSTB 3NVYA 3RJ3A 1C4AA 5HHDG 3DVGY 3AEGB 2WS3B 2EACA 1NYRA 3DVNV 3AECB 3NY5A 4N6EB 4JJJA 5HKHA 5C1ZA 2WXJA 2XWBB 1I42A 1OFFA 1FIQA 1UGMA 2FBAA 2DAFA 2RI9A 2MEKA 1WF9A 3PREA 4MH0E 1LF9A 1PQSA 1KF6B 5L95C 1S3SG 2B4FA 1R4MB 1N9AB 2G1EA 3H1UA 3PYAA 2INDC 3RNEC 2REXA 1RQ5A 4G11A 1YJ1A 5JPNB 1ZUD2 2AQ1B 3AH7A 4V1RA 3V62A 2FUG1 3S4CA 1PGBA 1HM3A 2IZVB 4FXKB 5AGDA 4C4VB 2HTME 3TUOA 1RWGA 2B39A 1XCQL 3B0AA 2L3ZA 1E90A 5IOIA 3ZXVA 4A90A 2ZJDA 3VH4B 1SE2A 1TY0A 1SIJA 1G9JA 4KSLC 1VZ8A 4G50A 1ROEA 2H6FB 3GT5A 3RFZB 5CZLA 2Z8LA 3A9JB 2LZ6A 5IKCM 3IVFA 2LGIA 3EZ8A 3SDRA 1N7PA 3KUCB 3BY4B 1R7SA 4LNFA 1O1SB 2FNJB 1Z5SB 4BBNC 2CHZA 4GDKA 4GN1A 3ECIA 1L7YA 3M02A 4RNAA 3ALBA 1YJJA 4EZKA 1N94B 1T5XD 3RNBC 1D5ZC 3FC4A 3ANKA 3AU4A 1VDVA 4FLHA 3W2DA 4DXAB 4WAFA 3T8MA 4A55A 3Q3JA 2KX0A 1WM2A 1WGHA 1IPGA 3QHTA 4XZ4A 1H12A 1VZ7A 3ONSA 1TNUB 4LTUA 1ESFA 3P2CA 3MP9A 3RX5A 1QSJA 2D5GA 1I7HA 1CLCA 2MBBB 2LWPA 2WXNA 3AV8A 2L1AA 3DOWA 3KWLA 2F0YB 3VUYA 2V4IB 3RNFC 1O1RB 1GJZA 2W55A 2WXPA 2Y3AA 4ZYSA 2LVPA 2KWCA 1JCRB 2PE9A 4LNKA 2R2LB 2K5PA 2IO3B 2KQSA 5BYSA 1ZDXA 3A1QA 2JQRB 3L0WB 1H37A 3ZRCA 2ZISB 2BB5A 2KVRA 3TBLD 3Q3OC 3DHGC 1MG4A 4US8A 1HXAA 1MJDA 3HXFB 4M8NA 3KLSX 1ZPSA 2EAEA 1SJED 4G0NB 4HJGE 3TEZA 3G4FA 1PFDA 3NZUA 1MHXA 4XYCA 3Q2AC 3BWUD 4XUVA 2J0MA 2NMQA 2UU7A 1TZOA 1GAQB 2K8CA 2I07B 2Z07A 5LXIB 4I6LB 2O2VB 1FXAA 3MFGA 4AOFA 3ZKJC 4FULA 3M76A 3GLYA 3JSVA 3ZO5B 2FV0A 4CQNA 3BIID 1ZXHA 2QSDA 2LUEA 3IT4B 4RCOA 1YMHE 3VXWA 1UF0A 2WY8A 4HRSA 4FBJB 1ZXIA 3WA0A 4K7UA 3HXCB 2L05A 1OJPA 3MJ5A 1XF5L 3EFUA 4RGOS 4GAXA 4FJQA 3PZ1B 4GTOB 4HDQA 2E3TA 2V9HA 1IYFA 4DBGA 1HMWA 1FM0D 1KWFA 4IG7B 5FO7B 4MMHA 3W9CB 4XWTA 5IKAA 1RWCA 1YJIA 1E10A 1GC7A 4GXBA 3QA8A 3KQ4A 2QCZA 2BYTA 1P98A 1LD7B 3M72A 5J17A 1SIFA 2MX2A 1GNUA 2KAJA 1ACCA 3I9V1 3VAWA 4DHJD 5BMGA 5ILIA 3GZNI 3PTFC 4L1BA 3PMMA 1H8CA 5G5HA 5BYQA 5ILHA 3RD2A 2GBMA 3IFWB 2KDBA 3WKFA 1WM3A 2K8BA 1LO5D 2L8JA 2VZKB 3N0GA 1PYWD 5FOBB 1V5OA 1QLBB 3W7UA 2K6DB 3ZJVA 2J4XA 3ZNGC 2DZJA 1JQ4A 3P4SB 2DNFA 2C60A 3DSXB 1AYXA 3V05A 3DDCB 2I1JA 1T0RC 3L16A 1H3CA 3Q8CA 1C4CA 2LEKA 1FXIA 3P4QB 2JWZA 4Q2JA 1UWXA 2ZCCA 1RWHA 2H89B 3EECA 3V60A 4YXDB 2KACA 1E7VA 2JT4B 4W9JA 4WWPA 3QT3A 4IM0A 2VH1A 3KUZA 4MSQB 4Z4LA 1L0VB 4YCRA 3UF8A 1D5MC 3C19A 4Q88A 2PW9A 1T0QC 4CJ1A 3I63C 4ZYNA 5AEKB 2V8KA 1HTOA 4AWJA 1WR1A 3W7SA 3N1XC 2KC2A 2SEBD 4MSMB 4GU2A 1S63B 1BT0A 3BINA 2WHIA 4WVCA 2LRUA 1I8QA 1N7RA 4B95A 2ZCBA 1J0MA 4L9PB 2BRVX 2D3AA 3PHXB 4DDGD 1N1ZA 3BVMA 4OZAA 5T8IA 4FXCA 1M4VA 3DVNU 1HEZE 3UQBA 4YTMB 4P1CC 2N9EB 3LZ9A 4PYZA 1WGKA 2G3QB 4C4VA 1VD5A 3TIXA 1GXNA 2R61A 2KZRA 4C7YA 3QWTA 1DOGA 3QAQA 5G5GA 3HRDD 3DBHI 4E1YA 2BS3B 3WALA 5FKAC 3A4SC 5CHVC 2KMCA 1TS3A 3PSEB 2AL6A 4M0WB 2PVGC 2D07B 3ML8A 3ZIMA 4D94A 1N5XA 1R4NI 3A9KB 4MGIE 4AP4C 3W5NA 3ZRFA 2L0FA 3WIQA 3A9JA 4RGNA 2ZVOA 2BB6A 5GY3A 1ZOYB 2K8HA 3GE3C 2C5LC 2JY6A 3AEAB 3GOEA 3NHEB 3GZNB 2V3NA 2RGFA 2KNBA 1DOIA 1UBQA 2O6VA 4BKSD 1TNYB 2AWTA 1KFYB 2GOWA 3E9SA 2ACZB 2DYBA 3EGRA 4W9CA 1JRUA 4JWSC 3Q8FA 3UGBB 4GTVB 5FK9C 3UIPB 3W1SC 1HXGA 1FPPB 1KRHA 2JZZA 1L0XB 1YD8U 1N5WA 2FE8A 4OZVA 1NENB 1Q5WB 3U2SC 1TT5B 5FO9B 2MQJA 3ZJUA 2J53A 1LF6A 2DZIA 2BKRB 1GHQA 2ZZRA 2LASA 3H7LA 1ENFA 1MVKA 2LXCA 4LJPB 1NVID 1KREA 1GA2A 1FT1B 1H36A 2IEJB 2XQWA 2QHOA 4OVZA 3RN9C 5M7IA 2BW2A 4MGZE 5MEHA 3N3KB 4KX6B 2SAKA 3U4EG 3TF4A 2JXXA 2L52A 4F8CB 2K1FA 2BS4B 2EABA 2NS5A 4QAYA 4X57B 4DQOC 1N7NA 3QC8B 3H7PB 3DRAB 1P3QU 2WXIA 3GP7A 4PYUA 1TYGB 1F9DA 1LXDA 5EE3A 2G4DB 2DRRA 2M8SA 2LHDA 4S0RA 1LFDA 4IM3A 2BYEA 1J7AA 1V86A 2PEAA 3NRZA 4F1SA 1OQQA 1HN0A 4TXTA 1OQYA 2PE6B 5CX3A 3M95A 5BMHA 3BK2A 4YSYB 5AZFA 5ILYA 2WX1A 1ZW7A 4LJOB 2IGHA 2X38A 1LD8B 1YQBA 2O2VA 4KTPA 3U30A 3DBHB 3SDUA 3SQCA 3SU8X 2WYQA 1HXYD 3L4PA 4A6QA 2RPQA 4DWFA 4OJZA 1BUIC 3QG0A 1R4NB 1L2AA 1N6ZA 5C2TB 2XBBC 3LXFA 2I2YA 1STEA 4MDKE 3M62B 3RX8A 2KLGA 2DHZA 2OJRA 4TMAB 2NVUI 4DK5A 3V6EB 1I4PA 3ETRA 3N30A 3GZKA 4OK2A 1XWQA 1GPXA 4FADA 3NVWA 1WZ0A 1F2RC 2RSUA 3M63B 1YOVB 3QT9A 2IY1B 2KMMA 2L0TA 2BRWA 3M77A 3L08A 2AL3A 4EEWA 4DXGA 2MBEA 3LYYA 1FFVA 4LNNA 3KLSA 1XWTA 2GBRA 2E24A 3PPAA 3S4DA 4ZH5A 2C7MB 2K39A 5D3DA 4WWNA 1K50A 4W9HA 4DXFA 4JE3B 1GOZA 3T9LA 2I38A 1H35A 1UH6A 2HJ8A 3T3OA 4AQ7A 3N1ZC 1E9MA 3BZDB 1P0RA 2G4SA 1UT9A 3H7SA 2WXKA 3RENA 3B2GA 1TBEA 3LJ3A 4GIVA 2ASQA 3NZ3A 3RNGC 2JUOA 1FCLA 1V5CA 1UUPA 1OTRB 2G0DA 3PLVA 2DYMA 3OWEB 2QILA 4LNBB 3B08A 1W6JA 3EQAA 2D3GA 2KANA 1HZ6A 1DOYA 3AE9B 4BOSC 3Q8AA 2BPSA 3NFVA 3RCZA 3TEYA 3X17A 2C9WB 2R2QA 1X1JA 3N32A 5MPOA 2QEJC 2MBOA 3PS6A 4RFBA 4E3CA 2INCC 4JLCA 3N9YC 1F9OA 2CQSA 5H8YE 1V1PA 1L0YB 4HK2A 4DHJB 2LJIA 1CZPA 3HM3A 1D8DB 1WY8A 2DYOA 4M01A 2FIDA 4BZAA 3KUDB 4RF0A 4A20A 2M0AA 1MPEA 3Q75B 1C1YB 3PZDA 2BWFA 4KDLB 4TUUA 1PDXA 2V1YA 2MA9B 3E73A 2XWJB 1FCCC 5J2RA 1I4XA 2N4FA 3WAPA 2MJEA 3WC3A 2GZ6A 4KV2A 3I57A 4A8XC 2WNMA 4M0WA 5E6JA 4ANVA 1DL2A 2X8XX 3A9KA 2KVZA 1XLNA 3M74A 1C78A 1WIAA 1W3YA 3QJZA 4ONTA 4DHZB 1V81A 4NAWB 1WH3A 2E6XA 2Z0EB 5KKBA 1F2RI 2GRIA 4KGRA 1XO3A 3X0WA 4GTQB 1ISNA 2N0SB 4MH8A 3AMZA 4O1NA 1YX5B 4WU0A 3M7LA 2GBKA 3OAWA 2J0KA 4H2AA 3VTWA 3BVZA 5IK9A 4KIKB 4WAAA 2W3SA 1P7FA 1VZ6A 2M19A 3PZ8A 3ABVB 3HXDB 1IUEA 3AN1A 2QDFA 4DHZE 1AWDA 2NOJA 5CHFA 3IHPC 2OHFA 2KHWB 3PLUA 1N20A 3S4AA 2KFKB 3DBRI 4AYOA 4K81A 2WDVB 4WJOA 1LTXB 1QOAA 4LCDE 3P2BA 1MHHE 3PT2B 3RI7C 3PRZA 1L2NA 1IS9A 3DHIC 1V80A 3AFJA 4RNQA 2WXHA 3AEDB 3P63A 1YQ3B 1WJNA 1D4BA 2INPE 2J52A 3GE8C 4ZHPA 4MELA 2WGSA 2D3BA 3R8BA 3H7PA 4AUQC 3URYA 2WY7A 2YEPF 2EMSA 1WMHB 2JRIB 4D4CA 1KLVA 2I1KA 1XT9B 2QJLA 3B9JA 3VVWB 4D4BA 2FCMA 2WXGA 4FHKA 3K7XA 4YTNB 3Q7FB 2RPVA 3U7DA 1AGMA 2WIIB 4KKJA 2CU1A 4W9LA 5D2MB 3SEBA 4W9EA 3RT3B 4E74A 4D2KA 2OJWA 2KTRB 2YVCA 4EZLA 4KSKC 1EU4A 4CYEA 1KKTA 1XXGA 2N7EA 2JWUA 1FBOA 4MMIA 3CU7A 3VTUA 3JVZX 1W6KA 3AE5B 1QOFA 3RZWC 1K8RB 2SQCA 2RR9A 1KJTA 5HI1A 3M3JA 4M8MA 4CO7A 1P1AA 3E32B 1RM6C 1I35A 2KMAA 2FUHB 1GSZA 1G6IA 2DZMA 2ZVNA 1UGJA 3W5VB 5DHIA 1JRPA 2KKCA 3V61A 4P6VF 1D8EB 1FMAD 2LGYA 4ZRPA 4EE2A 2W9NA 3M00A 5TSSA 1VR9A 5DPTA 2WDTB 2ONHA 2N9LA 5BMIA 1FT2B 2BEDB 2AX5A 3W7XA 1E5WA 1N4PB 3A0OA 4CJ0A 2A73B 2D11A 2EKIA 1TIFA 4ARIA 1D3ZA 4OZCA 3ZUNA 5G55A 3Q8EA 1FNVA 2ICIA 1FPYA 1UWMA 3Q14C 4PS3A 5GXGB 1FO3A 2ZNVC 4KVGB 3QCAA 1XD3B 4RGMA 3OXUA 3C72B 2IGGA 4FHJA 2Z0DB 1N22A 5IAAC 3DBRB 2GMIC 5DPRA 1FAEA 3TL5A 2A5UA 3CIRB 2WDRB 3AE1B 2ZPYA 5DGQA 4RM9A 5AZGA 2BWES 1V1OA 4FJZA 3D3IA 5JMDA 1JWBD 5IK6A 2Q1FA 1FP3A 3LDZE 3ANIA 2A8ZA 3ZW3A 1L4DB 2LJ5A 2KD0A 1ZDVA 2MCNB 4KTRA 3ZTCA 3KW5B 2N1VA 1V6EA 3K9PB 3NNBA 5FR3A 4N58A 2KOXA 1YNTE 2L32A 1SJHD 2W82A 4I6NB 2VH2A 2DAJA 4C7ZA 2K6QA 3HHMA 3TCAA 2GB1A 1DGJA 1A70A 1I4QA 3FKYA 2YIKA 1UBIA 3S4BA 4MT5A 4Z4JA 4FNVA 5DPSA 1IA6A 3SHQA 5IL3A 4KZCA 2AEHA 3M73A 2PVOD 4LDTD 1JROA 4LIXA 5JZEB 2CU3A 3IG3A 3S2AA 2RDHA 5JMFA 1KS8A 1O6HA 3H6NA 5ILDA 4REZA 2IPKD 3QDEA 2FUQA 1SE4A 2H88B 1JALA 1KLUD 2AHFA 1TKYA 4GB9A 1QBQB 4G3XB 4CE7A 1SA4B 2WLBA 3HIZA 1RWSA 1KFGA 4HDOA 1A5RA 4NJ6A 1TGZB 3U8ZA 2JPHA 2M4NA 5C05A 5LNK1 4F13A 1CMXB 1PGAA 1CK1A 3M01A 1VJKA 3HK0A 2EELA 3ZYYX 1L6UA 1O5MB 3W5MA 1KSDA 1N4SB 1NC5A 1WXMA 5JHBA 2KC1A 1WZZA 1V2YA 3UINB 4HPPA 3WAMA 4ASWC 2NCNA 4NAWA 1TN8B 1J0NA 3EA6A 3AE6B 3TEXA 3WKIA 5ILKA 1T0SC 2WXOA 4MJSB 1FD6A 5EASA 1FMIA 2WDQB 1RYJA 3PRMB 1O6QA 1WRIA 3AFLA 2B3AA 2PKOA 2IYDB 2MLBA 1BXTA 2WXLA 3DCGA 1JMLA 2WWZA 1AYFA 3W1SA 2MBHA 3OG5A 1EWYC 2C7HA 1V49A 2CQTA 4KIKA 3UI3A 1F9GA 2QMTA 1B1ZA 2WDAA 1SXTA 4PS8A 4M02A 3PV1A 1V7XA 2D5JA 3M7EA 3PZ3B 2CJOA 4EFOA 2GLSA 5H92C 1HM2A 1YIWA 2KFKA 2K0PA 1E6EB 1Q1OA 4RF1A 1EWCA 2V3PA 4GTTB 3R7RA 3VR9B 2GBJA 3QWZB 1WX9A 1SA5B 2NBWB 3QIJA 2ZW0A 2KLCA 4FA6A 2W3RA 4BKTA 3Q8BA 2FBWB 3ZDMC 3KH0A 1KZOB 3KSLB 5CA3A 1X1HA 1G6JA 1CQVA 2V8IA 2HE7A 1WMHA 1XLOA 2JXTA 2DRQA 1F77A 3CF6E 3AE7B 2RMMA 1I4HA 1WRDB 2NR2A 3VTVA 3B2FA 5L83A 1B9RA 3KVFB 2D10A 3QXQA 1XQQA 1HTQA 2CKHB 3QXFA 4HKZE 1G87A 3L54A 2LXAA 2WXMA 4BKSA 1N60A 4Q2BA 2GOXA 3RYTA 3Q73B 2MJDA 3D32A 1L4ZB 1WYWB 2D8LA 2BQQA 2KTRA 1XLQA 2A4ZA 1WU6A 1R76A 4L6XA 2N7JA 1GXMA 3VDZA 2ZIRB 1HCUA 1J7BA 4OZBA 3ZNZB 1K52A 4NY0A 4C1SA 4OK4A 3EFCA 3R2IA 3APDA 1PGXA 4MACA 4P7IA 5JH5C 4UDUC 4RMAA 4K3CA 4GDKB 5GW7A 1FCEA 4QT9A 1F52A 1WX7A 4NQLB 3P5PA 3C0RB 3VFKA 4F10A 2ZBLA 1WJUA 2ZPNA 4URKA 2JF4A 1H39A 2V8JA 3A3VA 3N20C 2M56B 4RH6A 2MH7A 3ANJA 2RI8A 4MU9A 1VD2A 3HVDA 4PS7A 2ZNVB 5LXHA 4NJCA 2WXFA 1QAZA 1OGWA 2N1WA 2CR5A 2N9XA 2ONQA 2BT6A 2QC8A 3SAEA 3GS2A 2P0VA 1NBFC 4FXGB 2BF8B 5E6OA 1C3DA 1FO4A 3VSMA 4N59A 1V97A 3Q78B 4KDIC 4M76A 2WQYB 5HG2A 5EAUA 1NL4B 3HVZA 1J0GA 1YN3A 3Q69A 2AYOB 1KOTA 1EO6A 3APCA 3H8HA 3LB8C 5C3JB 5TR5A 1HZ5A 4ARCA 5AZHA 3NVVA 1O1TB 2KDEB 1D5XC 2L83A 1L5PA 4B9KA 1RWFA 2XN9C 4YDEB 2FCQA 2M17A 1Y8RC 3I5JC 4ZRJA 2IY0B 1ET9A 1E0ZA 5JXVA 3U7ZA 2RDGA 4K1RB 4W9DA 2KO3A 1HX9A 2GBNA 2DRSA 2N9KA 2J5CA 1L6VA 5BYRA 1NYQA 1XCTL 2H6GB 3EHVA 1VLBA 3VXDA 4K7SA 1RWAA 4A3PA 1TS4A 3AEFB 3VUXA 5M7YA 3QRYA 3SFYB 1MG8A 4NNJB 4GGQA 4A3OA 3OJ3A 1N62A 4ICUA 4N9F4 5GMVA 4BKGA 1QOGA 2MBQA 2V0GA 2PN5A 4JWUC 4ZRKA 3QFZA 3OLMD 2GI9A 2JF5A 1GB4A 1PUTA 3G6JB 1C79A 2K25A 1IBXB 5FR6A 5EE0A 3M7BA 1V5DA 1WJ6A 2KWVB 2EMTA 3FAHA 3J9CA 4WJPA 3E33B 4V1SA 2ONGA 3DHHC 4ZRQA 3QK0A
chains in the Genus database with same CATH topology
3B9JA 1AN8A 2QJLA 3ZJVA 4D4BA 2J4XA 2LHEA 2K9XA 4XDDA 3VRBB 2JU6X 1JQ4A 2WXGA 1TN6B 3K7XA 4WVBA 3ACTA 1YN4A 4YTNB 3P4SB 3Q7FB 1X81B 2H6HB 2RPVA 3H2WA 4ZOHC 3DSXB 1TF4A 1AYXA 3FILB 1AGMA 2WIIB 4KKJA 3SEBA 3V05A 4YDOB 1FBWA 3VQIA 2QNOA 2AFAA 1H3CA 4D2KA 4KGTA 3Q8CA 1C4CA 2LEKA 1WSPA 1FXIA 1KTKA 1EU4A 3P4QB 2WXQA 1KKTA 1O6RA 1UWXA 2IGDA 3AE4B 3K11A 2KDMA 1XXGA 4Q2JA 3RPFC 2H89B 2JWUA 1FBOA 3KSQB 3CU7A 4USAA 4YXDB 2KACA 4IKGA 1W6KA 3HXEB 1P7EA 3AE5B 1QOFA 3R2TA 3Q7AB 1ET6A 4IDIA 1H3BA 2SQCA 3D5SA 3DPYB 1TS2A 4LLGM 5HI1A 4BOJA 1NEKB 3QT3A 3E32B 3ZQ4A 1RM6C 1VRAB 2IJ0A 4Z4LA 1N63A 2ZW1A 1HZFA 1GSZA 1L0VB 4YCRA 1TNOB 1I4GA 2KN4A 1H3AA 3AM9A 1G6IA 1JWUD 2LMCA 1T6BX 1D5MC 1UGJA 2NTSA 2LFIA 3W5VB 4Q88A 2PW9A 3IAM1 1WYGA 1TN7B 1EU3A 1FNUA 4CJ1A 1UMPA 1JRPA 4RGTA 5JPMB 3P5RA 4P6VF 1ULVA 2V8KA 3H3KA 3OEDA 1QKZA 2XFGA 3SR6A 3WCQA 3EUB2 1D8EB 1FMAD 3W7SA 2SEBD 1S63B 1GAHA 3ZJTA 4ZRPA 4EE2A 4WVCA 4AYPA 1SBBB 5TSSA 1VR9A 1TNBB 2CJNA 3IAS1 1QF6A 1RFKA 3DSUB 4L9PB 4R3DA 5HFYA 2N9LA 3HUIA 1FT2B 2BEDB 2AX5A 3W7XA 5BMIA 3BVMA 4OZAA 1N4PB 2B76B 4CJ0A 4FXCA 2A73B 4WURA 5T8IA 4NZLB 3E37B 1M4VA 1HEZE 2EKIA 3RX7A 4ARIA 2RGKA 4YTMB 4OZCA 3Q8EA 1FNVA 1KRFA 2ICIA 2WYNA 1WGKA 1H14A 5E2JA 1UWMA 1VD5A 3DSWB 1TKEA 1TS5A 1GXNA 2K3UA 2R61A 2EADA 4WIPA 4C7YA 3QWTA 4WWMA 5GXGB 4A9AA 1FO3A 3AE3B 3MHZA 1DOGA 1MI0A 5G5GA 2ON8A 3HXBB 2QIEB 1O79A 1JCKB 3HRDD 1K72A 4IOIE 5AUKA 4EHMB 2VN7A 2BS3B 5FKAC 4RGMA 3OXUA 5GZKA 5CD2A 3C72B 3O13A 2WU5B 4TQ0A 1X9DA 1TS3A 3NVZA 2IGGA 2PVGC 1MZCB 2WU2B 1JS4A 4TQ1A 2BTEA 4D94A 1SSNA 1N5XA 3PZ4B 2K22A 1JWSD 1YN5A 2DWQA 1FAEA 3SFXB 3CWIA 2JG0A 3W5NA 4J3OD 3U52E 1XEEA 3CIRB 2VZKD 1C4PA 2AQ3B 2WDRB 3WIQA 4RGNA 1TKGA 3AE1B 2BB6A 5DGQA 5GY3A 1KSCA 1ZOYB 3AE8B 4PT5A 2Y5PA 1V1OA 3D3IA 1JWBD 4L23A 1FFUA 3AEAB 3ON6A 4TSSA 3WKGA 1FP3A 4HEA1 2WINB 3CIHA 1SB3C 3ANIA 2OKXA 2A8ZA 2V3NA 1L4DB 2BBCA 1S64B 3QSPA 1ZDVA 1DOIA 4KTRA 1TNYB 1HA5A 3SDQA 2PTLA 1KFYB 1QILA 3E9SA 1L1YA 2ACZB 3EGRA 1WXQA 3Q8FA 4JWSC 4GTVB 5FK9C 3TEWA 2NVPA 1QOBA 4N58A 5FR3A 1T3QA 4B0EA 1FPPB 1KRHA 4HKQA 2DLBA 1L0XB 1YNTE 2L32A 3Q79B 1QQFA 1N5WA 1SJHD 2FE8A 4WQMA 2W82A 4YWGG 1NENB 3T33A 1OQRA 3U2SC 5FO9B 1AW7A 2SAKA 1JCSB 1C77A 3W7TA 3IXSA 4KGSA 4C7ZA 4DODA 3ZJUA 2J53A 1LF6A 3P1MA 3W7WA 3DWMA 1GXOA 2GB1A 2FUZA 1GHQA 2ZZRA 1C76A 1DGJA 3H7LA 2TSSA 1ENFA 5EE1A 1A70A 1WWTA 5AUIA 1I4QA 1MVKA 3E6UA 2YIKA 4GTMB 1V7VA 3NUHB 1IA7A 1KREA 3S4BA 1NVID 4Z4JA 2HDEA 4MT5A 1GA2A 1FT1B 1H36A 2F6DA 2IEJB 1WU4A 2XQWA 1SE3A 1TY2A 3BYYB 4OVZA 4P16A 4XDCA 1IA6A 5M7IA 2BW2A 2DBYA 5MEHA 3V3XA 4KX6B 4D4DA 1E7PB 3ACSA 3SDVA 3TF4A 1XLPA 2KWDA 2L52A 3VW5A 1K53A 1Y56A 2PLPA 4LK0M 3M73A 3QFYA 2BS4B 1IGDA 2EABA 2PVOD 1JROA 4LIXA 2CU3A 4DQOC 4EL8A 3KWVA 2RDHA 2WXRA 3C8YA 1KS8A 4GTSB 1O6HA 1GLMA 4REZA 2JSVX 4NAMA 3DRAB 2WXIA 3GP7A 2IPKD 1TYGB 3QDEA 2DROA 2VN4A 1SE4A 2H88B 2MJ3A 4OW0A 1JALA 1KLUD 1F9DA 2AHFA 3E34B 1TKYA 1KZPB 2JZPA 1YQ4B 1DCEB 1QBQB 5EE3A 5DGRA 2DRRA 4CE7A 2YEPB 1SA4B 1Q10A 2WLBA 1RWSA 3E56A 2LHDA 1KFGA 2LUMA 3EUVB 4OHJA 5I4DA 4L0GA 5FO8B 4WH4A 2PMVA 1JCQB 1J7AA 5LNK1 3DSSB 3NRZA 4ZG8A 4TXTA 4FUSA 1OQQA 1PGAA 1CK1A 1VJKA 4JX1C 2EELA 3ZYYX 1L6UA 4XE0A 1O5MB 3D5RA 3EU8A 4WVAA 1KSDA 1N4SB 3W5MA 4C80A 4XWWA 1XW2A 1NC5A 3DSTB 1NI1B 3NVYA 1WZZA 3RJ3A 1K51A 5BMHA 3BK2A 4YSYB 4YTPB 1C4AA 5HHDG 2OEDA 3AEGB 2WS3B 1TN8B 2IGHA 2X38A 4GDLB 2EACA 1LD8B 1FEHA 4KTPA 1NYRA 3EA6A 3AECB 4N6EB 3AE6B 3SDUA 3SQCA 2FV1A 4JJJA 3TEXA 3WKIA 4KKIA 1HXYD 3NS1A 2WXOA 3L4PA 2WXJA 2XWBB 4A6QA 2AHGA 1FD6A 3SDTA 1FMIA 2WDQB 1RYJA 1O6QA 1WRIA 1OFFA 1FIQA 2PKOA 1BUIC 2FBAA 1BXTA 2RI9A 3QG0A 1L2AA 4GTPB 1JMLA 1N61A 1AYFA 2MEKA 2WXLA 5C2TB 3W1SA 1QT9A 3VR8B 4YT0B 2H6IB 1EWYC 1LF9A 1N95B 3LXFA 2CQTA 3UI3A 2I2YA 1STEA 1KF6B 3PYBA 2QMTA 2B4FA 1B1ZA 3RX8A 1N9AB 2G1EA 4TMAB 1JWMD 3PYAA 1SXTA 1V8CA 1I4PA 3ETRA 1V7XA 2D5JA 3M7EA 1FRRA 3GZKA 1XWQA 1GPXA 3PZ3B 1RQ5A 2CJOA 5EE9A 5JPNB 3NVWA 1WU5A 1ZUD2 2AQ1B 5H92C 1F2RC 4V1RA 3AH7A 2FUG1 3S4CA 1PGBA 2K0PA 4FXKB 4HROA 4L2YA 1E6EB 5AGDA 3QT9A 2KMMA 4RF1A 2JX5A 1EWCA 4J5TA 2V3PA 3M77A 2GH4A 4GTTB 2HTME 3TUOA 1J7CA 3PZ7A 4DXGA 2B39A 3VR9B 3PZ2B 1CEMA 1XCQL 3LYYA 1FFVA 3S9VA 1DOXA 4YSXB 1SA5B 3KLSA 1XWTA 1SEBD 2ZW0A 4A90A 2W3RA 3Q8BA 3S4DA 2FBWB 1C9FA 4ZH5A 3M71A 1SE2A 1TY0A 4ZH1A 1SIJA 5D7GA 1IBXA 5D3DA 1K50A 1G9JA 2WP9B 4DXFA 3RSYA 4JE3B 1GOZA 1KZOB 3KSLB 5CA3A 1VZ8A 3DWGC 1ROEA 2H6FB 3GT5A 2I38A 3RFZB 1CQVA 1BMLC 2V8IA 5CZLA 3EU5B 2Z8LA 1H35A 1XLOA 2JXTA 3T3OA 4V1SA 4AQ7A 2DRQA 1F77A 3VRAB 1E9MA 3BZDB 3AE7B 4GLSC 1UT9A 2PIAA 4MBGB 2RMMA 1I4HA 1UNSA 3AB5A 2WXKA 3RENA 4AS1A 3B2FA 2LGIA 1B9RA 3W5UB 3B2GA 3EZ8A 3SDRA 1F0ZA 2Q5WD 3NZ3A 3QXQA 3ZGZA 1FCLA 3QXFA 1EM7A 3FILA 2BS2B 1G87A 1R7SA 2INNE 1O1SB 2JYTA 2WXMA 4HKZE 2XNAC 1N60A 1V5CA 2GOXA 4Q2BA 2JYEA 3Q73B 2MJDA 1UUPA 1L4ZB 2G0DA 3T3NA 2D8LA 2IDYA 2DYMA 1DYQA 3P4RB 3OWEB 1XLQA 4RNAA 1YJJA 1WU6A 2QILA 1N94B 1R76A 4L6XA 1W6JA 1G9GA 4LNBB 1D5ZC 3EQAA 1IGCA 1T5XD 2N7JA 3FC4A 1GXMA 1HZ6A 2G9HD 2W54A 1DOYA 3AE9B 3ANKA 2ZIRB 1VDVA 3W2DA 3Q8AA 3TEYA 1HCUA 4WAFA 3X17A 4MM3B 1J7BA 4OZBA 1K52A 4A55A 5MPOA 4C1SA 3WKHA 2QEJC 3R2IA 3AEEB 4RFBA 1H12A 1VZ7A 1PGXA 1SF0A 4MACA 1TNUB 2Y5CA 4UDUC 4LTUA 1QQRA 1ESFA 3P2CA 1F9OA 2CQSA 3RX5A 1QSJA 2D5GA 3MP9A 3N9YC 3P42A 1I7HA 3MC0B 1CLCA 5H8YE 1V1PA 1L0YB 4GDKB 5GW7A 4ITKA 2WXNA 1FCEA 4QT9A 3WUXA 1HQRD 3AV8A 2L1AA 3P5PA 3KWLA 2F0YB 2V4IB 1O1RB 2LJIA 1CZPA 2W55A 1NXCA 2ZBLA 1D8DB 2WXPA 1N4QB 2Y3AA 4ZYSA 2G02A 1JCRB 2JF4A 1H39A 2V8JA 2DYOA 3A3VA 3GB1A 1KLGD 2M56B 4RH6A 2R2LB 2MH7A 2K5PA 3AE2B 4LNVA 3ANJA 2RI8A 1GAIA 4MU9A 4RF0A 3HVDA 1NI3A 1N4RB 2M0AA 1MPEA 5BYSA 3Q75B 1ZDXA 1TJEA 2JQRB 4NJCA 1H37A 1PDXA 2WXFA 2ZISB 2BB5A 2ONQA 3SFDB 2BT6A 3E73A 3SAEA 2XWJB 1FCCC 3GS2A 4C56C 1I4XA 2P0VA 1V1PB 4FXGB 4US8A 1C3DA 1FO4A 2MJEA 4N59A 3HXFB 3WC3A 2GZ6A 3M7CA 3KLSX 3U4EG 1V97A 1ZPSA 2EAEA 3I57A 4A8XC 1SJED 3WIRA 2WNMA 3Q78B 4M0WA 4M76A 3AEBB 4HJGE 2WQYB 5E6JA 5HG2A 1NL4B 1DL2A 3HVZA 1PFDA 3TEZA 4LNGB 1YN3A 3Q69A 1MHXA 1XLNA 4AYQA 3M74A 1C78A 3H8HA 3BWUD 3LB8C 5C3JB 4XUVA 2NMQA 1HZ5A 4ONTA 1TZOA 4GTRB 4ARCA 3NVVA 1SQCA 1GAQB 1O1TB 1D5XC 2I07B 1D6EC 2Z07A 1L5PA 1I4RA 2AQ2B 2L83A 4NAWB 2E6XA 5KKBA 1JWAD 1KH0A 4B0MA 1F2RI 2GRIA 2XN9C 1FXAA 3MFGA 4KGRA 1GB1A 1XO3A 4GTQB 3IT6B 2N0SB 4JPSA 4MH8A 3AMZA 4YDEB 3DSVB 3M76A 3GLYA 3PO0A 4O1NA 2FV0A 1JW9D 4CQNA 3BIID 1ZXHA 2QSDA 3IT4B 4RCOA 1ET9A 2JJBA 4BOKA 1E0ZA 4WU0A 3M7LA 1YMHE 2KQ4X 3TSSA 5JXVA 2NTTA 1TNZB 3M75A 3U7ZA 2RDGA 1V7WA 2WY8A 3P4PB 4HRSA 1ZXIA 4H2AA 3BVZA 3BVGA 3SFEB 2DRSA 3HXCB 3QPFA 2N9KA 1L6VA 2W3SA 1P7FA 1VZ6A 2M19A 3PZ8A 3ABVB 5BYRA 3HXDB 1NYQA 3MJ5A 1FO2A 1XCTL 1XF5L 2H6GB 1IUEA 3WIWA 3BYTB 3AN1A 4RGOS 1VLBA 3VXDA 1ZE3D 4GTOB 3PZ1B 2E3TA 1TS4A 3AEFB 1AWDA 5M7YA 3QRYA 3SFYB 2NOJA 2OHFA 3S4AA 1FM0D 1KWFA 3BK1A 5FO7B 4GL3A 4AYOA 3W9CB 1FRDA 4XWTA 2WDVB 1LTXB 3M78A 1QOAA 1N62A 1YJIA 1E10A 4AYRA 4TF4A 1MHHE 1ZP0B 3KQ4A 2BYTA 3RRSA 1H13A 1QOGA 4US9A 2V0GA 2PN5A 4JWUC 1LD7B 4ZHOA 3M72A 1IS9A 3QFZA 2GI9A 2KAJA 1ACCA 3AFJA 3I9V1 1GB4A 1PUTA 2WXHA 3AEDB 3G6JB 1C79A 1YQ3B 2J42A 3P63A 2INPE 2J52A 5D3IB 5BMGA 1D4BA 4L1BA 4ZHPA 3PMMA 5G5HA 5BYQA 1IBXB 4D4AA 3E30B 5EE0A 3R8BA 3M7BA 1FNWA 1V5DA 3WKFA 3URYA 2WY7A 1LO5D 2YEPF 1CJEA 4YSZB 1H54A 2VZKB 3FAHA 4DOEA 3J9CA 1PYWD 1UG9A 3E33B 5FOBB 4ZRQA 1QLBB 4D4CA 3W7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBC A;  2R2L B;  1S64 B;  4D4B A;  4LNV A;  4MU9 A;  1N9A B;  1TNY B;  1TN6 B;  3K7X A;  1N4R B;  3Q7F B;  1X81 B;  2H6H B;  3Q75 B;  3DSX B;  1H37 A;  2WII B;  2ZIS B;  3PZ3 B;  4GTV B;  4KKJ A;  2BB5 A;  5JPN B;  4YDO B;  1FPP B;  2XWJ B;  4V1R A;  3Q79 B;  1QQF A;  4FXG B;  1H3C A;  4FXK B;  5AGD A;  1C3D A;  5FO9 B;  1JCS B;  3HXF B;  1O6R A;  2V3P A;  4GTT B;  3Q78 B;  3KSQ B;  4M76 A;  3CU7 A;  2B39 A;  1GXO A;  3PZ2 B;  1W6K A;  1NL4 B;  1GHQ A;  3HXE B;  3Q7A B;  4LNG B;  1H3B A;  2SQC A;  3D5S A;  1SA5 B;  3DPY B;  3KLS A;  4BOJ A;  3E32 B;  4GTM B;  4ONT A;  4GTR B;  4ZH1 A;  1HZF A;  1FT1 B;  1GSZ A;  1H36 A;  1SQC A;  1TNO B;  1O1T B;  2IEJ B;  1H3A A;  2XQW A;  4D4C A;  2I07 B;  1KZO B;  3KSL B;  4D4D A;  2H6F B;  1TN7 B;  2V8I A;  3EU5 B;  1H35 A;  1UMP A;  4GTQ B;  5JPM B;  2V8K A;  3OED A;  4YDE B;  1D8E B;  3DSV B;  4MBG B;  1S63 B;  4GTS B;  1O6H A;  4ZRP A;  4BOK A;  3DRA B;  1TNB B;  1TNZ B;  3U7Z A;  3DSU B;  2WY8 A;  4L9P B;  1FT2 B;  2BED B;  1O1S B;  3E34 B;  1KZP B;  1DCE B;  1QBQ B;  2GOX A;  1N4P B;  3HXC B;  3Q73 B;  1SA4 B;  2A73 B;  3E37 B;  2G0D A;  3HXD B;  3EUV B;  2H6G B;  5FO8 B;  4GTO B;  3PZ1 B;  2PMV A;  3DSW B;  1N94 B;  1GXN A;  1R76 A;  1JCQ B;  1W6J A;  4LNB B;  3SFY B;  3DSS B;  2NOJ A;  1GXM A;  3HXB B;  2ZIR B;  1O79 A;  5FO7 B;  1O5M B;  3D5R A;  4EHM B;  1N4S B;  1LTX B;  3OXU A;  4C1S A;  3DST B;  1NI1 B;  3C72 B;  3RJ3 A;  3KQ4 A;  2PN5 A;  1MZC B;  1LD7 B;  1TNU B;  4D94 A;  3PZ4 B;  1TN8 B;  1LD8 B;  1QSJ A;  3SFX B;  3G6J B;  3SQC A;  4KKI A;  2XWB B;  2F0Y B;  2BB6 A;  4D4A A;  3E30 B;  1O1R B;  1O6Q A;  1D8D B;  1N4Q B;  2WY7 A;  2G02 A;  4GTP B;  1JCR B;  1H39 A;  2V8J A;  2WIN B;  3E33 B;  4V1S A;  2H6I B;  5FOB B;  4ZRQ A;  1N95 B;  2V3N A; 
#chains in the Genus database with same CATH topology
 1AN8 A;  5C23 A;  2DZK A;  2G45 B;  4XDD A;  3VRB B;  2JU6 X;  2V3S A;  1TN6 B;  3Q6B A;  4HXD A;  2H6H B;  3H2W A;  3FIL B;  1TF4 A;  5D6J B;  2NPT B;  5IL8 A;  4M00 A;  4YDO B;  3Q3F A;  1WXS A;  2AFA A;  4RM8 A;  1LGR A;  1WSP A;  1KTK A;  4CHK A;  2WXQ A;  1O6R A;  2IGD A;  3AE4 B;  3K11 A;  5D94 A;  3VUW A;  3RPF C;  1EF1 A;  1FXT B;  4IKG A;  4IDI A;  1WJ4 A;  2LI5 A;  3R2T A;  1H3B A;  3D5S A;  1TS2 A;  1NEK B;  4NJ7 A;  3ZQ4 A;  2IJ0 A;  1N63 A;  4MJS A;  2FCS A;  2ZW1 A;  1HZF A;  4IWO A;  1TNO B;  1I4G A;  3AM9 A;  2LMC A;  1JWU D;  1T6B X;  3NOB A;  2NTS A;  1NDD A;  1GC6 A;  1TN7 B;  1EU3 A;  2EKE C;  1F1S A;  1ULV A;  1QKZ A;  3OED A;  1TTN A;  2IO2 B;  3WIM A;  2PJH A;  1GAH A;  3ZJT A;  1SBB B;  3E80 A;  3K9O B;  4LDT B;  1TNB B;  3PVL A;  3IAS 1;  1QF6 A;  1RFK A;  4R3D A;  5HFY A;  3HUI A;  2LRW A;  5IK0 A;  4F7Z A;  4HJK A;  2B76 B;  4WUR A;  4NZL B;  1HMU A;  1RW9 A;  3E37 B;  3RX7 A;  2RGK A;  2NBV B;  4AJW A;  1Q0W B;  4MGY E;  1TS5 A;  3UIO B;  3L13 A;  2K3U A;  4WIP A;  4WWM A;  3AE3 B;  2ON8 A;  3HXB B;  3SD5 A;  2QIE B;  5AUK A;  4EHM B;  4W9F A;  2VN7 A;  5GZK A;  3DBS A;  4DI5 A;  3Q3M C;  3O13 A;  5LLI A;  4TQ0 A;  3NVZ A;  1MZC B;  4ANW A;  2WU2 B;  4IW0 A;  4FJV B;  3PZ4 B;  1JWS D;  1YN5 A;  4J3O D;  3CWI A;  3O65 B;  1C4P A;  4JL9 A;  4PT5 A;  1KSC A;  3MTN B;  2Y5P A;  3NJT A;  4L23 A;  1FFU A;  1SGH A;  3ON6 A;  1EF5 A;  1RAX A;  1J8C A;  2RDB C;  4WJN A;  4HLE A;  3QSP A;  4OVU A;  2ZEQ A;  4IM2 A;  1HA5 A;  2PTL A;  1L1Y A;  1WE7 A;  4JIO U;  1WXQ A;  2BKF A;  2NVP A;  1QOB A;  1T3Q A;  4HKQ A;  4MEM A;  1GG3 A;  3N0F A;  3V6C B;  3VSN A;  4WQM A;  4YWG G;  3QQ8 B;  3VH3 B;  3T33 A;  1OQR A;  3IXS A;  1JCS B;  1C77 A;  3W7T A;  3SDL C;  2LVQ A;  2FUZ A;  1C76 A;  2CHW A;  2TSS A;  5IM1 A;  3E6U A;  4GMV A;  4KZ0 A;  4GTM B;  3NUH B;  1IA7 A;  5J18 A;  2O6V B;  2HDE A;  2F6D A;  1TY2 A;  4P16 A;  3MC9 A;  3V3X A;  4D4D A;  1E7P B;  3ACS A;  3SDV A;  1XLP A;  1S1Q B;  1LXM A;  1Y56 A;  1OJN A;  4LK0 M;  3TJP A;  2IBI B;  4ANU A;  2X03 A;  5JHA A;  3C8Y A;  2FAZ A;  4GTS B;  1GLM A;  4JGH B;  1E8Z A;  1F1H A;  2LVO A;  1GUA B;  4NPN A;  2MJ3 A;  4OW0 A;  2KTF A;  1YQ4 B;  1DCE B;  5DGR A;  1X1I A;  2DX5 B;  2YEP B;  1Q10 A;  3E56 A;  5I4D A;  3DPD A;  4OHJ A;  2KJR A;  5FO8 B;  2PMV A;  3DVG X;  2JRH A;  1JCQ B;  2Y5B B;  3DSS B;  2KJH B;  4ZG8 A;  4JX1 C;  1NI2 A;  2CHX A;  5E6N A;  1KM7 A;  4XE0 A;  4WVA A;  4C80 A;  3VHT C;  2D3C A;  1NI1 B;  2PPH A;  1K51 A;  1LQB A;  2Z59 B;  3DBL I;  4YTP B;  2OED A;  4GDL B;  1M94 A;  1FEH A;  1WI0 A;  2FV1 A;  4KKI A;  3NS1 A;  2AHG A;  3SDT A;  1QZE A;  4IWP A;  2XK5 B;  2UWQ A;  3APF A;  2OOB B;  4HVB A;  5EE1 A;  4GTP B;  1N61 A;  1QT9 A;  2MP2 B;  1F9J A;  5G2N A;  3VR8 B;  4YT0 B;  2H6I B;  2UYZ B;  1N95 B;  1VCB A;  1UZX B;  3PYB A;  1OEY A;  2NBU A;  1JWM D;  2BYV E;  1V8C A;  4JQW C;  1FRR A;  4MGK E;  5EE9 A;  1WU5 A;  1MFW A;  5EDS A;  1H4R A;  4HRO A;  4L2Y A;  2JX5 A;  2R2O A;  3MHS D;  3RMK C;  4J5T A;  4WWO A;  3R7Q A;  1EGU A;  4BFR A;  2GH4 A;  3PGE A;  1J7C A;  3PZ7 A;  1WGG A;  3PZ2 B;  1CEM A;  4FN2 A;  3S9V A;  2IO0 B;  2MHJ A;  4YSX B;  3ZDT A;  1DOX A;  3NG0 A;  1SEB D;  1N7O A;  1WX8 A;  2LGS A;  1EUV B;  3AUL A;  4BAX A;  1C9F A;  1E8Y A;  1WZ3 A;  3M71 A;  5D7G A;  4ZH1 A;  1IBX A;  2FUT A;  2WP9 B;  3RSY A;  3DWG C;  3E7J A;  1BML C;  3EU5 B;  3A33 B;  3VRA B;  4GLS C;  2PIA A;  4MBG B;  1UNS A;  2V4L A;  3AB5 A;  4B6W A;  4AS1 A;  3W5U B;  3ENE A;  4EZJ A;  2BYF A;  1F0Z A;  2Q5W D;  3ZGZ A;  3W1Y A;  4IUM B;  4EUT A;  1EM7 A;  3FIL A;  2BS2 B;  2INN E;  2JYT A;  2MSE D;  2NPT A;  2XNA C;  2JYE A;  1LXK A;  3AU5 A;  4FJY A;  3T3N A;  2IDY A;  1DYQ A;  3P4R B;  3I3T B;  3AI5 A;  1N23 A;  3RUI B;  3X23 A;  3Q3N C;  2DEN B;  5EAT A;  1G9G A;  1IGC A;  4AJY B;  2G9H D;  2W54 A;  3N1Y C;  4MM3 B;  4BVU C;  3WKH A;  3AEE B;  4W9G A;  1HE8 A;  1SF0 A;  2Y5C A;  1QQR A;  3ZNI D;  3P42 A;  3MC0 B;  4DDI D;  4HCP B;  1LM8 B;  4ITK A;  3WUX A;  1HQR D;  1OJM A;  2L00 B;  3DBL B;  1NXC A;  5CTR C;  5DPW A;  1N4Q B;  1E7U A;  4E71 A;  2G02 A;  2LGD A;  3MC8 A;  3GB1 A;  1KLG D;  2N9P C;  3KYD D;  3AE2 B;  4LNV A;  1GAI A;  1NI3 A;  1N4R B;  1TJE A;  4OVV A;  1OJO A;  4LNI A;  1U4A A;  4TKN A;  3SFD B;  4C56 C;  1V1P B;  1AAR A;  1V9J A;  3M7C A;  2N7D A;  1WXA A;  2KT7 A;  1V5T A;  2M0X A;  3WIR A;  3AEB B;  4W9I A;  4LNG B;  2HD5 B;  5KHQ A;  4AYQ A;  1E8W A;  3WAN A;  2KWU B;  4GTR B;  4BBN F;  1CB8 A;  1SQC A;  2XEW A;  4HWI B;  2L76 A;  2L7R A;  3R66 C;  1D6E C;  1I4R A;  2AQ2 B;  1JWA D;  1KH0 A;  4B0M A;  1GB1 A;  5ILJ A;  1RRB A;  3ML9 A;  1WFY A;  3IT6 B;  4JPS A;  3ZXR A;  3DSV B;  3PO0 A;  1JW9 D;  2JJB A;  4BOK A;  5ILZ A;  3TSS A;  2KQ4 X;  1YX6 B;  1TNZ B;  3M75 A;  2NTT A;  2O6V D;  1V7W A;  3P4P B;  3ZVV A;  3BVG A;  3SFE B;  3CSF A;  4EKU A;  3QPF A;  3NZS A;  1RFA A;  3RNC C;  1FO2 A;  3WIW A;  3BYT B;  3NS8 A;  1ZE3 D;  5IN7 A;  3MJW A;  3JYU A;  3H9D A;  4EOY A;  1N1B A;  3BK1 A;  4GL3 A;  4C00 A;  1WE6 A;  1FRD A;  3M78 A;  4AYR A;  4TF4 A;  3EC8 A;  1HV6 A;  1ZP0 B;  3RRS A;  1H13 A;  2CS4 A;  4US9 A;  4J6I A;  4K3B A;  4ZHO A;  4WQO B;  2LD9 A;  3RUL A;  2WCO A;  2J42 A;  5D3I B;  3PRP B;  2KDF B;  4D4A A;  3E30 B;  4K7W A;  2LGX A;  1FNW A;  3B1L X;  1TZ1 A;  1CJE A;  4YSZ B;  2KDI A;  1H54 A;  4DOE A;  2IO1 B;  1UG9 A;  2KXJ A;  2LHE A;  5IO9 A;  2K9X A;  1Z2M A;  3JW0 X;  4WVB A;  2J7Q B;  3ACT A;  1YN4 A;  1X81 B;  1N7Q A;  4ZOH C;  2KFJ A;  1N24 A;  1WGR A;  3G4D A;  3CST A;  4TV3 A;  1FBW A;  3CMM B;  2QNO A;  3VQI A;  2BRP A;  4KGT A;  5IKH A;  2WX0 A;  1C3T A;  2KDM A;  2YLM A;  3ZTD A;  3KSQ B;  4NQK E;  4USA A;  1HXC A;  3HXE B;  1P7E A;  3Q7A B;  1ET6 A;  1WGD A;  3DPY B;  4GDL A;  4LLG M;  4BOJ A;  2FCN A;  3UQA A;  4ACF A;  1VRA B;  2D2Q A;  2XK5 A;  2KN4 A;  1H3A A;  1C82 A;  2LFI A;  2ZZP B;  3IAM 1;  1WYG A;  1FNU A;  3KYC D;  1UMP A;  4RGT A;  5JPM B;  3P5R A;  2MP2 A;  3IBE A;  4ZDV A;  3H3K A;  3SR6 A;  3WCQ A;  2XFG A;  3EUB 2;  4HPL B;  2FIF A;  2HJ1 A;  4GSW A;  3AXC A;  3L10 B;  4HCN B;  4AYP A;  2KJ6 A;  1WGY A;  2CJN A;  5CHW A;  3L17 A;  4S17 A;  3OJ4 B;  3DSU B;  4W9K A;  5E6P A;  1J19 A;  4OZW A;  2KK8 A;  3QAR A;  3R3M A;  4XC2 A;  3DQV A;  2KX3 A;  2VRR B;  4NEI A;  1KRF A;  2WYN A;  4LNO A;  1H14 A;  3A1Q B;  5E2J A;  3DSW B;  4ANX A;  1TKE A;  2EAD A;  2MRP A;  4A9A A;  3MHZ A;  1MI0 A;  2HTH A;  4IOI E;  1O79 A;  1JCK B;  1K72 A;  4XGA B;  3HM6 X;  5CD2 A;  4GOC A;  3A4R A;  2WU5 B;  1X9D A;  2C7N B;  1N21 A;  4IWQ A;  1JS4 A;  4TQ1 A;  2BTE A;  1SSN A;  1ZKH A;  2K22 A;  1RLF A;  4P1B C;  5IP4 D;  2DWQ A;  3SFX B;  2JG0 A;  3U52 E;  1XEE A;  2VZK D;  2AQ3 B;  3ZLZ A;  1R4M I;  1TKG A;  3AE8 B;  4ICV A;  1ZGU B;  1LOH A;  3ZNH B;  2M1M A;  5DHK A;  4TSS A;  3WKG A;  4HEA 1;  2WIN B;  3CIH A;  1SB3 C;  2OKX A;  5KHO A;  2BBC A;  3JSV B;  1S64 B;  2JZ3 B;  2MW5 A;  3SDQ A;  3QX1 A;  1QIL A;  2RD0 A;  4WJQ A;  3TEW A;  4B0E A;  2DLB A;  4XX5 A;  3Q79 B;  1QQF A;  4HPM B;  4YL8 A;  4MM3 A;  4II3 B;  1P9D U;  4ZRI A;  1AW7 A;  4KGS A;  4DOD A;  5IA7 A;  3P1M A;  3W7W A;  1UEL A;  1UD7 A;  3DWM A;  1GXO A;  4II2 B;  4BOZ B;  1OEY J;  1WWT A;  5AUI A;  2KYW A;  2KN5 A;  1V7V A;  3RZF A;  3PHW B;  1WU4 A;  3RNA C;  3BYY B;  4XDC A;  1SE3 A;  2DBY A;  1SE9 A;  1WR6 E;  1IP9 A;  2BGF A;  2KWD A;  2MWS B;  5BO4 B;  3VW5 A;  1K53 A;  2PLP A;  3QFY A;  1IGD A;  5DCN A;  4EL8 A;  3KWV A;  2WXR A;  2J0J A;  4IC7 B;  2JSV X;  4NAM A;  2BVC A;  4PK1 A;  3TMP B;  2DRO A;  2VN4 A;  3E34 B;  1KZP B;  2JZP A;  2JVC A;  2LUM A;  3EUV B;  1X1M A;  4L0G A;  2E22 A;  4WH4 A;  1T0Y A;  1WXV A;  3WAO A;  4FUS A;  2KQ7 A;  3D5R A;  3EU8 A;  1E8X A;  4I6P A;  4XWW A;  1XW2 A;  3DST B;  3NVY A;  3RJ3 A;  1C4A A;  5HHD G;  3DVG Y;  3AEG B;  2WS3 B;  2EAC A;  1NYR A;  3DVN V;  3AEC B;  3NY5 A;  4N6E B;  4JJJ A;  5HKH A;  5C1Z A;  2WXJ A;  2XWB B;  1I42 A;  1OFF A;  1FIQ A;  1UGM A;  2FBA A;  2DAF A;  2RI9 A;  2MEK A;  1WF9 A;  3PRE A;  4MH0 E;  1LF9 A;  1PQS A;  1KF6 B;  5L95 C;  1S3S G;  2B4F A;  1R4M B;  1N9A B;  2G1E A;  3H1U A;  3PYA A;  2IND C;  3RNE C;  2REX A;  1RQ5 A;  4G11 A;  1YJ1 A;  5JPN B;  1ZUD 2;  2AQ1 B;  3AH7 A;  4V1R A;  3V62 A;  2FUG 1;  3S4C A;  1PGB A;  1HM3 A;  2IZV B;  4FXK B;  5AGD A;  4C4V B;  2HTM E;  3TUO A;  1RWG A;  2B39 A;  1XCQ L;  3B0A A;  2L3Z A;  1E90 A;  5IOI A;  3ZXV A;  4A90 A;  2ZJD A;  3VH4 B;  1SE2 A;  1TY0 A;  1SIJ A;  1G9J A;  4KSL C;  1VZ8 A;  4G50 A;  1ROE A;  2H6F B;  3GT5 A;  3RFZ B;  5CZL A;  2Z8L A;  3A9J B;  2LZ6 A;  5IKC M;  3IVF A;  2LGI A;  3EZ8 A;  3SDR A;  1N7P A;  3KUC B;  3BY4 B;  1R7S A;  4LNF A;  1O1S B;  2FNJ B;  1Z5S B;  4BBN C;  2CHZ A;  4GDK A;  4GN1 A;  3ECI A;  1L7Y A;  3M02 A;  4RNA A;  3ALB A;  1YJJ A;  4EZK A;  1N94 B;  1T5X D;  3RNB C;  1D5Z C;  3FC4 A;  3ANK A;  3AU4 A;  1VDV A;  4FLH A;  3W2D A;  4DXA B;  4WAF A;  3T8M A;  4A55 A;  3Q3J A;  2KX0 A;  1WM2 A;  1WGH A;  1IPG A;  3QHT A;  4XZ4 A;  1H12 A;  1VZ7 A;  3ONS A;  1TNU B;  4LTU A;  1ESF A;  3P2C A;  3MP9 A;  3RX5 A;  1QSJ A;  2D5G A;  1I7H A;  1CLC A;  2MBB B;  2LWP A;  2WXN A;  3AV8 A;  2L1A A;  3DOW A;  3KWL A;  2F0Y B;  3VUY A;  2V4I B;  3RNF C;  1O1R B;  1GJZ A;  2W55 A;  2WXP A;  2Y3A A;  4ZYS A;  2LVP A;  2KWC A;  1JCR B;  2PE9 A;  4LNK A;  2R2L B;  2K5P A;  2IO3 B;  2KQS A;  5BYS A;  1ZDX A;  3A1Q A;  2JQR B;  3L0W B;  1H37 A;  3ZRC A;  2ZIS B;  2BB5 A;  2KVR A;  3TBL D;  3Q3O C;  3DHG C;  1MG4 A;  4US8 A;  1HXA A;  1MJD A;  3HXF B;  4M8N A;  3KLS X;  1ZPS A;  2EAE A;  1SJE D;  4G0N B;  4HJG E;  3TEZ A;  3G4F A;  1PFD A;  3NZU A;  1MHX A;  4XYC A;  3Q2A C;  3BWU D;  4XUV A;  2J0M A;  2NMQ A;  2UU7 A;  1TZO A;  1GAQ B;  2K8C A;  2I07 B;  2Z07 A;  5LXI B;  4I6L B;  2O2V B;  1FXA A;  3MFG A;  4AOF A;  3ZKJ C;  4FUL A;  3M76 A;  3GLY A;  3JSV A;  3ZO5 B;  2FV0 A;  4CQN A;  3BII D;  1ZXH A;  2QSD A;  2LUE A;  3IT4 B;  4RCO A;  1YMH E;  3VXW A;  1UF0 A;  2WY8 A;  4HRS A;  4FBJ B;  1ZXI A;  3WA0 A;  4K7U A;  3HXC B;  2L05 A;  1OJP A;  3MJ5 A;  1XF5 L;  3EFU A;  4RGO S;  4GAX A;  4FJQ A;  3PZ1 B;  4GTO B;  4HDQ A;  2E3T A;  2V9H A;  1IYF A;  4DBG A;  1HMW A;  1FM0 D;  1KWF A;  4IG7 B;  5FO7 B;  4MMH A;  3W9C B;  4XWT A;  5IKA A;  1RWC A;  1YJI A;  1E10 A;  1GC7 A;  4GXB A;  3QA8 A;  3KQ4 A;  2QCZ A;  2BYT A;  1P98 A;  1LD7 B;  3M72 A;  5J17 A;  1SIF A;  2MX2 A;  1GNU A;  2KAJ A;  1ACC A;  3I9V 1;  3VAW A;  4DHJ D;  5BMG A;  5ILI A;  3GZN I;  3PTF C;  4L1B A;  3PMM A;  1H8C A;  5G5H A;  5BYQ A;  5ILH A;  3RD2 A;  2GBM A;  3IFW B;  2KDB A;  3WKF A;  1WM3 A;  2K8B A;  1LO5 D;  2L8J A;  2VZK B;  3N0G A;  1PYW D;  5FOB B;  1V5O A;  1QLB B;  3W7U A;  2K6D B;  3ZJV A;  2J4X A;  3ZNG C;  2DZJ A;  1JQ4 A;  3P4S B;  2DNF A;  2C60 A;  3DSX B;  1AYX A;  3V05 A;  3DDC B;  2I1J A;  1T0R C;  3L16 A;  1H3C A;  3Q8C A;  1C4C A;  2LEK A;  1FXI A;  3P4Q B;  2JWZ A;  4Q2J A;  1UWX A;  2ZCC A;  1RWH A;  2H89 B;  3EEC A;  3V60 A;  4YXD B;  2KAC A;  1E7V A;  2JT4 B;  4W9J A;  4WWP A;  3QT3 A;  4IM0 A;  2VH1 A;  3KUZ A;  4MSQ B;  4Z4L A;  1L0V B;  4YCR A;  3UF8 A;  1D5M C;  3C19 A;  4Q88 A;  2PW9 A;  1T0Q C;  4CJ1 A;  3I63 C;  4ZYN A;  5AEK B;  2V8K A;  1HTO A;  4AWJ A;  1WR1 A;  3W7S A;  3N1X C;  2KC2 A;  2SEB D;  4MSM B;  4GU2 A;  1S63 B;  1BT0 A;  3BIN A;  2WHI A;  4WVC A;  2LRU A;  1I8Q A;  1N7R A;  4B95 A;  2ZCB A;  1J0M A;  4L9P B;  2BRV X;  2D3A A;  3PHX B;  4DDG D;  1N1Z A;  3BVM A;  4OZA A;  5T8I A;  4FXC A;  1M4V A;  3DVN U;  1HEZ E;  3UQB A;  4YTM B;  4P1C C;  2N9E B;  3LZ9 A;  4PYZ A;  1WGK A;  2G3Q B;  4C4V A;  1VD5 A;  3TIX A;  1GXN A;  2R61 A;  2KZR A;  4C7Y A;  3QWT A;  1DOG A;  3QAQ A;  5G5G A;  3HRD D;  3DBH I;  4E1Y A;  2BS3 B;  3WAL A;  5FKA C;  3A4S C;  5CHV C;  2KMC A;  1TS3 A;  3PSE B;  2AL6 A;  4M0W B;  2PVG C;  2D07 B;  3ML8 A;  3ZIM A;  4D94 A;  1N5X A;  1R4N I;  3A9K B;  4MGI E;  4AP4 C;  3W5N A;  3ZRF A;  2L0F A;  3WIQ A;  3A9J A;  4RGN A;  2ZVO A;  2BB6 A;  5GY3 A;  1ZOY B;  2K8H A;  3GE3 C;  2C5L C;  2JY6 A;  3AEA B;  3GOE A;  3NHE B;  3GZN B;  2V3N A;  2RGF A;  2KNB A;  1DOI A;  1UBQ A;  2O6V A;  4BKS D;  1TNY B;  2AWT A;  1KFY B;  2GOW A;  3E9S A;  2ACZ B;  2DYB A;  3EGR A;  4W9C A;  1JRU A;  4JWS C;  3Q8F A;  3UGB B;  4GTV B;  5FK9 C;  3UIP B;  3W1S C;  1HXG A;  1FPP B;  1KRH A;  2JZZ A;  1L0X B;  1YD8 U;  1N5W A;  2FE8 A;  4OZV A;  1NEN B;  1Q5W B;  3U2S C;  1TT5 B;  5FO9 B;  2MQJ A;  3ZJU A;  2J53 A;  1LF6 A;  2DZI A;  2BKR B;  1GHQ A;  2ZZR A;  2LAS A;  3H7L A;  1ENF A;  1MVK A;  2LXC A;  4LJP B;  1NVI D;  1KRE A;  1GA2 A;  1FT1 B;  1H36 A;  2IEJ B;  2XQW A;  2QHO A;  4OVZ A;  3RN9 C;  5M7I A;  2BW2 A;  4MGZ E;  5MEH A;  3N3K B;  4KX6 B;  2SAK A;  3U4E G;  3TF4 A;  2JXX A;  2L52 A;  4F8C B;  2K1F A;  2BS4 B;  2EAB A;  2NS5 A;  4QAY A;  4X57 B;  4DQO C;  1N7N A;  3QC8 B;  3H7P B;  3DRA B;  1P3Q U;  2WXI A;  3GP7 A;  4PYU A;  1TYG B;  1F9D A;  1LXD A;  5EE3 A;  2G4D B;  2DRR A;  2M8S A;  2LHD A;  4S0R A;  1LFD A;  4IM3 A;  2BYE A;  1J7A A;  1V86 A;  2PEA A;  3NRZ A;  4F1S A;  1OQQ A;  1HN0 A;  4TXT A;  1OQY A;  2PE6 B;  5CX3 A;  3M95 A;  5BMH A;  3BK2 A;  4YSY B;  5AZF A;  5ILY A;  2WX1 A;  1ZW7 A;  4LJO B;  2IGH A;  2X38 A;  1LD8 B;  1YQB A;  2O2V A;  4KTP A;  3U30 A;  3DBH B;  3SDU A;  3SQC A;  3SU8 X;  2WYQ A;  1HXY D;  3L4P A;  4A6Q A;  2RPQ A;  4DWF A;  4OJZ A;  1BUI C;  3QG0 A;  1R4N B;  1L2A A;  1N6Z A;  5C2T B;  2XBB C;  3LXF A;  2I2Y A;  1STE A;  4MDK E;  3M62 B;  3RX8 A;  2KLG A;  2DHZ A;  2OJR A;  4TMA B;  2NVU I;  4DK5 A;  3V6E B;  1I4P A;  3ETR A;  3N30 A;  3GZK A;  4OK2 A;  1XWQ A;  1GPX A;  4FAD A;  3NVW A;  1WZ0 A;  1F2R C;  2RSU A;  3M63 B;  1YOV B;  3QT9 A;  2IY1 B;  2KMM A;  2L0T A;  2BRW A;  3M77 A;  3L08 A;  2AL3 A;  4EEW A;  4DXG A;  2MBE A;  3LYY A;  1FFV A;  4LNN A;  3KLS A;  1XWT A;  2GBR A;  2E24 A;  3PPA A;  3S4D A;  4ZH5 A;  2C7M B;  2K39 A;  5D3D A;  4WWN A;  1K50 A;  4W9H A;  4DXF A;  4JE3 B;  1GOZ A;  3T9L A;  2I38 A;  1H35 A;  1UH6 A;  2HJ8 A;  3T3O A;  4AQ7 A;  3N1Z C;  1E9M A;  3BZD B;  1P0R A;  2G4S A;  1UT9 A;  3H7S A;  2WXK A;  3REN A;  3B2G A;  1TBE A;  3LJ3 A;  4GIV A;  2ASQ A;  3NZ3 A;  3RNG C;  2JUO A;  1FCL A;  1V5C A;  1UUP A;  1OTR B;  2G0D A;  3PLV A;  2DYM A;  3OWE B;  2QIL A;  4LNB B;  3B08 A;  1W6J A;  3EQA A;  2D3G A;  2KAN A;  1HZ6 A;  1DOY A;  3AE9 B;  4BOS C;  3Q8A A;  2BPS A;  3NFV A;  3RCZ A;  3TEY A;  3X17 A;  2C9W B;  2R2Q A;  1X1J A;  3N32 A;  5MPO A;  2QEJ C;  2MBO A;  3PS6 A;  4RFB A;  4E3C A;  2INC C;  4JLC A;  3N9Y C;  1F9O A;  2CQS A;  5H8Y E;  1V1P A;  1L0Y B;  4HK2 A;  4DHJ B;  2LJI A;  1CZP A;  3HM3 A;  1D8D B;  1WY8 A;  2DYO A;  4M01 A;  2FID A;  4BZA A;  3KUD B;  4RF0 A;  4A20 A;  2M0A A;  1MPE A;  3Q75 B;  1C1Y B;  3PZD A;  2BWF A;  4KDL B;  4TUU A;  1PDX A;  2V1Y A;  2MA9 B;  3E73 A;  2XWJ B;  1FCC C;  5J2R A;  1I4X A;  2N4F A;  3WAP A;  2MJE A;  3WC3 A;  2GZ6 A;  4KV2 A;  3I57 A;  4A8X C;  2WNM A;  4M0W A;  5E6J A;  4ANV A;  1DL2 A;  2X8X X;  3A9K A;  2KVZ A;  1XLN A;  3M74 A;  1C78 A;  1WIA A;  1W3Y A;  3QJZ A;  4ONT A;  4DHZ B;  1V81 A;  4NAW B;  1WH3 A;  2E6X A;  2Z0E B;  5KKB A;  1F2R I;  2GRI A;  4KGR A;  1XO3 A;  3X0W A;  4GTQ B;  1ISN A;  2N0S B;  4MH8 A;  3AMZ A;  4O1N A;  1YX5 B;  4WU0 A;  3M7L A;  2GBK A;  3OAW A;  2J0K A;  4H2A A;  3VTW A;  3BVZ A;  5IK9 A;  4KIK B;  4WAA A;  2W3S A;  1P7F A;  1VZ6 A;  2M19 A;  3PZ8 A;  3ABV B;  3HXD B;  1IUE A;  3AN1 A;  2QDF A;  4DHZ E;  1AWD A;  2NOJ A;  5CHF A;  3IHP C;  2OHF A;  2KHW B;  3PLU A;  1N20 A;  3S4A A;  2KFK B;  3DBR I;  4AYO A;  4K81 A;  2WDV B;  4WJO A;  1LTX B;  1QOA A;  4LCD E;  3P2B A;  1MHH E;  3PT2 B;  3RI7 C;  3PRZ A;  1L2N A;  1IS9 A;  3DHI C;  1V80 A;  3AFJ A;  4RNQ A;  2WXH A;  3AED B;  3P63 A;  1YQ3 B;  1WJN A;  1D4B A;  2INP E;  2J52 A;  3GE8 C;  4ZHP A;  4MEL A;  2WGS A;  2D3B A;  3R8B A;  3H7P A;  4AUQ C;  3URY A;  2WY7 A;  2YEP F;  2EMS A;  1WMH B;  2JRI B;  4D4C A;  1KLV A;  2I1K A;  1XT9 B;  2QJL A;  3B9J A;  3VVW B;  4D4B A;  2FCM A;  2WXG A;  4FHK A;  3K7X A;  4YTN B;  3Q7F B;  2RPV A;  3U7D A;  1AGM A;  2WII B;  4KKJ A;  2CU1 A;  4W9L A;  5D2M B;  3SEB A;  4W9E A;  3RT3 B;  4E74 A;  4D2K A;  2OJW A;  2KTR B;  2YVC A;  4EZL A;  4KSK C;  1EU4 A;  4CYE A;  1KKT A;  1XXG A;  2N7E A;  2JWU A;  1FBO A;  4MMI A;  3CU7 A;  3VTU A;  3JVZ X;  1W6K A;  3AE5 B;  1QOF A;  3RZW C;  1K8R B;  2SQC A;  2RR9 A;  1KJT A;  5HI1 A;  3M3J A;  4M8M A;  4CO7 A;  1P1A A;  3E32 B;  1RM6 C;  1I35 A;  2KMA A;  2FUH B;  1GSZ A;  1G6I A;  2DZM A;  2ZVN A;  1UGJ A;  3W5V B;  5DHI A;  1JRP A;  2KKC A;  3V61 A;  4P6V F;  1D8E B;  1FMA D;  2LGY A;  4ZRP A;  4EE2 A;  2W9N A;  3M00 A;  5TSS A;  1VR9 A;  5DPT A;  2WDT B;  2ONH A;  2N9L A;  5BMI A;  1FT2 B;  2BED B;  2AX5 A;  3W7X A;  1E5W A;  1N4P B;  3A0O A;  4CJ0 A;  2A73 B;  2D11 A;  2EKI A;  1TIF A;  4ARI A;  1D3Z A;  4OZC A;  3ZUN A;  5G55 A;  3Q8E A;  1FNV A;  2ICI A;  1FPY A;  1UWM A;  3Q14 C;  4PS3 A;  5GXG B;  1FO3 A;  2ZNV C;  4KVG B;  3QCA A;  1XD3 B;  4RGM A;  3OXU A;  3C72 B;  2IGG A;  4FHJ A;  2Z0D B;  1N22 A;  5IAA C;  3DBR B;  2GMI C;  5DPR A;  1FAE A;  3TL5 A;  2A5U A;  3CIR B;  2WDR B;  3AE1 B;  2ZPY A;  5DGQ A;  4RM9 A;  5AZG A;  2BWE S;  1V1O A;  4FJZ A;  3D3I A;  5JMD A;  1JWB D;  5IK6 A;  2Q1F A;  1FP3 A;  3LDZ E;  3ANI A;  2A8Z A;  3ZW3 A;  1L4D B;  2LJ5 A;  2KD0 A;  1ZDV A;  2MCN B;  4KTR A;  3ZTC A;  3KW5 B;  2N1V A;  1V6E A;  3K9P B;  3NNB A;  5FR3 A;  4N58 A;  2KOX A;  1YNT E;  2L32 A;  1SJH D;  2W82 A;  4I6N B;  2VH2 A;  2DAJ A;  4C7Z A;  2K6Q A;  3HHM A;  3TCA A;  2GB1 A;  1DGJ A;  1A70 A;  1I4Q A;  3FKY A;  2YIK A;  1UBI A;  3S4B A;  4MT5 A;  4Z4J A;  4FNV A;  5DPS A;  1IA6 A;  3SHQ A;  5IL3 A;  4KZC A;  2AEH A;  3M73 A;  2PVO D;  4LDT D;  1JRO A;  4LIX A;  5JZE B;  2CU3 A;  3IG3 A;  3S2A A;  2RDH A;  5JMF A;  1KS8 A;  1O6H A;  3H6N A;  5ILD A;  4REZ A;  2IPK D;  3QDE A;  2FUQ A;  1SE4 A;  2H88 B;  1JAL A;  1KLU D;  2AHF A;  1TKY A;  4GB9 A;  1QBQ B;  4G3X B;  4CE7 A;  1SA4 B;  2WLB A;  3HIZ A;  1RWS A;  1KFG A;  4HDO A;  1A5R A;  4NJ6 A;  1TGZ B;  3U8Z A;  2JPH A;  2M4N A;  5C05 A;  5LNK 1;  4F13 A;  1CMX B;  1PGA A;  1CK1 A;  3M01 A;  1VJK A;  3HK0 A;  2EEL A;  3ZYY X;  1L6U A;  1O5M B;  3W5M A;  1KSD A;  1N4S B;  1NC5 A;  1WXM A;  5JHB A;  2KC1 A;  1WZZ A;  1V2Y A;  3UIN B;  4HPP A;  3WAM A;  4ASW C;  2NCN A;  4NAW A;  1TN8 B;  1J0N A;  3EA6 A;  3AE6 B;  3TEX A;  3WKI A;  5ILK A;  1T0S C;  2WXO A;  4MJS B;  1FD6 A;  5EAS A;  1FMI A;  2WDQ B;  1RYJ A;  3PRM B;  1O6Q A;  1WRI A;  3AFL A;  2B3A A;  2PKO A;  2IYD B;  2MLB A;  1BXT A;  2WXL A;  3DCG A;  1JML A;  2WWZ A;  1AYF A;  3W1S A;  2MBH A;  3OG5 A;  1EWY C;  2C7H A;  1V49 A;  2CQT A;  4KIK A;  3UI3 A;  1F9G A;  2QMT A;  1B1Z A;  2WDA A;  1SXT A;  4PS8 A;  4M02 A;  3PV1 A;  1V7X A;  2D5J A;  3M7E A;  3PZ3 B;  2CJO A;  4EFO A;  2GLS A;  5H92 C;  1HM2 A;  1YIW A;  2KFK A;  2K0P A;  1E6E B;  1Q1O A;  4RF1 A;  1EWC A;  2V3P A;  4GTT B;  3R7R A;  3VR9 B;  2GBJ A;  3QWZ B;  1WX9 A;  1SA5 B;  2NBW B;  3QIJ A;  2ZW0 A;  2KLC A;  4FA6 A;  2W3R A;  4BKT A;  3Q8B A;  2FBW B;  3ZDM C;  3KH0 A;  1KZO B;  3KSL B;  5CA3 A;  1X1H A;  1G6J A;  1CQV A;  2V8I A;  2HE7 A;  1WMH A;  1XLO A;  2JXT A;  2DRQ A;  1F77 A;  3CF6 E;  3AE7 B;  2RMM A;  1I4H A;  1WRD B;  2NR2 A;  3VTV A;  3B2F A;  5L83 A;  1B9R A;  3KVF B;  2D10 A;  3QXQ A;  1XQQ A;  1HTQ A;  2CKH B;  3QXF A;  4HKZ E;  1G87 A;  3L54 A;  2LXA A;  2WXM A;  4BKS A;  1N60 A;  4Q2B A;  2GOX A;  3RYT A;  3Q73 B;  2MJD A;  3D32 A;  1L4Z B;  1WYW B;  2D8L A;  2BQQ A;  2KTR A;  1XLQ A;  2A4Z A;  1WU6 A;  1R76 A;  4L6X A;  2N7J A;  1GXM A;  3VDZ A;  2ZIR B;  1HCU A;  1J7B A;  4OZB A;  3ZNZ B;  1K52 A;  4NY0 A;  4C1S A;  4OK4 A;  3EFC A;  3R2I A;  3APD A;  1PGX A;  4MAC A;  4P7I A;  5JH5 C;  4UDU C;  4RMA A;  4K3C A;  4GDK B;  5GW7 A;  1FCE A;  4QT9 A;  1F52 A;  1WX7 A;  4NQL B;  3P5P A;  3C0R B;  3VFK A;  4F10 A;  2ZBL A;  1WJU A;  2ZPN A;  4URK A;  2JF4 A;  1H39 A;  2V8J A;  3A3V A;  3N20 C;  2M56 B;  4RH6 A;  2MH7 A;  3ANJ A;  2RI8 A;  4MU9 A;  1VD2 A;  3HVD A;  4PS7 A;  2ZNV B;  5LXH A;  4NJC A;  2WXF A;  1QAZ A;  1OGW A;  2N1W A;  2CR5 A;  2N9X A;  2ONQ A;  2BT6 A;  2QC8 A;  3SAE A;  3GS2 A;  2P0V A;  1NBF C;  4FXG B;  2BF8 B;  5E6O A;  1C3D A;  1FO4 A;  3VSM A;  4N59 A;  1V97 A;  3Q78 B;  4KDI C;  4M76 A;  2WQY B;  5HG2 A;  5EAU A;  1NL4 B;  3HVZ A;  1J0G A;  1YN3 A;  3Q69 A;  2AYO B;  1KOT A;  1EO6 A;  3APC A;  3H8H A;  3LB8 C;  5C3J B;  5TR5 A;  1HZ5 A;  4ARC A;  5AZH A;  3NVV A;  1O1T B;  2KDE B;  1D5X C;  2L83 A;  1L5P A;  4B9K A;  1RWF A;  2XN9 C;  4YDE B;  2FCQ A;  2M17 A;  1Y8R C;  3I5J C;  4ZRJ A;  2IY0 B;  1ET9 A;  1E0Z A;  5JXV A;  3U7Z A;  2RDG A;  4K1R B;  4W9D A;  2KO3 A;  1HX9 A;  2GBN A;  2DRS A;  2N9K A;  2J5C A;  1L6V A;  5BYR A;  1NYQ A;  1XCT L;  2H6G B;  3EHV A;  1VLB A;  3VXD A;  4K7S A;  1RWA A;  4A3P A;  1TS4 A;  3AEF B;  3VUX A;  5M7Y A;  3QRY A;  3SFY B;  1MG8 A;  4NNJ B;  4GGQ A;  4A3O A;  3OJ3 A;  1N62 A;  4ICU A;  4N9F 4;  5GMV A;  4BKG A;  1QOG A;  2MBQ A;  2V0G A;  2PN5 A;  4JWU C;  4ZRK A;  3QFZ A;  3OLM D;  2GI9 A;  2JF5 A;  1GB4 A;  1PUT A;  3G6J B;  1C79 A;  2K25 A;  1IBX B;  5FR6 A;  5EE0 A;  3M7B A;  1V5D A;  1WJ6 A;  2KWV B;  2EMT A;  3FAH A;  3J9C A;  4WJP A;  3E33 B;  4V1S A;  2ONG A;  3DHH C;  4ZRQ A;  3QK0 A; 
#chains in the Genus database with same CATH homology
 3B9J A;  1AN8 A;  2QJL A;  3ZJV A;  4D4B A;  2J4X A;  2LHE A;  2K9X A;  4XDD A;  3VRB B;  2JU6 X;  1JQ4 A;  2WXG A;  1TN6 B;  3K7X A;  4WVB A;  3ACT A;  1YN4 A;  4YTN B;  3P4S B;  3Q7F B;  1X81 B;  2H6H B;  2RPV A;  3H2W A;  4ZOH C;  3DSX B;  1TF4 A;  1AYX A;  3FIL B;  1AGM A;  2WII B;  4KKJ A;  3SEB A;  3V05 A;  4YDO B;  1FBW A;  3VQI A;  2QNO A;  2AFA A;  1H3C A;  4D2K A;  4KGT A;  3Q8C A;  1C4C A;  2LEK A;  1WSP A;  1FXI A;  1KTK A;  1EU4 A;  3P4Q B;  2WXQ A;  1KKT A;  1O6R A;  1UWX A;  2IGD A;  3AE4 B;  3K11 A;  2KDM A;  1XXG A;  4Q2J A;  3RPF C;  2H89 B;  2JWU A;  1FBO A;  3KSQ B;  3CU7 A;  4USA A;  4YXD B;  2KAC A;  4IKG A;  1W6K A;  3HXE B;  1P7E A;  3AE5 B;  1QOF A;  3R2T A;  3Q7A B;  1ET6 A;  4IDI A;  1H3B A;  2SQC A;  3D5S A;  3DPY B;  1TS2 A;  4LLG M;  5HI1 A;  4BOJ A;  1NEK B;  3QT3 A;  3E32 B;  3ZQ4 A;  1RM6 C;  1VRA B;  2IJ0 A;  4Z4L A;  1N63 A;  2ZW1 A;  1HZF A;  1GSZ A;  1L0V B;  4YCR A;  1TNO B;  1I4G A;  2KN4 A;  1H3A A;  3AM9 A;  1G6I A;  1JWU D;  2LMC A;  1T6B X;  1D5M C;  1UGJ A;  2NTS A;  2LFI A;  3W5V B;  4Q88 A;  2PW9 A;  3IAM 1;  1WYG A;  1TN7 B;  1EU3 A;  1FNU A;  4CJ1 A;  1UMP A;  1JRP A;  4RGT A;  5JPM B;  3P5R A;  4P6V F;  1ULV A;  2V8K A;  3H3K A;  3OED A;  1QKZ A;  2XFG A;  3SR6 A;  3WCQ A;  3EUB 2;  1D8E B;  1FMA D;  3W7S A;  2SEB D;  1S63 B;  1GAH A;  3ZJT A;  4ZRP A;  4EE2 A;  4WVC A;  4AYP A;  1SBB B;  5TSS A;  1VR9 A;  1TNB B;  2CJN A;  3IAS 1;  1QF6 A;  1RFK A;  3DSU B;  4L9P B;  4R3D A;  5HFY A;  2N9L A;  3HUI A;  1FT2 B;  2BED B;  2AX5 A;  3W7X A;  5BMI A;  3BVM A;  4OZA A;  1N4P B;  2B76 B;  4CJ0 A;  4FXC A;  2A73 B;  4WUR A;  5T8I A;  4NZL B;  3E37 B;  1M4V A;  1HEZ E;  2EKI A;  3RX7 A;  4ARI A;  2RGK A;  4YTM B;  4OZC A;  3Q8E A;  1FNV A;  1KRF A;  2ICI A;  2WYN A;  1WGK A;  1H14 A;  5E2J A;  1UWM A;  1VD5 A;  3DSW B;  1TKE A;  1TS5 A;  1GXN A;  2K3U A;  2R61 A;  2EAD A;  4WIP A;  4C7Y A;  3QWT A;  4WWM A;  5GXG B;  4A9A A;  1FO3 A;  3AE3 B;  3MHZ A;  1DOG A;  1MI0 A;  5G5G A;  2ON8 A;  3HXB B;  2QIE B;  1O79 A;  1JCK B;  3HRD D;  1K72 A;  4IOI E;  5AUK A;  4EHM B;  2VN7 A;  2BS3 B;  5FKA C;  4RGM A;  3OXU A;  5GZK A;  5CD2 A;  3C72 B;  3O13 A;  2WU5 B;  4TQ0 A;  1X9D A;  1TS3 A;  3NVZ A;  2IGG A;  2PVG C;  1MZC B;  2WU2 B;  1JS4 A;  4TQ1 A;  2BTE A;  4D94 A;  1SSN A;  1N5X A;  3PZ4 B;  2K22 A;  1JWS D;  1YN5 A;  2DWQ A;  1FAE A;  3SFX B;  3CWI A;  2JG0 A;  3W5N A;  4J3O D;  3U52 E;  1XEE A;  3CIR B;  2VZK D;  1C4P A;  2AQ3 B;  2WDR B;  3WIQ A;  4RGN A;  1TKG A;  3AE1 B;  2BB6 A;  5DGQ A;  5GY3 A;  1KSC A;  1ZOY B;  3AE8 B;  4PT5 A;  2Y5P A;  1V1O A;  3D3I A;  1JWB D;  4L23 A;  1FFU A;  3AEA B;  3ON6 A;  4TSS A;  3WKG A;  1FP3 A;  4HEA 1;  2WIN B;  3CIH A;  1SB3 C;  3ANI A;  2OKX A;  2A8Z A;  2V3N A;  1L4D B;  2BBC A;  1S64 B;  3QSP A;  1ZDV A;  1DOI A;  4KTR A;  1TNY B;  1HA5 A;  3SDQ A;  2PTL A;  1KFY B;  1QIL A;  3E9S A;  1L1Y A;  2ACZ B;  3EGR A;  1WXQ A;  3Q8F A;  4JWS C;  4GTV B;  5FK9 C;  3TEW A;  2NVP A;  1QOB A;  4N58 A;  5FR3 A;  1T3Q A;  4B0E A;  1FPP B;  1KRH A;  4HKQ A;  2DLB A;  1L0X B;  1YNT E;  2L32 A;  3Q79 B;  1QQF A;  1N5W A;  1SJH D;  2FE8 A;  4WQM A;  2W82 A;  4YWG G;  1NEN B;  3T33 A;  1OQR A;  3U2S C;  5FO9 B;  1AW7 A;  2SAK A;  1JCS B;  1C77 A;  3W7T A;  3IXS A;  4KGS A;  4C7Z A;  4DOD A;  3ZJU A;  2J53 A;  1LF6 A;  3P1M A;  3W7W A;  3DWM A;  1GXO A;  2GB1 A;  2FUZ A;  1GHQ A;  2ZZR A;  1C76 A;  1DGJ A;  3H7L A;  2TSS A;  1ENF A;  5EE1 A;  1A70 A;  1WWT A;  5AUI A;  1I4Q A;  1MVK A;  3E6U A;  2YIK A;  4GTM B;  1V7V A;  3NUH B;  1IA7 A;  1KRE A;  3S4B A;  1NVI D;  4Z4J A;  2HDE A;  4MT5 A;  1GA2 A;  1FT1 B;  1H36 A;  2F6D A;  2IEJ B;  1WU4 A;  2XQW A;  1SE3 A;  1TY2 A;  3BYY B;  4OVZ A;  4P16 A;  4XDC A;  1IA6 A;  5M7I A;  2BW2 A;  2DBY A;  5MEH A;  3V3X A;  4KX6 B;  4D4D A;  1E7P B;  3ACS A;  3SDV A;  3TF4 A;  1XLP A;  2KWD A;  2L52 A;  3VW5 A;  1K53 A;  1Y56 A;  2PLP A;  4LK0 M;  3M73 A;  3QFY A;  2BS4 B;  1IGD A;  2EAB A;  2PVO D;  1JRO A;  4LIX A;  2CU3 A;  4DQO C;  4EL8 A;  3KWV A;  2RDH A;  2WXR A;  3C8Y A;  1KS8 A;  4GTS B;  1O6H A;  1GLM A;  4REZ A;  2JSV X;  4NAM A;  3DRA B;  2WXI A;  3GP7 A;  2IPK D;  1TYG B;  3QDE A;  2DRO A;  2VN4 A;  1SE4 A;  2H88 B;  2MJ3 A;  4OW0 A;  1JAL A;  1KLU D;  1F9D A;  2AHF A;  3E34 B;  1TKY A;  1KZP B;  2JZP A;  1YQ4 B;  1DCE B;  1QBQ B;  5EE3 A;  5DGR A;  2DRR A;  4CE7 A;  2YEP B;  1SA4 B;  1Q10 A;  2WLB A;  1RWS A;  3E56 A;  2LHD A;  1KFG A;  2LUM A;  3EUV B;  4OHJ A;  5I4D A;  4L0G A;  5FO8 B;  4WH4 A;  2PMV A;  1JCQ B;  1J7A A;  5LNK 1;  3DSS B;  3NRZ A;  4ZG8 A;  4TXT A;  4FUS A;  1OQQ A;  1PGA A;  1CK1 A;  1VJK A;  4JX1 C;  2EEL A;  3ZYY X;  1L6U A;  4XE0 A;  1O5M B;  3D5R A;  3EU8 A;  4WVA A;  1KSD A;  1N4S B;  3W5M A;  4C80 A;  4XWW A;  1XW2 A;  1NC5 A;  3DST B;  1NI1 B;  3NVY A;  1WZZ A;  3RJ3 A;  1K51 A;  5BMH A;  3BK2 A;  4YSY B;  4YTP B;  1C4A A;  5HHD G;  2OED A;  3AEG B;  2WS3 B;  1TN8 B;  2IGH A;  2X38 A;  4GDL B;  2EAC A;  1LD8 B;  1FEH A;  4KTP A;  1NYR A;  3EA6 A;  3AEC B;  4N6E B;  3AE6 B;  3SDU A;  3SQC A;  2FV1 A;  4JJJ A;  3TEX A;  3WKI A;  4KKI A;  1HXY D;  3NS1 A;  2WXO A;  3L4P A;  2WXJ A;  2XWB B;  4A6Q A;  2AHG A;  1FD6 A;  3SDT A;  1FMI A;  2WDQ B;  1RYJ A;  1O6Q A;  1WRI A;  1OFF A;  1FIQ A;  2PKO A;  1BUI C;  2FBA A;  1BXT A;  2RI9 A;  3QG0 A;  1L2A A;  4GTP B;  1JML A;  1N61 A;  1AYF A;  2MEK A;  2WXL A;  5C2T B;  3W1S A;  1QT9 A;  3VR8 B;  4YT0 B;  2H6I B;  1EWY C;  1LF9 A;  1N95 B;  3LXF A;  2CQT A;  3UI3 A;  2I2Y A;  1STE A;  1KF6 B;  3PYB A;  2QMT A;  2B4F A;  1B1Z A;  3RX8 A;  1N9A B;  2G1E A;  4TMA B;  1JWM D;  3PYA A;  1SXT A;  1V8C A;  1I4P A;  3ETR A;  1V7X A;  2D5J A;  3M7E A;  1FRR A;  3GZK A;  1XWQ A;  1GPX A;  3PZ3 B;  1RQ5 A;  2CJO A;  5EE9 A;  5JPN B;  3NVW A;  1WU5 A;  1ZUD 2;  2AQ1 B;  5H92 C;  1F2R C;  4V1R A;  3AH7 A;  2FUG 1;  3S4C A;  1PGB A;  2K0P A;  4FXK B;  4HRO A;  4L2Y A;  1E6E B;  5AGD A;  3QT9 A;  2KMM A;  4RF1 A;  2JX5 A;  1EWC A;  4J5T A;  2V3P A;  3M77 A;  2GH4 A;  4GTT B;  2HTM E;  3TUO A;  1J7C A;  3PZ7 A;  4DXG A;  2B39 A;  3VR9 B;  3PZ2 B;  1CEM A;  1XCQ L;  3LYY A;  1FFV A;  3S9V A;  1DOX A;  4YSX B;  1SA5 B;  3KLS A;  1XWT A;  1SEB D;  2ZW0 A;  4A90 A;  2W3R A;  3Q8B A;  3S4D A;  2FBW B;  1C9F A;  4ZH5 A;  3M71 A;  1SE2 A;  1TY0 A;  4ZH1 A;  1SIJ A;  5D7G A;  1IBX A;  5D3D A;  1K50 A;  1G9J A;  2WP9 B;  4DXF A;  3RSY A;  4JE3 B;  1GOZ A;  1KZO B;  3KSL B;  5CA3 A;  1VZ8 A;  3DWG C;  1ROE A;  2H6F B;  3GT5 A;  2I38 A;  3RFZ B;  1CQV A;  1BML C;  2V8I A;  5CZL A;  3EU5 B;  2Z8L A;  1H35 A;  1XLO A;  2JXT A;  3T3O A;  4V1S A;  4AQ7 A;  2DRQ A;  1F77 A;  3VRA B;  1E9M A;  3BZD B;  3AE7 B;  4GLS C;  1UT9 A;  2PIA A;  4MBG B;  2RMM A;  1I4H A;  1UNS A;  3AB5 A;  2WXK A;  3REN A;  4AS1 A;  3B2F A;  2LGI A;  1B9R A;  3W5U B;  3B2G A;  3EZ8 A;  3SDR A;  1F0Z A;  2Q5W D;  3NZ3 A;  3QXQ A;  3ZGZ A;  1FCL A;  3QXF A;  1EM7 A;  3FIL A;  2BS2 B;  1G87 A;  1R7S A;  2INN E;  1O1S B;  2JYT A;  2WXM A;  4HKZ E;  2XNA C;  1N60 A;  1V5C A;  2GOX A;  4Q2B A;  2JYE A;  3Q73 B;  2MJD A;  1UUP A;  1L4Z B;  2G0D A;  3T3N A;  2D8L A;  2IDY A;  2DYM A;  1DYQ A;  3P4R B;  3OWE B;  1XLQ A;  4RNA A;  1YJJ A;  1WU6 A;  2QIL A;  1N94 B;  1R76 A;  4L6X A;  1W6J A;  1G9G A;  4LNB B;  1D5Z C;  3EQA A;  1IGC A;  1T5X D;  2N7J A;  3FC4 A;  1GXM A;  1HZ6 A;  2G9H D;  2W54 A;  1DOY A;  3AE9 B;  3ANK A;  2ZIR B;  1VDV A;  3W2D A;  3Q8A A;  3TEY A;  1HCU A;  4WAF A;  3X17 A;  4MM3 B;  1J7B A;  4OZB A;  1K52 A;  4A55 A;  5MPO A;  4C1S A;  3WKH A;  2QEJ C;  3R2I A;  3AEE B;  4RFB A;  1H12 A;  1VZ7 A;  1PGX A;  1SF0 A;  4MAC A;  1TNU B;  2Y5C A;  4UDU C;  4LTU A;  1QQR A;  1ESF A;  3P2C A;  1F9O A;  2CQS A;  3RX5 A;  1QSJ A;  2D5G A;  3MP9 A;  3N9Y C;  3P42 A;  1I7H A;  3MC0 B;  1CLC A;  5H8Y E;  1V1P A;  1L0Y B;  4GDK B;  5GW7 A;  4ITK A;  2WXN A;  1FCE A;  4QT9 A;  3WUX A;  1HQR D;  3AV8 A;  2L1A A;  3P5P A;  3KWL A;  2F0Y B;  2V4I B;  1O1R B;  2LJI A;  1CZP A;  2W55 A;  1NXC A;  2ZBL A;  1D8D B;  2WXP A;  1N4Q B;  2Y3A A;  4ZYS A;  2G02 A;  1JCR B;  2JF4 A;  1H39 A;  2V8J A;  2DYO A;  3A3V A;  3GB1 A;  1KLG D;  2M56 B;  4RH6 A;  2R2L B;  2MH7 A;  2K5P A;  3AE2 B;  4LNV A;  3ANJ A;  2RI8 A;  1GAI A;  4MU9 A;  4RF0 A;  3HVD A;  1NI3 A;  1N4R B;  2M0A A;  1MPE A;  5BYS A;  3Q75 B;  1ZDX A;  1TJE A;  2JQR B;  4NJC A;  1H37 A;  1PDX A;  2WXF A;  2ZIS B;  2BB5 A;  2ONQ A;  3SFD B;  2BT6 A;  3E73 A;  3SAE A;  2XWJ B;  1FCC C;  3GS2 A;  4C56 C;  1I4X A;  2P0V A;  1V1P B;  4FXG B;  4US8 A;  1C3D A;  1FO4 A;  2MJE A;  4N59 A;  3HXF B;  3WC3 A;  2GZ6 A;  3M7C A;  3KLS X;  3U4E G;  1V97 A;  1ZPS A;  2EAE A;  3I57 A;  4A8X C;  1SJE D;  3WIR A;  2WNM A;  3Q78 B;  4M0W A;  4M76 A;  3AEB B;  4HJG E;  2WQY B;  5E6J A;  5HG2 A;  1NL4 B;  1DL2 A;  3HVZ A;  1PFD A;  3TEZ A;  4LNG B;  1YN3 A;  3Q69 A;  1MHX A;  1XLN A;  4AYQ A;  3M74 A;  1C78 A;  3H8H A;  3BWU D;  3LB8 C;  5C3J B;  4XUV A;  2NMQ A;  1HZ5 A;  4ONT A;  1TZO A;  4GTR B;  4ARC A;  3NVV A;  1SQC A;  1GAQ B;  1O1T B;  1D5X C;  2I07 B;  1D6E C;  2Z07 A;  1L5P A;  1I4R A;  2AQ2 B;  2L83 A;  4NAW B;  2E6X A;  5KKB A;  1JWA D;  1KH0 A;  4B0M A;  1F2R I;  2GRI A;  2XN9 C;  1FXA A;  3MFG A;  4KGR A;  1GB1 A;  1XO3 A;  4GTQ B;  3IT6 B;  2N0S B;  4JPS A;  4MH8 A;  3AMZ A;  4YDE B;  3DSV B;  3M76 A;  3GLY A;  3PO0 A;  4O1N A;  2FV0 A;  1JW9 D;  4CQN A;  3BII D;  1ZXH A;  2QSD A;  3IT4 B;  4RCO A;  1ET9 A;  2JJB A;  4BOK A;  1E0Z A;  4WU0 A;  3M7L A;  1YMH E;  2KQ4 X;  3TSS A;  5JXV A;  2NTT A;  1TNZ B;  3M75 A;  3U7Z A;  2RDG A;  1V7W A;  2WY8 A;  3P4P B;  4HRS A;  1ZXI A;  4H2A A;  3BVZ A;  3BVG A;  3SFE B;  2DRS A;  3HXC B;  3QPF A;  2N9K A;  1L6V A;  2W3S A;  1P7F A;  1VZ6 A;  2M19 A;  3PZ8 A;  3ABV B;  5BYR A;  3HXD B;  1NYQ A;  3MJ5 A;  1FO2 A;  1XCT L;  1XF5 L;  2H6G B;  1IUE A;  3WIW A;  3BYT B;  3AN1 A;  4RGO S;  1VLB A;  3VXD A;  1ZE3 D;  4GTO B;  3PZ1 B;  2E3T A;  1TS4 A;  3AEF B;  1AWD A;  5M7Y A;  3QRY A;  3SFY B;  2NOJ A;  2OHF A;  3S4A A;  1FM0 D;  1KWF A;  3BK1 A;  5FO7 B;  4GL3 A;  4AYO A;  3W9C B;  1FRD A;  4XWT A;  2WDV B;  1LTX B;  3M78 A;  1QOA A;  1N62 A;  1YJI A;  1E10 A;  4AYR A;  4TF4 A;  1MHH E;  1ZP0 B;  3KQ4 A;  2BYT A;  3RRS A;  1H13 A;  1QOG A;  4US9 A;  2V0G A;  2PN5 A;  4JWU C;  1LD7 B;  4ZHO A;  3M72 A;  1IS9 A;  3QFZ A;  2GI9 A;  2KAJ A;  1ACC A;  3AFJ A;  3I9V 1;  1GB4 A;  1PUT A;  2WXH A;  3AED B;  3G6J B;  1C79 A;  1YQ3 B;  2J42 A;  3P63 A;  2INP E;  2J52 A;  5D3I B;  5BMG A;  1D4B A;  4L1B A;  4ZHP A;  3PMM A;  5G5H A;  5BYQ A;  1IBX B;  4D4A A;  3E30 B;  5EE0 A;  3R8B A;  3M7B A;  1FNW A;  1V5D A;  3WKF A;  3URY A;  2WY7 A;  1LO5 D;  2YEP F;  1CJE A;  4YSZ B;  1H54 A;  2VZK B;  3FAH A;  4DOE A;  3J9C A;  1PYW D;  1UG9 A;  3E33 B;  5FOB B;  4ZRQ A;  1QLB B;  4D4C A;  3W7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...