2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
3E37B 3Q78B 4MU9A 3SQCA 4C1SA 2V3NA 3DSWB 1O6RA 2BEDB 1N4SB 2BB5A 2WIIB 2I07B 1N95B 4GTOB 4ZRQA 3DSTB 1DCEB 1R76A 2V8JA 1N4PB 1SA4B 1TN8B 3EU5B 1GHQA 4YDOB 2V8IA 3RJ3A 3KLSA 4GTSB 4MBGB 4EHMB 2GOXA 1JCRB 1X81B 3Q7AB 2IEJB 2SQCA 1O1RB 4ONTA 3D5RA 4V1SA 2XWJB 3Q73B 4GTTB 1D8EB 3Q7FB 3DSSB 1TNZB 1JCSB 4FXKB 4YDEB 3E33B 4LNVA 1N4RB 1W6KA 1H3AA 4ZH1A 1QBQB 4D4DA 1GXOA 3DRAB 2WINB 4GTVB 1NL4B 2PMVA 3HXFB 4LNGB 2H6HB 1O5MB 3E34B 4GTQB 1O79A 5JPMB 3HXCB 1HZFA 1MZCB 2ZISB 2A73B 1O1TB 3K7XA 1O1SB 1S63B 2BBCA 1O6HA 1H39A 1LD8B 1TNBB 3KSQB 4M76A 4KKIA 3U7ZA 1KZPB 1KZOB 3PZ3B 4D4BA 3E32B 3DSVB 2V3PA 4KKJA 2BB6A 2H6GB 1NI1B 1FT1B 2F0YB 1H35A 4L9PB 1SQCA 3Q79B 4ZRPA 1TNYB 1FT2B 2B39A 1UMPA 3SFXB 1TNUB 3SFYB 1FPPB 2XQWA 5FO7B 1N94B 3Q75B 1SA5B 3EUVB 3HXBB 1H3BA 5AGDA 3C72B 3OEDA 2H6IB 1GSZA 1W6JA 3OXUA 1GXNA 1QQFA 3PZ1B 4D94A 3HXEB 1QSJA 5FOBB 1JCQB 3G6JB 2G0DA 2NOJA 2WY7A 5FO9B 3KQ4A 4D4AA 4D4CA 1TNOB 1C3DA 4LNBB 1D8DB 3CU7A 3HXDB 1LTXB 3DPYB 4FXGB 4BOJA 1H37A 5FO8B 5JPNB 1LD7B 2R2LB 2V8KA 1N9AB 2XWBB 1TN7B 3PZ2B 2ZIRB 3KSLB 1S64B 3PZ4B 4BOKA 1H36A 1H3CA 2G02A 2H6FB 3DSUB 3DSXB 3D5SA 1O6QA 2WY8A 1TN6B 3E30B 2PN5A 4GTMB 4GTPB 1GXMA 1N4QB 4GTRB 4V1RA
chains in the Genus database with same CATH superfamily
3W9CB 3QQ8B 4N59A 3DSWB 1IA7A 2M17A 2HD5B 1X9DA 1UWMA 1UGMA 4NZLB 2WXIA 3GZKA 3L08A 1FCEA 5BMHA 2V8JA 3NS8A 2LJ5A 3EU5B 3AE7B 1CZPA 3PRZA 4ZRJA 2ZZPB 2WDVB 4DDID 1GB1A 2NTTA 1JW9D 5HHDG 2JVCA 4CHKA 5AEKB 2BKRB 4N58A 2G9HD 1QQRA 4P1BC 1UBIA 1XWQA 4FLHA 2XK5A 4ANVA 1K53A 2B4FA 4DXGA 5CHFA 4FXKB 2J0KA 2CU1A 1HEZE 1RYJA 2D10A 3M78A 3R7QA 3NVWA 2V1YA 4F10A 4ICVA 4WH4A 5DGQA 1N7QA 3E34B 4GTQB 5C3JB 3HXCB 2KXJA 2WDTB 2D5GA 3TF4A 4K81A 1HTOA 4ZG8A 1XD3B 2GOWA 4XUVA 2IY1B 4C80A 4PS8A 5DPWA 2K1FA 2N9LA 4RM9A 2IYDB 4NJ6A 1IUEA 1FPYA 2W82A 3MC0B 4WAAA 1LXKA 4QAYA 3LJ3A 1CK1A 1SBBB 2KAJA 2ZZRA 3PVLA 5IK0A 4P1CC 2E3TA 4OZCA 2BW2A 2B39A 1FXTB 3A33B 4ANWA 4TQ1A 2MBHA 2LZ6A 4GU2A 3U8ZA 4WWOA 2NPTA 3HXBB 1YOVB 3Q3JA 1OEYJ 4P16A 4YL8A 2BF8B 2XN9C 3M3JA 2DENB 2WU2B 3ML8A 3CSTA 1UBQA 2BKFA 2NBWB 2V9HA 3PZ8A 3QFYA 2WXJA 1V5OA 4LJPB 3TSSA 2VH2A 1OJNA 1RWAA 4ZDVA 2REXA 1N62A 2LD9A 2FIDA 2KWUB 3QIJA 3QWZB 1IPGA 2QIEB 5E6NA 4S0RA 3DSUB 3KH0A 2WY8A 1TN6B 2D07B 3GB1A 3CSFA 4GTMB 1YN5A 2FCQA 1LXMA 4MU9A 2MRPA 4WJQA 2WXKA 3AI5A 3RCZA 3RNCC 3QJZA 1GLMA 3AFLA 1N1BA 1J7BA 5DGRA 3SHQA 1N7NA 1DCEB 3DVGX 1WWTA 4OVUA 4EZJA 3TUOA 2FV0A 2V8IA 5D3IB 2NMQA 2J42A 2ONQA 4EHMB 2PPHA 2KDIA 5EE3A 2GOXA 2TSSA 3P1MA 3PT2B 2IEJB 1J0MA 1V81A 2A8ZA 2W54A 1VCBA 4IUMB 2KQ7A 4RGTA 1GPXA 1NENB 2C5LC 4PYUA 3MJWA 5IKHA 4JWSC 1WRDB 2L32A 4HKZE 2L52A 5LNK1 4N6EB 4B9KA 2WX1A 1SE4A 2L0TA 4OZBA 2JYTA 1N5WA 4W9GA 4NAMA 3WANA 1OQYA 3AE5B 3PMMA 1UZXB 3UQAA 2AQ1B 1TS5A 1WFYA 1CQVA 1WGYA 5J18A 2OJRA 5M7IA 3TEWA 1T0RC 4Q2JA 3U7ZA 2E22A 1RWGA 3ZNHB 3MFGA 2NBVB 1XW2A 2F0YB 3NVYA 2V0GA 5IM1A 3JSVA 1JWBD 2MP2A 4DXFA 2BYEA 2L05A 2ZW1A 4GB9A 2ASQA 2IJ0A 2HTHA 1KFGA 3KWLA 1UUPA 4L0GA 1X1MA 2OEDA 3AXCA 3N1XC 2LVOA 1WR6E 5AUKA 2SAKA 4AS1A 3AE1B 1ULVA 2D8LA 3M77A 2L00B 2AQ2B 1JRUA 2JX5A 4EE2A 4F7ZA 2XWBB 2XBBC 3VSMA 4LNFA 2IO2B 2KKCA 1OFFA 1TS2A 1TS3A 3MHSD 4OVZA 1AN8A 4LK0M 4GL3A 3V3XA 2Q5WD 1AWDA 2ZNVC 3APCA 1SB3C 3FILA 4KVGB 2PVOD 1GAQB 1ENFA 2AX5A 2GRIA 3X17A 3ABVB 1N4SB 3LXFA 4TSSA 2O2VA 1N6ZA 1TF4A 3S4BA 1VLBA 4KGSA 5DPRA 1MHXA 3E73A 3AE6B 1MI0A 1AGMA 1X81B 2SQCA 2ACZB 3D5RA 3L0WB 1N7PA 1J19A 4EZKA 4JGHB 5L83A 4D2KA 1TS4A 3QARA 3DVNV 3GOEA 2FBWB 3NHEB 5IL8A 1QF6A 2WXFA 1FBWA 4FJZA 1L0VB 1GOZA 2QCZA 2O6VA 5BYQA 2LXAA 4BKGA 1SE3A 3DBSA 4MGYE 4OW0A 1KH0A 1R4NI 3CMMB 3D3IA 3ZRFA 4B6WA 4PS7A 4M76A 5DPTA 1TGZB 4D4BA 1L6UA 2K8CA 4ZRIA 1LQBA 1WM2A 3W5UB 1EU3A 2DBYA 3U7DA 1W3YA 3HRDD 5JMDA 5ILJA 3A9JB 3BIID 1N94B 3Q75B 3V62A 1V97A 3ZNGC 5AGDA 1N7OA 1WU5A 1M4VA 1L4ZB 1MJDA 1I4PA 4D94A 4KZCA 2M8SA 4CE7A 2INNE 2WXNA 4FXCA 2Q1FA 1VDVA 1WIAA 2RR9A 2B76B 3DBHI 1XT9B 4LJOB 4G0NB 3N30A 2N9XA 2PE6B 2GBMA 2KDFB 3SDRA 3VAWA 3L13A 3Q8AA 3M01A 2K6QA 4ITKA 1WGKA 1XF5L 5GZKA 2K39A 1LOHA 5GY3A 3DSXB 1KLUD 3S4CA 4RFBA 1E6EB 3R3MA 1IYFA 3MHZA 3SDUA 3B2FA 3GZNI 2GBJA 3URYA 3S4AA 1I4HA 1E90A 2WU5B 4MJSA 4IWOA 1MPEA 4EUTA 1WU6A 2I07B 3L17A 4E3CA 1V1PB 5IP4D 2VZKB 4I6PA 1PDXA 1SSNA 1QLBB 1F9GA 4DXAB 2JRIB 5IA7A 2IO0B 1G87A 1X1JA 5MPOA 4JPSA 3U2SC 1EU4A 1FM0D 2CU3A 3ACSA 1E5WA 4ARCA 5ILHA 3EZ8A 2X03A 3KUDB 1QBQB 4TXTA 1DOXA 4TKNA 4MJSB 1HCUA 3HXFB 2H6HB 1R4NB 4BKTA 1XLQA 3P2BA 1FNVA 2N1VA 3QDEA 2LGSA 5FKAC 1CB8A 4MDKE 3T33A 1WYWB 4XX5A 5M7YA 3QWTA 1NI2A 2JXXA 2LEKA 4WWPA 1FIQA 1ZXIA 2JXTA 3VDZA 2VH1A 3Q3MC 1YN4A 1HM2A 1ZE3D 4FHKA 4XDDA 4EOYA 3M71A 1DOYA 4C7ZA 3SFYB 2MQJA 1DOIA 1FO3A 1E8YA 4BBNF 1N60A 2VN4A 1KKTA 2MLBA 1V2YA 3OAWA 4L1BA 3JVZX 3CIRB 2XFGA 1N24A 5FO9B 2K25A 1F2RI 2ONGA 1C3DA 1WM3A 5TR5A 3BYTB 4DK5A 1FCLA 1RFKA 1S1QB 2G1EA 2D3GA 4KTRA 1QAZA 1OQQA 1TKYA 2N7EA 4WWMA 2RGFA 4E71A 4PS3A 4USAA 2EADA 2KVZA 2R2OA 2LVPA 3R2TA 3V6CB 1V49A 3E30B 1G9GA 1Q10A 2QMTA 1E7UA 4YT0B 4C00A 1JWSD 2NS5A 2CJOA 3W7WA 2IGGA 1V86A 1UNSA 2J0JA 4FJYA 1UWXA 3IAM1 2NBUA 3M95A 1ZP0B 1T5XD 2CHWA 1HZ5A 1R76A 4DHZE 4L2YA 4DI5A 1ZKHA 3L16A 2LXCA 1IA6A 1HV6A 1O1RB 2RSUA 3Q7FB 3CF6E 3PO0A 5JMFA 1FRDA 4IWPA 4JX1C 1I4RA 2KFJA 3M73A 1TKGA 1CEMA 1GXOA 4REZA 2WYNA 3PTFC 1D6EC 3EA6A 5ILDA 1STEA 3KUZA 3Q8BA 1E9MA 2MJ3A 2NPTB 1YX6B 1PGBA 3EU8A 1HZFA 4RF0A 3M63B 1I7HA 3H6NA 1K72A 2K6DB 3W7XA 3PYBA 3I3TB 2RMMA 3ZIMA 3VRAB 3ZXVA 1D5XC 1JWUD 1JMLA 2DROA 4Z4LA 5JZEB 4FN2A 2RDBC 2GBNA 3R66C 2DZJA 3VW5A 2Z59B 2M4NA 2JPHA 3RI7C 1OEYA 5LLIA 2GB1A 2GLSA 1AYFA 3C72B 1WJUA 5C1ZA 3N1YC 3JSVB 1QQFA 3WIRA 3HIZA 3OG5A 3K11A 2LFIA 1R4MI 5KKBA 1TNOB 1EF1A 1SE9A 1A5RA 3HXDB 4KIKA 3H7PB 3M7EA 4GAXA 3U52E 1LD7B 1DOGA 4NJCA 2BRWA 4IM2A 1D4BA 1GNUA 2V3SA 2KX3A 4B0MA 4DBGA 4JE3B 2KACA 3E6UA 2WXMA 4KGTA 1Q5WB 3PZ4B 4W9JA 4B0EA 3ECIA 1LF6A 3ENEA 4AJYB 2UU7A 4WIPA 3PPAA 3P4SB 1U4AA 1N5XA 3QT3A 3EGRA 1F9OA 1OJPA 1LO5D 4ANXA 4WVAA 3NS1A 3H9DA 4AYQA 3EHVA 1V9JA 2V3NA 3I57A 5BMIA 4GLSC 1PFDA 2BYVE 4JIOU 4E74A 2YEPF 3W1SC 3N3KB 2MJEA 1FBOA 4GMVA 3M7BA 3TL5A 1BMLC 1IGDA 2F6DA 3AU4A 2KC2A 3RENA 5CA3A 4M0WB 1NEKB 4J5TA 1R7SA 3UINB 3ACTA 2H89B 5DHKA 1QKZA 3Q7AB 1IS9A 3VRBB 5MEHA 1EGUA 3H3KA 3DSSB 1QOFA 5J2RA 4C56C 2K5PA 1N4RB 5IAAC 4CJ1A 3GS2A 2PMVA 4K7UA 3W5NA 1NBFC 1HXGA 1O5MB 5T8IA 3BVZA 3QCAA 1O1TB 4JJJA 3RD2A 1VD5A 2MJDA 3QC8B 2N9PC 2KN4A 3P5RA 1GAIA 5BYRA 3R8BA 3V61A 3OJ3A 3ZXRA 3L54A 3DWMA 3P5PA 4KKIA 2C7MB 3BINA 3AEFB 2BS4B 3A3VA 3RFZB 5EDSA 4I6LB 1E7VA 4KKJA 1E8XA 1P7FA 3V60A 4FUSA 2KZRA 2B3AA 3QRYA 2FNJB 2MBEA 4URKA 3P4PB 2JSVX 5J17A 1G9JA 3FAHA 4UDUC 1YQBA 3FILB 1P0RA 4OHJA 1GG3A 4NEIA 1RM6C 2AL3A 1YJJA 1D8DB 1V1PA 3QFZA 1IBXB 1QZEA 3SFDB 1WZ0A 3QAQA 4EFOA 4BOJA 1H37A 5FO8B 1FFVA 3EFUA 1EF5A 3PLUA 1N9AB 3LZ9A 2KC1A 4OVVA 2YEPB 1TN7B 5DPSA 3N0FA 4RGMA 1T0SC 3VH4B 2BQQA 2QNOA 1YN3A 4M8MA 3C0RB 4WU0A 3UIPB 2M1MA 2J5CA 1GXMA 1WX8A 3EECA 3NY5A 2NR2A 2OHFA 3Q78B 4OZWA 4OK4A 4NY0A 3VR8B 2JT4B 2FBAA 1NYRA 1RFAA 2VRRB 2IO1B 3PRPB 2KJHB 2YIKA 2WXLA 2IZVB 3HM6X 2INDC 2EABA 1K51A 2WYQA 4IM3A 4FJVB 3RJ3A 2LRWA 3VUWA 2DRRA 2NTSA 4HLEA 2L3ZA 4HCPB 3NFVA 1JCRB 3ANKA 5HKHA 3Q73B 3NOBA 1D8EB 3W5VB 2GBRA 1F1SA 4BKSA 2KX0A 4DHJB 3IT4B 2X38A 3DRAB 3ZJTA 3W1SA 4HROA 2AEHA 3ZNID 2XNAC 2XEWA 3AEGB 1MZCB 3H7PA 3ZUNA 2WCOA 3T3NA 2E6XA 2KDBA 2BBCA 1KWFA 2O6VB 2I1JA 2LVQA 2WGSA 3B08A 3UI3A 1L0YB 2QILA 3E32B 4CJ0A 1FRRA 3NZ3A 4P7IA 3G4DA 4L9PB 1NYQA 1SQCA 3Q79B 4AQ7A 2C7HA 3RNAC 2XQWA 1HTQA 2A5UA 4GDKB 3SEBA 2D3AA 1L5PA 1FO4A 3MTNB 1GSZA 2PW9A 3K9PB 4GIVA 4HKQA 3RYTA 3E80A 1KFYB 2LGYA 2OJWA 2QDFA 2FCMA 2KK8A 2JU6X 3WIQA 2BWES 3PREA 2D3BA 2M0XA 2FUQA 3ZLZA 1XLOA 3RNEC 4AUQC 4JQWC 4BKSD 3A1QB 5EE0A 1L0XB 3N9YC 4LCDE 1J0NA 1WXSA 4RGOS 4X57B 3VQIA 1NI3A 3N20C 3Q8CA 1LM8B 4A55A 4AJWA 2LHEA 4P6VF 3E37B 3HVZA 4HPPA 3HVDA 2MEKA 1RWFA 3DBRB 2IY0B 2JG0A 1HXAA 4FNVA 2DRQA 1WF9A 2L76A 1SA4B 1UELA 1JWMD 2QJLA 4GTSB 3TMPB 4HDQA 1T3QA 3ANJA 3AV8A 1JQ4A 3AE3B 1V1OA 2INPE 4MM3B 4BFRA 4ZHOA 1UH6A 2A4ZA 2WINB 4MH0E 3N32A 3EC8A 1L4DB 1OTRB 1KJTA 1PYWD 3HM3A 3FKYA 3C19A 4FA6A 3BVGA 1SEBD 3KYDD 4IOIE 1E0ZA 2I38A 1YQ3B 1RLFA 5CHWA 2W9NA 3Q3OC 4EKUA 2LMCA 4ZYSA 4OZAA 4TUUA 4C4VB 1GJZA 3A9KB 1H13A 2ZVNA 1QOBA 2L0FA 4MM3A 1NI1B 1L2AA 2KMCA 1FPPB 1P98A 1SF0A 3A9KA 4JLCA 3A0OA 1WGRA 2C60A 2H6IB 1PQSA 1W6JA 5FOBB 4Q2BA 2NOJA 3H7SA 3APDA 4AP4C 3SDQA 1TYGB 3WIMA 1TJEA 2KWDA 2PIAA 1P7EA 2JZPA 4A6QA 4M01A 3ZJUA 2M56B 3CIHA 1AARA 4G3XB 2M19A 2N0SB 3MC8A 4W9EA 4HK2A 1C82A 1H3CA 1T0QC 1S3SG 1ZGUB 3I63C 2GMIC 2DX5B 3MC9A 4O1NA 2MWSB 2IGDA 1C3TA 4WJOA 1ESFA 2BB5A 4NAWB 3ZDTA 3NZSA 4FJQA 3RX7A 1Y8RC 2CQTA 2C7NB 3DSTB 3AEAB 4XDCA 1WYGA 5EAUA 1IP9A 4ANUA 1WZ3A 3E56A 2L8JA 1PUTA 3ZO5B 2ZEQA 1WJ4A 4HDOA 3AECB 1PGAA 3QPFA 2IPKD 1JCSB 3VUYA 3QX1A 2EAEA 3B2GA 1KTKA 2KTFA 1H54A 2MP2B 3RN9C 1B1ZA 4GTVB 3VFKA 3TEXA 1KM7A 2J52A 1C76A 4YCRA 5JPMB 3RX5A 2LUMA 1WXQA 2N9EB 3K7XA 3H1UA 2UYZB 2KDMA 2DAJA 3UQBA 3DBLI 4LTUA 1XEEA 2IDYA 1WH3A 1TKEA 2DYOA 2L83A 2KMMA 4K1RB 4LLGM 4MH8A 1FNWA 3ZYYX 4YTPB 2V3PA 4W9LA 2EMTA 4HJGE 4WAFA 4ZRPA 3JW0X 4XC2A 1HN0A 2ZJDA 3EUVB 2KN5A 3DVNU 4CYEA 3DWGC 1GC6A 2JWZA 3ONSA 2WLBA 2AHGA 1FAEA 2LASA 3WKIA 2G45B 4HRSA 2DYMA 3QT9A 2MW5A 3N1ZC 3M00A 1UF0A 2WQYB 1XO3A 4OJZA 2JWUA 5BMGA 3BWUD 3M7CA 2ZPNA 1VZ6A 4BOKA 1H36A 1N1ZA 4OZVA 1PGXA 1E8ZA 3D5SA 2MSED 1XLNA 3NRZA 4XYCA 1E7PB 2LRUA 4WVCA 3LYYA 1N63A 5H8YE 4DWFA 4GTPB 4BOZB 1ZOYB 4BZAA 3H8HA 3TCAA 2D5JA 3SQCA 3GP7A 3RUIB 1ZPSA 4HPLB 2BPSA 3PHWB 2DRSA 4YTNB 4IC7B 2INCC 2N1WA 4S17A 2D11A 1YMHE 3T3OA 3PLVA 1EM7A 5HFYA 2R61A 1DGJA 3D32A 4PK1A 4KX6B 1HMUA 4FHJA 3E33B 4KSLC 2LUEA 5E6JA 3ZW3A 2KYWA 1A70A 1ZXHA 4LNGB 2RI8A 3KVFB 3M7LA 4KDLB 4Q88A 2A73B 3RMKC 1WSPA 4LIXA 3KYCD 3B0AA 2OKXA 5KHOA 3A4RA 3P4QB 2YLMA 2K9XA 2ZVOA 1ZDVA 3RULA 3B9JA 4YXDB 1P3QU 1KLGD 3PZ7A 1TNYB 3S4DA 1UMPA 3SFXB 5E6OA 2ZCCA 1H3BA 1I8QA 3K9OB 2PTLA 1GXNA 3WALA 1LF9A 4BBNC 2G0DA 2WY7A 4ZYNA 1TTNA 2BTEA 2L1AA 3L10B 2AHFA 5L95C 2LGXA 2VZKD 2RPVA 3HUIA 1LFDA 4II3B 4W9KA 2KFKB 1HE8A 4WJNA 5JHBA 1SJHD 2ONHA 1HXYD 2GZ6A 2DNFA 2WS3B 1QOAA 4RNQA 3IG3A 4AWJA 1S64B 1D3ZA 4JWUC 2NVUI 5ILZA 2H6FB 4A90A 1O6QA 2LGDA 4NPNA 1HZ6A 4DHZB 3QK0A 1MG8A 2IGHA 3S2AA 3W2DA 4C4VA 4MGZE 4KGRA 1LGRA 2WXPA 1NXCA 2WXQA 3DBLB 4TV3A 2J0MA 4V1RA 1SJED 3Q8FA 3HHMA 1ISNA 1XCTL 4MMHA 3TJPA 5H92C 1WXAA 2GBKA 2ZW0A 3TIXA 1XQQA 2CJNA 2WXGA 1F1HA 4GTOB 4XWTA 4ZRQA 1F2RC 2KLCA 2H88B 5G2NA 3SR6A 3T8MA 1GHQA 2MH7A 4HEA1 1SE2A 2UWQA 1N23A 4MSMB 4NJ7A 1I35A 4V1SA 5FR6A 1L6VA 4GGQA 3BYYB 1T0YA 1ET9A 4LNVA 4HPMB 2Z0DB 5D3DA 1FMIA 3PRMB 3PHXB 4NQLB 5CD2A 2KJ6A 2RPQA 3AFJA 2DYBA 3L4PA 1H14A 1HXCA 2QC8A 2ZISB 3SDTA 2GI9A 3O13A 1WXMA 4ASWC 1S63B 3Q14C 3X0WA 2FE8A 4US9A 4RCOA 3SAEA 1LD8B 1MVKA 3KSQB 5IO9A 4PT5A 1HX9A 2RD0A 2DWQA 4XZ4A 3RPFC 3DSVB 3RZWC 1MHHE 2H6GB 1JALA 1GAHA 4DHJD 1FT2B 5E2JA 3TBLD 5DCNA 1TNUB 4B95A 2JRHA 4IG7B 2Z8LA 2LGIA 1YJIA 3OEDA 3PZ1B 1ZUD2 1QSJA 3G6JB 4YSXB 4KDIC 4D4AA 4F13A 4MELA 4GXBA 4XGAB 5AUIA 4K3CA 4LNBB 1JCKB 3CU7A 1J8CA 4LNNA 2BGFA 4IWQA 3FC4A 4ACFA 3BY4B 1YIWA 2Y5PA 2ZPYA 1J0GA 1MFWA 3IBEA 3M62B 5KHQA 1N22A 2W3SA 3VXDA 1ZDXA 2FCSA 4HVBA 2QEJC 5FK9C 2D3CA 2KTRA 4TMAB 1KSDA 1N7RA 3AE8B 2BT6A 4ZHPA 3ZJVA 1E10A 5G55A 1VZ8A 2V4LA 4I6NB 1SIFA 1BXTA 3P63A 5GW7A 2OOBB 3DBHB 3U4EG 3DPDA 4FBJB 2Y3AA 1V5CA 1JROA 4H2AA 3PV1A 4YSZB 1QILA 3BK2A 4YDOB 3U30A 1I4QA 1EWCA 2G4DB 1KLVA 4FULA 3SFEB 2PLPA 1T6BX 3OLMD 4G50A 3ZRCA 3VTVA 2AQ3B 1ET6A 1RWHA 2FIFA 2MCNB 2RDGA 1K52A 1WMHA 3UF8A 1I42A 4JL9A 2ZCBA 1H3AA 3M76A 4ZH1A 1TY0A 1AYXA 1TIFA 2HTME 1BT0A 3Q8EA 2Z07A 1WE7A 3W7SA 1WMHB 1XWTA 2QHOA 4W9HA 3M74A 1OJMA 1O79A 3ON6A 1KF6B 1WGDA 5EE9A 2JJBA 3PZDA 2KMAA 2N7DA 3ML9A 5AZFA 2WDQB 1WGHA 2JZ3B 3IVFA 4YTMB 1O6HA 3PS6A 1WX9A 1FMAD 2EACA 2MHJA 4GSWA 1KZOB 3PZ3B 3AE2B 2CS4A 2Z0EB 1K50A 1GB4A 1H35A 3ZQ4A 4K3BA 5CZLA 3DOWA 3DDCB 2N4FA 2GH4A 5BO4B 4GN1A 1F9DA 1X1HA 2O2VB 1VD2A 4IKGA 3HXEB 1JCQB 1GUAB 4K7SA 1X1IA 3M72A 4D4CA 3DVGY 3QG0A 3ZDMC 4R3DA 1HM3A 2WXRA 3RNGC 2K0PA 4EEWA 1VZ7A 1LTXB 3BK1A 4A20A 4A3PA 3SDLC 4RM8A 1HMWA 5GXGB 3BZDB 4EZLA 3PZ2B 3R2IA 3G4FA 3EUB2 4HJKA 2KWVB 2FUTA 4A9AA 1WZZA 4C7YA 2G02A 1HA5A 5ILIA 3ANIA 4BVUC 3Q3FA 3VUXA 2IBIB 3T9LA 2PN5A 3NG0A 5JHAA 1CMXB 2WXHA 2WNMA 3RSYA 5IOIA 3OJ4B 4C1SA 5DHIA 1O6RA 2G3QB 2WIIB 1FD6A 1WR1A 4J3OD 2SEBD 3H2WA 2LWPA 2KO3A 1VJKA 4RMAA 5IKAA 2KOXA 1F52A 5G5GA 3I9V1 3B1LX 3VSNA 2RGKA 3GT5A 3A9JA 4A3OA 2VN7A 3P4RB 4RGNA 4YDEB 2DHZA 3W1YA 3J9CA 2D2QA 3DHIC 3ETRA 1SIJA 3DHGC 3GE3C 4WJPA 3E7JA 5EATA 4YWGG 3ZKJC 3MP9A 1L1YA 2JZZA 5ILKA 1QOGA 5JH5C 2N9KA 4W9DA 3EQAA 3QA8A 2AYOB 1H39A 2KFKA 1V8CA 5EASA 1C78A 3CWIA 1J7AA 1RAXA 3ALBA 1C9FA 1NVID 1H4RA 1KS8A 4Z4JA 3IXSA 4GOCA 1FEHA 4CQNA 1YNTE 2DZIA 3PGEA 3N0GA 1XXGA 2K8BA 3SDVA 2ZBLA 3VHTC 1KOTA 3OXUA 2N7JA 3BVMA 3RT3B 1RWCA 1ROEA 3IT6B 5LXIB 1MG4A 3AU5A 2EKIA 3X23A 4LNKA 1J7CA 1V5TA 3PYAA 3TEZA 3S9VA 3AB5A 4CO7A 2KHWB 3M75A 5HI1A 4GDLA 1WU4A 4ICUA 2ZIRB 1Y56A 1EUVB 1Q0WB 4KIKB 1I4XA 3TEYA 3W5MA 3LDZE 1K8RB 4PYZA 5AZHA 4IM0A 3NJTA 2MBQA 2LJIA 3E9SA 4E1YA 4AYRA 3IHPC 2WDRB 2YVCA 4HCNB 4MACA 2KT7A 1FCCC 1YX5B 2RDHA 1V6EA 1C79A 1TZOA 2K3UA 3RNFC 3ZTCA 1UG9A 5CX3A 3RZFA 4EL8A 1N4PB 5IN7A 3O65B 1FO2A 2JUOA 2BS2B 2WDAA 2WWZA 4N9F4 3ZGZA 2NCNA 1I4GA 4MBGB 1ZW7A 3MJ5A 2XWJB 3AM9A 1XLPA 4GTTB 2WP9B 1TNZB 2RI9A 3H7LA 1RWSA 1WXVA 5C2TB 4LDTD 4LNOA 1VR9A 4GDKA 1QT9A 4W9IA 1CLCA 1OJOA 4OK2A 5IL3A 1Z2MA 4WQMA 3UIOB 1N20A 1SXTA 4DOEA 2AWTA 3AH7A 3QXQA 3KWVA 1C1YB 1UD7A 4MSQB 4MGKE 1BUIC 3RRSA 1JRPA 4AYPA 4ZRKA 3WC3A 4FADA 4F1SA 3WCQA 2HJ8A 1NC5A 3VXWA 4DDGD 2KQSA 1RW9A 1SA5B 3SU8X 3Q69A 5GMVA 1TZ1A 3NZUA 2FUG1 1N21A 3VVWB 4WQOB 3NUHB 1E8WA 3LB8C 2J7QB 2KD0A 2DZKA 3DHHC 3NVZA 2HJ1A 1WE6A 1EO6A 3A4SC 3AEBB 4W9CA 3WAMA 4TF4A 4WVBA 3JYUA 2I2YA 4FXGB 3DQVA 3P42A 3VTUA 1WI0A 3AN1A 5JPNB 3VR9B 2EMSA 2AL6A 2W55A 3KW5B 2J53A 4DQOC 5JXVA 2DLBA 3NVVA 3GLYA 3WAPA 2EELA 1WJ6A 1VRAB 2KJRA 2KVRA 1KRFA 1V80A 3HK0A 4RNAA 2PVGC 4MGIE 1IBXA 2PEAA 2C9WB 5BYSA 3WKGA 2G4SA 1GC7A 2Y5BB 4DODA 1CJEA 1V7VA 3W7TA 2HDEA 2V4IB 3SD5A 5D2MB 1LXDA 1V7XA 2NVPA 1TT5B 1B9RA 3AEDB 3Q2AC 1C4CA 3AMZA 2BRVX 4GDLB 1WRIA 4MMIA 3QSPA 1C77A 2BYTA 2PKOA 4ONTA 4NAWA 1IGCA 4II2B 2ON8A 5E6PA 1WJNA 1W6KA 4F8CB 3WIWA 2KANA 5HG2A 1C4PA 1KREA 2EKEC 1Z5SB 1NL4B 1V7WA 3PSEB 1F0ZA 4MT5A 1GA2A 3DCGA 1H8CA 4KSKC 2O6VD 5C05A 4KZ0A 4W9FA 2X8XX 4K7WA 5LXHA 2FCNA 3AEEB 1UGJA 2CQSA 1TNBB 3AE4B 3W7UA 4HWIB 2FUHB 4M02A 4BOSC 2JF5A 1KZPB 1DL2A 1JS4A 1D5ZC 1FNUA 4KV2A 4TQ0A 3AE9B 1FT1B 5FR3A 5CTRC 3UGBB 5FO7B 2L7RA 2CHXA 2IO3B 2JYEA 1WGGA 1RRBA 2P0VA 2BRPA 1NDDA 4RH6A 5EE1A 3KLSX 1N61A 3IAS1 4KTPA 1EWYC 1H12A 3VTWA 4G11A 3DBRI 3R7RA 3IFWB 2Y5CA 2J4XA 4L23A 3DPYB 4YSYB 5G5HA 2XK5B 2WHIA 3WKFA 1KRHA 3GE8C 2R2LB 2V8KA 1G6JA 2ZNVB 2JY6A 5D94A 1TY2A 2MX2A 2WXOA 5AZGA 1FXAA 2ICIA 2LHDA 3OWEB 4NQKE 4A8XC 5TSSA 2KQ4X 2M0AA 5D7GA 1Q1OA 3QHTA 2DAFA 1N4QB 3V6EB 4ZH5A 2CR5A 2KTRB 2PJHA 1AW7A 2FV1A 1YJ1A 2AFAA 3EFCA 2FAZA 2BEDB 1KSCA 3ZVVA 1N95B 1SGHA 4AYOA 3WAOA 4ZOHC 3WUXA 2QSDA 1TN8B 2LI5A 3ZNZB 1YQ4B 1UT9A 3KLSA 2JQRB 2BS3B 3NNBA 1FP3A 1D5MC 4LNIA 3A1QA 4RF1A 2JF4A 2W3RA 3Q3NC 1WX7A 2DZMA 1DYQA 2E24A 1XCQL 4J6IA 1TBEA 2CKHB 4D4DA 2KWCA 1OQRA 5CHVC 5IKCM 3C8YA 2HE7A 4QT9A 1OGWA 5C23A 2KDEB 2PE9A 4WWNA 1P9DU 3P2CA 4AOFA 1F9JA 3RX8A 2BVCA 2FUZA 3QXFA 3WA0A 3M02A 3I5JC 4BAXA 3GZNB 1O1SB 2BYFA 5D6JB 1JWAD 1L7YA 3ZTDA 1HQRD 4L6XA 2K22A 4M00A 4IDIA 2BWFA 2BB6A 4MEMA 4XE0A 3V05A 1M94A 1R4MB 4LDTB 1YD8U 4HXDA 4NNJB 5IK9A 1FXIA 5I4DA 3KUCB 4IW0A 2CHZA 4XWWA 1P1AA 1C4AA 2KLGA 2WX0A 3AULA 3KQ4A 2R2QA 2MBBB 1RQ5A 3APFA 2I1KA 3VH3B 1WY8A 4M8NA 5IK6A 1L2NA 4ARIA 2K8HA 3RNBC 2MBOA 3KSLB 1ACCA 4M0WA 3WKHA 2KNBA 1V5DA 1G6IA 3Q6BA 1FFUA 4US8A 5ILYA 2MA9B 4WURA 4GTRB 1F77A
chains in the Genus database with same CATH topology
3W9CB 1UNSA 4C1SA 4N59A 3DSWB 1O6RA 2WIIB 2BB5A 1IA7A 1ESFA 1UWXA 2SEBD 3IAM1 3H2WA 4J3OD 1X9DA 1UWMA 4NZLB 1VJKA 2WXIA 1ZP0B 3GZKA 3RX7A 2CQTA 1FCEA 5BMHA 3SFEB 1T5XD 3DSTB 3AEAB 1HZ5A 1R76A 2V8JA 4XDCA 1WYGA 4L2YA 3EU5B 3AE7B 1CZPA 5G5GA 3I9V1 3E56A 2WDVB 1PUTA 1GB1A 2NTTA 1JW9D 1IA6A 5HHDG 2RGKA 3GT5A 3AECB 4N58A 2G9HD 1QQRA 1O1RB 1XWQA 1PGAA 2VN7A 1K53A 2B4FA 3QPFA 3Q7FB 2IPKD 3P4RB 3PO0A 1FRDA 1JCSB 4RGNA 4DXGA 4FXKB 4YDEB 4JX1C 1I4RA 3M73A 2EAEA 1TKGA 1CEMA 1HEZE 1H54A 1KTKA 3M78A 1RYJA 1GXOA 1B1ZA 3B2GA 3J9CA 3NVWA 2WYNA 4GTVB 1D6EC 1SIJA 3EA6A 3ETRA 1STEA 4REZA 4WH4A 5DGQA 2J52A 3TEXA 3Q8BA 1C76A 1E9MA 3E34B 4GTQB 2MJ3A 4YCRA 1PGBA 3EU8A 5JPMB 4YWGG 3HXCB 5C3JB 1HZFA 3RX5A 3TF4A 2D5GA 3MP9A 1L1YA 4ZG8A 2LUMA 1I7HA 1WXQA 3K7XA 1K72A 4RF0A 2KDMA 1QOGA 3W7XA 4LTUA 4XUVA 2N9KA 1XEEA 2IDYA 4C80A 3PYBA 3EQAA 2N9LA 2RMMA 3VRAB 1TKEA 2DYOA 1IUEA 1H39A 1D5XC 2KMMA 1JWUD 1JMLA 2DROA 1V8CA 1C78A 4Z4LA 2W82A 3CWIA 3MC0B 4LLGM 1J7AA 4MH8A 1CK1A 3VW5A 1FNWA 2ZZRA 1SBBB 2KAJA 4YTPB 3ZYYX 1C9FA 1NVID 2V3PA 1KS8A 2E3TA 4OZCA 4HJGE 4Z4JA 2BW2A 3IXSA 4ZRPA 4WAFA 2B39A 1FEHA 4CQNA 1YNTE 4TQ1A 2GB1A 3EUVB 3HXBB 1AYFA 1XXGA 3C72B 3SDVA 2ZBLA 4P16A 3DWGC 3OXUA 2N7JA 3BVMA 1QQFA 3WIRA 2XN9C 2WLBA 1ROEA 2WU2B 2AHGA 3K11A 2LFIA 1FAEA 3IT6B 3WKIA 5KKBA 1TNOB 2EKIA 4HRSA 1J7CA 3PYAA 3TEZA 3HXDB 3S9VA 2DYMA 3AB5A 3QT9A 3PZ8A 3QFYA 2WXJA 3M7EA 3U52E 1LD7B 1DOGA 4NJCA 2WQYB 3TSSA 1XO3A 3M75A 2JWUA 1D4BA 5HI1A 5BMGA 1WU4A 4B0MA 1N62A 3BWUD 2ZIRB 3M7CA 3E6UA 1Y56A 2KACA 2WXMA 4JE3B 1VZ6A 3PZ4B 4BOKA 4KGTA 1H36A 1I4XA 4B0EA 3W5MA 2QIEB 3TEYA 1LF6A 1PGXA 3DSUB 3D5SA 4WIPA 2WY8A 1XLNA 3NRZA 1TN6B 1E7PB 3P4SB 3GB1A 1N5XA 4WVCA 2LJIA 3LYYA 1N63A 5H8YE 4GTMB 3QT3A 4GTPB 3E9SA 3EGRA 1F9OA 1LO5D 4AYRA 4WVAA 3NS1A 1ZOYB 2WDRB 1YN5A 3H8HA 4AYQA 4MU9A 2D5JA 3SQCA 3GP7A 2WXKA 4MACA 2V3NA 3I57A 5BMIA 1FCCC 4GLSC 1ZPSA 1PFDA 2RDHA 1C79A 2YEPF 1TZOA 2K3UA 1GLMA 1UG9A 1FBOA 1J7BA 2MJEA 2DRSA 5DGRA 3M7BA 4YTNB 1BMLC 1DCEB 4EL8A 1IGDA 1N4PB 2F6DA 1FO2A 3RENA 5CA3A 2BS2B 1WWTA 1NEKB 2FV0A 2V8IA 1YMHE 4J5TA 1R7SA 5D3IB 3TUOA 2NMQA 2J42A 3T3OA 1I4GA 4MBGB 2ONQA 4EHMB 3ACTA 1EM7A 5HFYA 5EE3A 2H89B 2GOXA 2TSSA 2R61A 3MJ5A 1QKZA 3P1MA 1DGJA 3Q7AB 2IEJB 2W54A 1IS9A 2A8ZA 2XWJB 3AM9A 5MEHA 3VRBB 1XLPA 4GTTB 4KX6B 2WP9B 4RGTA 3H3KA 1GPXA 3DSSB 1TNZB 1QOFA 1NENB 2RI9A 3H7LA 1RWSA 5C2TB 4C56C 3E33B 2K5PA 1N4RB 5E6JA 1VR9A 4CJ1A 1QT9A 4JWSC 1A70A 2L32A 3GS2A 2PMVA 1ZXHA 1CLCA 2RI8A 4LNGB 3W5NA 2L52A 4HKZE 1O5MB 4N6EB 5LNK1 5T8IA 3M7LA 1SE4A 4OZBA 3BVZA 4Q88A 2JYTA 1N5WA 2A73B 1O1TB 4JJJA 4NAMA 1VD5A 4WQMA 3AE5B 2MJDA 1WSPA 4LIXA 3PMMA 2KN4A 3P5RA 4DOEA 1GAIA 1SXTA 3QXQA 2OKXA 3AH7A 2AQ1B 4NAWB 5BYRA 1TS5A 3R8BA 3KWVA 1CQVA 5M7IA 1BUIC 3P5PA 3DWMA 3TEWA 3RRSA 3P4QB 4KKIA 1JRPA 4Q2JA 3U7ZA 2K9XA 3MFGA 3AEFB 2BS4B 3A3VA 3RFZB 4AYPA 1ZDVA 3B9JA 4YXDB 4KKJA 3WC3A 1P7FA 1KLGD 1XW2A 2F0YB 3NVYA 3WCQA 3PZ7A 1NC5A 4FUSA 1TNYB 2L83A 2V0GA 3S4DA 1UMPA 3SFXB 1JWBD 3QRYA 1SA5B 3P4PB 4DXFA 1H3BA 2JSVX 3Q69A 2PTLA 1G9JA 2FUG1 2ZW1A 3FAHA 1GXNA 4UDUC 2IJ0A 3NUHB 3FILB 1KFGA 1LF9A 3LB8C 2G0DA 2WY7A 1UUPA 3KWLA 4OHJA 1RM6C 3NVZA 4L0GA 2OEDA 2BTEA 1YJJA 2L1AA 3AEBB 1D8DB 1V1PA 2AHFA 3QFZA 4TF4A 4WVBA 1IBXB 5AUKA 2I2YA 2SAKA 2RPVA 2VZKD 3SFDB 4FXGB 3HUIA 3P42A 3VR9B 3AE1B 3AN1A 4BOJA 1H37A 1ULVA 5FO8B 5JPNB 2D8LA 3M77A 1FFVA 2AQ2B 2JX5A 1SJHD 2W55A 1HXYD 2GZ6A 1N9AB 2WS3B 4EE2A 2YEPB 1QOAA 2XWBB 1TN7B 4RGMA 2J53A 4DQOC 5JXVA 2DLBA 1S64B 1OFFA 1TS2A 1TS3A 4JWUC 4OVZA 3NVVA 1AN8A 2QNOA 4AS1A 4LK0M 2H6FB 4GL3A 3GLYA 4A90A 1O6QA 1YN3A 1HZ6A 2EELA 3V3XA 1VRAB 2IGHA 3W2DA 4WU0A 2Q5WD 1KRFA 1AWDA 4KGRA 1SB3C 3FILA 1GXMA 2WXPA 1NXCA 1GAQB 2PVGC 1ENFA 2AX5A 2PVOD 2WXQA 4RNAA 1IBXA 4V1RA 1SJED 2GRIA 5BYSA 3X17A 2OHFA 3Q8FA 3Q78B 3WKGA 1XCTL 3ABVB 3VR8B 5H92C 2FBAA 1N4SB 4DODA 3LXFA 2ZW0A 1CJEA 1NYRA 2CJNA 4TSSA 1V7VA 3W7TA 2HDEA 2WXGA 2V4IB 4TQ0A 1FD6A 4GTOB 4XWTA 4ZRQA 1TF4A 1V7XA 2YIKA 3S4BA 1F2RC 2WXLA 2NVPA 3SR6A 1VLBA 2H88B 1B9RA 4KGSA 1GHQA 2EABA 1K51A 2MH7A 1MHXA 3E73A 3AE6B 3AEDB 1C4CA 1MI0A 3AMZA 1SE2A 3RJ3A 4GDLB 4HEA1 2DRRA 2NTSA 1WRIA 3QSPA 1JCRB 1AGMA 1X81B 1C77A 3ANKA 2BYTA 2SQCA 2PKOA 4ONTA 2ACZB 3D5RA 4V1SA 1IGCA 3Q73B 1D8EB 3W5VB 1L6VA 3BYYB 4D2KA 1TS4A 1ET9A 2ON8A 4LNVA 3IT4B 1W6KA 2X38A 3WIWA 5D3DA 1FMIA 2FBWB 3DRAB 1C4PA 1KREA 5HG2A 3ZJTA 3W1SA 1QF6A 1NL4B 5CD2A 2WXFA 4HROA 1FBWA 3AFJA 1L0VB 1GOZA 2XNAC 3L4PA 1V7WA 1H14A 1F0ZA 4MT5A 3AEGB 1GA2A 5BYQA 1MZCB 2ZISB 1SE3A 4OW0A 3T3NA 3SDTA 2GI9A 1KH0A 3O13A 2E6XA 1S63B 3D3IA 3AEEB 2FE8A 2BBCA 2CQSA 1KWFA 1UGJA 4RCOA 4US9A 3SAEA 1LD8B 1MVKA 1TNBB 3KSQB 4M76A 3AE4B 3W7UA 4PT5A 1KZPB 1DL2A 4D4BA 3UI3A 1JS4A 1D5ZC 1FNUA 1L0YB 1L6UA 3E32B 2DWQA 3DSVB 2QILA 4CJ0A 1FRRA 1MHHE 3AE9B 3RPFC 2H6GB 3NZ3A 1FT1B 1JALA 1GAHA 5FR3A 4L9PB 1NYQA 1SQCA 3Q79B 1EU3A 3W5UB 1FT2B 4AQ7A 5E2JA 2DBYA 1TNUB 3HRDD 2XQWA 5FO7B 3BIID 1N94B 3Q75B 4GDKB 1V97A 2Z8LA 3SEBA 2JYEA 2LGIA 5AGDA 1L5PA 1YJIA 1FO4A 3OEDA 1GSZA 1WU5A 2P0VA 1M4VA 2PW9A 1L4ZB 3PZ1B 1I4PA 4RH6A 4D94A 5EE1A 4HKQA 1ZUD2 1QSJA 3G6JB 4CE7A 4YSXB 2INNE 2WXNA 3KLSX 1N61A 1KFYB 4D4AA 1VDVA 4KTPA 3IAS1 2B76B 1EWYC 4FXCA 5AUIA 1H12A 4LNBB 1JCKB 3CU7A 2Y5CA 2J4XA 4L23A 3DPYB 2JU6X 4YSYB 3WIQA 3FC4A 5G5HA 3WKFA 2Y5PA 1KRHA 2R2LB 2V8KA 1XLOA 3SDRA 1TY2A 2WXOA 3Q8AA 1FXAA 4ITKA 2ICIA 1WGKA 1XF5L 3VXDA 2W3SA 2LHDA 5GZKA 1ZDXA 3OWEB 5GY3A 4A8XC 5EE0A 5TSSA 2KQ4X 2QEJC 3DSXB 1KLUD 3S4CA 5FK9C 2M0AA 4RFBA 1E6EB 4TMAB 1L0XB 3N9YC 5D7GA 1KSDA 3MHZA 3SDUA 3AE8B 4RGOS 3B2FA 3VQIA 1NI3A 2BT6A 4ZHPA 3Q8CA 3ZJVA 1N4QB 3URYA 4A55A 1E10A 3S4AA 4ZH5A 1VZ8A 2LHEA 1I4HA 3E37B 1AW7A 2FV1A 3HVZA 4P6VF 3HVDA 2AFAA 2MEKA 1BXTA 2BEDB 3P63A 5GW7A 2WU5B 1KSCA 3U4EG 1MPEA 1WU6A 2I07B 2JG0A 1N95B 1V1PB 2VZKB 4AYOA 1PDXA 2Y3AA 1V5CA 1JROA 1SSNA 2DRQA 1QLBB 3WUXA 4H2AA 4ZOHC 2QSDA 1QILA 4YSZB 1SA4B 1TN8B 3BK2A 4YDOB 1I4QA 1EWCA 3ZGZA 1JWMD 1UT9A 1YQ4B 2PLPA 2QJLA 1G87A 3KLSA 4GTSB 1T6BX 2JQRB 2BS3B 5MPOA 1FP3A 1D5MC 4JPSA 3U2SC 1T3QA 4RF1A 3ANJA 2AQ3B 2JF4A 1ET6A 1EU4A 2W3RA 3AV8A 1FM0D 2RDGA 1K52A 1DYQA 1XCQL 1JQ4A 3AE3B 2CU3A 3ACSA 4ARCA 1V1OA 2INPE 4MM3B 3EZ8A 4ZHOA 1H3AA 3M76A 4ZH1A 1TY0A 1QBQB 4D4DA 1AYXA 4TXTA 2WINB 2HTME 1DOXA 3Q8EA 2Z07A 1OQRA 3W7SA 3C8YA 1L4DB 1HCUA 3HXFB 2H6HB 4QT9A 1XLQA 1XWTA 1FNVA 3P2CA 1PYWD 3M74A 1O79A 3ON6A 3RX8A 1KF6B 3QDEA 2FUZA 3BVGA 3QXFA 1SEBD 5EE9A 4IOIE 5FKAC 2JJBA 1E0ZA 2I38A 3T33A 1YQ3B 2WDQB 1O1SB 5M7YA 4YTMB 3QWTA 1JWAD 2LMCA 2LEKA 1O6HA 4L6XA 1FIQA 1HQRD 2K22A 4OZAA 4ZYSA 4IDIA 1FMAD 2EACA 1ZXIA 2JXTA 1H13A 1KZOB 3PZ3B 3AE2B 1YN4A 1K50A 1ZE3D 1QOBA 4XDDA 2BB6A 3M71A 4XE0A 1NI1B 3V05A 1GB4A 1H35A 4C7ZA 1DOYA 3ZQ4A 1L2AA 5CZLA 1FXIA 3SFYB 1FPPB 1SF0A 5I4DA 1DOIA 1FO3A 2GH4A 1N60A 2VN4A 2H6IB 1KKTA 1W6JA 1F9DA 4XWWA 4L1BA 3CIRB 4IKGA 3HXEB 5FOBB 1C4AA 1JCQB 4Q2BA 2NOJA 2XFGA 5FO9B 3KQ4A 3M72A 4D4CA 1F2RI 3QG0A 4R3DA 1C3DA 1RQ5A 2WXRA 2K0PA 3BYTB 3SDQA 1TYGB 1VZ7A 1LTXB 1TJEA 2KWDA 2PIAA 1FCLA 1P7EA 1RFKA 2JZPA 2G1EA 4A6QA 3BK1A 4KTRA 4ARIA 1OQQA 3ZJUA 1TKYA 5GXGB 2M56B 3BZDB 4WWMA 3PZ2B 3CIHA 3R2IA 2M19A 2N0SB 3KSLB 1ACCA 3EUB2 4M0WA 4A9AA 4USAA 1WZZA 3WKHA 2EADA 1H3CA 1G6IA 1V5DA 2G02A 1HA5A 4C7YA 3ANIA 3R2TA 1FFUA 4US8A 3E30B 1G9GA 2PN5A 1Q10A 2QMTA 4YT0B 1JWSD 2WXHA 4O1NA 4WURA 4GTRB 3RSYA 2CJOA 2WNMA 2IGDA 1F77A 3W7WA 2IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E37 B;  3Q78 B;  4MU9 A;  3SQC A;  4C1S A;  2V3N A;  3DSW B;  1O6R A;  2BED B;  1N4S B;  2BB5 A;  2WII B;  2I07 B;  1N95 B;  4GTO B;  4ZRQ A;  3DST B;  1DCE B;  1R76 A;  2V8J A;  1N4P B;  1SA4 B;  1TN8 B;  3EU5 B;  1GHQ A;  4YDO B;  2V8I A;  3RJ3 A;  3KLS A;  4GTS B;  4MBG B;  4EHM B;  2GOX A;  1JCR B;  1X81 B;  3Q7A B;  2IEJ B;  2SQC A;  1O1R B;  4ONT A;  3D5R A;  4V1S A;  2XWJ B;  3Q73 B;  4GTT B;  1D8E B;  3Q7F B;  3DSS B;  1TNZ B;  1JCS B;  4FXK B;  4YDE B;  3E33 B;  4LNV A;  1N4R B;  1W6K A;  1H3A A;  4ZH1 A;  1QBQ B;  4D4D A;  1GXO A;  3DRA B;  2WIN B;  4GTV B;  1NL4 B;  2PMV A;  3HXF B;  4LNG B;  2H6H B;  1O5M B;  3E34 B;  4GTQ B;  1O79 A;  5JPM B;  3HXC B;  1HZF A;  1MZC B;  2ZIS B;  2A73 B;  1O1T B;  3K7X A;  1O1S B;  1S63 B;  2BBC A;  1O6H A;  1H39 A;  1LD8 B;  1TNB B;  3KSQ B;  4M76 A;  4KKI A;  3U7Z A;  1KZP B;  1KZO B;  3PZ3 B;  4D4B A;  3E32 B;  3DSV B;  2V3P A;  4KKJ A;  2BB6 A;  2H6G B;  1NI1 B;  1FT1 B;  2F0Y B;  1H35 A;  4L9P B;  1SQC A;  3Q79 B;  4ZRP A;  1TNY B;  1FT2 B;  2B39 A;  1UMP A;  3SFX B;  1TNU B;  3SFY B;  1FPP B;  2XQW A;  5FO7 B;  1N94 B;  3Q75 B;  1SA5 B;  3EUV B;  3HXB B;  1H3B A;  5AGD A;  3C72 B;  3OED A;  2H6I B;  1GSZ A;  1W6J A;  3OXU A;  1GXN A;  1QQF A;  3PZ1 B;  4D94 A;  3HXE B;  1QSJ A;  5FOB B;  1JCQ B;  3G6J B;  2G0D A;  2NOJ A;  2WY7 A;  5FO9 B;  3KQ4 A;  4D4A A;  4D4C A;  1TNO B;  1C3D A;  4LNB B;  1D8D B;  3CU7 A;  3HXD B;  1LTX B;  3DPY B;  4FXG B;  4BOJ A;  1H37 A;  5FO8 B;  5JPN B;  1LD7 B;  2R2L B;  2V8K A;  1N9A B;  2XWB B;  1TN7 B;  3PZ2 B;  2ZIR B;  3KSL B;  1S64 B;  3PZ4 B;  4BOK A;  1H36 A;  1H3C A;  2G02 A;  2H6F B;  3DSU B;  3DSX B;  3D5S A;  1O6Q A;  2WY8 A;  1TN6 B;  3E30 B;  2PN5 A;  4GTM B;  4GTP B;  1GXM A;  1N4Q B;  4GTR B;  4V1R A; 
#chains in the Genus database with same CATH topology
 3W9C B;  3QQ8 B;  4N59 A;  3DSW B;  1IA7 A;  2M17 A;  2HD5 B;  1X9D A;  1UWM A;  1UGM A;  4NZL B;  2WXI A;  3GZK A;  3L08 A;  1FCE A;  5BMH A;  2V8J A;  3NS8 A;  2LJ5 A;  3EU5 B;  3AE7 B;  1CZP A;  3PRZ A;  4ZRJ A;  2ZZP B;  2WDV B;  4DDI D;  1GB1 A;  2NTT A;  1JW9 D;  5HHD G;  2JVC A;  4CHK A;  5AEK B;  2BKR B;  4N58 A;  2G9H D;  1QQR A;  4P1B C;  1UBI A;  1XWQ A;  4FLH A;  2XK5 A;  4ANV A;  1K53 A;  2B4F A;  4DXG A;  5CHF A;  4FXK B;  2J0K A;  2CU1 A;  1HEZ E;  1RYJ A;  2D10 A;  3M78 A;  3R7Q A;  3NVW A;  2V1Y A;  4F10 A;  4ICV A;  4WH4 A;  5DGQ A;  1N7Q A;  3E34 B;  4GTQ B;  5C3J B;  3HXC B;  2KXJ A;  2WDT B;  2D5G A;  3TF4 A;  4K81 A;  1HTO A;  4ZG8 A;  1XD3 B;  2GOW A;  4XUV A;  2IY1 B;  4C80 A;  4PS8 A;  5DPW A;  2K1F A;  2N9L A;  4RM9 A;  2IYD B;  4NJ6 A;  1IUE A;  1FPY A;  2W82 A;  3MC0 B;  4WAA A;  1LXK A;  4QAY A;  3LJ3 A;  1CK1 A;  1SBB B;  2KAJ A;  2ZZR A;  3PVL A;  5IK0 A;  4P1C C;  2E3T A;  4OZC A;  2BW2 A;  2B39 A;  1FXT B;  3A33 B;  4ANW A;  4TQ1 A;  2MBH A;  2LZ6 A;  4GU2 A;  3U8Z A;  4WWO A;  2NPT A;  3HXB B;  1YOV B;  3Q3J A;  1OEY J;  4P16 A;  4YL8 A;  2BF8 B;  2XN9 C;  3M3J A;  2DEN B;  2WU2 B;  3ML8 A;  3CST A;  1UBQ A;  2BKF A;  2NBW B;  2V9H A;  3PZ8 A;  3QFY A;  2WXJ A;  1V5O A;  4LJP B;  3TSS A;  2VH2 A;  1OJN A;  1RWA A;  4ZDV A;  2REX A;  1N62 A;  2LD9 A;  2FID A;  2KWU B;  3QIJ A;  3QWZ B;  1IPG A;  2QIE B;  5E6N A;  4S0R A;  3DSU B;  3KH0 A;  2WY8 A;  1TN6 B;  2D07 B;  3GB1 A;  3CSF A;  4GTM B;  1YN5 A;  2FCQ A;  1LXM A;  4MU9 A;  2MRP A;  4WJQ A;  2WXK A;  3AI5 A;  3RCZ A;  3RNC C;  3QJZ A;  1GLM A;  3AFL A;  1N1B A;  1J7B A;  5DGR A;  3SHQ A;  1N7N A;  1DCE B;  3DVG X;  1WWT A;  4OVU A;  4EZJ A;  3TUO A;  2FV0 A;  2V8I A;  5D3I B;  2NMQ A;  2J42 A;  2ONQ A;  4EHM B;  2PPH A;  2KDI A;  5EE3 A;  2GOX A;  2TSS A;  3P1M A;  3PT2 B;  2IEJ B;  1J0M A;  1V81 A;  2A8Z A;  2W54 A;  1VCB A;  4IUM B;  2KQ7 A;  4RGT A;  1GPX A;  1NEN B;  2C5L C;  4PYU A;  3MJW A;  5IKH A;  4JWS C;  1WRD B;  2L32 A;  4HKZ E;  2L52 A;  5LNK 1;  4N6E B;  4B9K A;  2WX1 A;  1SE4 A;  2L0T A;  4OZB A;  2JYT A;  1N5W A;  4W9G A;  4NAM A;  3WAN A;  1OQY A;  3AE5 B;  3PMM A;  1UZX B;  3UQA A;  2AQ1 B;  1TS5 A;  1WFY A;  1CQV A;  1WGY A;  5J18 A;  2OJR A;  5M7I A;  3TEW A;  1T0R C;  4Q2J A;  3U7Z A;  2E22 A;  1RWG A;  3ZNH B;  3MFG A;  2NBV B;  1XW2 A;  2F0Y B;  3NVY A;  2V0G A;  5IM1 A;  3JSV A;  1JWB D;  2MP2 A;  4DXF A;  2BYE A;  2L05 A;  2ZW1 A;  4GB9 A;  2ASQ A;  2IJ0 A;  2HTH A;  1KFG A;  3KWL A;  1UUP A;  4L0G A;  1X1M A;  2OED A;  3AXC A;  3N1X C;  2LVO A;  1WR6 E;  5AUK A;  2SAK A;  4AS1 A;  3AE1 B;  1ULV A;  2D8L A;  3M77 A;  2L00 B;  2AQ2 B;  1JRU A;  2JX5 A;  4EE2 A;  4F7Z A;  2XWB B;  2XBB C;  3VSM A;  4LNF A;  2IO2 B;  2KKC A;  1OFF A;  1TS2 A;  1TS3 A;  3MHS D;  4OVZ A;  1AN8 A;  4LK0 M;  4GL3 A;  3V3X A;  2Q5W D;  1AWD A;  2ZNV C;  3APC A;  1SB3 C;  3FIL A;  4KVG B;  2PVO D;  1GAQ B;  1ENF A;  2AX5 A;  2GRI A;  3X17 A;  3ABV B;  1N4S B;  3LXF A;  4TSS A;  2O2V A;  1N6Z A;  1TF4 A;  3S4B A;  1VLB A;  4KGS A;  5DPR A;  1MHX A;  3E73 A;  3AE6 B;  1MI0 A;  1AGM A;  1X81 B;  2SQC A;  2ACZ B;  3D5R A;  3L0W B;  1N7P A;  1J19 A;  4EZK A;  4JGH B;  5L83 A;  4D2K A;  1TS4 A;  3QAR A;  3DVN V;  3GOE A;  2FBW B;  3NHE B;  5IL8 A;  1QF6 A;  2WXF A;  1FBW A;  4FJZ A;  1L0V B;  1GOZ A;  2QCZ A;  2O6V A;  5BYQ A;  2LXA A;  4BKG A;  1SE3 A;  3DBS A;  4MGY E;  4OW0 A;  1KH0 A;  1R4N I;  3CMM B;  3D3I A;  3ZRF A;  4B6W A;  4PS7 A;  4M76 A;  5DPT A;  1TGZ B;  4D4B A;  1L6U A;  2K8C A;  4ZRI A;  1LQB A;  1WM2 A;  3W5U B;  1EU3 A;  2DBY A;  3U7D A;  1W3Y A;  3HRD D;  5JMD A;  5ILJ A;  3A9J B;  3BII D;  1N94 B;  3Q75 B;  3V62 A;  1V97 A;  3ZNG C;  5AGD A;  1N7O A;  1WU5 A;  1M4V A;  1L4Z B;  1MJD A;  1I4P A;  4D94 A;  4KZC A;  2M8S A;  4CE7 A;  2INN E;  2WXN A;  4FXC A;  2Q1F A;  1VDV A;  1WIA A;  2RR9 A;  2B76 B;  3DBH I;  1XT9 B;  4LJO B;  4G0N B;  3N30 A;  2N9X A;  2PE6 B;  2GBM A;  2KDF B;  3SDR A;  3VAW A;  3L13 A;  3Q8A A;  3M01 A;  2K6Q A;  4ITK A;  1WGK A;  1XF5 L;  5GZK A;  2K39 A;  1LOH A;  5GY3 A;  3DSX B;  1KLU D;  3S4C A;  4RFB A;  1E6E B;  3R3M A;  1IYF A;  3MHZ A;  3SDU A;  3B2F A;  3GZN I;  2GBJ A;  3URY A;  3S4A A;  1I4H A;  1E90 A;  2WU5 B;  4MJS A;  4IWO A;  1MPE A;  4EUT A;  1WU6 A;  2I07 B;  3L17 A;  4E3C A;  1V1P B;  5IP4 D;  2VZK B;  4I6P A;  1PDX A;  1SSN A;  1QLB B;  1F9G A;  4DXA B;  2JRI B;  5IA7 A;  2IO0 B;  1G87 A;  1X1J A;  5MPO A;  4JPS A;  3U2S C;  1EU4 A;  1FM0 D;  2CU3 A;  3ACS A;  1E5W A;  4ARC A;  5ILH A;  3EZ8 A;  2X03 A;  3KUD B;  1QBQ B;  4TXT A;  1DOX A;  4TKN A;  4MJS B;  1HCU A;  3HXF B;  2H6H B;  1R4N B;  4BKT A;  1XLQ A;  3P2B A;  1FNV A;  2N1V A;  3QDE A;  2LGS A;  5FKA C;  1CB8 A;  4MDK E;  3T33 A;  1WYW B;  4XX5 A;  5M7Y A;  3QWT A;  1NI2 A;  2JXX A;  2LEK A;  4WWP A;  1FIQ A;  1ZXI A;  2JXT A;  3VDZ A;  2VH1 A;  3Q3M C;  1YN4 A;  1HM2 A;  1ZE3 D;  4FHK A;  4XDD A;  4EOY A;  3M71 A;  1DOY A;  4C7Z A;  3SFY B;  2MQJ A;  1DOI A;  1FO3 A;  1E8Y A;  4BBN F;  1N60 A;  2VN4 A;  1KKT A;  2MLB A;  1V2Y A;  3OAW A;  4L1B A;  3JVZ X;  3CIR B;  2XFG A;  1N24 A;  5FO9 B;  2K25 A;  1F2R I;  2ONG A;  1C3D A;  1WM3 A;  5TR5 A;  3BYT B;  4DK5 A;  1FCL A;  1RFK A;  1S1Q B;  2G1E A;  2D3G A;  4KTR A;  1QAZ A;  1OQQ A;  1TKY A;  2N7E A;  4WWM A;  2RGF A;  4E71 A;  4PS3 A;  4USA A;  2EAD A;  2KVZ A;  2R2O A;  2LVP A;  3R2T A;  3V6C B;  1V49 A;  3E30 B;  1G9G A;  1Q10 A;  2QMT A;  1E7U A;  4YT0 B;  4C00 A;  1JWS D;  2NS5 A;  2CJO A;  3W7W A;  2IGG A;  1V86 A;  1UNS A;  2J0J A;  4FJY A;  1UWX A;  3IAM 1;  2NBU A;  3M95 A;  1ZP0 B;  1T5X D;  2CHW A;  1HZ5 A;  1R76 A;  4DHZ E;  4L2Y A;  4DI5 A;  1ZKH A;  3L16 A;  2LXC A;  1IA6 A;  1HV6 A;  1O1R B;  2RSU A;  3Q7F B;  3CF6 E;  3PO0 A;  5JMF A;  1FRD A;  4IWP A;  4JX1 C;  1I4R A;  2KFJ A;  3M73 A;  1TKG A;  1CEM A;  1GXO A;  4REZ A;  2WYN A;  3PTF C;  1D6E C;  3EA6 A;  5ILD A;  1STE A;  3KUZ A;  3Q8B A;  1E9M A;  2MJ3 A;  2NPT B;  1YX6 B;  1PGB A;  3EU8 A;  1HZF A;  4RF0 A;  3M63 B;  1I7H A;  3H6N A;  1K72 A;  2K6D B;  3W7X A;  3PYB A;  3I3T B;  2RMM A;  3ZIM A;  3VRA B;  3ZXV A;  1D5X C;  1JWU D;  1JML A;  2DRO A;  4Z4L A;  5JZE B;  4FN2 A;  2RDB C;  2GBN A;  3R66 C;  2DZJ A;  3VW5 A;  2Z59 B;  2M4N A;  2JPH A;  3RI7 C;  1OEY A;  5LLI A;  2GB1 A;  2GLS A;  1AYF A;  3C72 B;  1WJU A;  5C1Z A;  3N1Y C;  3JSV B;  1QQF A;  3WIR A;  3HIZ A;  3OG5 A;  3K11 A;  2LFI A;  1R4M I;  5KKB A;  1TNO B;  1EF1 A;  1SE9 A;  1A5R A;  3HXD B;  4KIK A;  3H7P B;  3M7E A;  4GAX A;  3U52 E;  1LD7 B;  1DOG A;  4NJC A;  2BRW A;  4IM2 A;  1D4B A;  1GNU A;  2V3S A;  2KX3 A;  4B0M A;  4DBG A;  4JE3 B;  2KAC A;  3E6U A;  2WXM A;  4KGT A;  1Q5W B;  3PZ4 B;  4W9J A;  4B0E A;  3ECI A;  1LF6 A;  3ENE A;  4AJY B;  2UU7 A;  4WIP A;  3PPA A;  3P4S B;  1U4A A;  1N5X A;  3QT3 A;  3EGR A;  1F9O A;  1OJP A;  1LO5 D;  4ANX A;  4WVA A;  3NS1 A;  3H9D A;  4AYQ A;  3EHV A;  1V9J A;  2V3N A;  3I57 A;  5BMI A;  4GLS C;  1PFD A;  2BYV E;  4JIO U;  4E74 A;  2YEP F;  3W1S C;  3N3K B;  2MJE A;  1FBO A;  4GMV A;  3M7B A;  3TL5 A;  1BML C;  1IGD A;  2F6D A;  3AU4 A;  2KC2 A;  3REN A;  5CA3 A;  4M0W B;  1NEK B;  4J5T A;  1R7S A;  3UIN B;  3ACT A;  2H89 B;  5DHK A;  1QKZ A;  3Q7A B;  1IS9 A;  3VRB B;  5MEH A;  1EGU A;  3H3K A;  3DSS B;  1QOF A;  5J2R A;  4C56 C;  2K5P A;  1N4R B;  5IAA C;  4CJ1 A;  3GS2 A;  2PMV A;  4K7U A;  3W5N A;  1NBF C;  1HXG A;  1O5M B;  5T8I A;  3BVZ A;  3QCA A;  1O1T B;  4JJJ A;  3RD2 A;  1VD5 A;  2MJD A;  3QC8 B;  2N9P C;  2KN4 A;  3P5R A;  1GAI A;  5BYR A;  3R8B A;  3V61 A;  3OJ3 A;  3ZXR A;  3L54 A;  3DWM A;  3P5P A;  4KKI A;  2C7M B;  3BIN A;  3AEF B;  2BS4 B;  3A3V A;  3RFZ B;  5EDS A;  4I6L B;  1E7V A;  4KKJ A;  1E8X A;  1P7F A;  3V60 A;  4FUS A;  2KZR A;  2B3A A;  3QRY A;  2FNJ B;  2MBE A;  4URK A;  3P4P B;  2JSV X;  5J17 A;  1G9J A;  3FAH A;  4UDU C;  1YQB A;  3FIL B;  1P0R A;  4OHJ A;  1GG3 A;  4NEI A;  1RM6 C;  2AL3 A;  1YJJ A;  1D8D B;  1V1P A;  3QFZ A;  1IBX B;  1QZE A;  3SFD B;  1WZ0 A;  3QAQ A;  4EFO A;  4BOJ A;  1H37 A;  5FO8 B;  1FFV A;  3EFU A;  1EF5 A;  3PLU A;  1N9A B;  3LZ9 A;  2KC1 A;  4OVV A;  2YEP B;  1TN7 B;  5DPS A;  3N0F A;  4RGM A;  1T0S C;  3VH4 B;  2BQQ A;  2QNO A;  1YN3 A;  4M8M A;  3C0R B;  4WU0 A;  3UIP B;  2M1M A;  2J5C A;  1GXM A;  1WX8 A;  3EEC A;  3NY5 A;  2NR2 A;  2OHF A;  3Q78 B;  4OZW A;  4OK4 A;  4NY0 A;  3VR8 B;  2JT4 B;  2FBA A;  1NYR A;  1RFA A;  2VRR B;  2IO1 B;  3PRP B;  2KJH B;  2YIK A;  2WXL A;  2IZV B;  3HM6 X;  2IND C;  2EAB A;  1K51 A;  2WYQ A;  4IM3 A;  4FJV B;  3RJ3 A;  2LRW A;  3VUW A;  2DRR A;  2NTS A;  4HLE A;  2L3Z A;  4HCP B;  3NFV A;  1JCR B;  3ANK A;  5HKH A;  3Q73 B;  3NOB A;  1D8E B;  3W5V B;  2GBR A;  1F1S A;  4BKS A;  2KX0 A;  4DHJ B;  3IT4 B;  2X38 A;  3DRA B;  3ZJT A;  3W1S A;  4HRO A;  2AEH A;  3ZNI D;  2XNA C;  2XEW A;  3AEG B;  1MZC B;  3H7P A;  3ZUN A;  2WCO A;  3T3N A;  2E6X A;  2KDB A;  2BBC A;  1KWF A;  2O6V B;  2I1J A;  2LVQ A;  2WGS A;  3B08 A;  3UI3 A;  1L0Y B;  2QIL A;  3E32 B;  4CJ0 A;  1FRR A;  3NZ3 A;  4P7I A;  3G4D A;  4L9P B;  1NYQ A;  1SQC A;  3Q79 B;  4AQ7 A;  2C7H A;  3RNA C;  2XQW A;  1HTQ A;  2A5U A;  4GDK B;  3SEB A;  2D3A A;  1L5P A;  1FO4 A;  3MTN B;  1GSZ A;  2PW9 A;  3K9P B;  4GIV A;  4HKQ A;  3RYT A;  3E80 A;  1KFY B;  2LGY A;  2OJW A;  2QDF A;  2FCM A;  2KK8 A;  2JU6 X;  3WIQ A;  2BWE S;  3PRE A;  2D3B A;  2M0X A;  2FUQ A;  3ZLZ A;  1XLO A;  3RNE C;  4AUQ C;  4JQW C;  4BKS D;  3A1Q B;  5EE0 A;  1L0X B;  3N9Y C;  4LCD E;  1J0N A;  1WXS A;  4RGO S;  4X57 B;  3VQI A;  1NI3 A;  3N20 C;  3Q8C A;  1LM8 B;  4A55 A;  4AJW A;  2LHE A;  4P6V F;  3E37 B;  3HVZ A;  4HPP A;  3HVD A;  2MEK A;  1RWF A;  3DBR B;  2IY0 B;  2JG0 A;  1HXA A;  4FNV A;  2DRQ A;  1WF9 A;  2L76 A;  1SA4 B;  1UEL A;  1JWM D;  2QJL A;  4GTS B;  3TMP B;  4HDQ A;  1T3Q A;  3ANJ A;  3AV8 A;  1JQ4 A;  3AE3 B;  1V1O A;  2INP E;  4MM3 B;  4BFR A;  4ZHO A;  1UH6 A;  2A4Z A;  2WIN B;  4MH0 E;  3N32 A;  3EC8 A;  1L4D B;  1OTR B;  1KJT A;  1PYW D;  3HM3 A;  3FKY A;  3C19 A;  4FA6 A;  3BVG A;  1SEB D;  3KYD D;  4IOI E;  1E0Z A;  2I38 A;  1YQ3 B;  1RLF A;  5CHW A;  2W9N A;  3Q3O C;  4EKU A;  2LMC A;  4ZYS A;  4OZA A;  4TUU A;  4C4V B;  1GJZ A;  3A9K B;  1H13 A;  2ZVN A;  1QOB A;  2L0F A;  4MM3 A;  1NI1 B;  1L2A A;  2KMC A;  1FPP B;  1P98 A;  1SF0 A;  3A9K A;  4JLC A;  3A0O A;  1WGR A;  2C60 A;  2H6I B;  1PQS A;  1W6J A;  5FOB B;  4Q2B A;  2NOJ A;  3H7S A;  3APD A;  4AP4 C;  3SDQ A;  1TYG B;  3WIM A;  1TJE A;  2KWD A;  2PIA A;  1P7E A;  2JZP A;  4A6Q A;  4M01 A;  3ZJU A;  2M56 B;  3CIH A;  1AAR A;  4G3X B;  2M19 A;  2N0S B;  3MC8 A;  4W9E A;  4HK2 A;  1C82 A;  1H3C A;  1T0Q C;  1S3S G;  1ZGU B;  3I63 C;  2GMI C;  2DX5 B;  3MC9 A;  4O1N A;  2MWS B;  2IGD A;  1C3T A;  4WJO A;  1ESF A;  2BB5 A;  4NAW B;  3ZDT A;  3NZS A;  4FJQ A;  3RX7 A;  1Y8R C;  2CQT A;  2C7N B;  3DST B;  3AEA B;  4XDC A;  1WYG A;  5EAU A;  1IP9 A;  4ANU A;  1WZ3 A;  3E56 A;  2L8J A;  1PUT A;  3ZO5 B;  2ZEQ A;  1WJ4 A;  4HDO A;  3AEC B;  1PGA A;  3QPF A;  2IPK D;  1JCS B;  3VUY A;  3QX1 A;  2EAE A;  3B2G A;  1KTK A;  2KTF A;  1H54 A;  2MP2 B;  3RN9 C;  1B1Z A;  4GTV B;  3VFK A;  3TEX A;  1KM7 A;  2J52 A;  1C76 A;  4YCR A;  5JPM B;  3RX5 A;  2LUM A;  1WXQ A;  2N9E B;  3K7X A;  3H1U A;  2UYZ B;  2KDM A;  2DAJ A;  3UQB A;  3DBL I;  4LTU A;  1XEE A;  2IDY A;  1WH3 A;  1TKE A;  2DYO A;  2L83 A;  2KMM A;  4K1R B;  4LLG M;  4MH8 A;  1FNW A;  3ZYY X;  4YTP B;  2V3P A;  4W9L A;  2EMT A;  4HJG E;  4WAF A;  4ZRP A;  3JW0 X;  4XC2 A;  1HN0 A;  2ZJD A;  3EUV B;  2KN5 A;  3DVN U;  4CYE A;  3DWG C;  1GC6 A;  2JWZ A;  3ONS A;  2WLB A;  2AHG A;  1FAE A;  2LAS A;  3WKI A;  2G45 B;  4HRS A;  2DYM A;  3QT9 A;  2MW5 A;  3N1Z C;  3M00 A;  1UF0 A;  2WQY B;  1XO3 A;  4OJZ A;  2JWU A;  5BMG A;  3BWU D;  3M7C A;  2ZPN A;  1VZ6 A;  4BOK A;  1H36 A;  1N1Z A;  4OZV A;  1PGX A;  1E8Z A;  3D5S A;  2MSE D;  1XLN A;  3NRZ A;  4XYC A;  1E7P B;  2LRU A;  4WVC A;  3LYY A;  1N63 A;  5H8Y E;  4DWF A;  4GTP B;  4BOZ B;  1ZOY B;  4BZA A;  3H8H A;  3TCA A;  2D5J A;  3SQC A;  3GP7 A;  3RUI B;  1ZPS A;  4HPL B;  2BPS A;  3PHW B;  2DRS A;  4YTN B;  4IC7 B;  2INC C;  2N1W A;  4S17 A;  2D11 A;  1YMH E;  3T3O A;  3PLV A;  1EM7 A;  5HFY A;  2R61 A;  1DGJ A;  3D32 A;  4PK1 A;  4KX6 B;  1HMU A;  4FHJ A;  3E33 B;  4KSL C;  2LUE A;  5E6J A;  3ZW3 A;  2KYW A;  1A70 A;  1ZXH A;  4LNG B;  2RI8 A;  3KVF B;  3M7L A;  4KDL B;  4Q88 A;  2A73 B;  3RMK C;  1WSP A;  4LIX A;  3KYC D;  3B0A A;  2OKX A;  5KHO A;  3A4R A;  3P4Q B;  2YLM A;  2K9X A;  2ZVO A;  1ZDV A;  3RUL A;  3B9J A;  4YXD B;  1P3Q U;  1KLG D;  3PZ7 A;  1TNY B;  3S4D A;  1UMP A;  3SFX B;  5E6O A;  2ZCC A;  1H3B A;  1I8Q A;  3K9O B;  2PTL A;  1GXN A;  3WAL A;  1LF9 A;  4BBN C;  2G0D A;  2WY7 A;  4ZYN A;  1TTN A;  2BTE A;  2L1A A;  3L10 B;  2AHF A;  5L95 C;  2LGX A;  2VZK D;  2RPV A;  3HUI A;  1LFD A;  4II3 B;  4W9K A;  2KFK B;  1HE8 A;  4WJN A;  5JHB A;  1SJH D;  2ONH A;  1HXY D;  2GZ6 A;  2DNF A;  2WS3 B;  1QOA A;  4RNQ A;  3IG3 A;  4AWJ A;  1S64 B;  1D3Z A;  4JWU C;  2NVU I;  5ILZ A;  2H6F B;  4A90 A;  1O6Q A;  2LGD A;  4NPN A;  1HZ6 A;  4DHZ B;  3QK0 A;  1MG8 A;  2IGH A;  3S2A A;  3W2D A;  4C4V A;  4MGZ E;  4KGR A;  1LGR A;  2WXP A;  1NXC A;  2WXQ A;  3DBL B;  4TV3 A;  2J0M A;  4V1R A;  1SJE D;  3Q8F A;  3HHM A;  1ISN A;  1XCT L;  4MMH A;  3TJP A;  5H92 C;  1WXA A;  2GBK A;  2ZW0 A;  3TIX A;  1XQQ A;  2CJN A;  2WXG A;  1F1H A;  4GTO B;  4XWT A;  4ZRQ A;  1F2R C;  2KLC A;  2H88 B;  5G2N A;  3SR6 A;  3T8M A;  1GHQ A;  2MH7 A;  4HEA 1;  1SE2 A;  2UWQ A;  1N23 A;  4MSM B;  4NJ7 A;  1I35 A;  4V1S A;  5FR6 A;  1L6V A;  4GGQ A;  3BYY B;  1T0Y A;  1ET9 A;  4LNV A;  4HPM B;  2Z0D B;  5D3D A;  1FMI A;  3PRM B;  3PHX B;  4NQL B;  5CD2 A;  2KJ6 A;  2RPQ A;  3AFJ A;  2DYB A;  3L4P A;  1H14 A;  1HXC A;  2QC8 A;  2ZIS B;  3SDT A;  2GI9 A;  3O13 A;  1WXM A;  4ASW C;  1S63 B;  3Q14 C;  3X0W A;  2FE8 A;  4US9 A;  4RCO A;  3SAE A;  1LD8 B;  1MVK A;  3KSQ B;  5IO9 A;  4PT5 A;  1HX9 A;  2RD0 A;  2DWQ A;  4XZ4 A;  3RPF C;  3DSV B;  3RZW C;  1MHH E;  2H6G B;  1JAL A;  1GAH A;  4DHJ D;  1FT2 B;  5E2J A;  3TBL D;  5DCN A;  1TNU B;  4B95 A;  2JRH A;  4IG7 B;  2Z8L A;  2LGI A;  1YJI A;  3OED A;  3PZ1 B;  1ZUD 2;  1QSJ A;  3G6J B;  4YSX B;  4KDI C;  4D4A A;  4F13 A;  4MEL A;  4GXB A;  4XGA B;  5AUI A;  4K3C A;  4LNB B;  1JCK B;  3CU7 A;  1J8C A;  4LNN A;  2BGF A;  4IWQ A;  3FC4 A;  4ACF A;  3BY4 B;  1YIW A;  2Y5P A;  2ZPY A;  1J0G A;  1MFW A;  3IBE A;  3M62 B;  5KHQ A;  1N22 A;  2W3S A;  3VXD A;  1ZDX A;  2FCS A;  4HVB A;  2QEJ C;  5FK9 C;  2D3C A;  2KTR A;  4TMA B;  1KSD A;  1N7R A;  3AE8 B;  2BT6 A;  4ZHP A;  3ZJV A;  1E10 A;  5G55 A;  1VZ8 A;  2V4L A;  4I6N B;  1SIF A;  1BXT A;  3P63 A;  5GW7 A;  2OOB B;  3DBH B;  3U4E G;  3DPD A;  4FBJ B;  2Y3A A;  1V5C A;  1JRO A;  4H2A A;  3PV1 A;  4YSZ B;  1QIL A;  3BK2 A;  4YDO B;  3U30 A;  1I4Q A;  1EWC A;  2G4D B;  1KLV A;  4FUL A;  3SFE B;  2PLP A;  1T6B X;  3OLM D;  4G50 A;  3ZRC A;  3VTV A;  2AQ3 B;  1ET6 A;  1RWH A;  2FIF A;  2MCN B;  2RDG A;  1K52 A;  1WMH A;  3UF8 A;  1I42 A;  4JL9 A;  2ZCB A;  1H3A A;  3M76 A;  4ZH1 A;  1TY0 A;  1AYX A;  1TIF A;  2HTM E;  1BT0 A;  3Q8E A;  2Z07 A;  1WE7 A;  3W7S A;  1WMH B;  1XWT A;  2QHO A;  4W9H A;  3M74 A;  1OJM A;  1O79 A;  3ON6 A;  1KF6 B;  1WGD A;  5EE9 A;  2JJB A;  3PZD A;  2KMA A;  2N7D A;  3ML9 A;  5AZF A;  2WDQ B;  1WGH A;  2JZ3 B;  3IVF A;  4YTM B;  1O6H A;  3PS6 A;  1WX9 A;  1FMA D;  2EAC A;  2MHJ A;  4GSW A;  1KZO B;  3PZ3 B;  3AE2 B;  2CS4 A;  2Z0E B;  1K50 A;  1GB4 A;  1H35 A;  3ZQ4 A;  4K3B A;  5CZL A;  3DOW A;  3DDC B;  2N4F A;  2GH4 A;  5BO4 B;  4GN1 A;  1F9D A;  1X1H A;  2O2V B;  1VD2 A;  4IKG A;  3HXE B;  1JCQ B;  1GUA B;  4K7S A;  1X1I A;  3M72 A;  4D4C A;  3DVG Y;  3QG0 A;  3ZDM C;  4R3D A;  1HM3 A;  2WXR A;  3RNG C;  2K0P A;  4EEW A;  1VZ7 A;  1LTX B;  3BK1 A;  4A20 A;  4A3P A;  3SDL C;  4RM8 A;  1HMW A;  5GXG B;  3BZD B;  4EZL A;  3PZ2 B;  3R2I A;  3G4F A;  3EUB 2;  4HJK A;  2KWV B;  2FUT A;  4A9A A;  1WZZ A;  4C7Y A;  2G02 A;  1HA5 A;  5ILI A;  3ANI A;  4BVU C;  3Q3F A;  3VUX A;  2IBI B;  3T9L A;  2PN5 A;  3NG0 A;  5JHA A;  1CMX B;  2WXH A;  2WNM A;  3RSY A;  5IOI A;  3OJ4 B;  4C1S A;  5DHI A;  1O6R A;  2G3Q B;  2WII B;  1FD6 A;  1WR1 A;  4J3O D;  2SEB D;  3H2W A;  2LWP A;  2KO3 A;  1VJK A;  4RMA A;  5IKA A;  2KOX A;  1F52 A;  5G5G A;  3I9V 1;  3B1L X;  3VSN A;  2RGK A;  3GT5 A;  3A9J A;  4A3O A;  2VN7 A;  3P4R B;  4RGN A;  4YDE B;  2DHZ A;  3W1Y A;  3J9C A;  2D2Q A;  3DHI C;  3ETR A;  1SIJ A;  3DHG C;  3GE3 C;  4WJP A;  3E7J A;  5EAT A;  4YWG G;  3ZKJ C;  3MP9 A;  1L1Y A;  2JZZ A;  5ILK A;  1QOG A;  5JH5 C;  2N9K A;  4W9D A;  3EQA A;  3QA8 A;  2AYO B;  1H39 A;  2KFK A;  1V8C A;  5EAS A;  1C78 A;  3CWI A;  1J7A A;  1RAX A;  3ALB A;  1C9F A;  1NVI D;  1H4R A;  1KS8 A;  4Z4J A;  3IXS A;  4GOC A;  1FEH A;  4CQN A;  1YNT E;  2DZI A;  3PGE A;  3N0G A;  1XXG A;  2K8B A;  3SDV A;  2ZBL A;  3VHT C;  1KOT A;  3OXU A;  2N7J A;  3BVM A;  3RT3 B;  1RWC A;  1ROE A;  3IT6 B;  5LXI B;  1MG4 A;  3AU5 A;  2EKI A;  3X23 A;  4LNK A;  1J7C A;  1V5T A;  3PYA A;  3TEZ A;  3S9V A;  3AB5 A;  4CO7 A;  2KHW B;  3M75 A;  5HI1 A;  4GDL A;  1WU4 A;  4ICU A;  2ZIR B;  1Y56 A;  1EUV B;  1Q0W B;  4KIK B;  1I4X A;  3TEY A;  3W5M A;  3LDZ E;  1K8R B;  4PYZ A;  5AZH A;  4IM0 A;  3NJT A;  2MBQ A;  2LJI A;  3E9S A;  4E1Y A;  4AYR A;  3IHP C;  2WDR B;  2YVC A;  4HCN B;  4MAC A;  2KT7 A;  1FCC C;  1YX5 B;  2RDH A;  1V6E A;  1C79 A;  1TZO A;  2K3U A;  3RNF C;  3ZTC A;  1UG9 A;  5CX3 A;  3RZF A;  4EL8 A;  1N4P B;  5IN7 A;  3O65 B;  1FO2 A;  2JUO A;  2BS2 B;  2WDA A;  2WWZ A;  4N9F 4;  3ZGZ A;  2NCN A;  1I4G A;  4MBG B;  1ZW7 A;  3MJ5 A;  2XWJ B;  3AM9 A;  1XLP A;  4GTT B;  2WP9 B;  1TNZ B;  2RI9 A;  3H7L A;  1RWS A;  1WXV A;  5C2T B;  4LDT D;  4LNO A;  1VR9 A;  4GDK A;  1QT9 A;  4W9I A;  1CLC A;  1OJO A;  4OK2 A;  5IL3 A;  1Z2M A;  4WQM A;  3UIO B;  1N20 A;  1SXT A;  4DOE A;  2AWT A;  3AH7 A;  3QXQ A;  3KWV A;  1C1Y B;  1UD7 A;  4MSQ B;  4MGK E;  1BUI C;  3RRS A;  1JRP A;  4AYP A;  4ZRK A;  3WC3 A;  4FAD A;  4F1S A;  3WCQ A;  2HJ8 A;  1NC5 A;  3VXW A;  4DDG D;  2KQS A;  1RW9 A;  1SA5 B;  3SU8 X;  3Q69 A;  5GMV A;  1TZ1 A;  3NZU A;  2FUG 1;  1N21 A;  3VVW B;  4WQO B;  3NUH B;  1E8W A;  3LB8 C;  2J7Q B;  2KD0 A;  2DZK A;  3DHH C;  3NVZ A;  2HJ1 A;  1WE6 A;  1EO6 A;  3A4S C;  3AEB B;  4W9C A;  3WAM A;  4TF4 A;  4WVB A;  3JYU A;  2I2Y A;  4FXG B;  3DQV A;  3P42 A;  3VTU A;  1WI0 A;  3AN1 A;  5JPN B;  3VR9 B;  2EMS A;  2AL6 A;  2W55 A;  3KW5 B;  2J53 A;  4DQO C;  5JXV A;  2DLB A;  3NVV A;  3GLY A;  3WAP A;  2EEL A;  1WJ6 A;  1VRA B;  2KJR A;  2KVR A;  1KRF A;  1V80 A;  3HK0 A;  4RNA A;  2PVG C;  4MGI E;  1IBX A;  2PEA A;  2C9W B;  5BYS A;  3WKG A;  2G4S A;  1GC7 A;  2Y5B B;  4DOD A;  1CJE A;  1V7V A;  3W7T A;  2HDE A;  2V4I B;  3SD5 A;  5D2M B;  1LXD A;  1V7X A;  2NVP A;  1TT5 B;  1B9R A;  3AED B;  3Q2A C;  1C4C A;  3AMZ A;  2BRV X;  4GDL B;  1WRI A;  4MMI A;  3QSP A;  1C77 A;  2BYT A;  2PKO A;  4ONT A;  4NAW A;  1IGC A;  4II2 B;  2ON8 A;  5E6P A;  1WJN A;  1W6K A;  4F8C B;  3WIW A;  2KAN A;  5HG2 A;  1C4P A;  1KRE A;  2EKE C;  1Z5S B;  1NL4 B;  1V7W A;  3PSE B;  1F0Z A;  4MT5 A;  1GA2 A;  3DCG A;  1H8C A;  4KSK C;  2O6V D;  5C05 A;  4KZ0 A;  4W9F A;  2X8X X;  4K7W A;  5LXH A;  2FCN A;  3AEE B;  1UGJ A;  2CQS A;  1TNB B;  3AE4 B;  3W7U A;  4HWI B;  2FUH B;  4M02 A;  4BOS C;  2JF5 A;  1KZP B;  1DL2 A;  1JS4 A;  1D5Z C;  1FNU A;  4KV2 A;  4TQ0 A;  3AE9 B;  1FT1 B;  5FR3 A;  5CTR C;  3UGB B;  5FO7 B;  2L7R A;  2CHX A;  2IO3 B;  2JYE A;  1WGG A;  1RRB A;  2P0V A;  2BRP A;  1NDD A;  4RH6 A;  5EE1 A;  3KLS X;  1N61 A;  3IAS 1;  4KTP A;  1EWY C;  1H12 A;  3VTW A;  4G11 A;  3DBR I;  3R7R A;  3IFW B;  2Y5C A;  2J4X A;  4L23 A;  3DPY B;  4YSY B;  5G5H A;  2XK5 B;  2WHI A;  3WKF A;  1KRH A;  3GE8 C;  2R2L B;  2V8K A;  1G6J A;  2ZNV B;  2JY6 A;  5D94 A;  1TY2 A;  2MX2 A;  2WXO A;  5AZG A;  1FXA A;  2ICI A;  2LHD A;  3OWE B;  4NQK E;  4A8X C;  5TSS A;  2KQ4 X;  2M0A A;  5D7G A;  1Q1O A;  3QHT A;  2DAF A;  1N4Q B;  3V6E B;  4ZH5 A;  2CR5 A;  2KTR B;  2PJH A;  1AW7 A;  2FV1 A;  1YJ1 A;  2AFA A;  3EFC A;  2FAZ A;  2BED B;  1KSC A;  3ZVV A;  1N95 B;  1SGH A;  4AYO A;  3WAO A;  4ZOH C;  3WUX A;  2QSD A;  1TN8 B;  2LI5 A;  3ZNZ B;  1YQ4 B;  1UT9 A;  3KLS A;  2JQR B;  2BS3 B;  3NNB A;  1FP3 A;  1D5M C;  4LNI A;  3A1Q A;  4RF1 A;  2JF4 A;  2W3R A;  3Q3N C;  1WX7 A;  2DZM A;  1DYQ A;  2E24 A;  1XCQ L;  4J6I A;  1TBE A;  2CKH B;  4D4D A;  2KWC A;  1OQR A;  5CHV C;  5IKC M;  3C8Y A;  2HE7 A;  4QT9 A;  1OGW A;  5C23 A;  2KDE B;  2PE9 A;  4WWN A;  1P9D U;  3P2C A;  4AOF A;  1F9J A;  3RX8 A;  2BVC A;  2FUZ A;  3QXF A;  3WA0 A;  3M02 A;  3I5J C;  4BAX A;  3GZN B;  1O1S B;  2BYF A;  5D6J B;  1JWA D;  1L7Y A;  3ZTD A;  1HQR D;  4L6X A;  2K22 A;  4M00 A;  4IDI A;  2BWF A;  2BB6 A;  4MEM A;  4XE0 A;  3V05 A;  1M94 A;  1R4M B;  4LDT B;  1YD8 U;  4HXD A;  4NNJ B;  5IK9 A;  1FXI A;  5I4D A;  3KUC B;  4IW0 A;  2CHZ A;  4XWW A;  1P1A A;  1C4A A;  2KLG A;  2WX0 A;  3AUL A;  3KQ4 A;  2R2Q A;  2MBB B;  1RQ5 A;  3APF A;  2I1K A;  3VH3 B;  1WY8 A;  4M8N A;  5IK6 A;  1L2N A;  4ARI A;  2K8H A;  3RNB C;  2MBO A;  3KSL B;  1ACC A;  4M0W A;  3WKH A;  2KNB A;  1V5D A;  1G6I A;  3Q6B A;  1FFU A;  4US8 A;  5ILY A;  2MA9 B;  4WUR A;  4GTR B;  1F77 A; 
#chains in the Genus database with same CATH homology
 3W9C B;  1UNS A;  4C1S A;  4N59 A;  3DSW B;  1O6R A;  2WII B;  2BB5 A;  1IA7 A;  1ESF A;  1UWX A;  2SEB D;  3IAM 1;  3H2W A;  4J3O D;  1X9D A;  1UWM A;  4NZL B;  1VJK A;  2WXI A;  1ZP0 B;  3GZK A;  3RX7 A;  2CQT A;  1FCE A;  5BMH A;  3SFE B;  1T5X D;  3DST B;  3AEA B;  1HZ5 A;  1R76 A;  2V8J A;  4XDC A;  1WYG A;  4L2Y A;  3EU5 B;  3AE7 B;  1CZP A;  5G5G A;  3I9V 1;  3E56 A;  2WDV B;  1PUT A;  1GB1 A;  2NTT A;  1JW9 D;  1IA6 A;  5HHD G;  2RGK A;  3GT5 A;  3AEC B;  4N58 A;  2G9H D;  1QQR A;  1O1R B;  1XWQ A;  1PGA A;  2VN7 A;  1K53 A;  2B4F A;  3QPF A;  3Q7F B;  2IPK D;  3P4R B;  3PO0 A;  1FRD A;  1JCS B;  4RGN A;  4DXG A;  4FXK B;  4YDE B;  4JX1 C;  1I4R A;  3M73 A;  2EAE A;  1TKG A;  1CEM A;  1HEZ E;  1H54 A;  1KTK A;  3M78 A;  1RYJ A;  1GXO A;  1B1Z A;  3B2G A;  3J9C A;  3NVW A;  2WYN A;  4GTV B;  1D6E C;  1SIJ A;  3EA6 A;  3ETR A;  1STE A;  4REZ A;  4WH4 A;  5DGQ A;  2J52 A;  3TEX A;  3Q8B A;  1C76 A;  1E9M A;  3E34 B;  4GTQ B;  2MJ3 A;  4YCR A;  1PGB A;  3EU8 A;  5JPM B;  4YWG G;  3HXC B;  5C3J B;  1HZF A;  3RX5 A;  3TF4 A;  2D5G A;  3MP9 A;  1L1Y A;  4ZG8 A;  2LUM A;  1I7H A;  1WXQ A;  3K7X A;  1K72 A;  4RF0 A;  2KDM A;  1QOG A;  3W7X A;  4LTU A;  4XUV A;  2N9K A;  1XEE A;  2IDY A;  4C80 A;  3PYB A;  3EQA A;  2N9L A;  2RMM A;  3VRA B;  1TKE A;  2DYO A;  1IUE A;  1H39 A;  1D5X C;  2KMM A;  1JWU D;  1JML A;  2DRO A;  1V8C A;  1C78 A;  4Z4L A;  2W82 A;  3CWI A;  3MC0 B;  4LLG M;  1J7A A;  4MH8 A;  1CK1 A;  3VW5 A;  1FNW A;  2ZZR A;  1SBB B;  2KAJ A;  4YTP B;  3ZYY X;  1C9F A;  1NVI D;  2V3P A;  1KS8 A;  2E3T A;  4OZC A;  4HJG E;  4Z4J A;  2BW2 A;  3IXS A;  4ZRP A;  4WAF A;  2B39 A;  1FEH A;  4CQN A;  1YNT E;  4TQ1 A;  2GB1 A;  3EUV B;  3HXB B;  1AYF A;  1XXG A;  3C72 B;  3SDV A;  2ZBL A;  4P16 A;  3DWG C;  3OXU A;  2N7J A;  3BVM A;  1QQF A;  3WIR A;  2XN9 C;  2WLB A;  1ROE A;  2WU2 B;  2AHG A;  3K11 A;  2LFI A;  1FAE A;  3IT6 B;  3WKI A;  5KKB A;  1TNO B;  2EKI A;  4HRS A;  1J7C A;  3PYA A;  3TEZ A;  3HXD B;  3S9V A;  2DYM A;  3AB5 A;  3QT9 A;  3PZ8 A;  3QFY A;  2WXJ A;  3M7E A;  3U52 E;  1LD7 B;  1DOG A;  4NJC A;  2WQY B;  3TSS A;  1XO3 A;  3M75 A;  2JWU A;  1D4B A;  5HI1 A;  5BMG A;  1WU4 A;  4B0M A;  1N62 A;  3BWU D;  2ZIR B;  3M7C A;  3E6U A;  1Y56 A;  2KAC A;  2WXM A;  4JE3 B;  1VZ6 A;  3PZ4 B;  4BOK A;  4KGT A;  1H36 A;  1I4X A;  4B0E A;  3W5M A;  2QIE B;  3TEY A;  1LF6 A;  1PGX A;  3DSU B;  3D5S A;  4WIP A;  2WY8 A;  1XLN A;  3NRZ A;  1TN6 B;  1E7P B;  3P4S B;  3GB1 A;  1N5X A;  4WVC A;  2LJI A;  3LYY A;  1N63 A;  5H8Y E;  4GTM B;  3QT3 A;  4GTP B;  3E9S A;  3EGR A;  1F9O A;  1LO5 D;  4AYR A;  4WVA A;  3NS1 A;  1ZOY B;  2WDR B;  1YN5 A;  3H8H A;  4AYQ A;  4MU9 A;  2D5J A;  3SQC A;  3GP7 A;  2WXK A;  4MAC A;  2V3N A;  3I57 A;  5BMI A;  1FCC C;  4GLS C;  1ZPS A;  1PFD A;  2RDH A;  1C79 A;  2YEP F;  1TZO A;  2K3U A;  1GLM A;  1UG9 A;  1FBO A;  1J7B A;  2MJE A;  2DRS A;  5DGR A;  3M7B A;  4YTN B;  1BML C;  1DCE B;  4EL8 A;  1IGD A;  1N4P B;  2F6D A;  1FO2 A;  3REN A;  5CA3 A;  2BS2 B;  1WWT A;  1NEK B;  2FV0 A;  2V8I A;  1YMH E;  4J5T A;  1R7S A;  5D3I B;  3TUO A;  2NMQ A;  2J42 A;  3T3O A;  1I4G A;  4MBG B;  2ONQ A;  4EHM B;  3ACT A;  1EM7 A;  5HFY A;  5EE3 A;  2H89 B;  2GOX A;  2TSS A;  2R61 A;  3MJ5 A;  1QKZ A;  3P1M A;  1DGJ A;  3Q7A B;  2IEJ B;  2W54 A;  1IS9 A;  2A8Z A;  2XWJ B;  3AM9 A;  5MEH A;  3VRB B;  1XLP A;  4GTT B;  4KX6 B;  2WP9 B;  4RGT A;  3H3K A;  1GPX A;  3DSS B;  1TNZ B;  1QOF A;  1NEN B;  2RI9 A;  3H7L A;  1RWS A;  5C2T B;  4C56 C;  3E33 B;  2K5P A;  1N4R B;  5E6J A;  1VR9 A;  4CJ1 A;  1QT9 A;  4JWS C;  1A70 A;  2L32 A;  3GS2 A;  2PMV A;  1ZXH A;  1CLC A;  2RI8 A;  4LNG B;  3W5N A;  2L52 A;  4HKZ E;  1O5M B;  4N6E B;  5LNK 1;  5T8I A;  3M7L A;  1SE4 A;  4OZB A;  3BVZ A;  4Q88 A;  2JYT A;  1N5W A;  2A73 B;  1O1T B;  4JJJ A;  4NAM A;  1VD5 A;  4WQM A;  3AE5 B;  2MJD A;  1WSP A;  4LIX A;  3PMM A;  2KN4 A;  3P5R A;  4DOE A;  1GAI A;  1SXT A;  3QXQ A;  2OKX A;  3AH7 A;  2AQ1 B;  4NAW B;  5BYR A;  1TS5 A;  3R8B A;  3KWV A;  1CQV A;  5M7I A;  1BUI C;  3P5P A;  3DWM A;  3TEW A;  3RRS A;  3P4Q B;  4KKI A;  1JRP A;  4Q2J A;  3U7Z A;  2K9X A;  3MFG A;  3AEF B;  2BS4 B;  3A3V A;  3RFZ B;  4AYP A;  1ZDV A;  3B9J A;  4YXD B;  4KKJ A;  3WC3 A;  1P7F A;  1KLG D;  1XW2 A;  2F0Y B;  3NVY A;  3WCQ A;  3PZ7 A;  1NC5 A;  4FUS A;  1TNY B;  2L83 A;  2V0G A;  3S4D A;  1UMP A;  3SFX B;  1JWB D;  3QRY A;  1SA5 B;  3P4P B;  4DXF A;  1H3B A;  2JSV X;  3Q69 A;  2PTL A;  1G9J A;  2FUG 1;  2ZW1 A;  3FAH A;  1GXN A;  4UDU C;  2IJ0 A;  3NUH B;  3FIL B;  1KFG A;  1LF9 A;  3LB8 C;  2G0D A;  2WY7 A;  1UUP A;  3KWL A;  4OHJ A;  1RM6 C;  3NVZ A;  4L0G A;  2OED A;  2BTE A;  1YJJ A;  2L1A A;  3AEB B;  1D8D B;  1V1P A;  2AHF A;  3QFZ A;  4TF4 A;  4WVB A;  1IBX B;  5AUK A;  2I2Y A;  2SAK A;  2RPV A;  2VZK D;  3SFD B;  4FXG B;  3HUI A;  3P42 A;  3VR9 B;  3AE1 B;  3AN1 A;  4BOJ A;  1H37 A;  1ULV A;  5FO8 B;  5JPN B;  2D8L A;  3M77 A;  1FFV A;  2AQ2 B;  2JX5 A;  1SJH D;  2W55 A;  1HXY D;  2GZ6 A;  1N9A B;  2WS3 B;  4EE2 A;  2YEP B;  1QOA A;  2XWB B;  1TN7 B;  4RGM A;  2J53 A;  4DQO C;  5JXV A;  2DLB A;  1S64 B;  1OFF A;  1TS2 A;  1TS3 A;  4JWU C;  4OVZ A;  3NVV A;  1AN8 A;  2QNO A;  4AS1 A;  4LK0 M;  2H6F B;  4GL3 A;  3GLY A;  4A90 A;  1O6Q A;  1YN3 A;  1HZ6 A;  2EEL A;  3V3X A;  1VRA B;  2IGH A;  3W2D A;  4WU0 A;  2Q5W D;  1KRF A;  1AWD A;  4KGR A;  1SB3 C;  3FIL A;  1GXM A;  2WXP A;  1NXC A;  1GAQ B;  2PVG C;  1ENF A;  2AX5 A;  2PVO D;  2WXQ A;  4RNA A;  1IBX A;  4V1R A;  1SJE D;  2GRI A;  5BYS A;  3X17 A;  2OHF A;  3Q8F A;  3Q78 B;  3WKG A;  1XCT L;  3ABV B;  3VR8 B;  5H92 C;  2FBA A;  1N4S B;  4DOD A;  3LXF A;  2ZW0 A;  1CJE A;  1NYR A;  2CJN A;  4TSS A;  1V7V A;  3W7T A;  2HDE A;  2WXG A;  2V4I B;  4TQ0 A;  1FD6 A;  4GTO B;  4XWT A;  4ZRQ A;  1TF4 A;  1V7X A;  2YIK A;  3S4B A;  1F2R C;  2WXL A;  2NVP A;  3SR6 A;  1VLB A;  2H88 B;  1B9R A;  4KGS A;  1GHQ A;  2EAB A;  1K51 A;  2MH7 A;  1MHX A;  3E73 A;  3AE6 B;  3AED B;  1C4C A;  1MI0 A;  3AMZ A;  1SE2 A;  3RJ3 A;  4GDL B;  4HEA 1;  2DRR A;  2NTS A;  1WRI A;  3QSP A;  1JCR B;  1AGM A;  1X81 B;  1C77 A;  3ANK A;  2BYT A;  2SQC A;  2PKO A;  4ONT A;  2ACZ B;  3D5R A;  4V1S A;  1IGC A;  3Q73 B;  1D8E B;  3W5V B;  1L6V A;  3BYY B;  4D2K A;  1TS4 A;  1ET9 A;  2ON8 A;  4LNV A;  3IT4 B;  1W6K A;  2X38 A;  3WIW A;  5D3D A;  1FMI A;  2FBW B;  3DRA B;  1C4P A;  1KRE A;  5HG2 A;  3ZJT A;  3W1S A;  1QF6 A;  1NL4 B;  5CD2 A;  2WXF A;  4HRO A;  1FBW A;  3AFJ A;  1L0V B;  1GOZ A;  2XNA C;  3L4P A;  1V7W A;  1H14 A;  1F0Z A;  4MT5 A;  3AEG B;  1GA2 A;  5BYQ A;  1MZC B;  2ZIS B;  1SE3 A;  4OW0 A;  3T3N A;  3SDT A;  2GI9 A;  1KH0 A;  3O13 A;  2E6X A;  1S63 B;  3D3I A;  3AEE B;  2FE8 A;  2BBC A;  2CQS A;  1KWF A;  1UGJ A;  4RCO A;  4US9 A;  3SAE A;  1LD8 B;  1MVK A;  1TNB B;  3KSQ B;  4M76 A;  3AE4 B;  3W7U A;  4PT5 A;  1KZP B;  1DL2 A;  4D4B A;  3UI3 A;  1JS4 A;  1D5Z C;  1FNU A;  1L0Y B;  1L6U A;  3E32 B;  2DWQ A;  3DSV B;  2QIL A;  4CJ0 A;  1FRR A;  1MHH E;  3AE9 B;  3RPF C;  2H6G B;  3NZ3 A;  1FT1 B;  1JAL A;  1GAH A;  5FR3 A;  4L9P B;  1NYQ A;  1SQC A;  3Q79 B;  1EU3 A;  3W5U B;  1FT2 B;  4AQ7 A;  5E2J A;  2DBY A;  1TNU B;  3HRD D;  2XQW A;  5FO7 B;  3BII D;  1N94 B;  3Q75 B;  4GDK B;  1V97 A;  2Z8L A;  3SEB A;  2JYE A;  2LGI A;  5AGD A;  1L5P A;  1YJI A;  1FO4 A;  3OED A;  1GSZ A;  1WU5 A;  2P0V A;  1M4V A;  2PW9 A;  1L4Z B;  3PZ1 B;  1I4P A;  4RH6 A;  4D94 A;  5EE1 A;  4HKQ A;  1ZUD 2;  1QSJ A;  3G6J B;  4CE7 A;  4YSX B;  2INN E;  2WXN A;  3KLS X;  1N61 A;  1KFY B;  4D4A A;  1VDV A;  4KTP A;  3IAS 1;  2B76 B;  1EWY C;  4FXC A;  5AUI A;  1H12 A;  4LNB B;  1JCK B;  3CU7 A;  2Y5C A;  2J4X A;  4L23 A;  3DPY B;  2JU6 X;  4YSY B;  3WIQ A;  3FC4 A;  5G5H A;  3WKF A;  2Y5P A;  1KRH A;  2R2L B;  2V8K A;  1XLO A;  3SDR A;  1TY2 A;  2WXO A;  3Q8A A;  1FXA A;  4ITK A;  2ICI A;  1WGK A;  1XF5 L;  3VXD A;  2W3S A;  2LHD A;  5GZK A;  1ZDX A;  3OWE B;  5GY3 A;  4A8X C;  5EE0 A;  5TSS A;  2KQ4 X;  2QEJ C;  3DSX B;  1KLU D;  3S4C A;  5FK9 C;  2M0A A;  4RFB A;  1E6E B;  4TMA B;  1L0X B;  3N9Y C;  5D7G A;  1KSD A;  3MHZ A;  3SDU A;  3AE8 B;  4RGO S;  3B2F A;  3VQI A;  1NI3 A;  2BT6 A;  4ZHP A;  3Q8C A;  3ZJV A;  1N4Q B;  3URY A;  4A55 A;  1E10 A;  3S4A A;  4ZH5 A;  1VZ8 A;  2LHE A;  1I4H A;  3E37 B;  1AW7 A;  2FV1 A;  3HVZ A;  4P6V F;  3HVD A;  2AFA A;  2MEK A;  1BXT A;  2BED B;  3P63 A;  5GW7 A;  2WU5 B;  1KSC A;  3U4E G;  1MPE A;  1WU6 A;  2I07 B;  2JG0 A;  1N95 B;  1V1P B;  2VZK B;  4AYO A;  1PDX A;  2Y3A A;  1V5C A;  1JRO A;  1SSN A;  2DRQ A;  1QLB B;  3WUX A;  4H2A A;  4ZOH C;  2QSD A;  1QIL A;  4YSZ B;  1SA4 B;  1TN8 B;  3BK2 A;  4YDO B;  1I4Q A;  1EWC A;  3ZGZ A;  1JWM D;  1UT9 A;  1YQ4 B;  2PLP A;  2QJL A;  1G87 A;  3KLS A;  4GTS B;  1T6B X;  2JQR B;  2BS3 B;  5MPO A;  1FP3 A;  1D5M C;  4JPS A;  3U2S C;  1T3Q A;  4RF1 A;  3ANJ A;  2AQ3 B;  2JF4 A;  1ET6 A;  1EU4 A;  2W3R A;  3AV8 A;  1FM0 D;  2RDG A;  1K52 A;  1DYQ A;  1XCQ L;  1JQ4 A;  3AE3 B;  2CU3 A;  3ACS A;  4ARC A;  1V1O A;  2INP E;  4MM3 B;  3EZ8 A;  4ZHO A;  1H3A A;  3M76 A;  4ZH1 A;  1TY0 A;  1QBQ B;  4D4D A;  1AYX A;  4TXT A;  2WIN B;  2HTM E;  1DOX A;  3Q8E A;  2Z07 A;  1OQR A;  3W7S A;  3C8Y A;  1L4D B;  1HCU A;  3HXF B;  2H6H B;  4QT9 A;  1XLQ A;  1XWT A;  1FNV A;  3P2C A;  1PYW D;  3M74 A;  1O79 A;  3ON6 A;  3RX8 A;  1KF6 B;  3QDE A;  2FUZ A;  3BVG A;  3QXF A;  1SEB D;  5EE9 A;  4IOI E;  5FKA C;  2JJB A;  1E0Z A;  2I38 A;  3T33 A;  1YQ3 B;  2WDQ B;  1O1S B;  5M7Y A;  4YTM B;  3QWT A;  1JWA D;  2LMC A;  2LEK A;  1O6H A;  4L6X A;  1FIQ A;  1HQR D;  2K22 A;  4OZA A;  4ZYS A;  4IDI A;  1FMA D;  2EAC A;  1ZXI A;  2JXT A;  1H13 A;  1KZO B;  3PZ3 B;  3AE2 B;  1YN4 A;  1K50 A;  1ZE3 D;  1QOB A;  4XDD A;  2BB6 A;  3M71 A;  4XE0 A;  1NI1 B;  3V05 A;  1GB4 A;  1H35 A;  4C7Z A;  1DOY A;  3ZQ4 A;  1L2A A;  5CZL A;  1FXI A;  3SFY B;  1FPP B;  1SF0 A;  5I4D A;  1DOI A;  1FO3 A;  2GH4 A;  1N60 A;  2VN4 A;  2H6I B;  1KKT A;  1W6J A;  1F9D A;  4XWW A;  4L1B A;  3CIR B;  4IKG A;  3HXE B;  5FOB B;  1C4A A;  1JCQ B;  4Q2B A;  2NOJ A;  2XFG A;  5FO9 B;  3KQ4 A;  3M72 A;  4D4C A;  1F2R I;  3QG0 A;  4R3D A;  1C3D A;  1RQ5 A;  2WXR A;  2K0P A;  3BYT B;  3SDQ A;  1TYG B;  1VZ7 A;  1LTX B;  1TJE A;  2KWD A;  2PIA A;  1FCL A;  1P7E A;  1RFK A;  2JZP A;  2G1E A;  4A6Q A;  3BK1 A;  4KTR A;  4ARI A;  1OQQ A;  3ZJU A;  1TKY A;  5GXG B;  2M56 B;  3BZD B;  4WWM A;  3PZ2 B;  3CIH A;  3R2I A;  2M19 A;  2N0S B;  3KSL B;  1ACC A;  3EUB 2;  4M0W A;  4A9A A;  4USA A;  1WZZ A;  3WKH A;  2EAD A;  1H3C A;  1G6I A;  1V5D A;  2G02 A;  1HA5 A;  4C7Y A;  3ANI A;  3R2T A;  1FFU A;  4US8 A;  3E30 B;  1G9G A;  2PN5 A;  1Q10 A;  2QMT A;  4YT0 B;  1JWS D;  2WXH A;  4O1N A;  4WUR A;  4GTR B;  3RSY A;  2CJO A;  2WNM A;  2IGD A;  1F77 A;  3W7W A;  2IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...