2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Gastric intrinsic factor
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
1H37A 1S63B 2ZIRB 3D5RA 4D4AA 2H6GB 1O6RA 4BOKA 4D4CA 1FT1B 3E37B 1N94B 3DSWB 2PMVA 3Q75B 1W6KA 4V1RA 1MZCB 3Q73B 1R76A 1QSJA 1D8DB 2V3PA 1JCSB 1W6JA 3DPYB 3K7XA 1O1RB 4GTMB 5JPMB 3E30B 3SFXB 1FPPB 3HXDB 4ZRQA 4LNBB 1KZOB 3CU7A 4GTRB 1N9AB 3DSTB 3DSXB 1GXNA 3E32B 3E34B 1JCQB 1H39A 2V8JA 4KKIA 1LTXB 2A73B 1N4QB 3HXCB 1H35A 2WINB 1O5MB 4YDOB 2H6IB 4LNGB 1SA5B 1UMPA 4M76A 2BBCA 4ONTA 2I07B 3PZ1B 2XQWA 2V8IA 3PZ3B 1HZFA 4FXKB 4D4DA 2R2LB 1S64B 2NOJA 1TNBB 3OEDA 1H36A 1X81B 2G02A 5JPNB 1TNYB 1TN7B 2V8KA 3D5SA 4EHMB 1LD7B 4MBGB 2XWJB 3U7ZA 3G6JB 3DRAB 1O6HA 1H3CA 1TN6B 3EU5B 4D94A 2IEJB 5FO9B 2WY8A 3Q7FB 4ZH1A 4GTOB 3RJ3A 3PZ2B 4D4BA 1TN8B 1GXMA 2H6FB 3KQ4A 2BEDB 4GTVB 2G0DA 3Q7AB 1DCEB 3SFYB 2BB6A 4L9PB 1D8EB 5FO8B 3PZ4B 3Q78B 1NL4B 1SQCA 1N4SB 5FO7B 3HXEB 4ZRPA 3HXFB 4MU9A 3E33B 1N95B 4YDEB 1H3BA 2F0YB 1O1TB 1N4RB 1N4PB 1TNUB 3OXUA 1FT2B 1SA4B 4GTTB 4C1SA 3DSSB 2PN5A 1TNZB 5AGDA 2B39A 2ZISB 1GSZA 1GHQA 2XWBB 3Q79B 3HXBB 3DSUB 2SQCA 2GOXA 2WIIB 4GTPB 4FXGB 1O1SB 1O79A 3C72B 4GTQB 1H3AA 4KKJA 1JCRB 1QQFA 1C3DA 1LD8B 1NI1B 3DSVB 3KSQB 2V3NA 3KSLB 1TNOB 3SQCA 2H6HB 4V1SA 3KLSA 4GTSB 2WY7A 1GXOA 5FOBB 1QBQB 3EUVB 1O6QA 2BB5A 4BOJA 4LNVA 1KZPB
chains in the Genus database with same CATH superfamily
3M63B 2D5JA 4FXCA 3K11A 2KZRA 1HXAA 3VH3B 2H88B 2INDC 2IO2B 2WDRB 3MFGA 4HRSA 3Q75B 3C0RB 1ZPSA 2ZPYA 2K3UA 2O2VA 2FCNA 1KLVA 3AE1B 4C56C 5DHIA 3WA0A 3G4DA 3KWVA 1EGUA 2N1WA 5E2JA 5J17A 2KHWB 2PJHA 4JQWC 4II2B 4M0WA 2C7MB 4PS7A 3PZ8A 2K6DB 3A9KB 3GS2A 1XLQA 3BVZA 4JX1C 3PMMA 4FULA 1DOXA 1SGHA 3Q3FA 2BBCA 1GA2A 4ONTA 2BVCA 1JRUA 5AEKB 5C23A 1ZP0B 2HJ1A 2MJ3A 2B76B 3E7JA 1JMLA 4FJZA 3MHZA 3RPFC 3M76A 2W54A 4HCNB 1OFFA 4YXDB 4EHMB 3VSNA 3U7ZA 4BVUC 3TCAA 1WXQA 3MTNB 4WVAA 3L4PA 2Y3AA 1TN6B 1IS9A 3A9JB 3DWGC 2YLMA 2WXQA 5J2RA 1TN8B 1GXMA 3P4RB 3UINB 3IFWB 4OZWA 1AW7A 1YOVB 1EF1A 1SEBD 1CZPA 2BW2A 1E8ZA 1DOGA 1NL4B 1OJOA 1WYWB 1QAZA 1B1ZA 2JXTA 4DDID 4PT5A 3PYBA 2ZPNA 3ML9A 4OHJA 4NQKE 4C7YA 2AWTA 1GC7A 4XYCA 1TNZB 1R4NI 1GHQA 2A5UA 4AYPA 1XLOA 2WXRA 4IG7B 4J6IA 3VTWA 4CO7A 3WKFA 4RGOS 1SF0A 1KLGD 5DPTA 1XXGA 3EC8A 2LZ6A 5AUIA 1GAQB 4NPNA 1UWXA 2C9WB 1J7BA 1XW2A 1GB1A 4DHJD 2V3NA 1I42A 1WIAA 4EL8A 1HXCA 3BWUD 3WIWA 4HJKA 4GL3A 3PSEB 3W5VB 1TTNA 2KWDA 4BOJA 4KDIC 3NVZA 4LNKA 4GXBA 4DXGA 1RWSA 4HK2A 1XWTA 2D5GA 4HCPB 1A5RA 2TSSA 1RFKA 3AH7A 4XZ4A 1W6JA 2DZJA 5GY3A 4EKUA 4GTMB 4OZAA 2LVPA 2K22A 1T6BX 2ZVOA 2JZZA 3E32B 4ZYSA 1RWAA 3E73A 3S4AA 2JQRB 1O5MB 2WLBA 5L83A 3DBLB 4EE2A 2J42A 1D3ZA 1F9JA 2M19A 2BTEA 3PZ1B 1T0RC 2WXOA 4EZJA 3M75A 2KN5A 3L08A 4WAFA 1E5WA 5IN7A 1ESFA 2JPHA 2QHOA 3DBHB 3G6JB 1WGYA 3NVVA 1PGBA 1JS4A 1NVID 4C80A 2N0SB 4FADA 4FHKA 2WXMA 4XDCA 2WY8A 2KDBA 3HVDA 2JYTA 2KVRA 2KDMA 3EECA 4G3XB 5EE9A 3JW0X 4L9PB 3DDCB 3GLYA 3QT9A 3QWZB 3SAEA 2XK5B 3RX8A 2FUZA 4ZRPA 1KRHA 3HM6X 1FMAD 2GB1A 3VAWA 1T3QA 4B6WA 1XT9B 2KTFA 2K6QA 4GMVA 2KWUB 5HG2A 2IPKD 2XEWA 2AX5A 2D8LA 2BQQA 1YIWA 3BZDB 4K7UA 4FXGB 3RI7C 1Q10A 3N30A 1KFGA 3LXFA 4NEIA 1WJ4A 1XEEA 2DRSA 4RH6A 3P2BA 1GG3A 1WM2A 1VD2A 1Q5WB 1FCCC 5CZLA 1AARA 2FCSA 3EGRA 4WQOB 4ANVA 2N4FA 3VSMA 3WAPA 1VZ6A 4GN1A 1T5XD 1ZDXA 2GBRA 3EUB2 3U8ZA 2YEPB 4BOKA 3P63A 4L2YA 5D6JB 1WXVA 1E8YA 1XCQL 3BYTB 2G45B 1ROEA 3PVLA 2ZW0A 2DYBA 4J5TA 3EFUA 2WXPA 2VRRB 5FKAC 1MG8A 2OEDA 1DGJA 4WURA 1QOAA 4B0MA 3L17A 4A90A 4AOFA 1UF0A 2LHDA 2KFKA 4WVCA 3DPDA 1N62A 2V8JA 1Q1OA 2QC8A 3IBEA 2ACZB 4HEA1 5CA3A 1K51A 1KWFA 1ET6A 5GZKA 2E24A 2MQJA 1KSDA 2ZEQA 1E7PB 4HPMB 4OVUA 2Q1FA 5IK6A 4BOSC 4MBGB 4JJJA 3MC8A 4MM3A 3T3OA 1GPXA 1KM7A 2K8CA 1X1HA 3ANJA 3ZIMA 3QPFA 2BS2B 2PVGC 1D4BA 1ZE3D 3AMZA 1HZ6A 5DPWA 3ANKA 1C77A 1I35A 3KQ4A 4I6LB 2J5CA 1QT9A 2GBNA 2WQYB 1TF4A 3SU8X 5FO8B 2WWZA 1FXTB 2G3QB 2MEKA 2NPTB 4IWOA 2UWQA 3W7WA 4XWTA 3KH0A 4GGQA 1JWUD 1TKGA 2KDFB 3UGBB 1WXAA 4FNVA 1F9DA 3N0FA 3KW5B 2J0JA 3APDA 1DL2A 1KF6B 4BOZB 3PYAA 2N9EB 1E0ZA 2JX5A 3U7DA 1R4MI 2VZKD 2AQ1B 2MRPA 2KTRB 3OJ4B 3P2CA 3V62A 3L54A 3RFZB 2LMCA 4GAXA 5EE1A 2VN7A 4KGRA 4LNVA 1FPYA 3RNFC 1NXCA 1S63B 2DROA 1EU4A 1F52A 2N9LA 2DHZA 1MZCB 4EOYA 4LJOB 4NAWB 3NS8A 1V81A 1F2RI 4RGNA 4M8MA 2QSDA 1JCSB 1JWAD 2WDQB 1P7FA 3M74A 2Y5PA 2Z0DB 4WVBA 2DLBA 4TQ1A 1DYQA 3OG5A 3S4BA 1F9GA 3Q2AC 1T0YA 4KGSA 3I63C 2WXJA 2BGFA 3TMPB 2JSVX 5C1ZA 1Q0WB 3J9CA 2ONGA 3D32A 2FBWB 3EU8A 3T9LA 3M73A 3JYUA 3QFZA 1WE7A 2JU6X 1MHHE 4E1YA 3V3XA 4A3PA 4D2KA 3QCAA 3Q14C 3CMMB 4C00A 4WWOA 3T8MA 3SDQA 4L23A 3S2AA 4EZLA 5TSSA 3SDLC 4ZRIA 4MDKE 3WAOA 3RN9C 1L7YA 5IKHA 4M0WB 4MGKE 1HTOA 4RFBA 4TMAB 5FR6A 1FCLA 3A9KA 4DK5A 1TT5B 4LJPB 2ONHA 3PLVA 1SJHD 3QHTA 1X9DA 1OTRB 3M00A 3M7BA 1EWYC 5C05A 5EASA 1FM0D 2A8ZA 2I1JA 5HKHA 4IOIE 3NHEB 3NUHB 2CHXA 1C4PA 1SIJA 2AEHA 1YN5A 1N4RB 1TNUB 2FUG1 2KWCA 3N3KB 4A9AA 2FUHB 4A55A 2IO3B 2FCMA 2JWUA 1I7HA 5FK9C 3ZDTA 1QOGA 1YN4A 3VVWB 1O1SB 2GZ6A 2K5PA 2LRUA 4C7ZA 3B1LX 2SEBD 3IG3A 3H6NA 3RENA 2JYEA 1FFVA 1TJEA 2M4NA 3A33B 5FR3A 4KTRA 2AL3A 2Y5CA 5C2TB 3WIQA 1UGJA 1L0VB 3QSPA 3VQIA 2BWFA 4FHJA 1N7NA 1NEKB 3PT2B 2RMMA 1O6QA 1TS4A 3W5MA 1GB4A 3L0WB 4D4AA 2KQ7A 4MMIA 4RGTA 4D4CA 1FT1B 2LGSA 1N94B 1KJTA 3ZNHB 3AV8A 1UT9A 1E8WA 4FJYA 3DPYB 4G50A 4MT5A 4GDLB 1OEYJ 4MH0E 4LNBB 2RI9A 4OZCA 3W7TA 1XWQA 3NOBA 1JWBD 1BXTA 3UQBA 2HDEA 1GXNA 2M17A 1FAEA 2Y5BB 5DPSA 3E34B 5D3DA 2JUOA 1MFWA 4YL8A 3RUIB 1TYGB 4W9GA 3AEDB 1JWSD 2WU5B 4M76A 3V6CB 2WS3B 2XQWA 4TKNA 2ASQA 1R4NB 2NMQA 1QLBB 1OJNA 3GT5A 1PGAA 2ZNVB 1WZ0A 3TBLD 1FBOA 3AI5A 5IK9A 2MX2A 4F8CB 1P98A 3AECB 1X1JA 4LLGM 5BMGA 1VZ8A 1QKZA 5G55A 3Q7FB 2IY1B 3VRBB 5L95C 3MC9A 1RFAA 4MJSB 2E3TA 4AYRA 1ET9A 3APFA 1Y56A 4NY0A 1IYFA 1YN3A 4GTTB 3DBLI 1C82A 5E6NA 1QILA 3U2SC 1SE9A 5ILJA 5CHVC 4PYUA 2GOXA 2QNOA 2WIIB 3GE8C 4ZHOA 1PUTA 4ZDVA 1KKTA 4W9CA 2KXJA 4PS3A 2CQTA 4ZG8A 3PZDA 1C3DA 3FAHA 2WDTB 4BBNF 3SDTA 4C4VA 2H6HB 2N7DA 4M00A 2EACA 3DVNU 2MJEA 1GNUA 4W9EA 1DOYA 1YJJA 1QBQB 3AEBB 1N60A 3PPAA 5GXGB 2ZIRB 2G4SA 1N7RA 1UWMA 2H6GB 1O6RA 3A0OA 1E6EB 1F1SA 3N1YC 3CSTA 1CEMA 3Q73B 3DBRI 1N1BA 1FMIA 2VH2A 1C76A 4W9DA 1RWFA 3SFEB 2JG0A 2RDBC 1FPPB 3OAWA 3HVZA 3U52E 1RRBA 1FD6A 1L0YB 2WXKA 1V2YA 2KFJA 2W9NA 1JRPA 3PZ7A 1HQRD 2N7EA 3R7QA 2H6IB 4LTUA 2M0XA 3QRYA 1I4PA 2LASA 3WAMA 2MP2A 3KLSX 2JJBA 4GLSC 4D4DA 4II3B 3ZRFA 2FV0A 2N1VA 3BIID 1TGZB 1N22A 2MBEA 1N24A 2M8SA 2MH7A 3H2WA 1OQQA 2B4FA 3EZ8A 2JRHA 3R7RA 2FIDA 2GMIC 1WJNA 4HLEA 1NYQA 1L4DB 3NG0A 3AE4B 4WJQA 1HXYD 4DDGD 4B0EA 1J19A 2D10A 3HXEB 1CK1A 4DQOC 3ENEA 2WP9B 3ZXVA 3PHXB 4GU2A 3DSSB 4AQ7A 2OJRA 4DBGA 3G4FA 3ZTDA 2J0MA 3IAM1 3RNEC 3N9YC 3C72B 4G11A 1H3AA 2LUEA 2VH1A 4XX5A 3AEEB 2R2QA 1NI1B 2FUQA 3BYYB 4JLCA 4Z4JA 1CQVA 3SQCA 4HROA 2LFIA 2RDHA 2NPTA 4KVGB 2NR2A 4WJNA 4YTMB 5GW7A 3AEFB 4ZRKA 3ZNZB 2RI8A 1H13A 1WY8A 1H14A 1WU5A 3NRZA 5HHDG 3DBRB 1G9JA 1SSNA 3I9V1 3RZWC 1O1RB 4A3OA 4R3DA 3HXDB 1V9JA 4JL9A 2LJ5A 2FNJB 2O6VD 2BS4B 1H4RA 1V1OA 1AYXA 1GLMA 4MJSA 1HM3A 5KHOA 4MM3B 1CJEA 4XC2A 2V1YA 4HDOA 3AULA 1N6ZA 3V60A 3M01A 4LNGB 1UH6A 2GOWA 1SA5B 2RR9A 3TIXA 1UMPA 2PKOA 4ANWA 4A8XC 2WXIA 1MJDA 2V8IA 1HZFA 4YSZB 1J0NA 3NVYA 2EADA 2FCQA 2KQSA 1H36A 2LXCA 1TY0A 2WXGA 2HTME 2MBOA 1NC5A 5BO4B 3D5SA 3BY4B 3BVGA 2Z07A 1MVKA 2IBIB 2W82A 2K25A 3BK2A 3O13A 2EMSA 1P7EA 4GTOB 3RJ3A 2NBVB 3LJ3A 2DAFA 2DYOA 3W7SA 2H6FB 4Q2BA 1HN0A 5KHQA 2BB6A 1IA7A 4HWIB 3URYA 3Q78B 5FO7B 2KAJA 4MU9A 1LO5D 3E80A 3AE6B 1FFUA 3VUXA 3OXUA 1HMWA 4ARIA 1N5WA 5JXVA 2PN5A 2KK8A 3VHTC 2J53A 3DSUB 3W1SA 4LNOA 3DHIC 3ACTA 2XN9C 1ENFA 1JCRB 2G9HD 3VUWA 1FXAA 2KVZA 4KSLC 4W9KA 4NQLB 4XUVA 2V9HA 2DENB 3ZGZA 2NVPA 1V5OA 5G5GA 1UUPA 4YTPB 2V3SA 3M7LA 3ECIA 2BRPA 3H7LA 2WU2B 4CQNA 1WJ6A 3PHWB 5HFYA 5E6JA 4BKGA 4IWPA 4V1RA 4A20A 1C1YB 5LXHA 4TXTA 2DZKA 1LXMA 5JMFA 3AU4A 2V3PA 3B9JA 4HPPA 2L1AA 1IA6A 3OWEB 2KTRA 4JWUC 4DWFA 3PRZA 3RNCC 1YD8U 3LDZE 2L0TA 1WU4A 3A4RA 2W3RA 3ZO5B 5JHAA 2J7QB 5CX3A 3VTUA 4YDOB 2OHFA 3TSSA 4K3CA 4NJ6A 3GZKA 2LVQA 2WHIA 2ZVNA 3JSVB 2V0GA 1JQ4A 1E7VA 2ONQA 1L1YA 2CU1A 4KZCA 3TJPA 1A70A 2G02A 3DWMA 5JPNB 5CD2A 1WRIA 1N61A 1N5XA 1VCBA 3QT3A 1YX6B 1J7CA 2Z59B 1Y8RC 1V8CA 2PW9A 3AE5B 2IEJB 3K9OB 1V86A 5J18A 4HKQA 2ZCCA 2BYTA 4JE3B 3SD5A 4FUSA 3E6UA 3P5RA 2O2VB 2IDYA 4DI5A 4YTNB 1D5XC 2K1FA 3B0AA 4QAYA 3P5PA 2WGSA 3PS6A 1L2NA 4YDEB 2PPHA 4BKSD 4TQ0A 3M78A 3ACSA 1HE8A 1ISNA 4EUTA 3VFKA 2WX0A 2WXNA 3Q79B 1XO3A 2JWZA 2UYZB 1OGWA 4MSMB 3WKHA 3BK1A 4GTQB 2JZ3B 4F7ZA 4AP4C 3PO0A 1RQ5A 1R4MB 2HTHA 3KSQB 1PDXA 5IP4D 5ILYA 2KDIA 2DRQA 3IAS1 3X0WA 4V1SA 4E3CA 3AE7B 2INPE 3R66C 3DHGC 4I6NB 3I3TB 3P42A 1WYGA 1TS3A 5E6OA 3JVZX 3FILA 4UDUC 3AFJA 3RCZA 3DHHC 2KWVB 5AZHA 3PGEA 1J0GA 1I4QA 2MWSB 1KREA 2PMVA 4TSSA 1W6KA 5D7GA 3TL5A 4L0GA 4TUUA 4L6XA 1N21A 4BKSA 3RMKC 2BRWA 1LQBA 4F13A 2I1KA 4MH8A 2KYWA 3BINA 1VR9A 1PGXA 1V7WA 4DXFA 2XNAC 4KDLB 1XLPA 4ANUA 1V6EA 1FRDA 4Z4LA 3AM9A 3HRDD 2DRRA 1LTXB 3N0GA 1VRAB 4KV2A 1L4ZB 2WDVB 4XGAB 3ANIA 1E8XA 1V80A 1RW9A 3QXFA 4YCRA 3DVGY 4IM2A 2FV1A 2VZKB 2QIEB 2RDGA 1N20A 4G0NB 1ZDVA 1FEHA 2D3BA 5D94A 1V97A 4BBNC 1EF5A 1I4XA 3H9DA 2G4DB 2YIKA 3H3KA 4K81A 1H3CA 2M1MA 2MSED 2PE6B 1K53A 4DOEA 3AE9B 4D4BA 3X23A 4I6PA 1TS2A 3MC0B 1DCEB 1UZXB 4JGHB 3ZW3A 1N4SB 1SE4A 2KX0A 1FCEA 1G87A 2DZMA 3ZJTA 2F0YB 1O1TB 4URKA 1KH0A 4DODA 1XF5L 2KD0A 1YX5B 2LRWA 2DWQA 2Q5WD 3GB1A 4HPLB 2K8BA 3A1QA 1WXSA 5KKBA 1ZGUB 3HXBB 2Z8LA 2INNE 4W9LA 2WXHA 4CHKA 2DZIA 4N9F4 1K8RB 3P4QB 4OW0A 3TEXA 4DHZB 1KFYB 3MJWA 4WWPA 2DX5B 3A4SC 4QT9A 1YMHE 1N7PA 4P16A 1IBXA 3ZVVA 1WR6E 1T0SC 2C7HA 1ZXIA 2BT6A 1I4HA 2KN4A 3UI3A 3QIJA 1NBFC 2CJOA 2IYDB 2ZNVC 2KJHB 1UNSA 2LD9A 3P4SB 3GZNB 2O6VB 1HXGA 1KZPB 4AYOA 3K9PB 3PLUA 3PRPB 1YQBA 1MHXA 2PTLA 2L7RA 3DVGX 2JXXA 3HIZA 1WX7A 4RGMA 2KLCA 3WKIA 3SEBA 1UBQA 5IOIA 4GTRB 4LCDE 5AZFA 3VR8B 1IGDA 3WIRA 1EWCA 3EHVA 1BUIC 4ANXA 2AQ2B 2A73B 2R2OA 3QWTA 3DQVA 3BVMA 4XWWA 3U30A 4ZOHC 4NJ7A 4BAXA 5BMHA 4BKTA 1ZUD2 1KRFA 2IGHA 4OVZA 3VUYA 1F0ZA 3T33A 3TEZA 3CWIA 3ZJUA 1X81B 3W7XA 1WH3A 2V4LA 2E22A 2DNFA 1TNYB 2XBBC 4C4VB 5IK0A 4IUMB 2EABA 5TR5A 5GMVA 3ON6A 3D3IA 2IO1B 5IKAA 2BYFA 3EU5B 5FO9B 1WR1A 5ILZA 3HK0A 1HMUA 4ZH1A 1J8CA 1OJMA 3DVNV 1D5MC 3Q7AB 4WJOA 3QX1A 5C3JB 1YJIA 4OJZA 1EM7A 2I38A 4NAWA 2WXFA 3E33B 1N95B 2FAZA 3R3MA 2H89B 2BS3B 2GBKA 3RNBC 2B39A 4EFOA 2ZISB 4OZBA 3GOEA 3M7EA 3WKGA 4LDTB 4E74A 3DOWA 1N7OA 3VXWA 4LNFA 1SE3A 4KGTA 3Q8FA 4HVBA 4RNQA 1QOBA 1IUEA 1YJ1A 5LXIB 5FOBB 1WRDB 5EATA 3H7PA 1HV6A 3SFDB 4K3BA 4NJCA 1P9DU 3RZFA 3KUCB 4NZLB 2LGDA 2DAJA 1P3QU 1OEYA 2JF5A 2GBJA 3Q8CA 4P7IA 3A9JA 2MW5A 3NS1A 2PEAA 3TF4A 2CHWA 4KIKB 2MBHA 4EEWA 4ZRQA 3CSFA 2KLGA 3TEWA 2CKHB 3DSXB 1K50A 4KKIA 1UGMA 2X38A 2D2QA 5G2NA 4PK1A 1J0MA 4GOCA 5BYQA 4W9IA 4MACA 3AEAB 4H2AA 2K39A 3M62B 1SJED 3GE3C 5H92C 1WM3A 3C8YA 1GOZA 2JVCA 3ZNID 3O65B 1GAIA 2IGDA 2XFGA 1NENB 1XLNA 2EKIA 3NZSA 1RM6C 1WGHA 2KT7A 4JWSC 1VZ7A 3UQAA 4WU0A 2X03A 5JMDA 3B2GA 3R8BA 3PZ2B 4W9JA 4WQMA 4DXAB 1N7QA 4TV3A 1JCKB 2K8HA 1N1ZA 3Q3JA 5DHKA 3EA6A 5JHBA 1WE6A 3RD2A 3AFLA 1F2RC 3H7PB 3AN1A 4RM8A 2LJIA 1H3BA 1S1QB 2KMCA 5I4DA 2KMAA 2WX1A 1BMLC 1X1MA 2MP2B 4ICVA 1ULVA 3TUOA 2IGGA 3CF6E 4N59A 4LDTD 1EO6A 2V4IB 1E10A 4KKJA 1WSPA 2QEJC 1MPEA 2BPSA 4USAA 4AYQA 3E56A 4YWGG 3WIMA 1CLCA 3P1MA 3GZNI 5LNK1 1UBIA 3NFVA 2PE9A 5ILDA 2EKEC 1G6JA 2FE8A 1H54A 1I4GA 2NBUA 3UF8A 1JROA 1FNUA 2ON8A 2BB5A 3QA8A 2ZJDA 4WAAA 3NZ3A 3V61A 3E37B 3LB8C 2W3SA 4FA6A 1VJKA 3LYYA 2AFAA 4AWJA 3RYTA 1D8DB 2RSUA 2ZCBA 3ZYYX 1RWCA 3NY5A 2F6DA 3CU7A 1RYJA 4ASWC 1V7XA 4M8NA 5CHWA 2RD0A 1JW9D 1JCQB 4CYEA 3HM3A 3AXCA 2BYVE 3CIRB 2BKFA 1AGMA 2WINB 1FIQA 3RRSA 4TF4A 4HXDA 2JRIB 4REZA 3S9VA 2R61A 1HA5A 3WALA 2I07B 5IO9A 1ZXHA 2FIFA 2LEKA 4P1CC 4MGIE 3PZ3B 4FXKB 2L32A 2M0AA 1RAXA 2NOJA 1FO2A 2J52A 2K0PA 3WC3A 2LI5A 2LGXA 1WGDA 4RMAA 2XWJB 3ZQ4A 1UELA 1L0XB 4KZ0A 3SDVA 2INCC 4IC7B 2SAKA 4WJPA 3QFYA 5DGQA 1WFYA 2BYEA 3ZKJC 1QQRA 1OJPA 4RM9A 4RF0A 1V49A 2NBWB 2IY0B 1TY2A 2A4ZA 4GTVB 5MEHA 1M4VA 2AHGA 3AE3B 2NCNA 1BT0A 2Z0EB 2AYOB 3R2IA 1MG4A 3SR6A 1N4PB 3WANA 2KOXA 2WDAA 4LIXA 1PFDA 1XCTL 4W9FA 5D3IB 2ZBLA 5AGDA 3Q3NC 2LUMA 1V5TA 2FUTA 1KLUD 4P6VF 1V7VA 1WI0A 4ACFA 1FNVA 1IBXB 3IVFA 1I8QA 2D3CA 4MELA 1E90A 3W2DA 3NNBA 1LOHA 2ZZRA 1TKEA 1WMHA 5IL3A 2AL6A 2G1EA 2D3AA 1V5DA 4KX6B 1WXMA 2RGFA 1CB8A 2MA9B 5IL8A 1WZ3A 4LK0M 2KACA 1TS5A 2KDEB 2AQ3B 3B2FA 2CR5A 1LF9A 2KC2A 1IGCA 4MGYE 3DSWB 4DHZE 3KUDB 2C60A 1WZZA 1C3TA 2CS4A 3H7SA 3NJTA 4RF1A 3K7XA 1B9RA 1CMXB 3H1UA 4P1BC 2W55A 1WWTA 2JY6A 4AUQC 3I5JC 2EAEA 2YVCA 3DSTB 3ABVB 5CHFA 1GAHA 3FC4A 4O1NA 4K7SA 1H39A 4MSQB 2P0VA 3PRMB 1N4QB 2EELA 3QJZA 1RLFA 1Z5SB 2C7NB 1K72A 1JALA 1HCUA 1G9GA 4EZKA 5LLIA 4F10A 2KMMA 4J3OD 2MCNB 3V05A 3OEDA 3Q8AA 4HDQA 2MLBA 2KANA 1TN7B 2V8KA 1V1PB 3DBHI 3M95A 3CIHA 1FXIA 3GP7A 3KUZA 1E9MA 2L0FA 1FO3A 1EUVB 2IO0B 4WWNA 1O6HA 4YT0B 2NS5A 1LM8B 5H8YE 3KYDD 1C79A 5G5HA 3Q8EA 4CE7A 2G0DA 4WH4A 2LVOA 2WNMA 3N32A 2LHEA 3TEYA 3DBSA 1SQCA 2E6XA 1WU6A 4IM3A 1L6UA 1SBBB 4C1SA 1ZW7A 3KVFB 4YSXB 1OQYA 3ZTCA 1EU3A 3M02A 1R7SA 3RSYA 3UIOB 2SQCA 5CTRC 1NI2A 1D6EC 1V1PA 2WYNA 1LXDA 3AB5A 4XDDA 5IA7A 3QQ8B 5ILIA 3HHMA 4GDKA 2MBBB 2WXLA 4K7WA 3AE2B 2RGKA 4FLHA 2KNBA 4GTSB 4Q2JA 3M77A 1C4CA 2REXA 3AEGB 1UG9A 3N20C 1NYRA 3VTVA 4X57B 1H37A 1P0RA 1HZ5A 1NI3A 3S4DA 1TIFA 2GRIA 2KKCA 2KFKB 4DHJB 1H12A 4ICUA 1WF9A 3WCQA 1FO4A 3LZ9A 3E30B 3RULA 4MEMA 5T8IA 4IWQA 4MGZE 2D11A 3S4CA 5ILHA 1P1AA 2EMTA 3C19A 1QZEA 3HXCB 2YEPF 3QG0A 3FKYA 3KWLA 2L76A 5AUKA 1WX8A 1WMHB 2L00B 3ZLZA 2L3ZA 3UIPB 2OKXA 1U4AA 2R2LB 2HD5B 3I57A 1S64B 1TNBB 3APCA 1LGRA 1SE2A 4ZYNA 2RPQA 2GI9A 1LD7B 3A1QB 4Q88A 3L16A 2NTSA 3ZJVA 3SHQA 4IKGA 2JF4A 2GH4A 4D94A 4K1RB 3B08A 2VN4A 3W1YA 1XQQA 1YQ4B 2BEDB 3FILB 5AZGA 3SFYB 4KIKA 4FBJB 3QDEA 4N6EB 4ZHPA 5BMIA 1VDVA 2X8XX 3PREA 4GB9A 2WYQA 3HXFB 2PIAA 5JH5C 2L52A 1LFDA 2IJ0A 1FT2B 1HEZE 1SA4B 2NVUI 2QJLA 3Q69A 1W3YA 1FNWA 1RWHA 2D3GA 2RPVA 1GSZA 1T0QC 3Q8BA 1OQRA 2PVOD 4GIVA 3ZNGC 3RX5A 2K9XA 3ML8A 3QK0A 1DOIA 3AU5A 1TNOB 4OK2A 2KQ4X 3Q3OC 4BFRA 2JT4B 1TZ1A 2N9KA 2BRVX 1TZOA 1IP9A 4BZAA 1C78A 3IHPC 3MJ5A 3MHSD 2CHZA 1WX9A 2D07B 3Q6BA 5DGRA 2N9PC 2GLSA 3NZUA 4IW0A 4ARCA 1N63A 1TBEA 1QSJA 4LNNA 2QMTA 2KX3A 2L8JA 3ZUNA 1X1IA 3DCGA 4ZRJA 3X17A 3RNAC 1KS8A 5D2MB 3W7UA 3T3NA 3W1SC 2N9XA 3MP9A 2I2YA 1HM2A 4B9KA 4B95A 3ZDMC 2LGIA 4RCOA 1GJZA 1C9FA 1QOFA 5ILKA 5DCNA 4CJ1A 1TKYA 3EQAA 3QXQA 4NNJB 4S0RA 4PYZA 1S3SG 2JZPA 3ALBA 3RX7A 4S17A 3WUXA 4KSKC 2L83A 2KJ6A 5M7YA 4WIPA 3DRAB 2FBAA 3U4EG 1RWGA 3W9CB 4YSYB 5EE3A 3PV1A 3RNGC 5IM1A 3VDZA 3V6EB 4M02A 2CQSA 2O6VA 2QILA 1D8EB 1LF6A 3W5UB 1FBWA 2LWPA 1D5ZC 2OJWA 2DYMA 4GSWA 4OVVA 3OJ3A 5JZEB 4N58A 3ONSA 1SB3C 4RNAA 4ZH5A 1I4RA 3HUIA 3KYCD 1FRRA 3R2TA 2XWBB 3IT6B 3N1ZC 5MPOA 4GTPB 2J0KA 5HI1A 2IZVB 3P4PB 1AWDA 1G6IA 3M7CA 1AN8A 5IAAC 2B3AA 1QQFA 1V5CA 3IXSA 4US8A 1LD8B 5BYSA 3ZXRA 3VXDA 3M71A 3Q3MC 3KSLB 2CU3A 5EE0A 1GC6A 3RT3B 2QCZA 1K52A 2KO3A 4PS8A 2NTTA 2J4XA 3L10B 3E9SA 3N1XC 5EAUA 3EUVB 1VD5A 1ZOYB 4WWMA 3D5RA 1M94A 3SDRA 1XD3B 4FJVB 1AYFA 1L2AA 2LGYA 4LNIA 3QAQA 4HKZE 4FJQA 2L05A 2GBMA 1R76A 1YQ3B 1YNTE 1VLBA 2UU7A 5JPMB 1F1HA 1JWMD 2DBYA 2AHFA 3SFXB 3PTFC 4CJ0A 3H8HA 1F9OA 1KZOB 1N9AB 3SDUA 1ZKHA 2WCOA 4AS1A 1HTQA 1SIFA 1H35A 1NDDA 4JPSA 2BKRB 4OZVA 3ETRA 1FP3A 1LXKA 1C4AA 1WGRA 1STEA 1SXTA 4JIOU 3M3JA 2ZZPB 3VR9B 1Z2MA 5BYRA 2KC1A 4MMHA 1J7AA 2CJNA 4W9HA 1L5PA 4GDKB 3VW5A 3L13A 4NAMA 5IKCM 1H8CA 1WJUA 2HJ8A 4US9A 3AE8B 2LXAA 4IDIA 3EFCA 4E71A 3NVWA 4GDLA 2M56B 2BF8B 3PZ4B 3VH4B 4KTPA 1IPGA 5DPRA 3QC8B 3QARA 4OK4A 1MI0A 1E7UA 1HX9A 4IM0A 3JSVA 1N23A 1PYWD 4AJYB 1WGKA 4F1SA 4M01A 2QDFA 1GUAB 3W5NA 1QF6A 3VRAB 4XE0A 4A6QA 2ZW1A 3A3VA 1KSCA 1UD7A 2KJRA 2MBQA 2N7JA 3ZRCA 1KOTA 4AJWA 1O79A 1ACCA 3IT4B 2PLPA 5EDSA 2MJDA 4ITKA 3DSVB 4L1BA 4FN2A 2OOBB 3M72A 3KLSA 1L6VA 2BWES 1KTKA 2HE7A 2MHJA 3OLMD 4HJGE 5E6PA 2WY7A 1GXOA 5M7IA 1PQSA 2ICIA 1WGGA 2XK5A 1F77A 2C5LC
chains in the Genus database with same CATH topology
4D4AA 2D5JA 4FXCA 1LF9A 3K11A 4RGTA 1IGCA 4D4CA 1FT1B 1I4QA 2H88B 1N94B 3DSWB 1KREA 2PMVA 3Q75B 2WDRB 1W6KA 3MFGA 4HRSA 4TSSA 5D7GA 1ZPSA 4L0GA 1WZZA 4L6XA 3AV8A 2K3UA 1UT9A 4RF1A 3DPYB 3K7XA 4MT5A 4GDLB 4MH8A 3AE1B 1B9RA 4LNBB 2RI9A 4C56C 4OZCA 3W7TA 2W55A 1XWQA 3KWVA 1JWBD 1WWTA 5E2JA 1VR9A 2EAEA 1V7WA 3DSTB 1BXTA 1PGXA 2XNAC 3ABVB 4DXFA 2HDEA 1GXNA 1XLPA 1FAEA 1GAHA 3FC4A 3E34B 1FRDA 4M0WA 4O1NA 5D3DA 1H39A 4Z4LA 3AM9A 2P0VA 3PZ8A 3HRDD 2DRRA 1LTXB 3GS2A 1TYGB 1N4QB 1XLQA 3BVZA 2EELA 1VRAB 3AEDB 1JWSD 4JX1C 3PMMA 2WU5B 1DOXA 1L4ZB 1K72A 2WDVB 4M76A 3ANIA 1JALA 2BBCA 1GA2A 4ONTA 2WS3B 3QXFA 4YCRA 1HCUA 2XQWA 2FV1A 2VZKB 1G9GA 2QIEB 2RDGA 1ZP0B 2KMMA 2MJ3A 2B76B 1JMLA 1ZDVA 1FEHA 4J3OD 3V05A 2NMQA 1QLBB 3OEDA 3MHZA 3Q8AA 3RPFC 1V97A 3GT5A 3M76A 1PGAA 2W54A 4YXDB 1OFFA 1TN7B 1FBOA 2V8KA 4EHMB 1F77A 3CIHA 1V1PB 1I4XA 3U7ZA 1FXIA 3GP7A 1E9MA 2YIKA 1FO3A 3AECB 1WXQA 3H3KA 1O6HA 4WVAA 1H3CA 1TN6B 1IS9A 2Y3AA 3DWGC 3L4PA 4LLGM 5BMGA 1VZ8A 1QKZA 4YT0B 5H8YE 2WXQA 1K53A 3Q7FB 3VRBB 4DOEA 3AE9B 4D4BA 1C79A 5G5HA 1TN8B 1GXMA 3P4RB 3Q8EA 4CE7A 1TS2A 2G0DA 4WH4A 3MC0B 1DCEB 1AW7A 2E3TA 4AYRA 1ET9A 1SEBD 1CZPA 2WNMA 2BW2A 2LHEA 3TEYA 1DOGA 1NL4B 1SQCA 1N4SB 1SE4A 2E6XA 1FCEA 1G87A 1WU6A 1B1ZA 1Y56A 2JXTA 1L6UA 4PT5A 3PYBA 3ZJTA 2F0YB 1O1TB 1YN3A 1SBBB 1KH0A 4DODA 4OHJA 4C7YA 1XF5L 4GTTB 4C1SA 4YSXB 2DWQA 2Q5WD 3GB1A 1TNZB 1EU3A 1QILA 5KKBA 1R7SA 1GHQA 3RSYA 3U2SC 3HXBB 2Z8LA 4AYPA 2INNE 2SQCA 2GOXA 2QNOA 2WIIB 1XLOA 4ZHOA 2WXRA 1D6EC 1V1PA 2WXHA 1PUTA 2WYNA 3P4QB 4OW0A 3WKFA 4RGOS 3AB5A 1KKTA 3TEXA 1SF0A 1KLGD 4XDDA 1XXGA 1KFYB 5AUIA 2CQTA 4ZG8A 1GAQB 1C3DA 1UWXA 1J7BA 1XW2A 3FAHA 1GB1A 2V3NA 2WXLA 3SDTA 4QT9A 1YMHE 4EL8A 3AE2B 4P16A 2RGKA 2H6HB 1IBXA 4GTSB 1ZXIA 2EACA 3BWUD 4Q2JA 2BT6A 2MJEA 3WIWA 1I4HA 3M77A 2KN4A 1YJJA 1QBQB 3UI3A 1DOYA 4GL3A 2CJOA 1C4CA 3AEGB 1UG9A 1UNSA 3AEBB 1NYRA 3P4SB 1N60A 3W5VB 2KWDA 5GXGB 4BOJA 1KZPB 1H37A 2ZIRB 4AYOA 1UWMA 3NVZA 4DXGA 2H6GB 1O6RA 1RWSA 1E6EB 1XWTA 1MHXA 2PTLA 2D5GA 1CEMA 3Q73B 1HZ5A 3S4DA 1NI3A 2GRIA 2TSSA 1RFKA 1FMIA 3AH7A 4RGMA 1H12A 1W6JA 1C76A 5GY3A 3SFEB 3WCQA 2JG0A 3WKIA 1FO4A 4GTMB 3SEBA 3E30B 4OZAA 1FPPB 2K22A 1T6BX 5T8IA 4GTRB 3VR8B 1IGDA 3HVZA 3U52E 3WIRA 3S4CA 1FD6A 3E32B 1EWCA 1L0YB 4ZYSA 2WXKA 3E73A 3S4AA 1BUIC 3PZ7A 1JRPA 2AQ2B 2JQRB 2A73B 3HXCB 1HQRD 2YEPF 3QG0A 3QWTA 1O5MB 2WLBA 2H6IB 4EE2A 2J42A 3BVMA 4LTUA 4XWWA 3KWLA 3QRYA 5AUKA 1I4PA 4ZOHC 2M19A 2BTEA 5BMHA 3PZ1B 3KLSX 1ZUD2 1KRFA 2IGHA 2JJBA 2WXOA 4D4DA 4GLSC 4OVZA 2FV0A 3M75A 1F0ZA 2OKXA 4WAFA 2R2LB 3BIID 3T33A 3I57A 3TEZA 1S64B 3CWIA 1TNBB 1ESFA 3ZJUA 1X81B 3W7XA 1SE2A 3ZYYX 1TNYB 2MH7A 3H2WA 1LD7B 2GI9A 4Q88A 1OQQA 2B4FA 2EABA 3G6JB 2NTSA 3NVVA 1PGBA 3ON6A 3D3IA 1JS4A 1NVID 3ZJVA 4C80A 4IKGA 3EZ8A 2N0SB 2JF4A 3EU5B 2WXMA 2GH4A 4D94A 4XDCA 5FO9B 2WY8A 3HVDA 2JYTA 4ZH1A 2VN4A 1NYQA 1YQ4B 2KDMA 1L4DB 2BEDB 3FILB 1D5MC 3AE4B 3Q7AB 3SFYB 5EE9A 5C3JB 4L9PB 1HXYD 3GLYA 3QT9A 3QDEA 4N6EB 4ZHPA 1YJIA 1VDVA 4B0EA 5BMIA 3SAEA 3RX8A 1EM7A 2I38A 2FUZA 3HXEB 4ZRPA 3HXFB 1CK1A 2PIAA 2WXFA 3E33B 1KRHA 4DQOC 1N95B 2L52A 2WP9B 1FMAD 2GB1A 1T3QA 2IJ0A 2H89B 1FT2B 1HEZE 1SA4B 2BS3B 2QJLA 3Q69A 1FNWA 3DSSB 4AQ7A 2B39A 2RPVA 5HG2A 2IPKD 2ZISB 1GSZA 2AX5A 4OZBA 2D8LA 3IAM1 3M7EA 3WKGA 3Q8BA 3BZDB 4FXGB 1OQRA 3N9YC 3OWEB 3C72B 1Q10A 2PVOD 1KFGA 3LXFA 1XEEA 1H3AA 1SE3A 3RX5A 2DRSA 2K9XA 4RH6A 4KGTA 3Q8FA 1DOIA 3AEEB 1NI1B 3BYYB 1FCCC 1QOBA 4Z4JA 1TNOB 1CQVA 3SQCA 5CZLA 4HROA 2KQ4X 2LFIA 2RDHA 1IUEA 3EGRA 5FOBB 2N9KA 1TZOA 3SFDB 1VZ6A 1T5XD 1C78A 1ZDXA 4YTMB 5GW7A 3AEFB 4NJCA 3EUB2 3MJ5A 4NZLB 2YEPB 2RI8A 1H13A 4BOKA 1H14A 3P63A 4L2YA 3BYTB 1WU5A 1XCQL 3NRZA 5HHDG 5DGRA 4ARCA 3Q8CA 1N63A 1G9JA 1QSJA 1ROEA 1SSNA 3I9V1 3NS1A 2QMTA 3TF4A 2ZW0A 4J5TA 1O1RB 4R3DA 2WXPA 3HXDB 4ZRQA 5FKAC 1DGJA 3X17A 2OEDA 1QOAA 1KS8A 2BS4B 1V1OA 4WURA 4B0MA 3W7UA 4A90A 3TEWA 3T3NA 1AYXA 1GLMA 3DSXB 1K50A 2LHDA 4WVCA 1N62A 4MM3B 2V8JA 4KKIA 1CJEA 3MP9A 2I2YA 2ACZB 4HEA1 5CA3A 2X38A 1K51A 4LNGB 2LGIA 1SA5B 1KWFA 4RCOA 1ET6A 1UMPA 2PKOA 4A8XC 5GZKA 2WXIA 1C9FA 1QOFA 5BYQA 2V8IA 4CJ1A 1HZFA 3AEAB 4MACA 4H2AA 4YSZB 1TKYA 3EQAA 3NVYA 1KSDA 3QXQA 2EADA 1SJED 1E7PB 1H36A 1TY0A 2JZPA 5H92C 2WXGA 3RX7A 2HTME 1NC5A 3D5SA 4MBGB 4JJJA 3WUXA 1GOZA 3C8YA 3T3OA 1GPXA 1GAIA 2IGDA 2XFGA 3BVGA 2Z07A 1MVKA 1NENB 5M7YA 1XLNA 2EKIA 3ANJA 3DRAB 1RM6C 2L83A 4WIPA 3QPFA 2BS2B 2PVGC 2W82A 4JWSC 1ZE3D 1VZ7A 1D4BA 4WU0A 3BK2A 2FBAA 3AMZA 3O13A 3U4EG 3W9CB 1P7EA 1HZ6A 4GTOB 4YSYB 3RJ3A 3B2GA 3ANKA 3PZ2B 5EE3A 3R8BA 2DYOA 3W7SA 1C77A 2H6FB 3KQ4A 1QT9A 4WQMA 4Q2BA 2WQYB 1JCKB 1TF4A 2CQSA 2BB6A 1IA7A 2QILA 1D8EB 3URYA 5FO8B 3EA6A 1LF6A 3W5UB 2MEKA 1FBWA 3Q78B 5FR3A 5FO7B 3W7WA 1F2RC 2KAJA 4MU9A 3AN1A 1LO5D 4XWTA 1D5ZC 2LJIA 1H3BA 3AE6B 1FFUA 2DYMA 5I4DA 4N58A 3OXUA 1JWUD 1TKGA 1SB3C 4RNAA 4ARIA 4ZH5A 1N5WA 5JXVA 1I4RA 2PN5A 1F9DA 3HUIA 1FRRA 3R2TA 2XWBB 3IT6B 2J53A 1BMLC 1DL2A 1ULVA 3DSUB 3W1SA 1KF6B 3TUOA 2IGGA 4N59A 5MPOA 4GTPB 5HI1A 3PYAA 3P4PB 3ACTA 1AWDA 2V4IB 1ENFA 2XN9C 1E10A 1E0ZA 2JX5A 4KKJA 1G6IA 1WSPA 1JCRB 3M7CA 1AN8A 1FXAA 1MPEA 2G9HD 2QEJC 4USAA 1QQFA 1V5CA 3IXSA 4US8A 1LD8B 4AYQA 3E56A 5BYSA 3VXDA 3M71A 2VZKD 4YWGG 1CLCA 3KSLB 4XUVA 3P1MA 2CU3A 5EE0A 2AQ1B 5LNK1 3ZGZA 3P2CA 2NVPA 1K52A 2NTTA 2J4XA 5G5GA 1UUPA 3E9SA 2FE8A 1H54A 2LMCA 4YTPB 1I4GA 3RFZB 3M7LA 2VN7A 5EE1A 3EUVB 1JROA 4KGRA 1FNUA 2ON8A 2BB5A 1VD5A 4LNVA 1ZOYB 3H7LA 1NXCA 1S63B 2DROA 3D5RA 3SDRA 2WU2B 4WWMA 4CQNA 1AYFA 1L2AA 1EU4A 3NZ3A 5E6JA 5HFYA 3E37B 2N9LA 4HKZE 4V1RA 3LB8C 1MZCB 4TXTA 2W3SA 4NAWB 1R76A 1VJKA 3LYYA 2AFAA 4RGNA 1F2RI 1D8DB 2V3PA 3B9JA 2QSDA 2L1AA 1JCSB 1IA6A 1JWAD 1YQ3B 1YNTE 1P7FA 1VLBA 5JPMB 3M74A 1JWMD 2DBYA 2WDQB 2AHFA 2F6DA 4WVBA 3SFXB 4CJ0A 2DLBA 2Y5PA 1DYQA 1F9OA 1KZOB 3H8HA 4JWUC 3CU7A 1RYJA 1V7XA 1N9AB 3SDUA 3S4BA 1JW9D 1WU4A 4KGSA 1JCQB 2WXJA 2W3RA 4AS1A 3CIRB 1AGMA 1H35A 2WINB 4JPSA 1FIQA 3RRSA 4TF4A 4YDOB 2JSVX 3ETRA 2OHFA 1FP3A 4REZA 4TQ1A 3S9VA 2R61A 3TSSA 1C4AA 1HA5A 3J9CA 2I07B 3EU8A 3GZKA 1STEA 3M73A 1SXTA 1ZXHA 2FBWB 2LEKA 3PZ3B 4FXKB 3VR9B 2V0GA 3QFZA 2L32A 2ONQA 2JU6X 1MHHE 1L1YA 2M0AA 3V3XA 1JQ4A 4D2KA 5BYRA 2NOJA 1A70A 1FO2A 2G02A 3DWMA 5JPNB 1J7AA 2CJNA 5CD2A 1WRIA 1N61A 3WC3A 3SDQA 1N5XA 2J52A 2K0PA 4L23A 1L5PA 4GDKB 3QT3A 3VW5A 1J7CA 2XWJB 3ZQ4A 5TSSA 1L0XB 1V8CA 4NAMA 2PW9A 3SDVA 3AE5B 2IEJB 2SAKA 4HKQA 3QFYA 5DGQA 2BYTA 4RFBA 1QQRA 4TMAB 1FCLA 4JE3B 4RF0A 4FUSA 3E6UA 3P5RA 4US9A 1TY2A 1SJHD 3AE8B 4GTVB 5MEHA 1M4VA 2IDYA 4IDIA 4YTNB 1X9DA 2AHGA 1D5XC 3AE3B 2M56B 3NVWA 3M7BA 1EWYC 3P5PA 3PZ4B 4KTPA 1FM0D 2A8ZA 4IOIE 3R2IA 3NUHB 1MI0A 4YDEB 1C4PA 1SIJA 1YN5A 1N4RB 3SR6A 1N4PB 4TQ0A 1TNUB 2FUG1 3M78A 4LIXA 1PFDA 3ACSA 1XCTL 1PYWD 4A55A 4A9AA 5D3IB 1WGKA 2ZBLA 5AGDA 2WXNA 3W5NA 1QF6A 5FK9C 2JWUA 1I7HA 2LUMA 4XE0A 3VRAB 4A6QA 3Q79B 1KLUD 1XO3A 4P6VF 1V7VA 1QOGA 2ZW1A 3A3VA 1KSCA 1YN4A 1FNVA 2N7JA 1IBXB 1O1SB 1O79A 3WKHA 1ACCA 2GZ6A 3BK1A 4GTQB 2K5PA 3IT4B 2PLPA 3PO0A 4C7ZA 3W2DA 1RQ5A 2SEBD 2ZZRA 1TKEA 2MJDA 4ITKA 3KSQB 3DSVB 3RENA 1PDXA 2G1EA 2JYEA 1FFVA 4L1BA 1TJEA 1V5DA 2DRQA 3IAS1 4V1SA 3M72A 4KTRA 3AE7B 3KLSA 1L6VA 2INPE 1KTKA 2Y5CA 4KX6B 3P42A 4HJGE 5C2TB 2WY7A 1GXOA 3WIQA 5M7IA 1TS3A 1L0VB 1UGJA 3QSPA 1WYGA 3VQIA 2ICIA 2KACA 1TS5A 4LK0M 1NEKB 3FILA 2RMMA 2AQ3B 4UDUC 3B2FA 1O6QA 3AFJA 3W5MA 1TS4A 1GB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H37 A;  1S63 B;  2ZIR B;  3D5R A;  4D4A A;  2H6G B;  1O6R A;  4BOK A;  4D4C A;  1FT1 B;  3E37 B;  1N94 B;  3DSW B;  2PMV A;  3Q75 B;  1W6K A;  4V1R A;  1MZC B;  3Q73 B;  1R76 A;  1QSJ A;  1D8D B;  2V3P A;  1JCS B;  1W6J A;  3DPY B;  3K7X A;  1O1R B;  4GTM B;  5JPM B;  3E30 B;  3SFX B;  1FPP B;  3HXD B;  4ZRQ A;  4LNB B;  1KZO B;  3CU7 A;  4GTR B;  1N9A B;  3DST B;  3DSX B;  1GXN A;  3E32 B;  3E34 B;  1JCQ B;  1H39 A;  2V8J A;  4KKI A;  1LTX B;  2A73 B;  1N4Q B;  3HXC B;  1H35 A;  2WIN B;  1O5M B;  4YDO B;  2H6I B;  4LNG B;  1SA5 B;  1UMP A;  4M76 A;  2BBC A;  4ONT A;  2I07 B;  3PZ1 B;  2XQW A;  2V8I A;  3PZ3 B;  1HZF A;  4FXK B;  4D4D A;  2R2L B;  1S64 B;  2NOJ A;  1TNB B;  3OED A;  1H36 A;  1X81 B;  2G02 A;  5JPN B;  1TNY B;  1TN7 B;  2V8K A;  3D5S A;  4EHM B;  1LD7 B;  4MBG B;  2XWJ B;  3U7Z A;  3G6J B;  3DRA B;  1O6H A;  1H3C A;  1TN6 B;  3EU5 B;  4D94 A;  2IEJ B;  5FO9 B;  2WY8 A;  3Q7F B;  4ZH1 A;  4GTO B;  3RJ3 A;  3PZ2 B;  4D4B A;  1TN8 B;  1GXM A;  2H6F B;  3KQ4 A;  2BED B;  4GTV B;  2G0D A;  3Q7A B;  1DCE B;  3SFY B;  2BB6 A;  4L9P B;  1D8E B;  5FO8 B;  3PZ4 B;  3Q78 B;  1NL4 B;  1SQC A;  1N4S B;  5FO7 B;  3HXE B;  4ZRP A;  3HXF B;  4MU9 A;  3E33 B;  1N95 B;  4YDE B;  1H3B A;  2F0Y B;  1O1T B;  1N4R B;  1N4P B;  1TNU B;  3OXU A;  1FT2 B;  1SA4 B;  4GTT B;  4C1S A;  3DSS B;  2PN5 A;  1TNZ B;  5AGD A;  2B39 A;  2ZIS B;  1GSZ A;  1GHQ A;  2XWB B;  3Q79 B;  3HXB B;  3DSU B;  2SQC A;  2GOX A;  2WII B;  4GTP B;  4FXG B;  1O1S B;  1O79 A;  3C72 B;  4GTQ B;  1H3A A;  4KKJ A;  1JCR B;  1QQF A;  1C3D A;  1LD8 B;  1NI1 B;  3DSV B;  3KSQ B;  2V3N A;  3KSL B;  1TNO B;  3SQC A;  2H6H B;  4V1S A;  3KLS A;  4GTS B;  2WY7 A;  1GXO A;  5FOB B;  1QBQ B;  3EUV B;  1O6Q A;  2BB5 A;  4BOJ A;  4LNV A;  1KZP B; 
#chains in the Genus database with same CATH topology
 3M63 B;  2D5J A;  4FXC A;  3K11 A;  2KZR A;  1HXA A;  3VH3 B;  2H88 B;  2IND C;  2IO2 B;  2WDR B;  3MFG A;  4HRS A;  3Q75 B;  3C0R B;  1ZPS A;  2ZPY A;  2K3U A;  2O2V A;  2FCN A;  1KLV A;  3AE1 B;  4C56 C;  5DHI A;  3WA0 A;  3G4D A;  3KWV A;  1EGU A;  2N1W A;  5E2J A;  5J17 A;  2KHW B;  2PJH A;  4JQW C;  4II2 B;  4M0W A;  2C7M B;  4PS7 A;  3PZ8 A;  2K6D B;  3A9K B;  3GS2 A;  1XLQ A;  3BVZ A;  4JX1 C;  3PMM A;  4FUL A;  1DOX A;  1SGH A;  3Q3F A;  2BBC A;  1GA2 A;  4ONT A;  2BVC A;  1JRU A;  5AEK B;  5C23 A;  1ZP0 B;  2HJ1 A;  2MJ3 A;  2B76 B;  3E7J A;  1JML A;  4FJZ A;  3MHZ A;  3RPF C;  3M76 A;  2W54 A;  4HCN B;  1OFF A;  4YXD B;  4EHM B;  3VSN A;  3U7Z A;  4BVU C;  3TCA A;  1WXQ A;  3MTN B;  4WVA A;  3L4P A;  2Y3A A;  1TN6 B;  1IS9 A;  3A9J B;  3DWG C;  2YLM A;  2WXQ A;  5J2R A;  1TN8 B;  1GXM A;  3P4R B;  3UIN B;  3IFW B;  4OZW A;  1AW7 A;  1YOV B;  1EF1 A;  1SEB D;  1CZP A;  2BW2 A;  1E8Z A;  1DOG A;  1NL4 B;  1OJO A;  1WYW B;  1QAZ A;  1B1Z A;  2JXT A;  4DDI D;  4PT5 A;  3PYB A;  2ZPN A;  3ML9 A;  4OHJ A;  4NQK E;  4C7Y A;  2AWT A;  1GC7 A;  4XYC A;  1TNZ B;  1R4N I;  1GHQ A;  2A5U A;  4AYP A;  1XLO A;  2WXR A;  4IG7 B;  4J6I A;  3VTW A;  4CO7 A;  3WKF A;  4RGO S;  1SF0 A;  1KLG D;  5DPT A;  1XXG A;  3EC8 A;  2LZ6 A;  5AUI A;  1GAQ B;  4NPN A;  1UWX A;  2C9W B;  1J7B A;  1XW2 A;  1GB1 A;  4DHJ D;  2V3N A;  1I42 A;  1WIA A;  4EL8 A;  1HXC A;  3BWU D;  3WIW A;  4HJK A;  4GL3 A;  3PSE B;  3W5V B;  1TTN A;  2KWD A;  4BOJ A;  4KDI C;  3NVZ A;  4LNK A;  4GXB A;  4DXG A;  1RWS A;  4HK2 A;  1XWT A;  2D5G A;  4HCP B;  1A5R A;  2TSS A;  1RFK A;  3AH7 A;  4XZ4 A;  1W6J A;  2DZJ A;  5GY3 A;  4EKU A;  4GTM B;  4OZA A;  2LVP A;  2K22 A;  1T6B X;  2ZVO A;  2JZZ A;  3E32 B;  4ZYS A;  1RWA A;  3E73 A;  3S4A A;  2JQR B;  1O5M B;  2WLB A;  5L83 A;  3DBL B;  4EE2 A;  2J42 A;  1D3Z A;  1F9J A;  2M19 A;  2BTE A;  3PZ1 B;  1T0R C;  2WXO A;  4EZJ A;  3M75 A;  2KN5 A;  3L08 A;  4WAF A;  1E5W A;  5IN7 A;  1ESF A;  2JPH A;  2QHO A;  3DBH B;  3G6J B;  1WGY A;  3NVV A;  1PGB A;  1JS4 A;  1NVI D;  4C80 A;  2N0S B;  4FAD A;  4FHK A;  2WXM A;  4XDC A;  2WY8 A;  2KDB A;  3HVD A;  2JYT A;  2KVR A;  2KDM A;  3EEC A;  4G3X B;  5EE9 A;  3JW0 X;  4L9P B;  3DDC B;  3GLY A;  3QT9 A;  3QWZ B;  3SAE A;  2XK5 B;  3RX8 A;  2FUZ A;  4ZRP A;  1KRH A;  3HM6 X;  1FMA D;  2GB1 A;  3VAW A;  1T3Q A;  4B6W A;  1XT9 B;  2KTF A;  2K6Q A;  4GMV A;  2KWU B;  5HG2 A;  2IPK D;  2XEW A;  2AX5 A;  2D8L A;  2BQQ A;  1YIW A;  3BZD B;  4K7U A;  4FXG B;  3RI7 C;  1Q10 A;  3N30 A;  1KFG A;  3LXF A;  4NEI A;  1WJ4 A;  1XEE A;  2DRS A;  4RH6 A;  3P2B A;  1GG3 A;  1WM2 A;  1VD2 A;  1Q5W B;  1FCC C;  5CZL A;  1AAR A;  2FCS A;  3EGR A;  4WQO B;  4ANV A;  2N4F A;  3VSM A;  3WAP A;  1VZ6 A;  4GN1 A;  1T5X D;  1ZDX A;  2GBR A;  3EUB 2;  3U8Z A;  2YEP B;  4BOK A;  3P63 A;  4L2Y A;  5D6J B;  1WXV A;  1E8Y A;  1XCQ L;  3BYT B;  2G45 B;  1ROE A;  3PVL A;  2ZW0 A;  2DYB A;  4J5T A;  3EFU A;  2WXP A;  2VRR B;  5FKA C;  1MG8 A;  2OED A;  1DGJ A;  4WUR A;  1QOA A;  4B0M A;  3L17 A;  4A90 A;  4AOF A;  1UF0 A;  2LHD A;  2KFK A;  4WVC A;  3DPD A;  1N62 A;  2V8J A;  1Q1O A;  2QC8 A;  3IBE A;  2ACZ B;  4HEA 1;  5CA3 A;  1K51 A;  1KWF A;  1ET6 A;  5GZK A;  2E24 A;  2MQJ A;  1KSD A;  2ZEQ A;  1E7P B;  4HPM B;  4OVU A;  2Q1F A;  5IK6 A;  4BOS C;  4MBG B;  4JJJ A;  3MC8 A;  4MM3 A;  3T3O A;  1GPX A;  1KM7 A;  2K8C A;  1X1H A;  3ANJ A;  3ZIM A;  3QPF A;  2BS2 B;  2PVG C;  1D4B A;  1ZE3 D;  3AMZ A;  1HZ6 A;  5DPW A;  3ANK A;  1C77 A;  1I35 A;  3KQ4 A;  4I6L B;  2J5C A;  1QT9 A;  2GBN A;  2WQY B;  1TF4 A;  3SU8 X;  5FO8 B;  2WWZ A;  1FXT B;  2G3Q B;  2MEK A;  2NPT B;  4IWO A;  2UWQ A;  3W7W A;  4XWT A;  3KH0 A;  4GGQ A;  1JWU D;  1TKG A;  2KDF B;  3UGB B;  1WXA A;  4FNV A;  1F9D A;  3N0F A;  3KW5 B;  2J0J A;  3APD A;  1DL2 A;  1KF6 B;  4BOZ B;  3PYA A;  2N9E B;  1E0Z A;  2JX5 A;  3U7D A;  1R4M I;  2VZK D;  2AQ1 B;  2MRP A;  2KTR B;  3OJ4 B;  3P2C A;  3V62 A;  3L54 A;  3RFZ B;  2LMC A;  4GAX A;  5EE1 A;  2VN7 A;  4KGR A;  4LNV A;  1FPY A;  3RNF C;  1NXC A;  1S63 B;  2DRO A;  1EU4 A;  1F52 A;  2N9L A;  2DHZ A;  1MZC B;  4EOY A;  4LJO B;  4NAW B;  3NS8 A;  1V81 A;  1F2R I;  4RGN A;  4M8M A;  2QSD A;  1JCS B;  1JWA D;  2WDQ B;  1P7F A;  3M74 A;  2Y5P A;  2Z0D B;  4WVB A;  2DLB A;  4TQ1 A;  1DYQ A;  3OG5 A;  3S4B A;  1F9G A;  3Q2A C;  1T0Y A;  4KGS A;  3I63 C;  2WXJ A;  2BGF A;  3TMP B;  2JSV X;  5C1Z A;  1Q0W B;  3J9C A;  2ONG A;  3D32 A;  2FBW B;  3EU8 A;  3T9L A;  3M73 A;  3JYU A;  3QFZ A;  1WE7 A;  2JU6 X;  1MHH E;  4E1Y A;  3V3X A;  4A3P A;  4D2K A;  3QCA A;  3Q14 C;  3CMM B;  4C00 A;  4WWO A;  3T8M A;  3SDQ A;  4L23 A;  3S2A A;  4EZL A;  5TSS A;  3SDL C;  4ZRI A;  4MDK E;  3WAO A;  3RN9 C;  1L7Y A;  5IKH A;  4M0W B;  4MGK E;  1HTO A;  4RFB A;  4TMA B;  5FR6 A;  1FCL A;  3A9K A;  4DK5 A;  1TT5 B;  4LJP B;  2ONH A;  3PLV A;  1SJH D;  3QHT A;  1X9D A;  1OTR B;  3M00 A;  3M7B A;  1EWY C;  5C05 A;  5EAS A;  1FM0 D;  2A8Z A;  2I1J A;  5HKH A;  4IOI E;  3NHE B;  3NUH B;  2CHX A;  1C4P A;  1SIJ A;  2AEH A;  1YN5 A;  1N4R B;  1TNU B;  2FUG 1;  2KWC A;  3N3K B;  4A9A A;  2FUH B;  4A55 A;  2IO3 B;  2FCM A;  2JWU A;  1I7H A;  5FK9 C;  3ZDT A;  1QOG A;  1YN4 A;  3VVW B;  1O1S B;  2GZ6 A;  2K5P A;  2LRU A;  4C7Z A;  3B1L X;  2SEB D;  3IG3 A;  3H6N A;  3REN A;  2JYE A;  1FFV A;  1TJE A;  2M4N A;  3A33 B;  5FR3 A;  4KTR A;  2AL3 A;  2Y5C A;  5C2T B;  3WIQ A;  1UGJ A;  1L0V B;  3QSP A;  3VQI A;  2BWF A;  4FHJ A;  1N7N A;  1NEK B;  3PT2 B;  2RMM A;  1O6Q A;  1TS4 A;  3W5M A;  1GB4 A;  3L0W B;  4D4A A;  2KQ7 A;  4MMI A;  4RGT A;  4D4C A;  1FT1 B;  2LGS A;  1N94 B;  1KJT A;  3ZNH B;  3AV8 A;  1UT9 A;  1E8W A;  4FJY A;  3DPY B;  4G50 A;  4MT5 A;  4GDL B;  1OEY J;  4MH0 E;  4LNB B;  2RI9 A;  4OZC A;  3W7T A;  1XWQ A;  3NOB A;  1JWB D;  1BXT A;  3UQB A;  2HDE A;  1GXN A;  2M17 A;  1FAE A;  2Y5B B;  5DPS A;  3E34 B;  5D3D A;  2JUO A;  1MFW A;  4YL8 A;  3RUI B;  1TYG B;  4W9G A;  3AED B;  1JWS D;  2WU5 B;  4M76 A;  3V6C B;  2WS3 B;  2XQW A;  4TKN A;  2ASQ A;  1R4N B;  2NMQ A;  1QLB B;  1OJN A;  3GT5 A;  1PGA A;  2ZNV B;  1WZ0 A;  3TBL D;  1FBO A;  3AI5 A;  5IK9 A;  2MX2 A;  4F8C B;  1P98 A;  3AEC B;  1X1J A;  4LLG M;  5BMG A;  1VZ8 A;  1QKZ A;  5G55 A;  3Q7F B;  2IY1 B;  3VRB B;  5L95 C;  3MC9 A;  1RFA A;  4MJS B;  2E3T A;  4AYR A;  1ET9 A;  3APF A;  1Y56 A;  4NY0 A;  1IYF A;  1YN3 A;  4GTT B;  3DBL I;  1C82 A;  5E6N A;  1QIL A;  3U2S C;  1SE9 A;  5ILJ A;  5CHV C;  4PYU A;  2GOX A;  2QNO A;  2WII B;  3GE8 C;  4ZHO A;  1PUT A;  4ZDV A;  1KKT A;  4W9C A;  2KXJ A;  4PS3 A;  2CQT A;  4ZG8 A;  3PZD A;  1C3D A;  3FAH A;  2WDT B;  4BBN F;  3SDT A;  4C4V A;  2H6H B;  2N7D A;  4M00 A;  2EAC A;  3DVN U;  2MJE A;  1GNU A;  4W9E A;  1DOY A;  1YJJ A;  1QBQ B;  3AEB B;  1N60 A;  3PPA A;  5GXG B;  2ZIR B;  2G4S A;  1N7R A;  1UWM A;  2H6G B;  1O6R A;  3A0O A;  1E6E B;  1F1S A;  3N1Y C;  3CST A;  1CEM A;  3Q73 B;  3DBR I;  1N1B A;  1FMI A;  2VH2 A;  1C76 A;  4W9D A;  1RWF A;  3SFE B;  2JG0 A;  2RDB C;  1FPP B;  3OAW A;  3HVZ A;  3U52 E;  1RRB A;  1FD6 A;  1L0Y B;  2WXK A;  1V2Y A;  2KFJ A;  2W9N A;  1JRP A;  3PZ7 A;  1HQR D;  2N7E A;  3R7Q A;  2H6I B;  4LTU A;  2M0X A;  3QRY A;  1I4P A;  2LAS A;  3WAM A;  2MP2 A;  3KLS X;  2JJB A;  4GLS C;  4D4D A;  4II3 B;  3ZRF A;  2FV0 A;  2N1V A;  3BII D;  1TGZ B;  1N22 A;  2MBE A;  1N24 A;  2M8S A;  2MH7 A;  3H2W A;  1OQQ A;  2B4F A;  3EZ8 A;  2JRH A;  3R7R A;  2FID A;  2GMI C;  1WJN A;  4HLE A;  1NYQ A;  1L4D B;  3NG0 A;  3AE4 B;  4WJQ A;  1HXY D;  4DDG D;  4B0E A;  1J19 A;  2D10 A;  3HXE B;  1CK1 A;  4DQO C;  3ENE A;  2WP9 B;  3ZXV A;  3PHX B;  4GU2 A;  3DSS B;  4AQ7 A;  2OJR A;  4DBG A;  3G4F A;  3ZTD A;  2J0M A;  3IAM 1;  3RNE C;  3N9Y C;  3C72 B;  4G11 A;  1H3A A;  2LUE A;  2VH1 A;  4XX5 A;  3AEE B;  2R2Q A;  1NI1 B;  2FUQ A;  3BYY B;  4JLC A;  4Z4J A;  1CQV A;  3SQC A;  4HRO A;  2LFI A;  2RDH A;  2NPT A;  4KVG B;  2NR2 A;  4WJN A;  4YTM B;  5GW7 A;  3AEF B;  4ZRK A;  3ZNZ B;  2RI8 A;  1H13 A;  1WY8 A;  1H14 A;  1WU5 A;  3NRZ A;  5HHD G;  3DBR B;  1G9J A;  1SSN A;  3I9V 1;  3RZW C;  1O1R B;  4A3O A;  4R3D A;  3HXD B;  1V9J A;  4JL9 A;  2LJ5 A;  2FNJ B;  2O6V D;  2BS4 B;  1H4R A;  1V1O A;  1AYX A;  1GLM A;  4MJS A;  1HM3 A;  5KHO A;  4MM3 B;  1CJE A;  4XC2 A;  2V1Y A;  4HDO A;  3AUL A;  1N6Z A;  3V60 A;  3M01 A;  4LNG B;  1UH6 A;  2GOW A;  1SA5 B;  2RR9 A;  3TIX A;  1UMP A;  2PKO A;  4ANW A;  4A8X C;  2WXI A;  1MJD A;  2V8I A;  1HZF A;  4YSZ B;  1J0N A;  3NVY A;  2EAD A;  2FCQ A;  2KQS A;  1H36 A;  2LXC A;  1TY0 A;  2WXG A;  2HTM E;  2MBO A;  1NC5 A;  5BO4 B;  3D5S A;  3BY4 B;  3BVG A;  2Z07 A;  1MVK A;  2IBI B;  2W82 A;  2K25 A;  3BK2 A;  3O13 A;  2EMS A;  1P7E A;  4GTO B;  3RJ3 A;  2NBV B;  3LJ3 A;  2DAF A;  2DYO A;  3W7S A;  2H6F B;  4Q2B A;  1HN0 A;  5KHQ A;  2BB6 A;  1IA7 A;  4HWI B;  3URY A;  3Q78 B;  5FO7 B;  2KAJ A;  4MU9 A;  1LO5 D;  3E80 A;  3AE6 B;  1FFU A;  3VUX A;  3OXU A;  1HMW A;  4ARI A;  1N5W A;  5JXV A;  2PN5 A;  2KK8 A;  3VHT C;  2J53 A;  3DSU B;  3W1S A;  4LNO A;  3DHI C;  3ACT A;  2XN9 C;  1ENF A;  1JCR B;  2G9H D;  3VUW A;  1FXA A;  2KVZ A;  4KSL C;  4W9K A;  4NQL B;  4XUV A;  2V9H A;  2DEN B;  3ZGZ A;  2NVP A;  1V5O A;  5G5G A;  1UUP A;  4YTP B;  2V3S A;  3M7L A;  3ECI A;  2BRP A;  3H7L A;  2WU2 B;  4CQN A;  1WJ6 A;  3PHW B;  5HFY A;  5E6J A;  4BKG A;  4IWP A;  4V1R A;  4A20 A;  1C1Y B;  5LXH A;  4TXT A;  2DZK A;  1LXM A;  5JMF A;  3AU4 A;  2V3P A;  3B9J A;  4HPP A;  2L1A A;  1IA6 A;  3OWE B;  2KTR A;  4JWU C;  4DWF A;  3PRZ A;  3RNC C;  1YD8 U;  3LDZ E;  2L0T A;  1WU4 A;  3A4R A;  2W3R A;  3ZO5 B;  5JHA A;  2J7Q B;  5CX3 A;  3VTU A;  4YDO B;  2OHF A;  3TSS A;  4K3C A;  4NJ6 A;  3GZK A;  2LVQ A;  2WHI A;  2ZVN A;  3JSV B;  2V0G A;  1JQ4 A;  1E7V A;  2ONQ A;  1L1Y A;  2CU1 A;  4KZC A;  3TJP A;  1A70 A;  2G02 A;  3DWM A;  5JPN B;  5CD2 A;  1WRI A;  1N61 A;  1N5X A;  1VCB A;  3QT3 A;  1YX6 B;  1J7C A;  2Z59 B;  1Y8R C;  1V8C A;  2PW9 A;  3AE5 B;  2IEJ B;  3K9O B;  1V86 A;  5J18 A;  4HKQ A;  2ZCC A;  2BYT A;  4JE3 B;  3SD5 A;  4FUS A;  3E6U A;  3P5R A;  2O2V B;  2IDY A;  4DI5 A;  4YTN B;  1D5X C;  2K1F A;  3B0A A;  4QAY A;  3P5P A;  2WGS A;  3PS6 A;  1L2N A;  4YDE B;  2PPH A;  4BKS D;  4TQ0 A;  3M78 A;  3ACS A;  1HE8 A;  1ISN A;  4EUT A;  3VFK A;  2WX0 A;  2WXN A;  3Q79 B;  1XO3 A;  2JWZ A;  2UYZ B;  1OGW A;  4MSM B;  3WKH A;  3BK1 A;  4GTQ B;  2JZ3 B;  4F7Z A;  4AP4 C;  3PO0 A;  1RQ5 A;  1R4M B;  2HTH A;  3KSQ B;  1PDX A;  5IP4 D;  5ILY A;  2KDI A;  2DRQ A;  3IAS 1;  3X0W A;  4V1S A;  4E3C A;  3AE7 B;  2INP E;  3R66 C;  3DHG C;  4I6N B;  3I3T B;  3P42 A;  1WYG A;  1TS3 A;  5E6O A;  3JVZ X;  3FIL A;  4UDU C;  3AFJ A;  3RCZ A;  3DHH C;  2KWV B;  5AZH A;  3PGE A;  1J0G A;  1I4Q A;  2MWS B;  1KRE A;  2PMV A;  4TSS A;  1W6K A;  5D7G A;  3TL5 A;  4L0G A;  4TUU A;  4L6X A;  1N21 A;  4BKS A;  3RMK C;  2BRW A;  1LQB A;  4F13 A;  2I1K A;  4MH8 A;  2KYW A;  3BIN A;  1VR9 A;  1PGX A;  1V7W A;  4DXF A;  2XNA C;  4KDL B;  1XLP A;  4ANU A;  1V6E A;  1FRD A;  4Z4L A;  3AM9 A;  3HRD D;  2DRR A;  1LTX B;  3N0G A;  1VRA B;  4KV2 A;  1L4Z B;  2WDV B;  4XGA B;  3ANI A;  1E8X A;  1V80 A;  1RW9 A;  3QXF A;  4YCR A;  3DVG Y;  4IM2 A;  2FV1 A;  2VZK B;  2QIE B;  2RDG A;  1N20 A;  4G0N B;  1ZDV A;  1FEH A;  2D3B A;  5D94 A;  1V97 A;  4BBN C;  1EF5 A;  1I4X A;  3H9D A;  2G4D B;  2YIK A;  3H3K A;  4K81 A;  1H3C A;  2M1M A;  2MSE D;  2PE6 B;  1K53 A;  4DOE A;  3AE9 B;  4D4B A;  3X23 A;  4I6P A;  1TS2 A;  3MC0 B;  1DCE B;  1UZX B;  4JGH B;  3ZW3 A;  1N4S B;  1SE4 A;  2KX0 A;  1FCE A;  1G87 A;  2DZM A;  3ZJT A;  2F0Y B;  1O1T B;  4URK A;  1KH0 A;  4DOD A;  1XF5 L;  2KD0 A;  1YX5 B;  2LRW A;  2DWQ A;  2Q5W D;  3GB1 A;  4HPL B;  2K8B A;  3A1Q A;  1WXS A;  5KKB A;  1ZGU B;  3HXB B;  2Z8L A;  2INN E;  4W9L A;  2WXH A;  4CHK A;  2DZI A;  4N9F 4;  1K8R B;  3P4Q B;  4OW0 A;  3TEX A;  4DHZ B;  1KFY B;  3MJW A;  4WWP A;  2DX5 B;  3A4S C;  4QT9 A;  1YMH E;  1N7P A;  4P16 A;  1IBX A;  3ZVV A;  1WR6 E;  1T0S C;  2C7H A;  1ZXI A;  2BT6 A;  1I4H A;  2KN4 A;  3UI3 A;  3QIJ A;  1NBF C;  2CJO A;  2IYD B;  2ZNV C;  2KJH B;  1UNS A;  2LD9 A;  3P4S B;  3GZN B;  2O6V B;  1HXG A;  1KZP B;  4AYO A;  3K9P B;  3PLU A;  3PRP B;  1YQB A;  1MHX A;  2PTL A;  2L7R A;  3DVG X;  2JXX A;  3HIZ A;  1WX7 A;  4RGM A;  2KLC A;  3WKI A;  3SEB A;  1UBQ A;  5IOI A;  4GTR B;  4LCD E;  5AZF A;  3VR8 B;  1IGD A;  3WIR A;  1EWC A;  3EHV A;  1BUI C;  4ANX A;  2AQ2 B;  2A73 B;  2R2O A;  3QWT A;  3DQV A;  3BVM A;  4XWW A;  3U30 A;  4ZOH C;  4NJ7 A;  4BAX A;  5BMH A;  4BKT A;  1ZUD 2;  1KRF A;  2IGH A;  4OVZ A;  3VUY A;  1F0Z A;  3T33 A;  3TEZ A;  3CWI A;  3ZJU A;  1X81 B;  3W7X A;  1WH3 A;  2V4L A;  2E22 A;  2DNF A;  1TNY B;  2XBB C;  4C4V B;  5IK0 A;  4IUM B;  2EAB A;  5TR5 A;  5GMV A;  3ON6 A;  3D3I A;  2IO1 B;  5IKA A;  2BYF A;  3EU5 B;  5FO9 B;  1WR1 A;  5ILZ A;  3HK0 A;  1HMU A;  4ZH1 A;  1J8C A;  1OJM A;  3DVN V;  1D5M C;  3Q7A B;  4WJO A;  3QX1 A;  5C3J B;  1YJI A;  4OJZ A;  1EM7 A;  2I38 A;  4NAW A;  2WXF A;  3E33 B;  1N95 B;  2FAZ A;  3R3M A;  2H89 B;  2BS3 B;  2GBK A;  3RNB C;  2B39 A;  4EFO A;  2ZIS B;  4OZB A;  3GOE A;  3M7E A;  3WKG A;  4LDT B;  4E74 A;  3DOW A;  1N7O A;  3VXW A;  4LNF A;  1SE3 A;  4KGT A;  3Q8F A;  4HVB A;  4RNQ A;  1QOB A;  1IUE A;  1YJ1 A;  5LXI B;  5FOB B;  1WRD B;  5EAT A;  3H7P A;  1HV6 A;  3SFD B;  4K3B A;  4NJC A;  1P9D U;  3RZF A;  3KUC B;  4NZL B;  2LGD A;  2DAJ A;  1P3Q U;  1OEY A;  2JF5 A;  2GBJ A;  3Q8C A;  4P7I A;  3A9J A;  2MW5 A;  3NS1 A;  2PEA A;  3TF4 A;  2CHW A;  4KIK B;  2MBH A;  4EEW A;  4ZRQ A;  3CSF A;  2KLG A;  3TEW A;  2CKH B;  3DSX B;  1K50 A;  4KKI A;  1UGM A;  2X38 A;  2D2Q A;  5G2N A;  4PK1 A;  1J0M A;  4GOC A;  5BYQ A;  4W9I A;  4MAC A;  3AEA B;  4H2A A;  2K39 A;  3M62 B;  1SJE D;  3GE3 C;  5H92 C;  1WM3 A;  3C8Y A;  1GOZ A;  2JVC A;  3ZNI D;  3O65 B;  1GAI A;  2IGD A;  2XFG A;  1NEN B;  1XLN A;  2EKI A;  3NZS A;  1RM6 C;  1WGH A;  2KT7 A;  4JWS C;  1VZ7 A;  3UQA A;  4WU0 A;  2X03 A;  5JMD A;  3B2G A;  3R8B A;  3PZ2 B;  4W9J A;  4WQM A;  4DXA B;  1N7Q A;  4TV3 A;  1JCK B;  2K8H A;  1N1Z A;  3Q3J A;  5DHK A;  3EA6 A;  5JHB A;  1WE6 A;  3RD2 A;  3AFL A;  1F2R C;  3H7P B;  3AN1 A;  4RM8 A;  2LJI A;  1H3B A;  1S1Q B;  2KMC A;  5I4D A;  2KMA A;  2WX1 A;  1BML C;  1X1M A;  2MP2 B;  4ICV A;  1ULV A;  3TUO A;  2IGG A;  3CF6 E;  4N59 A;  4LDT D;  1EO6 A;  2V4I B;  1E10 A;  4KKJ A;  1WSP A;  2QEJ C;  1MPE A;  2BPS A;  4USA A;  4AYQ A;  3E56 A;  4YWG G;  3WIM A;  1CLC A;  3P1M A;  3GZN I;  5LNK 1;  1UBI A;  3NFV A;  2PE9 A;  5ILD A;  2EKE C;  1G6J A;  2FE8 A;  1H54 A;  1I4G A;  2NBU A;  3UF8 A;  1JRO A;  1FNU A;  2ON8 A;  2BB5 A;  3QA8 A;  2ZJD A;  4WAA A;  3NZ3 A;  3V61 A;  3E37 B;  3LB8 C;  2W3S A;  4FA6 A;  1VJK A;  3LYY A;  2AFA A;  4AWJ A;  3RYT A;  1D8D B;  2RSU A;  2ZCB A;  3ZYY X;  1RWC A;  3NY5 A;  2F6D A;  3CU7 A;  1RYJ A;  4ASW C;  1V7X A;  4M8N A;  5CHW A;  2RD0 A;  1JW9 D;  1JCQ B;  4CYE A;  3HM3 A;  3AXC A;  2BYV E;  3CIR B;  2BKF A;  1AGM A;  2WIN B;  1FIQ A;  3RRS A;  4TF4 A;  4HXD A;  2JRI B;  4REZ A;  3S9V A;  2R61 A;  1HA5 A;  3WAL A;  2I07 B;  5IO9 A;  1ZXH A;  2FIF A;  2LEK A;  4P1C C;  4MGI E;  3PZ3 B;  4FXK B;  2L32 A;  2M0A A;  1RAX A;  2NOJ A;  1FO2 A;  2J52 A;  2K0P A;  3WC3 A;  2LI5 A;  2LGX A;  1WGD A;  4RMA A;  2XWJ B;  3ZQ4 A;  1UEL A;  1L0X B;  4KZ0 A;  3SDV A;  2INC C;  4IC7 B;  2SAK A;  4WJP A;  3QFY A;  5DGQ A;  1WFY A;  2BYE A;  3ZKJ C;  1QQR A;  1OJP A;  4RM9 A;  4RF0 A;  1V49 A;  2NBW B;  2IY0 B;  1TY2 A;  2A4Z A;  4GTV B;  5MEH A;  1M4V A;  2AHG A;  3AE3 B;  2NCN A;  1BT0 A;  2Z0E B;  2AYO B;  3R2I A;  1MG4 A;  3SR6 A;  1N4P B;  3WAN A;  2KOX A;  2WDA A;  4LIX A;  1PFD A;  1XCT L;  4W9F A;  5D3I B;  2ZBL A;  5AGD A;  3Q3N C;  2LUM A;  1V5T A;  2FUT A;  1KLU D;  4P6V F;  1V7V A;  1WI0 A;  4ACF A;  1FNV A;  1IBX B;  3IVF A;  1I8Q A;  2D3C A;  4MEL A;  1E90 A;  3W2D A;  3NNB A;  1LOH A;  2ZZR A;  1TKE A;  1WMH A;  5IL3 A;  2AL6 A;  2G1E A;  2D3A A;  1V5D A;  4KX6 B;  1WXM A;  2RGF A;  1CB8 A;  2MA9 B;  5IL8 A;  1WZ3 A;  4LK0 M;  2KAC A;  1TS5 A;  2KDE B;  2AQ3 B;  3B2F A;  2CR5 A;  1LF9 A;  2KC2 A;  1IGC A;  4MGY E;  3DSW B;  4DHZ E;  3KUD B;  2C60 A;  1WZZ A;  1C3T A;  2CS4 A;  3H7S A;  3NJT A;  4RF1 A;  3K7X A;  1B9R A;  1CMX B;  3H1U A;  4P1B C;  2W55 A;  1WWT A;  2JY6 A;  4AUQ C;  3I5J C;  2EAE A;  2YVC A;  3DST B;  3ABV B;  5CHF A;  1GAH A;  3FC4 A;  4O1N A;  4K7S A;  1H39 A;  4MSQ B;  2P0V A;  3PRM B;  1N4Q B;  2EEL A;  3QJZ A;  1RLF A;  1Z5S B;  2C7N B;  1K72 A;  1JAL A;  1HCU A;  1G9G A;  4EZK A;  5LLI A;  4F10 A;  2KMM A;  4J3O D;  2MCN B;  3V05 A;  3OED A;  3Q8A A;  4HDQ A;  2MLB A;  2KAN A;  1TN7 B;  2V8K A;  1V1P B;  3DBH I;  3M95 A;  3CIH A;  1FXI A;  3GP7 A;  3KUZ A;  1E9M A;  2L0F A;  1FO3 A;  1EUV B;  2IO0 B;  4WWN A;  1O6H A;  4YT0 B;  2NS5 A;  1LM8 B;  5H8Y E;  3KYD D;  1C79 A;  5G5H A;  3Q8E A;  4CE7 A;  2G0D A;  4WH4 A;  2LVO A;  2WNM A;  3N32 A;  2LHE A;  3TEY A;  3DBS A;  1SQC A;  2E6X A;  1WU6 A;  4IM3 A;  1L6U A;  1SBB B;  4C1S A;  1ZW7 A;  3KVF B;  4YSX B;  1OQY A;  3ZTC A;  1EU3 A;  3M02 A;  1R7S A;  3RSY A;  3UIO B;  2SQC A;  5CTR C;  1NI2 A;  1D6E C;  1V1P A;  2WYN A;  1LXD A;  3AB5 A;  4XDD A;  5IA7 A;  3QQ8 B;  5ILI A;  3HHM A;  4GDK A;  2MBB B;  2WXL A;  4K7W A;  3AE2 B;  2RGK A;  4FLH A;  2KNB A;  4GTS B;  4Q2J A;  3M77 A;  1C4C A;  2REX A;  3AEG B;  1UG9 A;  3N20 C;  1NYR A;  3VTV A;  4X57 B;  1H37 A;  1P0R A;  1HZ5 A;  1NI3 A;  3S4D A;  1TIF A;  2GRI A;  2KKC A;  2KFK B;  4DHJ B;  1H12 A;  4ICU A;  1WF9 A;  3WCQ A;  1FO4 A;  3LZ9 A;  3E30 B;  3RUL A;  4MEM A;  5T8I A;  4IWQ A;  4MGZ E;  2D11 A;  3S4C A;  5ILH A;  1P1A A;  2EMT A;  3C19 A;  1QZE A;  3HXC B;  2YEP F;  3QG0 A;  3FKY A;  3KWL A;  2L76 A;  5AUK A;  1WX8 A;  1WMH B;  2L00 B;  3ZLZ A;  2L3Z A;  3UIP B;  2OKX A;  1U4A A;  2R2L B;  2HD5 B;  3I57 A;  1S64 B;  1TNB B;  3APC A;  1LGR A;  1SE2 A;  4ZYN A;  2RPQ A;  2GI9 A;  1LD7 B;  3A1Q B;  4Q88 A;  3L16 A;  2NTS A;  3ZJV A;  3SHQ A;  4IKG A;  2JF4 A;  2GH4 A;  4D94 A;  4K1R B;  3B08 A;  2VN4 A;  3W1Y A;  1XQQ A;  1YQ4 B;  2BED B;  3FIL B;  5AZG A;  3SFY B;  4KIK A;  4FBJ B;  3QDE A;  4N6E B;  4ZHP A;  5BMI A;  1VDV A;  2X8X X;  3PRE A;  4GB9 A;  2WYQ A;  3HXF B;  2PIA A;  5JH5 C;  2L52 A;  1LFD A;  2IJ0 A;  1FT2 B;  1HEZ E;  1SA4 B;  2NVU I;  2QJL A;  3Q69 A;  1W3Y A;  1FNW A;  1RWH A;  2D3G A;  2RPV A;  1GSZ A;  1T0Q C;  3Q8B A;  1OQR A;  2PVO D;  4GIV A;  3ZNG C;  3RX5 A;  2K9X A;  3ML8 A;  3QK0 A;  1DOI A;  3AU5 A;  1TNO B;  4OK2 A;  2KQ4 X;  3Q3O C;  4BFR A;  2JT4 B;  1TZ1 A;  2N9K A;  2BRV X;  1TZO A;  1IP9 A;  4BZA A;  1C78 A;  3IHP C;  3MJ5 A;  3MHS D;  2CHZ A;  1WX9 A;  2D07 B;  3Q6B A;  5DGR A;  2N9P C;  2GLS A;  3NZU A;  4IW0 A;  4ARC A;  1N63 A;  1TBE A;  1QSJ A;  4LNN A;  2QMT A;  2KX3 A;  2L8J A;  3ZUN A;  1X1I A;  3DCG A;  4ZRJ A;  3X17 A;  3RNA C;  1KS8 A;  5D2M B;  3W7U A;  3T3N A;  3W1S C;  2N9X A;  3MP9 A;  2I2Y A;  1HM2 A;  4B9K A;  4B95 A;  3ZDM C;  2LGI A;  4RCO A;  1GJZ A;  1C9F A;  1QOF A;  5ILK A;  5DCN A;  4CJ1 A;  1TKY A;  3EQA A;  3QXQ A;  4NNJ B;  4S0R A;  4PYZ A;  1S3S G;  2JZP A;  3ALB A;  3RX7 A;  4S17 A;  3WUX A;  4KSK C;  2L83 A;  2KJ6 A;  5M7Y A;  4WIP A;  3DRA B;  2FBA A;  3U4E G;  1RWG A;  3W9C B;  4YSY B;  5EE3 A;  3PV1 A;  3RNG C;  5IM1 A;  3VDZ A;  3V6E B;  4M02 A;  2CQS A;  2O6V A;  2QIL A;  1D8E B;  1LF6 A;  3W5U B;  1FBW A;  2LWP A;  1D5Z C;  2OJW A;  2DYM A;  4GSW A;  4OVV A;  3OJ3 A;  5JZE B;  4N58 A;  3ONS A;  1SB3 C;  4RNA A;  4ZH5 A;  1I4R A;  3HUI A;  3KYC D;  1FRR A;  3R2T A;  2XWB B;  3IT6 B;  3N1Z C;  5MPO A;  4GTP B;  2J0K A;  5HI1 A;  2IZV B;  3P4P B;  1AWD A;  1G6I A;  3M7C A;  1AN8 A;  5IAA C;  2B3A A;  1QQF A;  1V5C A;  3IXS A;  4US8 A;  1LD8 B;  5BYS A;  3ZXR A;  3VXD A;  3M71 A;  3Q3M C;  3KSL B;  2CU3 A;  5EE0 A;  1GC6 A;  3RT3 B;  2QCZ A;  1K52 A;  2KO3 A;  4PS8 A;  2NTT A;  2J4X A;  3L10 B;  3E9S A;  3N1X C;  5EAU A;  3EUV B;  1VD5 A;  1ZOY B;  4WWM A;  3D5R A;  1M94 A;  3SDR A;  1XD3 B;  4FJV B;  1AYF A;  1L2A A;  2LGY A;  4LNI A;  3QAQ A;  4HKZ E;  4FJQ A;  2L05 A;  2GBM A;  1R76 A;  1YQ3 B;  1YNT E;  1VLB A;  2UU7 A;  5JPM B;  1F1H A;  1JWM D;  2DBY A;  2AHF A;  3SFX B;  3PTF C;  4CJ0 A;  3H8H A;  1F9O A;  1KZO B;  1N9A B;  3SDU A;  1ZKH A;  2WCO A;  4AS1 A;  1HTQ A;  1SIF A;  1H35 A;  1NDD A;  4JPS A;  2BKR B;  4OZV A;  3ETR A;  1FP3 A;  1LXK A;  1C4A A;  1WGR A;  1STE A;  1SXT A;  4JIO U;  3M3J A;  2ZZP B;  3VR9 B;  1Z2M A;  5BYR A;  2KC1 A;  4MMH A;  1J7A A;  2CJN A;  4W9H A;  1L5P A;  4GDK B;  3VW5 A;  3L13 A;  4NAM A;  5IKC M;  1H8C A;  1WJU A;  2HJ8 A;  4US9 A;  3AE8 B;  2LXA A;  4IDI A;  3EFC A;  4E71 A;  3NVW A;  4GDL A;  2M56 B;  2BF8 B;  3PZ4 B;  3VH4 B;  4KTP A;  1IPG A;  5DPR A;  3QC8 B;  3QAR A;  4OK4 A;  1MI0 A;  1E7U A;  1HX9 A;  4IM0 A;  3JSV A;  1N23 A;  1PYW D;  4AJY B;  1WGK A;  4F1S A;  4M01 A;  2QDF A;  1GUA B;  3W5N A;  1QF6 A;  3VRA B;  4XE0 A;  4A6Q A;  2ZW1 A;  3A3V A;  1KSC A;  1UD7 A;  2KJR A;  2MBQ A;  2N7J A;  3ZRC A;  1KOT A;  4AJW A;  1O79 A;  1ACC A;  3IT4 B;  2PLP A;  5EDS A;  2MJD A;  4ITK A;  3DSV B;  4L1B A;  4FN2 A;  2OOB B;  3M72 A;  3KLS A;  1L6V A;  2BWE S;  1KTK A;  2HE7 A;  2MHJ A;  3OLM D;  4HJG E;  5E6P A;  2WY7 A;  1GXO A;  5M7I A;  1PQS A;  2ICI A;  1WGG A;  2XK5 A;  1F77 A;  2C5L C; 
#chains in the Genus database with same CATH homology
 4D4A A;  2D5J A;  4FXC A;  1LF9 A;  3K11 A;  4RGT A;  1IGC A;  4D4C A;  1FT1 B;  1I4Q A;  2H88 B;  1N94 B;  3DSW B;  1KRE A;  2PMV A;  3Q75 B;  2WDR B;  1W6K A;  3MFG A;  4HRS A;  4TSS A;  5D7G A;  1ZPS A;  4L0G A;  1WZZ A;  4L6X A;  3AV8 A;  2K3U A;  1UT9 A;  4RF1 A;  3DPY B;  3K7X A;  4MT5 A;  4GDL B;  4MH8 A;  3AE1 B;  1B9R A;  4LNB B;  2RI9 A;  4C56 C;  4OZC A;  3W7T A;  2W55 A;  1XWQ A;  3KWV A;  1JWB D;  1WWT A;  5E2J A;  1VR9 A;  2EAE A;  1V7W A;  3DST B;  1BXT A;  1PGX A;  2XNA C;  3ABV B;  4DXF A;  2HDE A;  1GXN A;  1XLP A;  1FAE A;  1GAH A;  3FC4 A;  3E34 B;  1FRD A;  4M0W A;  4O1N A;  5D3D A;  1H39 A;  4Z4L A;  3AM9 A;  2P0V A;  3PZ8 A;  3HRD D;  2DRR A;  1LTX B;  3GS2 A;  1TYG B;  1N4Q B;  1XLQ A;  3BVZ A;  2EEL A;  1VRA B;  3AED B;  1JWS D;  4JX1 C;  3PMM A;  2WU5 B;  1DOX A;  1L4Z B;  1K72 A;  2WDV B;  4M76 A;  3ANI A;  1JAL A;  2BBC A;  1GA2 A;  4ONT A;  2WS3 B;  3QXF A;  4YCR A;  1HCU A;  2XQW A;  2FV1 A;  2VZK B;  1G9G A;  2QIE B;  2RDG A;  1ZP0 B;  2KMM A;  2MJ3 A;  2B76 B;  1JML A;  1ZDV A;  1FEH A;  4J3O D;  3V05 A;  2NMQ A;  1QLB B;  3OED A;  3MHZ A;  3Q8A A;  3RPF C;  1V97 A;  3GT5 A;  3M76 A;  1PGA A;  2W54 A;  4YXD B;  1OFF A;  1TN7 B;  1FBO A;  2V8K A;  4EHM B;  1F77 A;  3CIH A;  1V1P B;  1I4X A;  3U7Z A;  1FXI A;  3GP7 A;  1E9M A;  2YIK A;  1FO3 A;  3AEC B;  1WXQ A;  3H3K A;  1O6H A;  4WVA A;  1H3C A;  1TN6 B;  1IS9 A;  2Y3A A;  3DWG C;  3L4P A;  4LLG M;  5BMG A;  1VZ8 A;  1QKZ A;  4YT0 B;  5H8Y E;  2WXQ A;  1K53 A;  3Q7F B;  3VRB B;  4DOE A;  3AE9 B;  4D4B A;  1C79 A;  5G5H A;  1TN8 B;  1GXM A;  3P4R B;  3Q8E A;  4CE7 A;  1TS2 A;  2G0D A;  4WH4 A;  3MC0 B;  1DCE B;  1AW7 A;  2E3T A;  4AYR A;  1ET9 A;  1SEB D;  1CZP A;  2WNM A;  2BW2 A;  2LHE A;  3TEY A;  1DOG A;  1NL4 B;  1SQC A;  1N4S B;  1SE4 A;  2E6X A;  1FCE A;  1G87 A;  1WU6 A;  1B1Z A;  1Y56 A;  2JXT A;  1L6U A;  4PT5 A;  3PYB A;  3ZJT A;  2F0Y B;  1O1T B;  1YN3 A;  1SBB B;  1KH0 A;  4DOD A;  4OHJ A;  4C7Y A;  1XF5 L;  4GTT B;  4C1S A;  4YSX B;  2DWQ A;  2Q5W D;  3GB1 A;  1TNZ B;  1EU3 A;  1QIL A;  5KKB A;  1R7S A;  1GHQ A;  3RSY A;  3U2S C;  3HXB B;  2Z8L A;  4AYP A;  2INN E;  2SQC A;  2GOX A;  2QNO A;  2WII B;  1XLO A;  4ZHO A;  2WXR A;  1D6E C;  1V1P A;  2WXH A;  1PUT A;  2WYN A;  3P4Q B;  4OW0 A;  3WKF A;  4RGO S;  3AB5 A;  1KKT A;  3TEX A;  1SF0 A;  1KLG D;  4XDD A;  1XXG A;  1KFY B;  5AUI A;  2CQT A;  4ZG8 A;  1GAQ B;  1C3D A;  1UWX A;  1J7B A;  1XW2 A;  3FAH A;  1GB1 A;  2V3N A;  2WXL A;  3SDT A;  4QT9 A;  1YMH E;  4EL8 A;  3AE2 B;  4P16 A;  2RGK A;  2H6H B;  1IBX A;  4GTS B;  1ZXI A;  2EAC A;  3BWU D;  4Q2J A;  2BT6 A;  2MJE A;  3WIW A;  1I4H A;  3M77 A;  2KN4 A;  1YJJ A;  1QBQ B;  3UI3 A;  1DOY A;  4GL3 A;  2CJO A;  1C4C A;  3AEG B;  1UG9 A;  1UNS A;  3AEB B;  1NYR A;  3P4S B;  1N60 A;  3W5V B;  2KWD A;  5GXG B;  4BOJ A;  1KZP B;  1H37 A;  2ZIR B;  4AYO A;  1UWM A;  3NVZ A;  4DXG A;  2H6G B;  1O6R A;  1RWS A;  1E6E B;  1XWT A;  1MHX A;  2PTL A;  2D5G A;  1CEM A;  3Q73 B;  1HZ5 A;  3S4D A;  1NI3 A;  2GRI A;  2TSS A;  1RFK A;  1FMI A;  3AH7 A;  4RGM A;  1H12 A;  1W6J A;  1C76 A;  5GY3 A;  3SFE B;  3WCQ A;  2JG0 A;  3WKI A;  1FO4 A;  4GTM B;  3SEB A;  3E30 B;  4OZA A;  1FPP B;  2K22 A;  1T6B X;  5T8I A;  4GTR B;  3VR8 B;  1IGD A;  3HVZ A;  3U52 E;  3WIR A;  3S4C A;  1FD6 A;  3E32 B;  1EWC A;  1L0Y B;  4ZYS A;  2WXK A;  3E73 A;  3S4A A;  1BUI C;  3PZ7 A;  1JRP A;  2AQ2 B;  2JQR B;  2A73 B;  3HXC B;  1HQR D;  2YEP F;  3QG0 A;  3QWT A;  1O5M B;  2WLB A;  2H6I B;  4EE2 A;  2J42 A;  3BVM A;  4LTU A;  4XWW A;  3KWL A;  3QRY A;  5AUK A;  1I4P A;  4ZOH C;  2M19 A;  2BTE A;  5BMH A;  3PZ1 B;  3KLS X;  1ZUD 2;  1KRF A;  2IGH A;  2JJB A;  2WXO A;  4D4D A;  4GLS C;  4OVZ A;  2FV0 A;  3M75 A;  1F0Z A;  2OKX A;  4WAF A;  2R2L B;  3BII D;  3T33 A;  3I57 A;  3TEZ A;  1S64 B;  3CWI A;  1TNB B;  1ESF A;  3ZJU A;  1X81 B;  3W7X A;  1SE2 A;  3ZYY X;  1TNY B;  2MH7 A;  3H2W A;  1LD7 B;  2GI9 A;  4Q88 A;  1OQQ A;  2B4F A;  2EAB A;  3G6J B;  2NTS A;  3NVV A;  1PGB A;  3ON6 A;  3D3I A;  1JS4 A;  1NVI D;  3ZJV A;  4C80 A;  4IKG A;  3EZ8 A;  2N0S B;  2JF4 A;  3EU5 B;  2WXM A;  2GH4 A;  4D94 A;  4XDC A;  5FO9 B;  2WY8 A;  3HVD A;  2JYT A;  4ZH1 A;  2VN4 A;  1NYQ A;  1YQ4 B;  2KDM A;  1L4D B;  2BED B;  3FIL B;  1D5M C;  3AE4 B;  3Q7A B;  3SFY B;  5EE9 A;  5C3J B;  4L9P B;  1HXY D;  3GLY A;  3QT9 A;  3QDE A;  4N6E B;  4ZHP A;  1YJI A;  1VDV A;  4B0E A;  5BMI A;  3SAE A;  3RX8 A;  1EM7 A;  2I38 A;  2FUZ A;  3HXE B;  4ZRP A;  3HXF B;  1CK1 A;  2PIA A;  2WXF A;  3E33 B;  1KRH A;  4DQO C;  1N95 B;  2L52 A;  2WP9 B;  1FMA D;  2GB1 A;  1T3Q A;  2IJ0 A;  2H89 B;  1FT2 B;  1HEZ E;  1SA4 B;  2BS3 B;  2QJL A;  3Q69 A;  1FNW A;  3DSS B;  4AQ7 A;  2B39 A;  2RPV A;  5HG2 A;  2IPK D;  2ZIS B;  1GSZ A;  2AX5 A;  4OZB A;  2D8L A;  3IAM 1;  3M7E A;  3WKG A;  3Q8B A;  3BZD B;  4FXG B;  1OQR A;  3N9Y C;  3OWE B;  3C72 B;  1Q10 A;  2PVO D;  1KFG A;  3LXF A;  1XEE A;  1H3A A;  1SE3 A;  3RX5 A;  2DRS A;  2K9X A;  4RH6 A;  4KGT A;  3Q8F A;  1DOI A;  3AEE B;  1NI1 B;  3BYY B;  1FCC C;  1QOB A;  4Z4J A;  1TNO B;  1CQV A;  3SQC A;  5CZL A;  4HRO A;  2KQ4 X;  2LFI A;  2RDH A;  1IUE A;  3EGR A;  5FOB B;  2N9K A;  1TZO A;  3SFD B;  1VZ6 A;  1T5X D;  1C78 A;  1ZDX A;  4YTM B;  5GW7 A;  3AEF B;  4NJC A;  3EUB 2;  3MJ5 A;  4NZL B;  2YEP B;  2RI8 A;  1H13 A;  4BOK A;  1H14 A;  3P63 A;  4L2Y A;  3BYT B;  1WU5 A;  1XCQ L;  3NRZ A;  5HHD G;  5DGR A;  4ARC A;  3Q8C A;  1N63 A;  1G9J A;  1QSJ A;  1ROE A;  1SSN A;  3I9V 1;  3NS1 A;  2QMT A;  3TF4 A;  2ZW0 A;  4J5T A;  1O1R B;  4R3D A;  2WXP A;  3HXD B;  4ZRQ A;  5FKA C;  1DGJ A;  3X17 A;  2OED A;  1QOA A;  1KS8 A;  2BS4 B;  1V1O A;  4WUR A;  4B0M A;  3W7U A;  4A90 A;  3TEW A;  3T3N A;  1AYX A;  1GLM A;  3DSX B;  1K50 A;  2LHD A;  4WVC A;  1N62 A;  4MM3 B;  2V8J A;  4KKI A;  1CJE A;  3MP9 A;  2I2Y A;  2ACZ B;  4HEA 1;  5CA3 A;  2X38 A;  1K51 A;  4LNG B;  2LGI A;  1SA5 B;  1KWF A;  4RCO A;  1ET6 A;  1UMP A;  2PKO A;  4A8X C;  5GZK A;  2WXI A;  1C9F A;  1QOF A;  5BYQ A;  2V8I A;  4CJ1 A;  1HZF A;  3AEA B;  4MAC A;  4H2A A;  4YSZ B;  1TKY A;  3EQA A;  3NVY A;  1KSD A;  3QXQ A;  2EAD A;  1SJE D;  1E7P B;  1H36 A;  1TY0 A;  2JZP A;  5H92 C;  2WXG A;  3RX7 A;  2HTM E;  1NC5 A;  3D5S A;  4MBG B;  4JJJ A;  3WUX A;  1GOZ A;  3C8Y A;  3T3O A;  1GPX A;  1GAI A;  2IGD A;  2XFG A;  3BVG A;  2Z07 A;  1MVK A;  1NEN B;  5M7Y A;  1XLN A;  2EKI A;  3ANJ A;  3DRA B;  1RM6 C;  2L83 A;  4WIP A;  3QPF A;  2BS2 B;  2PVG C;  2W82 A;  4JWS C;  1ZE3 D;  1VZ7 A;  1D4B A;  4WU0 A;  3BK2 A;  2FBA A;  3AMZ A;  3O13 A;  3U4E G;  3W9C B;  1P7E A;  1HZ6 A;  4GTO B;  4YSY B;  3RJ3 A;  3B2G A;  3ANK A;  3PZ2 B;  5EE3 A;  3R8B A;  2DYO A;  3W7S A;  1C77 A;  2H6F B;  3KQ4 A;  1QT9 A;  4WQM A;  4Q2B A;  2WQY B;  1JCK B;  1TF4 A;  2CQS A;  2BB6 A;  1IA7 A;  2QIL A;  1D8E B;  3URY A;  5FO8 B;  3EA6 A;  1LF6 A;  3W5U B;  2MEK A;  1FBW A;  3Q78 B;  5FR3 A;  5FO7 B;  3W7W A;  1F2R C;  2KAJ A;  4MU9 A;  3AN1 A;  1LO5 D;  4XWT A;  1D5Z C;  2LJI A;  1H3B A;  3AE6 B;  1FFU A;  2DYM A;  5I4D A;  4N58 A;  3OXU A;  1JWU D;  1TKG A;  1SB3 C;  4RNA A;  4ARI A;  4ZH5 A;  1N5W A;  5JXV A;  1I4R A;  2PN5 A;  1F9D A;  3HUI A;  1FRR A;  3R2T A;  2XWB B;  3IT6 B;  2J53 A;  1BML C;  1DL2 A;  1ULV A;  3DSU B;  3W1S A;  1KF6 B;  3TUO A;  2IGG A;  4N59 A;  5MPO A;  4GTP B;  5HI1 A;  3PYA A;  3P4P B;  3ACT A;  1AWD A;  2V4I B;  1ENF A;  2XN9 C;  1E10 A;  1E0Z A;  2JX5 A;  4KKJ A;  1G6I A;  1WSP A;  1JCR B;  3M7C A;  1AN8 A;  1FXA A;  1MPE A;  2G9H D;  2QEJ C;  4USA A;  1QQF A;  1V5C A;  3IXS A;  4US8 A;  1LD8 B;  4AYQ A;  3E56 A;  5BYS A;  3VXD A;  3M71 A;  2VZK D;  4YWG G;  1CLC A;  3KSL B;  4XUV A;  3P1M A;  2CU3 A;  5EE0 A;  2AQ1 B;  5LNK 1;  3ZGZ A;  3P2C A;  2NVP A;  1K52 A;  2NTT A;  2J4X A;  5G5G A;  1UUP A;  3E9S A;  2FE8 A;  1H54 A;  2LMC A;  4YTP B;  1I4G A;  3RFZ B;  3M7L A;  2VN7 A;  5EE1 A;  3EUV B;  1JRO A;  4KGR A;  1FNU A;  2ON8 A;  2BB5 A;  1VD5 A;  4LNV A;  1ZOY B;  3H7L A;  1NXC A;  1S63 B;  2DRO A;  3D5R A;  3SDR A;  2WU2 B;  4WWM A;  4CQN A;  1AYF A;  1L2A A;  1EU4 A;  3NZ3 A;  5E6J A;  5HFY A;  3E37 B;  2N9L A;  4HKZ E;  4V1R A;  3LB8 C;  1MZC B;  4TXT A;  2W3S A;  4NAW B;  1R76 A;  1VJK A;  3LYY A;  2AFA A;  4RGN A;  1F2R I;  1D8D B;  2V3P A;  3B9J A;  2QSD A;  2L1A A;  1JCS B;  1IA6 A;  1JWA D;  1YQ3 B;  1YNT E;  1P7F A;  1VLB A;  5JPM B;  3M74 A;  1JWM D;  2DBY A;  2WDQ B;  2AHF A;  2F6D A;  4WVB A;  3SFX B;  4CJ0 A;  2DLB A;  2Y5P A;  1DYQ A;  1F9O A;  1KZO B;  3H8H A;  4JWU C;  3CU7 A;  1RYJ A;  1V7X A;  1N9A B;  3SDU A;  3S4B A;  1JW9 D;  1WU4 A;  4KGS A;  1JCQ B;  2WXJ A;  2W3R A;  4AS1 A;  3CIR B;  1AGM A;  1H35 A;  2WIN B;  4JPS A;  1FIQ A;  3RRS A;  4TF4 A;  4YDO B;  2JSV X;  3ETR A;  2OHF A;  1FP3 A;  4REZ A;  4TQ1 A;  3S9V A;  2R61 A;  3TSS A;  1C4A A;  1HA5 A;  3J9C A;  2I07 B;  3EU8 A;  3GZK A;  1STE A;  3M73 A;  1SXT A;  1ZXH A;  2FBW B;  2LEK A;  3PZ3 B;  4FXK B;  3VR9 B;  2V0G A;  3QFZ A;  2L32 A;  2ONQ A;  2JU6 X;  1MHH E;  1L1Y A;  2M0A A;  3V3X A;  1JQ4 A;  4D2K A;  5BYR A;  2NOJ A;  1A70 A;  1FO2 A;  2G02 A;  3DWM A;  5JPN B;  1J7A A;  2CJN A;  5CD2 A;  1WRI A;  1N61 A;  3WC3 A;  3SDQ A;  1N5X A;  2J52 A;  2K0P A;  4L23 A;  1L5P A;  4GDK B;  3QT3 A;  3VW5 A;  1J7C A;  2XWJ B;  3ZQ4 A;  5TSS A;  1L0X B;  1V8C A;  4NAM A;  2PW9 A;  3SDV A;  3AE5 B;  2IEJ B;  2SAK A;  4HKQ A;  3QFY A;  5DGQ A;  2BYT A;  4RFB A;  1QQR A;  4TMA B;  1FCL A;  4JE3 B;  4RF0 A;  4FUS A;  3E6U A;  3P5R A;  4US9 A;  1TY2 A;  1SJH D;  3AE8 B;  4GTV B;  5MEH A;  1M4V A;  2IDY A;  4IDI A;  4YTN B;  1X9D A;  2AHG A;  1D5X C;  3AE3 B;  2M56 B;  3NVW A;  3M7B A;  1EWY C;  3P5P A;  3PZ4 B;  4KTP A;  1FM0 D;  2A8Z A;  4IOI E;  3R2I A;  3NUH B;  1MI0 A;  4YDE B;  1C4P A;  1SIJ A;  1YN5 A;  1N4R B;  3SR6 A;  1N4P B;  4TQ0 A;  1TNU B;  2FUG 1;  3M78 A;  4LIX A;  1PFD A;  3ACS A;  1XCT L;  1PYW D;  4A55 A;  4A9A A;  5D3I B;  1WGK A;  2ZBL A;  5AGD A;  2WXN A;  3W5N A;  1QF6 A;  5FK9 C;  2JWU A;  1I7H A;  2LUM A;  4XE0 A;  3VRA B;  4A6Q A;  3Q79 B;  1KLU D;  1XO3 A;  4P6V F;  1V7V A;  1QOG A;  2ZW1 A;  3A3V A;  1KSC A;  1YN4 A;  1FNV A;  2N7J A;  1IBX B;  1O1S B;  1O79 A;  3WKH A;  1ACC A;  2GZ6 A;  3BK1 A;  4GTQ B;  2K5P A;  3IT4 B;  2PLP A;  3PO0 A;  4C7Z A;  3W2D A;  1RQ5 A;  2SEB D;  2ZZR A;  1TKE A;  2MJD A;  4ITK A;  3KSQ B;  3DSV B;  3REN A;  1PDX A;  2G1E A;  2JYE A;  1FFV A;  4L1B A;  1TJE A;  1V5D A;  2DRQ A;  3IAS 1;  4V1S A;  3M72 A;  4KTR A;  3AE7 B;  3KLS A;  1L6V A;  2INP E;  1KTK A;  2Y5C A;  4KX6 B;  3P42 A;  4HJG E;  5C2T B;  2WY7 A;  1GXO A;  3WIQ A;  5M7I A;  1TS3 A;  1L0V B;  1UGJ A;  3QSP A;  1WYG A;  3VQI A;  2ICI A;  2KAC A;  1TS5 A;  4LK0 M;  1NEK B;  3FIL A;  2RMM A;  2AQ3 B;  4UDU C;  3B2F A;  1O6Q A;  3AFJ A;  3W5M A;  1TS4 A;  1GB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...