2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gastric intrinsic factor
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
1NI1B 4KKIA 2PN5A 4L9PB 2V8JA 3D5RA 1LD7B 1TNOB 2B39A 1C3DA 2PMVA 4GTPB 1R76A 4BOKA 5JPNB 1X81B 1LTXB 1TN7B 1H36A 4GTOB 1UMPA 1D8DB 1N9AB 2F0YB 2GOXA 1FT2B 2XQWA 3PZ1B 1H37A 3KQ4A 2BEDB 3KLSA 2XWBB 1H3BA 1QSJA 4D4CA 4GTTB 4D4AA 1D8EB 3HXCB 1NL4B 1GXMA 1LD8B 3PZ2B 3EUVB 3D5SA 5AGDA 5FOBB 1TNUB 2R2LB 2XWJB 3C72B 2WIIB 4V1RA 1GSZA 3E37B 2ZIRB 1SA4B 4EHMB 1H39A 1TN8B 4V1SA 5JPMB 4MU9A 3KSLB 4D4BA 3K7XA 1O6QA 1SQCA 4GTQB 1O1TB 3OXUA 4ONTA 2V8IA 3Q7AB 3SFYB 3CU7A 2A73B 1H3AA 1TN6B 3Q73B 4LNGB 3SFXB 3Q75B 3E34B 3HXFB 3Q7FB 1O6RA 1S64B 3E32B 3RJ3A 3HXDB 2I07B 4M76A 1O6HA 1H35A 1TNYB 4GTVB 4MBGB 1TNZB 1GXOA 1KZPB 4FXGB 2H6FB 3KSQB 3SQCA 1N94B 1W6JA 1HZFA 2H6HB 4D4DA 1JCRB 3HXEB 3DSVB 3DSXB 3G6JB 5FO8B 4D94A 1O1RB 2IEJB 1O79A 1KZOB 3PZ4B 2BB5A 2BB6A 5FO7B 2V8KA 1O1SB 4ZH1A 4GTSB 3DSTB 5FO9B 1DCEB 4YDOB 4C1SA 2V3PA 3DPYB 2H6IB 1QQFA 1H3CA 3DSWB 4ZRPA 1FT1B 3OEDA 2H6GB 1W6KA 2SQCA 1FPPB 1O5MB 1MZCB 1QBQB 4GTMB 2V3NA 4ZRQA 1N4RB 3E30B 1SA5B 3DRAB 4LNVA 1N4QB 1N4PB 2WINB 1S63B 2G0DA 2NOJA 3PZ3B 1N95B 4GTRB 2WY7A 1TNBB 3E33B 1GHQA 2G02A 3Q78B 4KKJA 1N4SB 4YDEB 2WY8A 2ZISB 3EU5B 3Q79B 1GXNA 1JCQB 3U7ZA 3DSSB 4LNBB 4BOJA 2BBCA 3DSUB 1JCSB 4FXKB 3HXBB
chains in the Genus database with same CATH superfamily
2HE7A 3B2FA 3R8BA 2WXHA 3FKYA 1J7BA 3QIJA 3Q3NC 3CIRB 2KDEB 2GBJA 1I4GA 2L0TA 1FT2B 2IY1B 2ZJDA 4M00A 2RSUA 3KQ4A 1KRHA 1S3SG 4PS8A 3R7RA 3DVGY 4BVUC 1JWSD 1YQBA 4FJYA 1C4PA 3OWEB 1TF4A 1WRIA 3R2IA 5BYQA 1ZXHA 2ACZB 3QJZA 3WCQA 3HK0A 2ZPNA 1AN8A 2OKXA 4ARIA 1O6QA 1KSCA 5IL3A 4ZRKA 3VDZA 1H3AA 1G9JA 4EL8A 3W7TA 1ENFA 4II3B 3MHZA 3SFXB 3Q75B 1IGDA 3VSNA 5L95C 3BYYB 2QHOA 2CKHB 4W9HA 4E3CA 1C78A 5BMIA 5GZKA 4RGTA 2IGGA 3TF4A 5T8IA 2ZW1A 3KUDB 1I42A 2L3ZA 3PRPB 1N7RA 2PVOD 1LOHA 3ETRA 1O1RB 3VH4B 3PYAA 4AJWA 4H2AA 4HDQA 1JW9D 4DHJD 4TMAB 1TZ1A 2D2QA 2WNMA 4F7ZA 4M8MA 5FO9B 1KWFA 3ZYYX 2WYQA 4LK0M 4PS7A 2UWQA 4MGKE 1FFVA 2KFKA 2ZEQA 2WP9B 4WWOA 3DSWB 1H13A 1W6KA 2WXIA 1H12A 3WKIA 1JRUA 2EABA 2V3NA 3WAOA 3H9DA 4OZBA 1TTNA 1WJ6A 4M0WA 3BWUD 1S63B 3NNBA 2YIKA 3BVMA 3T8MA 1TNBB 4GLSC 1LGRA 3QWZB 2KFKB 1JCQB 2NCNA 5TR5A 2CJNA 1IP9A 3N32A 5MPOA 4M0WB 3ZKJC 5E6JA 2A5UA 4WH4A 4GTPB 1KM7A 1QZEA 3N1XC 2ZZPB 2CHWA 3BZDB 4KZ0A 4FA6A 2BRPA 3PZ1B 3KLSA 4D2KA 5IL8A 1J0MA 1WR1A 1D5XC 2L83A 4RGMA 4XX5A 2X03A 1GXMA 4US8A 3HVDA 3WALA 3D5SA 1IPGA 1F2RC 4DQOC 1UGJA 2KQ7A 2YVCA 4IWPA 1FRDA 2W9NA 2ZNVC 3QARA 3ZXRA 3M75A 2MCNB 2E6XA 3P4SB 2E24A 2JSVX 4AWJA 1NVID 2OEDA 1FRRA 1D5ZC 4C80A 2BYEA 2ZZRA 1WGHA 3WIRA 3QQ8B 4G0NB 3EGRA 1FFUA 1RQ5A 1K8RB 1UG9A 1XF5L 1UWXA 2EACA 3TUOA 3T3OA 3PT2B 4A9AA 2WXLA 1TNZB 5D3DA 1H54A 2XFGA 2BWES 3S4CA 2ZVOA 3M76A 1JS4A 1I7HA 4A8XC 2V3SA 3QK0A 3FILA 1XCTL 2Q1FA 3AE5B 5IOIA 3VUYA 1X1HA 4BKSD 4O1NA 3ZVVA 2Y5BB 2FUZA 1I4PA 3ZDTA 2L1AA 5CHFA 5D3IB 1J0GA 4YSXB 2V8KA 1TS5A 1J8CA 3R3MA 2WYNA 3T33A 3VUXA 3ZIMA 5HFYA 4KTPA 3W5NA 5E6PA 2M19A 3FILB 4ANXA 4WQOB 3PGEA 1N6ZA 2LUEA 4ZDVA 2KDBA 1I4RA 2MRPA 4MGYE 1W3YA 2ZPYA 2DRRA 1GOZA 1TT5B 3ANIA 3GLYA 1GA2A 1AARA 1WJNA 3ZRFA 2BYVE 1T0QC 3C0RB 2LASA 3W1SC 1ROEA 3D5RA 2C5LC 1C3DA 1WWTA 3SFDB 3DBSA 4A20A 3M01A 2W82A 1H36A 3QT3A 2LEKA 2RD0A 1F9DA 3M71A 3DDCB 3WANA 2INNE 2FBWB 4ICUA 1RWGA 4I6NB 1KLGD 4WWMA 1V1OA 4NZLB 3AULA 3M95A 4L6XA 1STEA 1WZZA 4N6EB 1SE4A 3WIQA 3DBHI 2PPHA 3DCGA 1F9GA 1CJEA 4HDOA 3M7LA 4WJNA 3URYA 1TY0A 2C60A 2AHGA 4TXTA 3PS6A 1NXCA 3BYTB 4L23A 2GI9A 1TN6B 1P98A 1G6IA 3I57A 2R2OA 1KH0A 3JYUA 3SDRA 3H8HA 2SAKA 3H3KA 2DHZA 1IYFA 3AEDB 1IGCA 1FNUA 3VW5A 4UDUC 2EKIA 3QXQA 4K1RB 3SQCA 4CJ1A 1N94B 2LHEA 2BW2A 2H6HB 3P2BA 1H4RA 2M0XA 5AZHA 4WVCA 2FAZA 2IEJB 3M7CA 3RSYA 3W7SA 1WE7A 3WAMA 1YD8U 1EGUA 3OLMD 3Q2AC 3BK2A 4KSKC 1PYWD 1ZKHA 2AFAA 2EADA 4RFBA 4EOYA 2MP2A 3Q3FA 2KX3A 2Y5CA 5JHBA 3JW0X 3KYCD 4IM3A 3Q8EA 3TCAA 4CQNA 1NI2A 1TS3A 2M8SA 3M72A 3A1QA 2L32A 3E30B 1RWAA 2D5GA 1N4QB 3U8ZA 2WINB 1RM6C 5G5GA 1LXDA 2WY7A 2LI5A 2K22A 4KKJA 4JWUC 4JWSC 2MP2B 1T6BX 1HEZE 1CMXB 2BQQA 3DSUB 2CU3A 3A1QB 3KW5B 2MQJA 3NY5A 3PHWB 4YL8A 3NHEB 5BYSA 2N9PC 3DVGX 3TMPB 2O6VA 4DWFA 2G4DB 1EF1A 2DZMA 1I4HA 4WJPA 4GTOB 2NBUA 1D8DB 4W9JA 1L2AA 1WY8A 5CA3A 4DHZE 3VVWB 2RDGA 3WC3A 3KWVA 2FE8A 2MBQA 1AYXA 2WXGA 5IK6A 2O6VB 3K9PB 2OOBB 4WU0A 1KFYB 3E37B 1K52A 2LWPA 1WGKA 3RZFA 2ZNVB 3AE3B 3D3IA 3SD5A 1C79A 1NENB 2BS3B 2BTEA 4NJCA 2KO3A 2A73B 3M02A 1M4VA 3PLUA 2K3UA 3E34B 3HXDB 4M76A 2ONGA 1MHXA 4RNAA 1RWHA 4Q88A 4XWTA 3JSVA 2NTSA 2W3RA 1NYRA 5IP4D 2H6FB 3PMMA 3QG0A 1V49A 3DBLB 4Q2BA 2JYEA 2DYBA 5ILJA 2IO2B 4USAA 1V81A 4JLCA 4WQMA 3JSVB 2DYOA 4E71A 4YTMB 2I2YA 4RGOS 4YTNB 4EUTA 1NYQA 3N0GA 2DRSA 1Q10A 1TZOA 3PHXB 1WU4A 3EU8A 3M78A 3NVZA 4F13A 1ZDXA 1FCLA 3RT3B 3W1SA 1R4MI 3PLVA 3ABVB 1XLOA 3A0OA 1JWBD 3A33B 1GUAB 4LNOA 3EU5B 3Q79B 3E9SA 3AE9B 4M02A 2NBWB 3AU4A 2WX1A 4C7ZA 2LVPA 2PN5A 3DHIC 1GC6A 4KSLC 2XK5A 3ZGZA 1R76A 3AE2B 1LTXB 2KLCA 1E8ZA 3RYTA 2V0GA 1HE8A 1F0ZA 1N9AB 2F0YB 1LM8B 3C8YA 2N0SB 2GOXA 3A3VA 3WKGA 1KFGA 1V80A 1H37A 2JWUA 3ALBA 2IPKD 2KJHB 2DX5B 3L0WB 1WH3A 2XK5B 3PPAA 4BAXA 4AOFA 3EUVB 4A55A 4XC2A 4HCPB 3X23A 3C72B 3M73A 1GSZA 4HKQA 4FJQA 3MP9A 1TS2A 2FIDA 2CQSA 2J0KA 4R3DA 2KJ6A 1N7NA 1L0YB 5ILIA 4N58A 2V8IA 2N7EA 1D4BA 4DODA 1T3QA 4LNGB 3GP7A 3APCA 2DWQA 3APDA 4XE0A 1VD2A 3IAS1 3IVFA 4MMHA 1N24A 3QC8B 1DOIA 4K7UA 5BO4B 1VDVA 3H7SA 3IT4B 4JGHB 1BXTA 4NJ7A 2BB6A 2KC1A 1WU6A 2WXOA 4AQ7A 2BRVX 4P6VF 2J53A 1GAIA 2KWCA 3AV8A 1F9OA 2ZBLA 2KK8A 1WSPA 2LZ6A 5FR3A 2EELA 3EUB2 3NS8A 1UNSA 1FO4A 3ONSA 2A4ZA 3TL5A 2N1WA 3W1YA 2JXXA 2AL3A 2MEKA 1PUTA 3T9LA 3RMKC 2NR2A 1D6EC 4CJ0A 1V2YA 5IO9A 4ZOHC 1C82A 5M7YA 3S4DA 2PJHA 2ON8A 1XWTA 4HCNB 1WXMA 1UD7A 1FXIA 2PE6B 1B9RA 3OG5A 2JVCA 2DAJA 4KDIC 3MJWA 1UMPA 1FEHA 2KANA 2GMIC 5D2MB 2XQWA 2N9XA 4IW0A 2B4FA 4NAMA 3DOWA 3N0FA 4MM3A 4NPNA 1Y56A 1V5CA 5IA7A 1ZDVA 3A9KA 1DOXA 5HHDG 4TV3A 3PZ2B 2NVUI 4W9KA 2JJBA 4FJVB 2KNBA 2XWJB 5EE1A 1XLPA 4HPMB 2D3CA 5LLIA 4EHMB 1WXAA 4MM3B 1YIWA 5ILKA 5DPTA 2DZKA 4D4BA 3A9KB 1P0RA 2FCSA 3CU7A 3KVFB 2CHXA 1VZ6A 2V4LA 3P63A 2BT6A 3DHGC 3Q73B 3ZJVA 3NOBA 2AQ2B 3U30A 3N20C 3Q7FB 5D94A 2IDYA 1S64B 3NVVA 5G2NA 1MPEA 4F1SA 1P7FA 3GOEA 1WI0A 1XXGA 5GMVA 5KHOA 2E22A 1C76A 1PFDA 3E7JA 2WWZA 3R66C 3CF6E 3RN9C 2KMMA 2WXPA 4TUUA 4WWNA 2RR9A 1WFYA 1NBFC 3HXEB 1ACCA 2KOXA 3VUWA 3DSXB 3QFZA 2Z0DB 1D5MC 1RRBA 5AZFA 4S17A 2N9LA 4MJSA 1HM2A 3PV1A 3PZDA 3APFA 3AM9A 4GN1A 3QXFA 1OGWA 3TEYA 3NZUA 1UT9A 3MJ5A 2KYWA 1GJZA 1XO3A 1DCEB 2N7JA 2WDQB 3VRBB 3K11A 4KIKA 5EE3A 3OEDA 2M17A 3VTWA 4LJOB 2DRQA 4MJSB 4W9LA 5CHWA 3DRAB 1F9JA 2KKCA 5J17A 4EEWA 1N23A 1FIQA 2E3TA 4WVAA 4URKA 4CE7A 3NUHB 2N9KA 1SGHA 4FUSA 4KIKB 1VJKA 2K0PA 3WIWA 4B95A 1SSNA 3AEBB 4KKIA 2O6VD 4FXCA 1QOBA 4HRSA 1YJIA 2KC2A 3LYYA 1KREA 2B39A 2X8XX 1K50A 2FV1A 5CD2A 4FN2A 3SDUA 1SEBD 4C7YA 1WMHA 3RX8A 1E8YA 4KVGB 4GDLA 2BF8B 1MG4A 1N20A 4GIVA 3NZSA 1RWSA 1RWFA 2PIAA 3K9OB 2D8LA 2K39A 2FBAA 1V86A 2MJDA 3FC4A 1WMHB 1UGMA 3M7BA 3Q3OC 4GDLB 2AQ1B 2RPVA 1OJMA 2BYTA 3ECIA 4P16A 4CHKA 2KDMA 4V1SA 4MMIA 4XYCA 1O1TB 5FKAC 1AGMA 5IN7A 4WAAA 4HKZE 4RM8A 2K6DB 2DAFA 4FLHA 3Q3MC 1O6RA 4HXDA 3NFVA 3NZ3A 2FCMA 2VN7A 4YSZB 1I35A 3SR6A 3RX5A 2D07B 4NAWA 1XQQA 1WX9A 4PYZA 1V7WA 2NPTA 5FO8B 3CWIA 3G6JB 1L4ZB 3AXCA 4NEIA 1J7CA 4N59A 3U7DA 2N4FA 4IUMB 5I4DA 5FO7B 4K3BA 1LXMA 3DSTB 4NAWB 3ZRCA 1LO5D 1TGZB 1KSDA 4ZHPA 2RGKA 1VD5A 1WM2A 2NPTB 1X1JA 1FT1B 3RNAC 1QBQB 1N5WA 4BOZB 1JROA 5EAUA 2MH7A 3RULA 1N62A 1L7YA 1C9FA 4HK2A 1GHQA 1RAXA 2ZISB 2LD9A 4MDKE 3SDTA 4FXKB 3HXBB 4IM0A 2V8JA 2V1YA 3MC9A 5LXHA 2JWZA 2M0AA 2PMVA 3WKHA 1C77A 3AFLA 2AYOB 2LGIA 1HXAA 2FIFA 2PKOA 1TBEA 3N1ZC 2AWTA 4AP4C 1V8CA 4OZAA 5L83A 4PK1A 3ENEA 4WVBA 2J0MA 3IT6B 2BEDB 2Y5PA 1GLMA 2REXA 1OQQA 4D4AA 2YLMA 4KGRA 2NS5A 1CLCA 2O2VA 3W7WA 2FUG1 1ZP0B 4NJ6A 4OVZA 3VTVA 2C7HA 1RLFA 3SDVA 3PRZA 3T3NA 3AE6B 4OVUA 2KWUB 3G4DA 5BYRA 1SA4B 3RUIB 5J2RA 4E1YA 5LNK1 4BBNC 4GTQB 4FHKA 2O2VB 3GS2A 3BINA 3KLSX 1XLNA 3M77A 3ZLZA 3V6EB 1KJTA 2MX2A 2ICIA 4FNVA 3RJ3A 3Q8FA 1WXQA 1SF0A 4GTVB 1V7XA 2JZZA 1WF9A 3VH3B 2KLGA 4TQ1A 4AYOA 3A9JA 1HCUA 1F2RI 2CU1A 1X9DA 2EKEC 4D4DA 1J0NA 4EZKA 1TKGA 1JALA 5ILHA 1NEKB 2H89B 3NRZA 4XZ4A 4IWQA 1PGBA 4TQ0A 4ARCA 5ILYA 3AE4B 4ACFA 3A9JB 2QJLA 3M62B 2L05A 5M7IA 3OAWA 2P0VA 2MHJA 2V3PA 2BS2B 1QOAA 5E2JA 2K9XA 2N7DA 2M4NA 2K8CA 1C1YB 2WXFA 1P9DU 4PS3A 2LFIA 3C19A 3DBLI 3L17A 3PREA 2KACA 1QF6A 3LDZE 4OW0A 5IK0A 5DGRA 2JZPA 2QCZA 1F77A 5IKCM 4FJZA 1JRPA 1JWUD 1ISNA 2QNOA 1GXNA 1V5TA 2KTRA 1E8WA 1WZ0A 3DSSB 4LNBB 2BBCA 1VCBA 2C7MB 1TYGB 4WAFA 2IYDB 3EFCA 3ZO5B 4J3OD 1LD7B 1FD6A 5IKHA 3I9V1 2IGDA 1EU4A 3FAHA 3VAWA 1TN7B 4KDLB 4FADA 3WKFA 2KTRB 4TF4A 3Q8AA 1X1IA 2AX5A 1N1BA 2JUOA 1PQSA 2OJRA 2WXMA 2G1EA 4GOCA 4C00A 3M00A 1TKYA 1CK1A 3SEBA 3N9YC 4MGIE 1L0VB 1NL4B 1LFDA 2NBVB 5C3JB 1LD8B 3ZTDA 4GXBA 1WJ4A 2KQSA 2R61A 1P3QU 4E74A 3OJ4B 5LXIB 1QAZA 3KH0A 3NVWA 1N21A 2ONHA 3V62A 1PGAA 1A5RA 4LCDE 1GB4A 2KHWB 5TSSA 3R7QA 1V5DA 1JWAD 3Q7AB 2A8ZA 4WWPA 3ZJUA 2K5PA 4LTUA 4HJGE 2DBYA 3QA8A 4OZVA 1FP3A 2HTHA 3I3TB 4PYUA 5CZLA 3PTFC 1SE3A 4DXGA 3BK1A 2GOWA 2W3SA 4M01A 2KAJA 3VXWA 4G50A 3GZKA 3VTUA 1R4NB 2GZ6A 1DGJA 4REZA 4CYEA 2EMTA 1AW7A 1E7PB 1QT9A 4YT0B 1FO2A 2DROA 4ZRIA 2ASQA 4EE2A 5DCNA 2HJ1A 3RFZB 1KZOB 1FMAD 3IXSA 2R2QA 4OK4A 1S1QB 2BB5A 3P2CA 3AEFB 4GB9A 3P4PB 1OTRB 1H8CA 4WJQA 1JQ4A 1DOYA 4KX6B 4QAYA 1RFKA 5H92C 2Z07A 1UUPA 3PZ7A 4WURA 4I6LB 1MJDA 1TIFA 2C9WB 1YX6B 2X38A 1V1PA 1HXGA 1LXKA 4ZRQA 4HPLB 1N4RB 4ICVA 1L6UA 3E6UA 1NC5A 3AU5A 2G4SA 1UELA 2NOJA 1GAHA 2I38A 3P1MA 3NS1A 2ZVNA 1XEEA 1SE2A 2FV0A 4LNKA 4FHJA 2BRWA 2JF5A 3B08A 5CTRC 1WXVA 3N1YC 1V1PB 1EO6A 3HVZA 2BPSA 3B2GA 1L2NA 1TKEA 3U52E 1KLVA 1E9MA 1QLBB 2JX5A 1G6JA 3VRAB 1C3TA 2M56B 1X81B 3W5VB 1FCEA 3EQAA 3LXFA 4EKUA 3U2SC 5GXGB 1H3BA 4MACA 4F8CB 3QAQA 1LF6A 4AYPA 1QKZA 3ACTA 1K72A 1ZGUB 5CX3A 5AGDA 1HQRD 3L16A 2MBHA 2AQ3B 4NQLB 5FOBB 2R2LB 2WIIB 2GBNA 2KJRA 4NNJB 3BY4B 3S9VA 3BVZA 1CEMA 3RCZA 2WXQA 5JMFA 2J42A 1UH6A 2I1JA 2MW5A 3OXUA 1TS4A 2ZCBA 2ZW0A 4GAXA 3ZNGC 1KS8A 4MELA 3EC8A 1EUVB 5EATA 3E32B 1TNYB 4MBGB 1ZW7A 2KDIA 1I4XA 3L54A 4JQWC 1T0RC 1WGRA 1N63A 3H2WA 4GDKA 1SJED 4MSMB 3ZNHB 2QDFA 1KKTA 4F10A 4DDID 2L0FA 3VR9B 4DDGD 2KX0A 2FCQA 3TIXA 2L00B 1WE6A 3SU8X 4ZYNA 2W55A 2L7RA 1N7OA 1O1SB 2RMMA 2HTME 2BYFA 4GDKB 1WGGA 2INCC 5EE9A 2J52A 1N22A 1VRAB 3MHSD 2RDHA 2H6IB 1DL2A 3H6NA 4A3PA 4ZRPA 1L6VA 2J4XA 5AZGA 4HLEA 5EASA 1O5MB 1SIJA 1IA7A 2KMCA 4ANVA 2HD5B 2JU6X 1UWMA 2B3AA 3AMZA 1P1AA 3W9CB 2G02A 1N4SB 1YOVB 4NY0A 4BKGA 2WY8A 2WLBA 3SHQA 1E0ZA 4IWOA 2D3BA 4OZCA 1NI1B 4N9F4 3LB8C 2NMQA 4FBJB 3S4AA 1E7UA 4MEMA 1GAQB 2G45B 3Q8BA 2HJ8A 4MSQB 4OHJA 3V3XA 1HV6A 2EAEA 4DBGA 4L0GA 4ITKA 1C4AA 3DWGC 1UF0A 5DHKA 1KTKA 3MFGA 1BT0A 1XT9B 3X17A 3DQVA 5HKHA 3Q3JA 2BGFA 2N9EB 4DXFA 2AEHA 2MSED 3WIMA 2LRUA 2KWVB 1IA6A 1X1MA 2CQTA 2BKFA 3AB5A 4P1CC 1H39A 1YN5A 3ML9A 1J7AA 1M94A 4IKGA 1ZUD2 5AUKA 3RX7A 4JIOU 1DOGA 2IO0B 2FUQA 3L10B 2GH4A 3QSPA 2VH2A 4YSYB 1Q5WB 2NVPA 1YN3A 1XCQL 2XNAC 3GB1A 3TEZA 1GXOA 1OQRA 4AYRA 5BMHA 1E90A 3DVNU 5E6NA 1W6JA 2RDBC 2Z59B 3BIID 3VQIA 4BBNF 2WGSA 1EWCA 1HZ6A 1QOGA 1VZ8A 2QILA 4J6IA 2PEAA 2KWDA 4P1BC 3H1UA 1WYWB 4AUQC 2JRIB 1HMUA 1XWQA 4ZRJA 1HTOA 4YDOB 3AECB 2LVOA 3X0WA 1E5WA 1FBOA 2IY0B 2IBIB 3N30A 3DBRB 1Y8RC 4JL9A 1ET6A 4LNVA 4ZH5A 2LXCA 4KGSA 3M74A 2G0DA 3WA0A 2DNFA 5JH5C 4HPPA 3EHVA 1GB1A 5EE0A 1D3ZA 2LJ5A 2MBBB 3ZJTA 1E10A 4PT5A 4V1RA 4YTPB 2EMSA 3N3KB 4W9EA 4K3CA 5EDSA 1T0YA 1WGDA 3HM6X 4RGNA 1QOFA 5DPWA 3MC0B 4HJKA 1SJHD 2PLPA 3W2DA 3QRYA 2AL6A 2FNJB 2BVCA 1N7QA 1WGYA 1DYQA 2MBEA 3WAPA 2XWBB 1QSJA 2KT7A 1FAEA 1D8EB 3PZ8A 2V9HA 2VZKB 5IK9A 4IG7B 3O13A 3W5UB 4EFOA 4C4VA 5AUIA 4RM9A 5JXVA 5BMGA 3UIPB 3P4RB 4L1BA 4MT5A 4BKTA 5DPRA 2L8JA 1AWDA 5MEHA 3M63B 4WJOA 3AN1A 4S0RA 1CQVA 4C4VB 1ZOYB 1QILA 3L13A 2CHZA 3UQBA 3V05A 1KLUD 1P7EA 1MI0A 1H35A 1IUEA 3M7EA 3B1LX 3GZNB 3KUZA 4A90A 3IAM1 1YN4A 3RNEC 1HN0A 2RGFA 1YX5B 1JWMD 1SBBB 2L76A 1HA5A 1TJEA 5IAAC 1CZPA 1GPXA 1JCRB 4W9IA 3G4FA 2F6DA 2TSSA 5ILZA 3IFWB 3AE8B 3PVLA 1UBQA 4G11A 2CJOA 2BS4B 3PZ4B 3OJ3A 4IDIA 1JMLA 2NTTA 2DYMA 1ULVA 2PW9A 1A70A 3QCAA 3ZNID 2I1KA 2N1VA 5GW7A 1AYFA 5C1ZA 3S4BA 4JE3B 3VFKA 4IM2A 1KOTA 1LF9A 3I5JC 1N95B 1GG3A 3V61A 3P42A 1YJ1A 1OEYA 2JT4B 3U7ZA 2J7QB 1Q0WB 4BOJA 2D5JA 2SQCA 2LVQA 2PE9A 4TSSA 3P5RA 1NI3A 2Q5WD 4KTRA 2JRHA 3ZTCA 1PDXA 5JPNB 1Z2MA 4LDTB 4K7SA 1EF5A 2WXJA 3MTNB 1OQYA 2JZ3B 1ET9A 2QIEB 2INDC 3W7XA 3QDEA 3ACSA 3B9JA 1Q1OA 1WZ3A 4Q2JA 2C7NB 3NVYA 2LHDA 3TJPA 1TNUB 2BKRB 1MFWA 4YXDB 2WXNA 2VN4A 2ZIRB 1N7PA 1ZXIA 4W9FA 1V5OA 2DZIA 1TN8B 2CS4A 2LMCA 3KWLA 5JHAA 3DWMA 5JPMB 1FNWA 3KSLB 3ZW3A 3K7XA 3AI5A 5CHVC 4LLGM 5IM1A 1WM3A 2WDRB 3RI7C 3SFYB 2LXAA 3Q69A 2G9HD 2MLBA 1HMWA 1VZ7A 2BWFA 4ZG8A 4OK2A 3VHTC 3ZDMC 2IO1B 2I07B 2KN5A 2GRIA 3UINB 2MA9B 1SIFA 4EZJA 2RI9A 1RWCA 1E7VA 3PO0A 4QT9A 3PSEB 3M3JA 2DZJA 3AEAB 2DENB 1HZ5A 2UU7A 4ASWC 3TEXA 2KD0A 1WXSA 2KTFA 2KVRA 3ML8A 2GBKA 4J5TA 1K51A 3A4SC 3I63C 5KHQA 3UQAA 1J19A 1GNUA 1MVKA 2HDEA 3DPYB 1FMIA 1R4NI 5JMDA 4KGTA 2H6GB 5G5HA 1MZCB 1SA5B 2WS3B 1E8XA 1HTQA 3D32A 3QWTA 4A3OA 4RCOA 2V4IB 3H7LA 1I8QA 3SAEA 3RD2A 3E33B 2KFJA 4YDEB 1Z5SB 4GGQA 2JF4A 4W9DA 3O65B 3S2AA 2YEPB 1JCSB 4JX1C 2KN4A 3AEEB 3SDQA 4BZAA 3ANKA 1F1SA 1RYJA 3QHTA 1XLQA 1HM3A 4OZWA 3AE7B 2K1FA 5AEKB 4ANUA 2GLSA 2XEWA 1BUIC 3SFEB 4XGAB 2XN9C 5JZEB 2WDTB 2Y3AA 1K53A 1VLBA 3VSMA 3UGBB 3H7PA 3QPFA 1ZE3D 4RF0A 3A4RA 2JXTA 4US9A 5C2TB 4JPSA 3ZQ4A 3RNBC 3RNFC 4Z4JA 1FBWA 4OVVA 3H7PB 4YWGG 2MJEA 1SQCA 3J9CA 1L1YA 1BMLC 5FK9C 3AEGB 1V7VA 3L08A 3UIOB 3QX1A 2VRRB 1OJOA 1WX8A 3B0AA 5E6OA 4XWWA 4EZLA 1KRFA 2RPQA 5DPSA 4IOIE 2IZVB 1FCCC 2OJWA 2VH1A 3KSQB 2G3QB 1LQBA 4HVBA 1V97A 3VXDA 3DSVB 2WXKA 2WXRA 3HRDD 3ZNZB 3EZ8A 2OHFA 1N1ZA 1T0SC 1G87A 3CMMB 4C1SA 3IHPC 2IO3B 1L4DB 2KZRA 4MH8A 4BOSC 2WHIA 1FPPB 4GTMB 5IKAA 2D3AA 2QEJC 4DI5A 1FNVA 1N4PB 1N5XA 4GTRB 3ON6A 4XUVA 1GC7A 3AE1B 4DHJB 3Q78B 4HROA 3LZ9A 1FO3A 4RH6A 4XDCA 2MBOA 4W9GA 2LRWA 2QSDA 2K6QA 4LNFA 4NQKE 3EFUA 2DLBA 1UBIA 2GBMA 2VZKD 3DBHB 3U4EG 5KKBA 3HUIA 4L9PB 4M8NA 4ZHOA 4B0MA 4RNQA 4AYQA 2IJ0A 2JG0A 4BOKA 5HG2A 1I4QA 4B0EA 4XDDA 2XBBC 3V60A 1WYGA 3RENA 3GE3C 3EA6A 4DHZB 3Q8CA 2FUTA 1YMHE 1RW9A 3TBLD 2YEPF 4ANWA 4D4CA 1N60A 4GTTB 2KVZA 3Q14C 3HXCB 3QT9A 2FUHB 4FULA 1H14A 2WDAA 2W54A 5H8YE 1G9GA 3IG3A 1SB3C 1V6EA 1WX7A 2WQYB 4K81A 3RZWC 3L4PA 2KXJA 3UI3A 4I6PA 4KV2A 1FXAA 4B9KA 1FXTB 3TSSA 1UZXB 4MU9A 1L0XB 3W7UA 2MWSB 2WU5B 4WIPA 3AH7A 2JPHA 5G55A 1KF6B 1NDDA 5J18A 3NJTA 2D11A 2B76B 4RMAA 1HXYD 3HIZA 1WIAA 1XD3B 2K8HA 2PVGC 4BFRA 2KDFB 3QFYA 4TKNA 3DPDA 1KZPB 2JY6A 4L2YA 1R7SA 2CR5A 2Z8LA 1IS9A 3HHMA 1HXCA 4GL3A 3LJ3A 1WU5A 3E80A 3AFJA 4D94A 1YQ3B 2JQRB 2KMAA 2J0JA 1IBXA 4W9CA 2ONQA 4BKSA 2MJ3A 4Z4LA 4GTSB 4ZH1A 4X57B 3E56A 1YQ4B 1SE9A 4KZCA 2RI8A 1WR6E 3DVNV 1FPYA 2L52A 1MG8A 2ZCCA 1ESFA 2H88B 2K8BA 4YCRA 4LDTD 1IBXB 4GU2A 1RFAA 1B1ZA 2GBRA 3PZ3B 4A6QA 3GT5A 3ANJA 3RRSA 2PTLA 2QC8A 2GB1A 3NG0A 2FCNA 4GMVA 1T5XD 3UF8A 4JJJA 3RNCC 3HM3A 3EECA 1TNOB 3E73A 1N61A 2LGYA 1EWYC 4DOEA 4LIXA 3DBRI 3DHHC 1VR9A 1WJUA 4HWIB 3ZUNA 2J5CA 3R2TA 2LUMA 1HX9A 2Z0EB 5C23A 1OFFA 5C05A 2AHFA 1ZPSA 1E6EB 2IGHA 2WX0A 2INPE 4RF1A 1YJJA 3RNGC 3ZXVA 4MGZE 3WUXA 4MH0E 2D10A 2M1MA 3VR8B 2D3GA 1WRDB 3P4QB 4ZYSA 1QQRA 4C56C 1YNTE 4ONTA 5FR6A 1F1HA 1V9JA 3IBEA 4B6WA 5DGQA 3BVGA 3HXFB 4HEA1 5DHIA 1U4AA 4II2B 3SDLC 4LNNA 1JCKB 2WU2B 1O6HA 2WCOA 1EM7A 1OJPA 3CSTA 3RPFC 4LNIA 4FXGB 4CO7A 4DK5A 4DXAB 3JVZX 1CB8A 3CSFA 1HZFA 2UYZB 2KQ4X 4P7IA 2LJIA 1R4MB 5ILDA 3PYBA 3V6CB 3W5MA 1O79A 5GY3A 5D6JB 3KYDD 2JYTA 3GE8C 1EU3A 3PRMB 4AS1A 5HI1A 2LGSA 2WDVB 3CIHA 4G3XB 4GSWA 2K25A 3GZNI 1L5PA 1FM0D 4IC7B 4AJYB 1XW2A 1QQFA 1H3CA 4LJPB 1PGXA 2QMTA 3P5PA 1TY2A 4OJZA 1MHHE 3KUCB 2LGDA 5D7GA 1F52A 4K7WA 3Q6BA 3TEWA 2SEBD 1SXTA 1OJNA 3MC8A 1C4CA 1OEYJ 2LGXA
chains in the Genus database with same CATH topology
3B2FA 3R8BA 4TSSA 2PN5A 3P5RA 1NI3A 1TYGB 2WXHA 4WAFA 2Q5WD 1J7BA 4J3OD 1LD7B 4KTRA 1FD6A 3I9V1 3ZGZA 1R76A 3AE2B 1PDXA 2IGDA 1EU4A 3CIRB 5JPNB 1LTXB 1I4GA 3FAHA 1TN7B 2V0GA 1F0ZA 1N9AB 2F0YB 3WKFA 3C8YA 2WXJA 2N0SB 2GOXA 3A3VA 1FT2B 4TF4A 3WKGA 1KFGA 1ET9A 2QIEB 3Q8AA 1H37A 3KQ4A 1KRHA 2AX5A 3W7XA 2JWUA 3QDEA 2WXMA 2G1EA 2IPKD 3ACSA 1TKYA 3B9JA 1CK1A 3SEBA 3N9YC 1L0VB 1NL4B 1JWSD 5C3JB 1C4PA 3OWEB 1LD8B 3EUVB 4Q2JA 1TF4A 1WRIA 3NVYA 3R2IA 5BYQA 2LHDA 2R61A 4A55A 1ZXHA 2ACZB 1TNUB 3C72B 3M73A 1GSZA 4HKQA 4YXDB 3NVWA 2WXNA 2VN4A 2ZIRB 1ZXIA 3MP9A 3WCQA 1TN8B 2LMCA 3KWLA 3DWMA 5JPMB 1AN8A 2OKXA 1PGAA 1GB4A 1TS2A 1FNWA 3KSLB 5TSSA 2CQSA 3K7XA 1O6QA 1KSCA 1V5DA 4LLGM 4R3DA 4ARIA 2WDRB 1L0YB 1JWAD 4N58A 2V8IA 3Q7AB 3SFYB 2A8ZA 4DODA 1D4BA 3ZJUA 1H3AA 1G9JA 4EL8A 1T3QA 2K5PA 4LTUA 3Q69A 3W7TA 2DBYA 4LNGB 2G9HD 1ENFA 4HJGE 1FP3A 3SFXB 3Q75B 1VZ7A 3GP7A 3MHZA 4ZG8A 1IGDA 5CZLA 1SE3A 4DXGA 3BK1A 3BYYB 2I07B 2DWQA 2W3SA 2KAJA 3GZKA 2GRIA 4XE0A 1C78A 5BMIA 5GZKA 2GZ6A 1DGJA 4REZA 4RGTA 2IGGA 3TF4A 3IAS1 1AW7A 1E7PB 1QT9A 2ZW1A 4YT0B 5T8IA 2RI9A 1DOIA 1FO2A 2DROA 3PO0A 1VDVA 4QT9A 2PVOD 4EE2A 3AEAB 1O1RB 3ETRA 3IT4B 1HZ5A 3PYAA 3RFZB 4H2AA 1BXTA 3TEXA 1KZOB 1FMAD 1JW9D 3IXSA 4C7ZA 2BB5A 3P2CA 2BB6A 2WXOA 1WU6A 3AEFB 4TMAB 2WNMA 3P4PB 4AQ7A 4J5TA 1K51A 5FO9B 1KWFA 4P6VF 1MVKA 1GAIA 2HDEA 2J53A 3ZYYX 1JQ4A 1DOYA 4KX6B 3AV8A 1F9OA 1RFKA 4LK0M 2ZBLA 5H92C 2Z07A 3DPYB 1UUPA 1WSPA 3PZ7A 4WURA 5FR3A 1FMIA 1FFVA 2WP9B 3DSWB 2EELA 3EUB2 1H13A 4KGTA 2H6GB 5G5HA 1W6KA 2WXIA 1UNSA 1H12A 1FO4A 2X38A 1MZCB 3WKIA 4ZRQA 2EABA 2V3NA 1V1PA 1N4RB 4OZBA 1SA5B 4M0WA 1L6UA 2WS3B 3E6UA 3BWUD 3QWTA 1NC5A 2V4IB 4RCOA 1S63B 3BVMA 2YIKA 2NOJA 3H7LA 1GAHA 3SAEA 2I38A 2MEKA 1TNBB 3P1MA 3NS1A 3E33B 4GLSC 1PUTA 4YDEB 1D6EC 4CJ0A 2FV0A 2JF4A 1SE2A 1XEEA 1JCQB 2YEPB 2CJNA 1JCSB 5MPOA 4ZOHC 1V1PB 4JX1C 3HVZA 3B2GA 2KN4A 5M7YA 1TKEA 3AEEB 1E9MA 3S4DA 3SDQA 1QLBB 2JX5A 5E6JA 3ANKA 3VRAB 1RYJA 2ON8A 1XWTA 4WH4A 4GTPB 1XLQA 1FXIA 1B9RA 3AE7B 2M56B 1X81B 3W5VB 1FCEA 1BUIC 3SFEB 1UMPA 3EQAA 1FEHA 2XN9C 3LXFA 2Y3AA 3BZDB 2XQWA 1K53A 3PZ1B 3U2SC 2B4FA 5GXGB 3KLSA 1VLBA 4NAMA 1H3BA 4D2KA 1D5XC 3QPFA 4MACA 1Y56A 1ZE3D 4RF0A 2L83A 1V5CA 1LF6A 4AYPA 2JXTA 1QKZA 4RGMA 1ZDVA 1GXMA 3ACTA 5HHDG 1DOXA 4US8A 3PZ2B 3HVDA 1K72A 2JJBA 3D5SA 4US9A 5AGDA 5C2TB 1HQRD 4JPSA 1F2RC 3ZQ4A 2AQ3B 4DQOC 1UGJA 5FOBB 2XWJB 2R2LB 2WIIB 5EE1A 1XLPA 4Z4JA 1FRDA 1FBWA 3S9VA 3M75A 4EHMB 2E6XA 3BVZA 4YWGG 3P4SB 1CEMA 4MM3B 2JSVX 2WXQA 1NVID 4D4BA 2OEDA 2MJEA 1SQCA 1FRRA 3J9CA 1L1YA 1D5ZC 1BMLC 2J42A 3OXUA 1TS4A 5FK9C 2ZZRA 3AEGB 1V7VA 3CU7A 4C80A 2ZW0A 3WIRA 1VZ6A 3P63A 2BT6A 3EGRA 3Q73B 1KS8A 1FFUA 2AQ2B 3ZJVA 1RQ5A 4XWWA 1UG9A 3Q7FB 2IDYA 1S64B 3E32B 1XF5L 3NVVA 1UWXA 2EACA 1MPEA 3TUOA 3T3OA 1TNYB 1KRFA 4MBGB 1P7FA 1XXGA 4IOIE 4A9AA 2WXLA 1TNZB 1I4XA 5D3DA 1FCCC 1H54A 2XFGA 1C76A 1PFDA 3S4CA 1N63A 3H2WA 3KSQB 3M76A 1JS4A 1SJED 2KMMA 1I7HA 2WXPA 4A8XC 1V97A 3VXDA 3HXEB 1ACCA 3DSVB 1KKTA 3DSXB 3QFZA 3FILA 1XCTL 1D5MC 3AE5B 2WXKA 2WXRA 2N9LA 4O1NA 3VR9B 3HRDD 2FUZA 1I4PA 2L1AA 5D3IB 3AM9A 3QXFA 2W55A 4YSXB 3TEYA 2V8KA 1TS5A 1O1SB 3EZ8A 2OHFA 1UT9A 2RMMA 3MJ5A 2HTME 2WYNA 3T33A 1DCEB 1G87A 1XO3A 2N7JA 2WDQB 4GDKB 5EE9A 3VRBB 4C1SA 2J52A 5HFYA 1L4DB 4KTPA 3K11A 3W5NA 1VRAB 2M19A 2RDHA 3FILB 2H6IB 4MH8A 1DL2A 4ZRPA 1L6VA 3OEDA 2J4XA 5EE3A 1FPPB 1O5MB 1SIJA 1IA7A 2DRQA 4GTMB 2QEJC 1P7EA 2JU6X 3DRAB 1FNVA 1I4RA 1N4PB 1N5XA 3U52E 1UWMA 3AMZA 4GTRB 2DRRA 3ON6A 4XUVA 1FIQA 2E3TA 4WVAA 1GOZA 3AE1B 3W9CB 2G02A 3Q78B 1N4SB 3ANIA 1FO3A 3GLYA 4CE7A 1GA2A 2N9KA 2WY8A 3NUHB 4HROA 4RH6A 2QSDA 4XDCA 4FUSA 1VJKA 2K0PA 2WLBA 1E0ZA 3WIWA 2DLBA 4OZCA 1SSNA 2VZKD 1NI1B 3AEBB 4KKIA 3LB8C 2NMQA 4FXCA 3U4EG 5KKBA 3HUIA 4L9PB 4ZHOA 3S4AA 1QOBA 1ROEA 4HRSA 1YJIA 3D5RA 3LYYA 1KREA 1GAQB 2B39A 4AYQA 4B0MA 1K50A 1C3DA 2FV1A 1WWTA 2IJ0A 2JG0A 3SFDB 3Q8BA 4BOKA 5HG2A 5CD2A 4OHJA 3V3XA 3SDUA 1SEBD 1I4QA 2W82A 4XDDA 4B0EA 4C7YA 1H36A 3QT3A 2EAEA 2LEKA 3RX8A 1F9DA 3M71A 1WYGA 4L0GA 4ITKA 3RENA 3EA6A 1C4AA 3DWGC 2INNE 1KTKA 2FBWB 3MFGA 1RWSA 1YMHE 3Q8CA 2YEPF 4D4CA 3X17A 4GTTB 1N60A 1KLGD 3HXCB 3QT9A 2PIAA 4WWMA 1V1OA 2D8LA 4NZLB 4DXFA 4L6XA 1STEA 2FBAA 1H14A 1WZZA 2MJDA 1SE4A 2W54A 3FC4A 3WIQA 4N6EB 1G9GA 1IA6A 5H8YE 1SB3C 3M7BA 2WQYB 1CJEA 3L4PA 3M7LA 4GDLB 3UI3A 2AQ1B 3URYA 2RPVA 2CQTA 1TY0A 2BYTA 3AB5A 4P16A 1H39A 1YN5A 2AHGA 1FXAA 4V1SA 2KDMA 3TSSA 1J7AA 4MU9A 4TXTA 1NXCA 3W7UA 1L0XB 2WU5B 1ZUD2 1O1TB 3RX7A 3AH7A 1DOGA 3BYTB 4IKGA 4L23A 4WIPA 5AUKA 5FKAC 2GI9A 1AGMA 1TN6B 2GH4A 4HKZE 1KF6B 3QSPA 4YSYB 1G6IA 2NVPA 2B76B 1O6RA 3I57A 1KH0A 1YN3A 3SDRA 1HXYD 1XCQL 2XNAC 2SAKA 3H8HA 3NZ3A 3H3KA 3GB1A 2PVGC 3AEDB 2VN7A 1IGCA 4YSZB 3QFYA 3TEZA 1FNUA 1GXOA 1KZPB 3VW5A 4UDUC 3SR6A 1OQRA 3RX5A 4AYRA 3QXQA 2EKIA 5BMHA 3SQCA 4CJ1A 1N94B 2LHEA 2BW2A 1W6JA 2H6HB 1R7SA 4L2YA 3BIID 3VQIA 1V7WA 2Z8LA 1IS9A 3CWIA 5FO8B 4GL3A 3G6JB 4WVCA 1WU5A 4D94A 3AFJA 1L4ZB 1YQ3B 2IEJB 3M7CA 3RSYA 1EWCA 2JQRB 3W7SA 1HZ6A 1QOGA 1J7CA 1VZ8A 2QILA 4N59A 2KWDA 5I4DA 5FO7B 1IBXA 2ONQA 3BK2A 2MJ3A 4Z4LA 4GTSB 3DSTB 4ZH1A 4NAWB 1XWQA 1LO5D 1PYWD 3E56A 4YDOB 1YQ4B 2AFAA 2EADA 3AECB 4RFBA 1KSDA 4ZHPA 2RGKA 1VD5A 2Y5CA 2RI8A 1FBOA 3Q8EA 1FT1B 4CQNA 2L52A 1TS3A 1QBQB 3M72A 1ESFA 1N5WA 2H88B 2L32A 1JROA 3E30B 2D5GA 4YCRA 1ET6A 2MH7A 4LNVA 1IBXB 1N4QB 4ZH5A 2WINB 1RM6C 4KGSA 3M74A 2G0DA 1B1ZA 5G5GA 3PZ3B 1N62A 4A6QA 2WY7A 2K22A 1C9FA 3GT5A 1GHQA 1GB1A 4KKJA 4JWUC 3ANJA 3RRSA 2PTLA 4JWSC 2ZISB 2GB1A 1T6BX 5EE0A 1HEZE 3DSUB 2CU3A 1T5XD 3ZJTA 1E10A 3SDTA 4FXKB 4V1RA 4PT5A 3HXBB 4JJJA 4YTPB 2V8JA 5BYSA 1TNOB 3E73A 1N61A 4RGNA 1EWYC 1QOFA 2M0AA 3MC0B 2PMVA 3WKHA 4DOEA 1C77A 2LGIA 1SJHD 4LIXA 2PLPA 2PKOA 3W2DA 3QRYA 1VR9A 1I4HA 4GTOB 3R2TA 1D8DB 2LUMA 1L2AA 1DYQA 4RNAA 1V8CA 4OZAA 5CA3A 4WVBA 1OFFA 2RDGA 3IT6B 2BEDB 2AHFA 2XWBB 2Y5PA 1GLMA 1QSJA 3WC3A 1ZPSA 2FE8A 3KWVA 1AYXA 1FAEA 1E6EB 1OQQA 4D4AA 1D8EB 2IGHA 2WXGA 3PZ8A 2VZKB 4KGRA 1CLCA 2INPE 3O13A 4RF1A 3W5UB 3W7WA 2FUG1 1ZP0B 4OVZA 1YJJA 4WU0A 5AUIA 3SDVA 3WUXA 1KFYB 3T3NA 3AE6B 5JXVA 5BMGA 5BYRA 3E37B 3VR8B 1K52A 1WGKA 1SA4B 3P4RB 4L1BA 4MT5A 3AE3B 3P4QB 1AWDA 5LNK1 3D3IA 4ZYSA 1C79A 1NENB 4GTQB 5MEHA 1QQRA 4C56C 1YNTE 2BS3B 2BTEA 4ONTA 3GS2A 4NJCA 3KLSX 2A73B 1M4VA 1CQVA 1XLNA 3M77A 3AN1A 5DGQA 1ZOYB 1QILA 1C4CA 2K3UA 3BVGA 3E34B 3HXFB 2ICIA 4HEA1 3RJ3A 3V05A 3HXDB 1KLUD 4M76A 1JCKB 1MHXA 1O6HA 1H35A 1IUEA 3M7EA 4GTVB 1V7XA 1EM7A 1MI0A 1SF0A 4Q88A 4XWTA 4A90A 4TQ1A 2NTSA 3IAM1 2W3RA 3RPFC 4AYOA 1YN4A 1NYRA 4FXGB 1HCUA 2H6FB 1F2RI 3PMMA 1JWMD 3QG0A 1X9DA 1SBBB 1HA5A 1TJEA 1GPXA 1HZFA 1CZPA 4D4DA 4Q2BA 1JCRB 2JYEA 2KQ4X 2TSSA 2F6DA 2LJIA 4USAA 1TKGA 3AE8B 3PYBA 1JALA 1NEKB 2H89B 3NRZA 3W5MA 2CJOA 1O79A 3PZ4B 2BS4B 1PGBA 5GY3A 4TQ0A 4IDIA 4WQMA 2JYTA 4ARCA 1EU3A 2DYOA 3Q8FA 3AE4B 4AS1A 5HI1A 4YTMB 1WXQA 2QJLA 1JMLA 2NTTA 2I2YA 4RGOS 4YTNB 2DYMA 3CIHA 5M7IA 1NYQA 2WDVB 1ULVA 2PW9A 2P0VA 2V3PA 2DRSA 1A70A 1FM0D 1L5PA 1QOAA 2BS2B 1XW2A 5E2JA 1Q10A 1TZOA 2K9XA 1QQFA 1H3CA 5GW7A 1PGXA 1AYFA 2QMTA 1WU4A 3EU8A 3P5PA 3M78A 2WXFA 3NVZA 1TY2A 2LFIA 1ZDXA 1FCLA 1MHHE 3W1SA 3S4BA 4JE3B 2KACA 1QF6A 1LF9A 4OW0A 5DGRA 5D7GA 2JZPA 1N95B 1F77A 1XLOA 3ABVB 3P42A 1JWBD 1JRPA 3TEWA 1JWUD 3EU5B 3Q79B 2SEBD 2QNOA 1GXNA 3E9SA 3AE9B 1SXTA 3U7ZA 3DSSB 4LNBB 4BOJA 2BBCA 2WU2B 2D5JA 2SQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI1 B;  4KKI A;  2PN5 A;  4L9P B;  2V8J A;  3D5R A;  1LD7 B;  1TNO B;  2B39 A;  1C3D A;  2PMV A;  4GTP B;  1R76 A;  4BOK A;  5JPN B;  1X81 B;  1LTX B;  1TN7 B;  1H36 A;  4GTO B;  1UMP A;  1D8D B;  1N9A B;  2F0Y B;  2GOX A;  1FT2 B;  2XQW A;  3PZ1 B;  1H37 A;  3KQ4 A;  2BED B;  3KLS A;  2XWB B;  1H3B A;  1QSJ A;  4D4C A;  4GTT B;  4D4A A;  1D8E B;  3HXC B;  1NL4 B;  1GXM A;  1LD8 B;  3PZ2 B;  3EUV B;  3D5S A;  5AGD A;  5FOB B;  1TNU B;  2R2L B;  2XWJ B;  3C72 B;  2WII B;  4V1R A;  1GSZ A;  3E37 B;  2ZIR B;  1SA4 B;  4EHM B;  1H39 A;  1TN8 B;  4V1S A;  5JPM B;  4MU9 A;  3KSL B;  4D4B A;  3K7X A;  1O6Q A;  1SQC A;  4GTQ B;  1O1T B;  3OXU A;  4ONT A;  2V8I A;  3Q7A B;  3SFY B;  3CU7 A;  2A73 B;  1H3A A;  1TN6 B;  3Q73 B;  4LNG B;  3SFX B;  3Q75 B;  3E34 B;  3HXF B;  3Q7F B;  1O6R A;  1S64 B;  3E32 B;  3RJ3 A;  3HXD B;  2I07 B;  4M76 A;  1O6H A;  1H35 A;  1TNY B;  4GTV B;  4MBG B;  1TNZ B;  1GXO A;  1KZP B;  4FXG B;  2H6F B;  3KSQ B;  3SQC A;  1N94 B;  1W6J A;  1HZF A;  2H6H B;  4D4D A;  1JCR B;  3HXE B;  3DSV B;  3DSX B;  3G6J B;  5FO8 B;  4D94 A;  1O1R B;  2IEJ B;  1O79 A;  1KZO B;  3PZ4 B;  2BB5 A;  2BB6 A;  5FO7 B;  2V8K A;  1O1S B;  4ZH1 A;  4GTS B;  3DST B;  5FO9 B;  1DCE B;  4YDO B;  4C1S A;  2V3P A;  3DPY B;  2H6I B;  1QQF A;  1H3C A;  3DSW B;  4ZRP A;  1FT1 B;  3OED A;  2H6G B;  1W6K A;  2SQC A;  1FPP B;  1O5M B;  1MZC B;  1QBQ B;  4GTM B;  2V3N A;  4ZRQ A;  1N4R B;  3E30 B;  1SA5 B;  3DRA B;  4LNV A;  1N4Q B;  1N4P B;  2WIN B;  1S63 B;  2G0D A;  2NOJ A;  3PZ3 B;  1N95 B;  4GTR B;  2WY7 A;  1TNB B;  3E33 B;  1GHQ A;  2G02 A;  3Q78 B;  4KKJ A;  1N4S B;  4YDE B;  2WY8 A;  2ZIS B;  3EU5 B;  3Q79 B;  1GXN A;  1JCQ B;  3U7Z A;  3DSS B;  4LNB B;  4BOJ A;  2BBC A;  3DSU B;  1JCS B;  4FXK B;  3HXB B; 
#chains in the Genus database with same CATH topology
 2HE7 A;  3B2F A;  3R8B A;  2WXH A;  3FKY A;  1J7B A;  3QIJ A;  3Q3N C;  3CIR B;  2KDE B;  2GBJ A;  1I4G A;  2L0T A;  1FT2 B;  2IY1 B;  2ZJD A;  4M00 A;  2RSU A;  3KQ4 A;  1KRH A;  1S3S G;  4PS8 A;  3R7R A;  3DVG Y;  4BVU C;  1JWS D;  1YQB A;  4FJY A;  1C4P A;  3OWE B;  1TF4 A;  1WRI A;  3R2I A;  5BYQ A;  1ZXH A;  2ACZ B;  3QJZ A;  3WCQ A;  3HK0 A;  2ZPN A;  1AN8 A;  2OKX A;  4ARI A;  1O6Q A;  1KSC A;  5IL3 A;  4ZRK A;  3VDZ A;  1H3A A;  1G9J A;  4EL8 A;  3W7T A;  1ENF A;  4II3 B;  3MHZ A;  3SFX B;  3Q75 B;  1IGD A;  3VSN A;  5L95 C;  3BYY B;  2QHO A;  2CKH B;  4W9H A;  4E3C A;  1C78 A;  5BMI A;  5GZK A;  4RGT A;  2IGG A;  3TF4 A;  5T8I A;  2ZW1 A;  3KUD B;  1I42 A;  2L3Z A;  3PRP B;  1N7R A;  2PVO D;  1LOH A;  3ETR A;  1O1R B;  3VH4 B;  3PYA A;  4AJW A;  4H2A A;  4HDQ A;  1JW9 D;  4DHJ D;  4TMA B;  1TZ1 A;  2D2Q A;  2WNM A;  4F7Z A;  4M8M A;  5FO9 B;  1KWF A;  3ZYY X;  2WYQ A;  4LK0 M;  4PS7 A;  2UWQ A;  4MGK E;  1FFV A;  2KFK A;  2ZEQ A;  2WP9 B;  4WWO A;  3DSW B;  1H13 A;  1W6K A;  2WXI A;  1H12 A;  3WKI A;  1JRU A;  2EAB A;  2V3N A;  3WAO A;  3H9D A;  4OZB A;  1TTN A;  1WJ6 A;  4M0W A;  3BWU D;  1S63 B;  3NNB A;  2YIK A;  3BVM A;  3T8M A;  1TNB B;  4GLS C;  1LGR A;  3QWZ B;  2KFK B;  1JCQ B;  2NCN A;  5TR5 A;  2CJN A;  1IP9 A;  3N32 A;  5MPO A;  4M0W B;  3ZKJ C;  5E6J A;  2A5U A;  4WH4 A;  4GTP B;  1KM7 A;  1QZE A;  3N1X C;  2ZZP B;  2CHW A;  3BZD B;  4KZ0 A;  4FA6 A;  2BRP A;  3PZ1 B;  3KLS A;  4D2K A;  5IL8 A;  1J0M A;  1WR1 A;  1D5X C;  2L83 A;  4RGM A;  4XX5 A;  2X03 A;  1GXM A;  4US8 A;  3HVD A;  3WAL A;  3D5S A;  1IPG A;  1F2R C;  4DQO C;  1UGJ A;  2KQ7 A;  2YVC A;  4IWP A;  1FRD A;  2W9N A;  2ZNV C;  3QAR A;  3ZXR A;  3M75 A;  2MCN B;  2E6X A;  3P4S B;  2E24 A;  2JSV X;  4AWJ A;  1NVI D;  2OED A;  1FRR A;  1D5Z C;  4C80 A;  2BYE A;  2ZZR A;  1WGH A;  3WIR A;  3QQ8 B;  4G0N B;  3EGR A;  1FFU A;  1RQ5 A;  1K8R B;  1UG9 A;  1XF5 L;  1UWX A;  2EAC A;  3TUO A;  3T3O A;  3PT2 B;  4A9A A;  2WXL A;  1TNZ B;  5D3D A;  1H54 A;  2XFG A;  2BWE S;  3S4C A;  2ZVO A;  3M76 A;  1JS4 A;  1I7H A;  4A8X C;  2V3S A;  3QK0 A;  3FIL A;  1XCT L;  2Q1F A;  3AE5 B;  5IOI A;  3VUY A;  1X1H A;  4BKS D;  4O1N A;  3ZVV A;  2Y5B B;  2FUZ A;  1I4P A;  3ZDT A;  2L1A A;  5CHF A;  5D3I B;  1J0G A;  4YSX B;  2V8K A;  1TS5 A;  1J8C A;  3R3M A;  2WYN A;  3T33 A;  3VUX A;  3ZIM A;  5HFY A;  4KTP A;  3W5N A;  5E6P A;  2M19 A;  3FIL B;  4ANX A;  4WQO B;  3PGE A;  1N6Z A;  2LUE A;  4ZDV A;  2KDB A;  1I4R A;  2MRP A;  4MGY E;  1W3Y A;  2ZPY A;  2DRR A;  1GOZ A;  1TT5 B;  3ANI A;  3GLY A;  1GA2 A;  1AAR A;  1WJN A;  3ZRF A;  2BYV E;  1T0Q C;  3C0R B;  2LAS A;  3W1S C;  1ROE A;  3D5R A;  2C5L C;  1C3D A;  1WWT A;  3SFD B;  3DBS A;  4A20 A;  3M01 A;  2W82 A;  1H36 A;  3QT3 A;  2LEK A;  2RD0 A;  1F9D A;  3M71 A;  3DDC B;  3WAN A;  2INN E;  2FBW B;  4ICU A;  1RWG A;  4I6N B;  1KLG D;  4WWM A;  1V1O A;  4NZL B;  3AUL A;  3M95 A;  4L6X A;  1STE A;  1WZZ A;  4N6E B;  1SE4 A;  3WIQ A;  3DBH I;  2PPH A;  3DCG A;  1F9G A;  1CJE A;  4HDO A;  3M7L A;  4WJN A;  3URY A;  1TY0 A;  2C60 A;  2AHG A;  4TXT A;  3PS6 A;  1NXC A;  3BYT B;  4L23 A;  2GI9 A;  1TN6 B;  1P98 A;  1G6I A;  3I57 A;  2R2O A;  1KH0 A;  3JYU A;  3SDR A;  3H8H A;  2SAK A;  3H3K A;  2DHZ A;  1IYF A;  3AED B;  1IGC A;  1FNU A;  3VW5 A;  4UDU C;  2EKI A;  3QXQ A;  4K1R B;  3SQC A;  4CJ1 A;  1N94 B;  2LHE A;  2BW2 A;  2H6H B;  3P2B A;  1H4R A;  2M0X A;  5AZH A;  4WVC A;  2FAZ A;  2IEJ B;  3M7C A;  3RSY A;  3W7S A;  1WE7 A;  3WAM A;  1YD8 U;  1EGU A;  3OLM D;  3Q2A C;  3BK2 A;  4KSK C;  1PYW D;  1ZKH A;  2AFA A;  2EAD A;  4RFB A;  4EOY A;  2MP2 A;  3Q3F A;  2KX3 A;  2Y5C A;  5JHB A;  3JW0 X;  3KYC D;  4IM3 A;  3Q8E A;  3TCA A;  4CQN A;  1NI2 A;  1TS3 A;  2M8S A;  3M72 A;  3A1Q A;  2L32 A;  3E30 B;  1RWA A;  2D5G A;  1N4Q B;  3U8Z A;  2WIN B;  1RM6 C;  5G5G A;  1LXD A;  2WY7 A;  2LI5 A;  2K22 A;  4KKJ A;  4JWU C;  4JWS C;  2MP2 B;  1T6B X;  1HEZ E;  1CMX B;  2BQQ A;  3DSU B;  2CU3 A;  3A1Q B;  3KW5 B;  2MQJ A;  3NY5 A;  3PHW B;  4YL8 A;  3NHE B;  5BYS A;  2N9P C;  3DVG X;  3TMP B;  2O6V A;  4DWF A;  2G4D B;  1EF1 A;  2DZM A;  1I4H A;  4WJP A;  4GTO B;  2NBU A;  1D8D B;  4W9J A;  1L2A A;  1WY8 A;  5CA3 A;  4DHZ E;  3VVW B;  2RDG A;  3WC3 A;  3KWV A;  2FE8 A;  2MBQ A;  1AYX A;  2WXG A;  5IK6 A;  2O6V B;  3K9P B;  2OOB B;  4WU0 A;  1KFY B;  3E37 B;  1K52 A;  2LWP A;  1WGK A;  3RZF A;  2ZNV B;  3AE3 B;  3D3I A;  3SD5 A;  1C79 A;  1NEN B;  2BS3 B;  2BTE A;  4NJC A;  2KO3 A;  2A73 B;  3M02 A;  1M4V A;  3PLU A;  2K3U A;  3E34 B;  3HXD B;  4M76 A;  2ONG A;  1MHX A;  4RNA A;  1RWH A;  4Q88 A;  4XWT A;  3JSV A;  2NTS A;  2W3R A;  1NYR A;  5IP4 D;  2H6F B;  3PMM A;  3QG0 A;  1V49 A;  3DBL B;  4Q2B A;  2JYE A;  2DYB A;  5ILJ A;  2IO2 B;  4USA A;  1V81 A;  4JLC A;  4WQM A;  3JSV B;  2DYO A;  4E71 A;  4YTM B;  2I2Y A;  4RGO S;  4YTN B;  4EUT A;  1NYQ A;  3N0G A;  2DRS A;  1Q10 A;  1TZO A;  3PHX B;  1WU4 A;  3EU8 A;  3M78 A;  3NVZ A;  4F13 A;  1ZDX A;  1FCL A;  3RT3 B;  3W1S A;  1R4M I;  3PLV A;  3ABV B;  1XLO A;  3A0O A;  1JWB D;  3A33 B;  1GUA B;  4LNO A;  3EU5 B;  3Q79 B;  3E9S A;  3AE9 B;  4M02 A;  2NBW B;  3AU4 A;  2WX1 A;  4C7Z A;  2LVP A;  2PN5 A;  3DHI C;  1GC6 A;  4KSL C;  2XK5 A;  3ZGZ A;  1R76 A;  3AE2 B;  1LTX B;  2KLC A;  1E8Z A;  3RYT A;  2V0G A;  1HE8 A;  1F0Z A;  1N9A B;  2F0Y B;  1LM8 B;  3C8Y A;  2N0S B;  2GOX A;  3A3V A;  3WKG A;  1KFG A;  1V80 A;  1H37 A;  2JWU A;  3ALB A;  2IPK D;  2KJH B;  2DX5 B;  3L0W B;  1WH3 A;  2XK5 B;  3PPA A;  4BAX A;  4AOF A;  3EUV B;  4A55 A;  4XC2 A;  4HCP B;  3X23 A;  3C72 B;  3M73 A;  1GSZ A;  4HKQ A;  4FJQ A;  3MP9 A;  1TS2 A;  2FID A;  2CQS A;  2J0K A;  4R3D A;  2KJ6 A;  1N7N A;  1L0Y B;  5ILI A;  4N58 A;  2V8I A;  2N7E A;  1D4B A;  4DOD A;  1T3Q A;  4LNG B;  3GP7 A;  3APC A;  2DWQ A;  3APD A;  4XE0 A;  1VD2 A;  3IAS 1;  3IVF A;  4MMH A;  1N24 A;  3QC8 B;  1DOI A;  4K7U A;  5BO4 B;  1VDV A;  3H7S A;  3IT4 B;  4JGH B;  1BXT A;  4NJ7 A;  2BB6 A;  2KC1 A;  1WU6 A;  2WXO A;  4AQ7 A;  2BRV X;  4P6V F;  2J53 A;  1GAI A;  2KWC A;  3AV8 A;  1F9O A;  2ZBL A;  2KK8 A;  1WSP A;  2LZ6 A;  5FR3 A;  2EEL A;  3EUB 2;  3NS8 A;  1UNS A;  1FO4 A;  3ONS A;  2A4Z A;  3TL5 A;  2N1W A;  3W1Y A;  2JXX A;  2AL3 A;  2MEK A;  1PUT A;  3T9L A;  3RMK C;  2NR2 A;  1D6E C;  4CJ0 A;  1V2Y A;  5IO9 A;  4ZOH C;  1C82 A;  5M7Y A;  3S4D A;  2PJH A;  2ON8 A;  1XWT A;  4HCN B;  1WXM A;  1UD7 A;  1FXI A;  2PE6 B;  1B9R A;  3OG5 A;  2JVC A;  2DAJ A;  4KDI C;  3MJW A;  1UMP A;  1FEH A;  2KAN A;  2GMI C;  5D2M B;  2XQW A;  2N9X A;  4IW0 A;  2B4F A;  4NAM A;  3DOW A;  3N0F A;  4MM3 A;  4NPN A;  1Y56 A;  1V5C A;  5IA7 A;  1ZDV A;  3A9K A;  1DOX A;  5HHD G;  4TV3 A;  3PZ2 B;  2NVU I;  4W9K A;  2JJB A;  4FJV B;  2KNB A;  2XWJ B;  5EE1 A;  1XLP A;  4HPM B;  2D3C A;  5LLI A;  4EHM B;  1WXA A;  4MM3 B;  1YIW A;  5ILK A;  5DPT A;  2DZK A;  4D4B A;  3A9K B;  1P0R A;  2FCS A;  3CU7 A;  3KVF B;  2CHX A;  1VZ6 A;  2V4L A;  3P63 A;  2BT6 A;  3DHG C;  3Q73 B;  3ZJV A;  3NOB A;  2AQ2 B;  3U30 A;  3N20 C;  3Q7F B;  5D94 A;  2IDY A;  1S64 B;  3NVV A;  5G2N A;  1MPE A;  4F1S A;  1P7F A;  3GOE A;  1WI0 A;  1XXG A;  5GMV A;  5KHO A;  2E22 A;  1C76 A;  1PFD A;  3E7J A;  2WWZ A;  3R66 C;  3CF6 E;  3RN9 C;  2KMM A;  2WXP A;  4TUU A;  4WWN A;  2RR9 A;  1WFY A;  1NBF C;  3HXE B;  1ACC A;  2KOX A;  3VUW A;  3DSX B;  3QFZ A;  2Z0D B;  1D5M C;  1RRB A;  5AZF A;  4S17 A;  2N9L A;  4MJS A;  1HM2 A;  3PV1 A;  3PZD A;  3APF A;  3AM9 A;  4GN1 A;  3QXF A;  1OGW A;  3TEY A;  3NZU A;  1UT9 A;  3MJ5 A;  2KYW A;  1GJZ A;  1XO3 A;  1DCE B;  2N7J A;  2WDQ B;  3VRB B;  3K11 A;  4KIK A;  5EE3 A;  3OED A;  2M17 A;  3VTW A;  4LJO B;  2DRQ A;  4MJS B;  4W9L A;  5CHW A;  3DRA B;  1F9J A;  2KKC A;  5J17 A;  4EEW A;  1N23 A;  1FIQ A;  2E3T A;  4WVA A;  4URK A;  4CE7 A;  3NUH B;  2N9K A;  1SGH A;  4FUS A;  4KIK B;  1VJK A;  2K0P A;  3WIW A;  4B95 A;  1SSN A;  3AEB B;  4KKI A;  2O6V D;  4FXC A;  1QOB A;  4HRS A;  1YJI A;  2KC2 A;  3LYY A;  1KRE A;  2B39 A;  2X8X X;  1K50 A;  2FV1 A;  5CD2 A;  4FN2 A;  3SDU A;  1SEB D;  4C7Y A;  1WMH A;  3RX8 A;  1E8Y A;  4KVG B;  4GDL A;  2BF8 B;  1MG4 A;  1N20 A;  4GIV A;  3NZS A;  1RWS A;  1RWF A;  2PIA A;  3K9O B;  2D8L A;  2K39 A;  2FBA A;  1V86 A;  2MJD A;  3FC4 A;  1WMH B;  1UGM A;  3M7B A;  3Q3O C;  4GDL B;  2AQ1 B;  2RPV A;  1OJM A;  2BYT A;  3ECI A;  4P16 A;  4CHK A;  2KDM A;  4V1S A;  4MMI A;  4XYC A;  1O1T B;  5FKA C;  1AGM A;  5IN7 A;  4WAA A;  4HKZ E;  4RM8 A;  2K6D B;  2DAF A;  4FLH A;  3Q3M C;  1O6R A;  4HXD A;  3NFV A;  3NZ3 A;  2FCM A;  2VN7 A;  4YSZ B;  1I35 A;  3SR6 A;  3RX5 A;  2D07 B;  4NAW A;  1XQQ A;  1WX9 A;  4PYZ A;  1V7W A;  2NPT A;  5FO8 B;  3CWI A;  3G6J B;  1L4Z B;  3AXC A;  4NEI A;  1J7C A;  4N59 A;  3U7D A;  2N4F A;  4IUM B;  5I4D A;  5FO7 B;  4K3B A;  1LXM A;  3DST B;  4NAW B;  3ZRC A;  1LO5 D;  1TGZ B;  1KSD A;  4ZHP A;  2RGK A;  1VD5 A;  1WM2 A;  2NPT B;  1X1J A;  1FT1 B;  3RNA C;  1QBQ B;  1N5W A;  4BOZ B;  1JRO A;  5EAU A;  2MH7 A;  3RUL A;  1N62 A;  1L7Y A;  1C9F A;  4HK2 A;  1GHQ A;  1RAX A;  2ZIS B;  2LD9 A;  4MDK E;  3SDT A;  4FXK B;  3HXB B;  4IM0 A;  2V8J A;  2V1Y A;  3MC9 A;  5LXH A;  2JWZ A;  2M0A A;  2PMV A;  3WKH A;  1C77 A;  3AFL A;  2AYO B;  2LGI A;  1HXA A;  2FIF A;  2PKO A;  1TBE A;  3N1Z C;  2AWT A;  4AP4 C;  1V8C A;  4OZA A;  5L83 A;  4PK1 A;  3ENE A;  4WVB A;  2J0M A;  3IT6 B;  2BED B;  2Y5P A;  1GLM A;  2REX A;  1OQQ A;  4D4A A;  2YLM A;  4KGR A;  2NS5 A;  1CLC A;  2O2V A;  3W7W A;  2FUG 1;  1ZP0 B;  4NJ6 A;  4OVZ A;  3VTV A;  2C7H A;  1RLF A;  3SDV A;  3PRZ A;  3T3N A;  3AE6 B;  4OVU A;  2KWU B;  3G4D A;  5BYR A;  1SA4 B;  3RUI B;  5J2R A;  4E1Y A;  5LNK 1;  4BBN C;  4GTQ B;  4FHK A;  2O2V B;  3GS2 A;  3BIN A;  3KLS X;  1XLN A;  3M77 A;  3ZLZ A;  3V6E B;  1KJT A;  2MX2 A;  2ICI A;  4FNV A;  3RJ3 A;  3Q8F A;  1WXQ A;  1SF0 A;  4GTV B;  1V7X A;  2JZZ A;  1WF9 A;  3VH3 B;  2KLG A;  4TQ1 A;  4AYO A;  3A9J A;  1HCU A;  1F2R I;  2CU1 A;  1X9D A;  2EKE C;  4D4D A;  1J0N A;  4EZK A;  1TKG A;  1JAL A;  5ILH A;  1NEK B;  2H89 B;  3NRZ A;  4XZ4 A;  4IWQ A;  1PGB A;  4TQ0 A;  4ARC A;  5ILY A;  3AE4 B;  4ACF A;  3A9J B;  2QJL A;  3M62 B;  2L05 A;  5M7I A;  3OAW A;  2P0V A;  2MHJ A;  2V3P A;  2BS2 B;  1QOA A;  5E2J A;  2K9X A;  2N7D A;  2M4N A;  2K8C A;  1C1Y B;  2WXF A;  1P9D U;  4PS3 A;  2LFI A;  3C19 A;  3DBL I;  3L17 A;  3PRE A;  2KAC A;  1QF6 A;  3LDZ E;  4OW0 A;  5IK0 A;  5DGR A;  2JZP A;  2QCZ A;  1F77 A;  5IKC M;  4FJZ A;  1JRP A;  1JWU D;  1ISN A;  2QNO A;  1GXN A;  1V5T A;  2KTR A;  1E8W A;  1WZ0 A;  3DSS B;  4LNB B;  2BBC A;  1VCB A;  2C7M B;  1TYG B;  4WAF A;  2IYD B;  3EFC A;  3ZO5 B;  4J3O D;  1LD7 B;  1FD6 A;  5IKH A;  3I9V 1;  2IGD A;  1EU4 A;  3FAH A;  3VAW A;  1TN7 B;  4KDL B;  4FAD A;  3WKF A;  2KTR B;  4TF4 A;  3Q8A A;  1X1I A;  2AX5 A;  1N1B A;  2JUO A;  1PQS A;  2OJR A;  2WXM A;  2G1E A;  4GOC A;  4C00 A;  3M00 A;  1TKY A;  1CK1 A;  3SEB A;  3N9Y C;  4MGI E;  1L0V B;  1NL4 B;  1LFD A;  2NBV B;  5C3J B;  1LD8 B;  3ZTD A;  4GXB A;  1WJ4 A;  2KQS A;  2R61 A;  1P3Q U;  4E74 A;  3OJ4 B;  5LXI B;  1QAZ A;  3KH0 A;  3NVW A;  1N21 A;  2ONH A;  3V62 A;  1PGA A;  1A5R A;  4LCD E;  1GB4 A;  2KHW B;  5TSS A;  3R7Q A;  1V5D A;  1JWA D;  3Q7A B;  2A8Z A;  4WWP A;  3ZJU A;  2K5P A;  4LTU A;  4HJG E;  2DBY A;  3QA8 A;  4OZV A;  1FP3 A;  2HTH A;  3I3T B;  4PYU A;  5CZL A;  3PTF C;  1SE3 A;  4DXG A;  3BK1 A;  2GOW A;  2W3S A;  4M01 A;  2KAJ A;  3VXW A;  4G50 A;  3GZK A;  3VTU A;  1R4N B;  2GZ6 A;  1DGJ A;  4REZ A;  4CYE A;  2EMT A;  1AW7 A;  1E7P B;  1QT9 A;  4YT0 B;  1FO2 A;  2DRO A;  4ZRI A;  2ASQ A;  4EE2 A;  5DCN A;  2HJ1 A;  3RFZ B;  1KZO B;  1FMA D;  3IXS A;  2R2Q A;  4OK4 A;  1S1Q B;  2BB5 A;  3P2C A;  3AEF B;  4GB9 A;  3P4P B;  1OTR B;  1H8C A;  4WJQ A;  1JQ4 A;  1DOY A;  4KX6 B;  4QAY A;  1RFK A;  5H92 C;  2Z07 A;  1UUP A;  3PZ7 A;  4WUR A;  4I6L B;  1MJD A;  1TIF A;  2C9W B;  1YX6 B;  2X38 A;  1V1P A;  1HXG A;  1LXK A;  4ZRQ A;  4HPL B;  1N4R B;  4ICV A;  1L6U A;  3E6U A;  1NC5 A;  3AU5 A;  2G4S A;  1UEL A;  2NOJ A;  1GAH A;  2I38 A;  3P1M A;  3NS1 A;  2ZVN A;  1XEE A;  1SE2 A;  2FV0 A;  4LNK A;  4FHJ A;  2BRW A;  2JF5 A;  3B08 A;  5CTR C;  1WXV A;  3N1Y C;  1V1P B;  1EO6 A;  3HVZ A;  2BPS A;  3B2G A;  1L2N A;  1TKE A;  3U52 E;  1KLV A;  1E9M A;  1QLB B;  2JX5 A;  1G6J A;  3VRA B;  1C3T A;  2M56 B;  1X81 B;  3W5V B;  1FCE A;  3EQA A;  3LXF A;  4EKU A;  3U2S C;  5GXG B;  1H3B A;  4MAC A;  4F8C B;  3QAQ A;  1LF6 A;  4AYP A;  1QKZ A;  3ACT A;  1K72 A;  1ZGU B;  5CX3 A;  5AGD A;  1HQR D;  3L16 A;  2MBH A;  2AQ3 B;  4NQL B;  5FOB B;  2R2L B;  2WII B;  2GBN A;  2KJR A;  4NNJ B;  3BY4 B;  3S9V A;  3BVZ A;  1CEM A;  3RCZ A;  2WXQ A;  5JMF A;  2J42 A;  1UH6 A;  2I1J A;  2MW5 A;  3OXU A;  1TS4 A;  2ZCB A;  2ZW0 A;  4GAX A;  3ZNG C;  1KS8 A;  4MEL A;  3EC8 A;  1EUV B;  5EAT A;  3E32 B;  1TNY B;  4MBG B;  1ZW7 A;  2KDI A;  1I4X A;  3L54 A;  4JQW C;  1T0R C;  1WGR A;  1N63 A;  3H2W A;  4GDK A;  1SJE D;  4MSM B;  3ZNH B;  2QDF A;  1KKT A;  4F10 A;  4DDI D;  2L0F A;  3VR9 B;  4DDG D;  2KX0 A;  2FCQ A;  3TIX A;  2L00 B;  1WE6 A;  3SU8 X;  4ZYN A;  2W55 A;  2L7R A;  1N7O A;  1O1S B;  2RMM A;  2HTM E;  2BYF A;  4GDK B;  1WGG A;  2INC C;  5EE9 A;  2J52 A;  1N22 A;  1VRA B;  3MHS D;  2RDH A;  2H6I B;  1DL2 A;  3H6N A;  4A3P A;  4ZRP A;  1L6V A;  2J4X A;  5AZG A;  4HLE A;  5EAS A;  1O5M B;  1SIJ A;  1IA7 A;  2KMC A;  4ANV A;  2HD5 B;  2JU6 X;  1UWM A;  2B3A A;  3AMZ A;  1P1A A;  3W9C B;  2G02 A;  1N4S B;  1YOV B;  4NY0 A;  4BKG A;  2WY8 A;  2WLB A;  3SHQ A;  1E0Z A;  4IWO A;  2D3B A;  4OZC A;  1NI1 B;  4N9F 4;  3LB8 C;  2NMQ A;  4FBJ B;  3S4A A;  1E7U A;  4MEM A;  1GAQ B;  2G45 B;  3Q8B A;  2HJ8 A;  4MSQ B;  4OHJ A;  3V3X A;  1HV6 A;  2EAE A;  4DBG A;  4L0G A;  4ITK A;  1C4A A;  3DWG C;  1UF0 A;  5DHK A;  1KTK A;  3MFG A;  1BT0 A;  1XT9 B;  3X17 A;  3DQV A;  5HKH A;  3Q3J A;  2BGF A;  2N9E B;  4DXF A;  2AEH A;  2MSE D;  3WIM A;  2LRU A;  2KWV B;  1IA6 A;  1X1M A;  2CQT A;  2BKF A;  3AB5 A;  4P1C C;  1H39 A;  1YN5 A;  3ML9 A;  1J7A A;  1M94 A;  4IKG A;  1ZUD 2;  5AUK A;  3RX7 A;  4JIO U;  1DOG A;  2IO0 B;  2FUQ A;  3L10 B;  2GH4 A;  3QSP A;  2VH2 A;  4YSY B;  1Q5W B;  2NVP A;  1YN3 A;  1XCQ L;  2XNA C;  3GB1 A;  3TEZ A;  1GXO A;  1OQR A;  4AYR A;  5BMH A;  1E90 A;  3DVN U;  5E6N A;  1W6J A;  2RDB C;  2Z59 B;  3BII D;  3VQI A;  4BBN F;  2WGS A;  1EWC A;  1HZ6 A;  1QOG A;  1VZ8 A;  2QIL A;  4J6I A;  2PEA A;  2KWD A;  4P1B C;  3H1U A;  1WYW B;  4AUQ C;  2JRI B;  1HMU A;  1XWQ A;  4ZRJ A;  1HTO A;  4YDO B;  3AEC B;  2LVO A;  3X0W A;  1E5W A;  1FBO A;  2IY0 B;  2IBI B;  3N30 A;  3DBR B;  1Y8R C;  4JL9 A;  1ET6 A;  4LNV A;  4ZH5 A;  2LXC A;  4KGS A;  3M74 A;  2G0D A;  3WA0 A;  2DNF A;  5JH5 C;  4HPP A;  3EHV A;  1GB1 A;  5EE0 A;  1D3Z A;  2LJ5 A;  2MBB B;  3ZJT A;  1E10 A;  4PT5 A;  4V1R A;  4YTP B;  2EMS A;  3N3K B;  4W9E A;  4K3C A;  5EDS A;  1T0Y A;  1WGD A;  3HM6 X;  4RGN A;  1QOF A;  5DPW A;  3MC0 B;  4HJK A;  1SJH D;  2PLP A;  3W2D A;  3QRY A;  2AL6 A;  2FNJ B;  2BVC A;  1N7Q A;  1WGY A;  1DYQ A;  2MBE A;  3WAP A;  2XWB B;  1QSJ A;  2KT7 A;  1FAE A;  1D8E B;  3PZ8 A;  2V9H A;  2VZK B;  5IK9 A;  4IG7 B;  3O13 A;  3W5U B;  4EFO A;  4C4V A;  5AUI A;  4RM9 A;  5JXV A;  5BMG A;  3UIP B;  3P4R B;  4L1B A;  4MT5 A;  4BKT A;  5DPR A;  2L8J A;  1AWD A;  5MEH A;  3M63 B;  4WJO A;  3AN1 A;  4S0R A;  1CQV A;  4C4V B;  1ZOY B;  1QIL A;  3L13 A;  2CHZ A;  3UQB A;  3V05 A;  1KLU D;  1P7E A;  1MI0 A;  1H35 A;  1IUE A;  3M7E A;  3B1L X;  3GZN B;  3KUZ A;  4A90 A;  3IAM 1;  1YN4 A;  3RNE C;  1HN0 A;  2RGF A;  1YX5 B;  1JWM D;  1SBB B;  2L76 A;  1HA5 A;  1TJE A;  5IAA C;  1CZP A;  1GPX A;  1JCR B;  4W9I A;  3G4F A;  2F6D A;  2TSS A;  5ILZ A;  3IFW B;  3AE8 B;  3PVL A;  1UBQ A;  4G11 A;  2CJO A;  2BS4 B;  3PZ4 B;  3OJ3 A;  4IDI A;  1JML A;  2NTT A;  2DYM A;  1ULV A;  2PW9 A;  1A70 A;  3QCA A;  3ZNI D;  2I1K A;  2N1V A;  5GW7 A;  1AYF A;  5C1Z A;  3S4B A;  4JE3 B;  3VFK A;  4IM2 A;  1KOT A;  1LF9 A;  3I5J C;  1N95 B;  1GG3 A;  3V61 A;  3P42 A;  1YJ1 A;  1OEY A;  2JT4 B;  3U7Z A;  2J7Q B;  1Q0W B;  4BOJ A;  2D5J A;  2SQC A;  2LVQ A;  2PE9 A;  4TSS A;  3P5R A;  1NI3 A;  2Q5W D;  4KTR A;  2JRH A;  3ZTC A;  1PDX A;  5JPN B;  1Z2M A;  4LDT B;  4K7S A;  1EF5 A;  2WXJ A;  3MTN B;  1OQY A;  2JZ3 B;  1ET9 A;  2QIE B;  2IND C;  3W7X A;  3QDE A;  3ACS A;  3B9J A;  1Q1O A;  1WZ3 A;  4Q2J A;  2C7N B;  3NVY A;  2LHD A;  3TJP A;  1TNU B;  2BKR B;  1MFW A;  4YXD B;  2WXN A;  2VN4 A;  2ZIR B;  1N7P A;  1ZXI A;  4W9F A;  1V5O A;  2DZI A;  1TN8 B;  2CS4 A;  2LMC A;  3KWL A;  5JHA A;  3DWM A;  5JPM B;  1FNW A;  3KSL B;  3ZW3 A;  3K7X A;  3AI5 A;  5CHV C;  4LLG M;  5IM1 A;  1WM3 A;  2WDR B;  3RI7 C;  3SFY B;  2LXA A;  3Q69 A;  2G9H D;  2MLB A;  1HMW A;  1VZ7 A;  2BWF A;  4ZG8 A;  4OK2 A;  3VHT C;  3ZDM C;  2IO1 B;  2I07 B;  2KN5 A;  2GRI A;  3UIN B;  2MA9 B;  1SIF A;  4EZJ A;  2RI9 A;  1RWC A;  1E7V A;  3PO0 A;  4QT9 A;  3PSE B;  3M3J A;  2DZJ A;  3AEA B;  2DEN B;  1HZ5 A;  2UU7 A;  4ASW C;  3TEX A;  2KD0 A;  1WXS A;  2KTF A;  2KVR A;  3ML8 A;  2GBK A;  4J5T A;  1K51 A;  3A4S C;  3I63 C;  5KHQ A;  3UQA A;  1J19 A;  1GNU A;  1MVK A;  2HDE A;  3DPY B;  1FMI A;  1R4N I;  5JMD A;  4KGT A;  2H6G B;  5G5H A;  1MZC B;  1SA5 B;  2WS3 B;  1E8X A;  1HTQ A;  3D32 A;  3QWT A;  4A3O A;  4RCO A;  2V4I B;  3H7L A;  1I8Q A;  3SAE A;  3RD2 A;  3E33 B;  2KFJ A;  4YDE B;  1Z5S B;  4GGQ A;  2JF4 A;  4W9D A;  3O65 B;  3S2A A;  2YEP B;  1JCS B;  4JX1 C;  2KN4 A;  3AEE B;  3SDQ A;  4BZA A;  3ANK A;  1F1S A;  1RYJ A;  3QHT A;  1XLQ A;  1HM3 A;  4OZW A;  3AE7 B;  2K1F A;  5AEK B;  4ANU A;  2GLS A;  2XEW A;  1BUI C;  3SFE B;  4XGA B;  2XN9 C;  5JZE B;  2WDT B;  2Y3A A;  1K53 A;  1VLB A;  3VSM A;  3UGB B;  3H7P A;  3QPF A;  1ZE3 D;  4RF0 A;  3A4R A;  2JXT A;  4US9 A;  5C2T B;  4JPS A;  3ZQ4 A;  3RNB C;  3RNF C;  4Z4J A;  1FBW A;  4OVV A;  3H7P B;  4YWG G;  2MJE A;  1SQC A;  3J9C A;  1L1Y A;  1BML C;  5FK9 C;  3AEG B;  1V7V A;  3L08 A;  3UIO B;  3QX1 A;  2VRR B;  1OJO A;  1WX8 A;  3B0A A;  5E6O A;  4XWW A;  4EZL A;  1KRF A;  2RPQ A;  5DPS A;  4IOI E;  2IZV B;  1FCC C;  2OJW A;  2VH1 A;  3KSQ B;  2G3Q B;  1LQB A;  4HVB A;  1V97 A;  3VXD A;  3DSV B;  2WXK A;  2WXR A;  3HRD D;  3ZNZ B;  3EZ8 A;  2OHF A;  1N1Z A;  1T0S C;  1G87 A;  3CMM B;  4C1S A;  3IHP C;  2IO3 B;  1L4D B;  2KZR A;  4MH8 A;  4BOS C;  2WHI A;  1FPP B;  4GTM B;  5IKA A;  2D3A A;  2QEJ C;  4DI5 A;  1FNV A;  1N4P B;  1N5X A;  4GTR B;  3ON6 A;  4XUV A;  1GC7 A;  3AE1 B;  4DHJ B;  3Q78 B;  4HRO A;  3LZ9 A;  1FO3 A;  4RH6 A;  4XDC A;  2MBO A;  4W9G A;  2LRW A;  2QSD A;  2K6Q A;  4LNF A;  4NQK E;  3EFU A;  2DLB A;  1UBI A;  2GBM A;  2VZK D;  3DBH B;  3U4E G;  5KKB A;  3HUI A;  4L9P B;  4M8N A;  4ZHO A;  4B0M A;  4RNQ A;  4AYQ A;  2IJ0 A;  2JG0 A;  4BOK A;  5HG2 A;  1I4Q A;  4B0E A;  4XDD A;  2XBB C;  3V60 A;  1WYG A;  3REN A;  3GE3 C;  3EA6 A;  4DHZ B;  3Q8C A;  2FUT A;  1YMH E;  1RW9 A;  3TBL D;  2YEP F;  4ANW A;  4D4C A;  1N60 A;  4GTT B;  2KVZ A;  3Q14 C;  3HXC B;  3QT9 A;  2FUH B;  4FUL A;  1H14 A;  2WDA A;  2W54 A;  5H8Y E;  1G9G A;  3IG3 A;  1SB3 C;  1V6E A;  1WX7 A;  2WQY B;  4K81 A;  3RZW C;  3L4P A;  2KXJ A;  3UI3 A;  4I6P A;  4KV2 A;  1FXA A;  4B9K A;  1FXT B;  3TSS A;  1UZX B;  4MU9 A;  1L0X B;  3W7U A;  2MWS B;  2WU5 B;  4WIP A;  3AH7 A;  2JPH A;  5G55 A;  1KF6 B;  1NDD A;  5J18 A;  3NJT A;  2D11 A;  2B76 B;  4RMA A;  1HXY D;  3HIZ A;  1WIA A;  1XD3 B;  2K8H A;  2PVG C;  4BFR A;  2KDF B;  3QFY A;  4TKN A;  3DPD A;  1KZP B;  2JY6 A;  4L2Y A;  1R7S A;  2CR5 A;  2Z8L A;  1IS9 A;  3HHM A;  1HXC A;  4GL3 A;  3LJ3 A;  1WU5 A;  3E80 A;  3AFJ A;  4D94 A;  1YQ3 B;  2JQR B;  2KMA A;  2J0J A;  1IBX A;  4W9C A;  2ONQ A;  4BKS A;  2MJ3 A;  4Z4L A;  4GTS B;  4ZH1 A;  4X57 B;  3E56 A;  1YQ4 B;  1SE9 A;  4KZC A;  2RI8 A;  1WR6 E;  3DVN V;  1FPY A;  2L52 A;  1MG8 A;  2ZCC A;  1ESF A;  2H88 B;  2K8B A;  4YCR A;  4LDT D;  1IBX B;  4GU2 A;  1RFA A;  1B1Z A;  2GBR A;  3PZ3 B;  4A6Q A;  3GT5 A;  3ANJ A;  3RRS A;  2PTL A;  2QC8 A;  2GB1 A;  3NG0 A;  2FCN A;  4GMV A;  1T5X D;  3UF8 A;  4JJJ A;  3RNC C;  3HM3 A;  3EEC A;  1TNO B;  3E73 A;  1N61 A;  2LGY A;  1EWY C;  4DOE A;  4LIX A;  3DBR I;  3DHH C;  1VR9 A;  1WJU A;  4HWI B;  3ZUN A;  2J5C A;  3R2T A;  2LUM A;  1HX9 A;  2Z0E B;  5C23 A;  1OFF A;  5C05 A;  2AHF A;  1ZPS A;  1E6E B;  2IGH A;  2WX0 A;  2INP E;  4RF1 A;  1YJJ A;  3RNG C;  3ZXV A;  4MGZ E;  3WUX A;  4MH0 E;  2D10 A;  2M1M A;  3VR8 B;  2D3G A;  1WRD B;  3P4Q B;  4ZYS A;  1QQR A;  4C56 C;  1YNT E;  4ONT A;  5FR6 A;  1F1H A;  1V9J A;  3IBE A;  4B6W A;  5DGQ A;  3BVG A;  3HXF B;  4HEA 1;  5DHI A;  1U4A A;  4II2 B;  3SDL C;  4LNN A;  1JCK B;  2WU2 B;  1O6H A;  2WCO A;  1EM7 A;  1OJP A;  3CST A;  3RPF C;  4LNI A;  4FXG B;  4CO7 A;  4DK5 A;  4DXA B;  3JVZ X;  1CB8 A;  3CSF A;  1HZF A;  2UYZ B;  2KQ4 X;  4P7I A;  2LJI A;  1R4M B;  5ILD A;  3PYB A;  3V6C B;  3W5M A;  1O79 A;  5GY3 A;  5D6J B;  3KYD D;  2JYT A;  3GE8 C;  1EU3 A;  3PRM B;  4AS1 A;  5HI1 A;  2LGS A;  2WDV B;  3CIH A;  4G3X B;  4GSW A;  2K25 A;  3GZN I;  1L5P A;  1FM0 D;  4IC7 B;  4AJY B;  1XW2 A;  1QQF A;  1H3C A;  4LJP B;  1PGX A;  2QMT A;  3P5P A;  1TY2 A;  4OJZ A;  1MHH E;  3KUC B;  2LGD A;  5D7G A;  1F52 A;  4K7W A;  3Q6B A;  3TEW A;  2SEB D;  1SXT A;  1OJN A;  3MC8 A;  1C4C A;  1OEY J;  2LGX A; 
#chains in the Genus database with same CATH homology
 3B2F A;  3R8B A;  4TSS A;  2PN5 A;  3P5R A;  1NI3 A;  1TYG B;  2WXH A;  4WAF A;  2Q5W D;  1J7B A;  4J3O D;  1LD7 B;  4KTR A;  1FD6 A;  3I9V 1;  3ZGZ A;  1R76 A;  3AE2 B;  1PDX A;  2IGD A;  1EU4 A;  3CIR B;  5JPN B;  1LTX B;  1I4G A;  3FAH A;  1TN7 B;  2V0G A;  1F0Z A;  1N9A B;  2F0Y B;  3WKF A;  3C8Y A;  2WXJ A;  2N0S B;  2GOX A;  3A3V A;  1FT2 B;  4TF4 A;  3WKG A;  1KFG A;  1ET9 A;  2QIE B;  3Q8A A;  1H37 A;  3KQ4 A;  1KRH A;  2AX5 A;  3W7X A;  2JWU A;  3QDE A;  2WXM A;  2G1E A;  2IPK D;  3ACS A;  1TKY A;  3B9J A;  1CK1 A;  3SEB A;  3N9Y C;  1L0V B;  1NL4 B;  1JWS D;  5C3J B;  1C4P A;  3OWE B;  1LD8 B;  3EUV B;  4Q2J A;  1TF4 A;  1WRI A;  3NVY A;  3R2I A;  5BYQ A;  2LHD A;  2R61 A;  4A55 A;  1ZXH A;  2ACZ B;  1TNU B;  3C72 B;  3M73 A;  1GSZ A;  4HKQ A;  4YXD B;  3NVW A;  2WXN A;  2VN4 A;  2ZIR B;  1ZXI A;  3MP9 A;  3WCQ A;  1TN8 B;  2LMC A;  3KWL A;  3DWM A;  5JPM B;  1AN8 A;  2OKX A;  1PGA A;  1GB4 A;  1TS2 A;  1FNW A;  3KSL B;  5TSS A;  2CQS A;  3K7X A;  1O6Q A;  1KSC A;  1V5D A;  4LLG M;  4R3D A;  4ARI A;  2WDR B;  1L0Y B;  1JWA D;  4N58 A;  2V8I A;  3Q7A B;  3SFY B;  2A8Z A;  4DOD A;  1D4B A;  3ZJU A;  1H3A A;  1G9J A;  4EL8 A;  1T3Q A;  2K5P A;  4LTU A;  3Q69 A;  3W7T A;  2DBY A;  4LNG B;  2G9H D;  1ENF A;  4HJG E;  1FP3 A;  3SFX B;  3Q75 B;  1VZ7 A;  3GP7 A;  3MHZ A;  4ZG8 A;  1IGD A;  5CZL A;  1SE3 A;  4DXG A;  3BK1 A;  3BYY B;  2I07 B;  2DWQ A;  2W3S A;  2KAJ A;  3GZK A;  2GRI A;  4XE0 A;  1C78 A;  5BMI A;  5GZK A;  2GZ6 A;  1DGJ A;  4REZ A;  4RGT A;  2IGG A;  3TF4 A;  3IAS 1;  1AW7 A;  1E7P B;  1QT9 A;  2ZW1 A;  4YT0 B;  5T8I A;  2RI9 A;  1DOI A;  1FO2 A;  2DRO A;  3PO0 A;  1VDV A;  4QT9 A;  2PVO D;  4EE2 A;  3AEA B;  1O1R B;  3ETR A;  3IT4 B;  1HZ5 A;  3PYA A;  3RFZ B;  4H2A A;  1BXT A;  3TEX A;  1KZO B;  1FMA D;  1JW9 D;  3IXS A;  4C7Z A;  2BB5 A;  3P2C A;  2BB6 A;  2WXO A;  1WU6 A;  3AEF B;  4TMA B;  2WNM A;  3P4P B;  4AQ7 A;  4J5T A;  1K51 A;  5FO9 B;  1KWF A;  4P6V F;  1MVK A;  1GAI A;  2HDE A;  2J53 A;  3ZYY X;  1JQ4 A;  1DOY A;  4KX6 B;  3AV8 A;  1F9O A;  1RFK A;  4LK0 M;  2ZBL A;  5H92 C;  2Z07 A;  3DPY B;  1UUP A;  1WSP A;  3PZ7 A;  4WUR A;  5FR3 A;  1FMI A;  1FFV A;  2WP9 B;  3DSW B;  2EEL A;  3EUB 2;  1H13 A;  4KGT A;  2H6G B;  5G5H A;  1W6K A;  2WXI A;  1UNS A;  1H12 A;  1FO4 A;  2X38 A;  1MZC B;  3WKI A;  4ZRQ A;  2EAB A;  2V3N A;  1V1P A;  1N4R B;  4OZB A;  1SA5 B;  4M0W A;  1L6U A;  2WS3 B;  3E6U A;  3BWU D;  3QWT A;  1NC5 A;  2V4I B;  4RCO A;  1S63 B;  3BVM A;  2YIK A;  2NOJ A;  3H7L A;  1GAH A;  3SAE A;  2I38 A;  2MEK A;  1TNB B;  3P1M A;  3NS1 A;  3E33 B;  4GLS C;  1PUT A;  4YDE B;  1D6E C;  4CJ0 A;  2FV0 A;  2JF4 A;  1SE2 A;  1XEE A;  1JCQ B;  2YEP B;  2CJN A;  1JCS B;  5MPO A;  4ZOH C;  1V1P B;  4JX1 C;  3HVZ A;  3B2G A;  2KN4 A;  5M7Y A;  1TKE A;  3AEE B;  1E9M A;  3S4D A;  3SDQ A;  1QLB B;  2JX5 A;  5E6J A;  3ANK A;  3VRA B;  1RYJ A;  2ON8 A;  1XWT A;  4WH4 A;  4GTP B;  1XLQ A;  1FXI A;  1B9R A;  3AE7 B;  2M56 B;  1X81 B;  3W5V B;  1FCE A;  1BUI C;  3SFE B;  1UMP A;  3EQA A;  1FEH A;  2XN9 C;  3LXF A;  2Y3A A;  3BZD B;  2XQW A;  1K53 A;  3PZ1 B;  3U2S C;  2B4F A;  5GXG B;  3KLS A;  1VLB A;  4NAM A;  1H3B A;  4D2K A;  1D5X C;  3QPF A;  4MAC A;  1Y56 A;  1ZE3 D;  4RF0 A;  2L83 A;  1V5C A;  1LF6 A;  4AYP A;  2JXT A;  1QKZ A;  4RGM A;  1ZDV A;  1GXM A;  3ACT A;  5HHD G;  1DOX A;  4US8 A;  3PZ2 B;  3HVD A;  1K72 A;  2JJB A;  3D5S A;  4US9 A;  5AGD A;  5C2T B;  1HQR D;  4JPS A;  1F2R C;  3ZQ4 A;  2AQ3 B;  4DQO C;  1UGJ A;  5FOB B;  2XWJ B;  2R2L B;  2WII B;  5EE1 A;  1XLP A;  4Z4J A;  1FRD A;  1FBW A;  3S9V A;  3M75 A;  4EHM B;  2E6X A;  3BVZ A;  4YWG G;  3P4S B;  1CEM A;  4MM3 B;  2JSV X;  2WXQ A;  1NVI D;  4D4B A;  2OED A;  2MJE A;  1SQC A;  1FRR A;  3J9C A;  1L1Y A;  1D5Z C;  1BML C;  2J42 A;  3OXU A;  1TS4 A;  5FK9 C;  2ZZR A;  3AEG B;  1V7V A;  3CU7 A;  4C80 A;  2ZW0 A;  3WIR A;  1VZ6 A;  3P63 A;  2BT6 A;  3EGR A;  3Q73 B;  1KS8 A;  1FFU A;  2AQ2 B;  3ZJV A;  1RQ5 A;  4XWW A;  1UG9 A;  3Q7F B;  2IDY A;  1S64 B;  3E32 B;  1XF5 L;  3NVV A;  1UWX A;  2EAC A;  1MPE A;  3TUO A;  3T3O A;  1TNY B;  1KRF A;  4MBG B;  1P7F A;  1XXG A;  4IOI E;  4A9A A;  2WXL A;  1TNZ B;  1I4X A;  5D3D A;  1FCC C;  1H54 A;  2XFG A;  1C76 A;  1PFD A;  3S4C A;  1N63 A;  3H2W A;  3KSQ B;  3M76 A;  1JS4 A;  1SJE D;  2KMM A;  1I7H A;  2WXP A;  4A8X C;  1V97 A;  3VXD A;  3HXE B;  1ACC A;  3DSV B;  1KKT A;  3DSX B;  3QFZ A;  3FIL A;  1XCT L;  1D5M C;  3AE5 B;  2WXK A;  2WXR A;  2N9L A;  4O1N A;  3VR9 B;  3HRD D;  2FUZ A;  1I4P A;  2L1A A;  5D3I B;  3AM9 A;  3QXF A;  2W55 A;  4YSX B;  3TEY A;  2V8K A;  1TS5 A;  1O1S B;  3EZ8 A;  2OHF A;  1UT9 A;  2RMM A;  3MJ5 A;  2HTM E;  2WYN A;  3T33 A;  1DCE B;  1G87 A;  1XO3 A;  2N7J A;  2WDQ B;  4GDK B;  5EE9 A;  3VRB B;  4C1S A;  2J52 A;  5HFY A;  1L4D B;  4KTP A;  3K11 A;  3W5N A;  1VRA B;  2M19 A;  2RDH A;  3FIL B;  2H6I B;  4MH8 A;  1DL2 A;  4ZRP A;  1L6V A;  3OED A;  2J4X A;  5EE3 A;  1FPP B;  1O5M B;  1SIJ A;  1IA7 A;  2DRQ A;  4GTM B;  2QEJ C;  1P7E A;  2JU6 X;  3DRA B;  1FNV A;  1I4R A;  1N4P B;  1N5X A;  3U52 E;  1UWM A;  3AMZ A;  4GTR B;  2DRR A;  3ON6 A;  4XUV A;  1FIQ A;  2E3T A;  4WVA A;  1GOZ A;  3AE1 B;  3W9C B;  2G02 A;  3Q78 B;  1N4S B;  3ANI A;  1FO3 A;  3GLY A;  4CE7 A;  1GA2 A;  2N9K A;  2WY8 A;  3NUH B;  4HRO A;  4RH6 A;  2QSD A;  4XDC A;  4FUS A;  1VJK A;  2K0P A;  2WLB A;  1E0Z A;  3WIW A;  2DLB A;  4OZC A;  1SSN A;  2VZK D;  1NI1 B;  3AEB B;  4KKI A;  3LB8 C;  2NMQ A;  4FXC A;  3U4E G;  5KKB A;  3HUI A;  4L9P B;  4ZHO A;  3S4A A;  1QOB A;  1ROE A;  4HRS A;  1YJI A;  3D5R A;  3LYY A;  1KRE A;  1GAQ B;  2B39 A;  4AYQ A;  4B0M A;  1K50 A;  1C3D A;  2FV1 A;  1WWT A;  2IJ0 A;  2JG0 A;  3SFD B;  3Q8B A;  4BOK A;  5HG2 A;  5CD2 A;  4OHJ A;  3V3X A;  3SDU A;  1SEB D;  1I4Q A;  2W82 A;  4XDD A;  4B0E A;  4C7Y A;  1H36 A;  3QT3 A;  2EAE A;  2LEK A;  3RX8 A;  1F9D A;  3M71 A;  1WYG A;  4L0G A;  4ITK A;  3REN A;  3EA6 A;  1C4A A;  3DWG C;  2INN E;  1KTK A;  2FBW B;  3MFG A;  1RWS A;  1YMH E;  3Q8C A;  2YEP F;  4D4C A;  3X17 A;  4GTT B;  1N60 A;  1KLG D;  3HXC B;  3QT9 A;  2PIA A;  4WWM A;  1V1O A;  2D8L A;  4NZL B;  4DXF A;  4L6X A;  1STE A;  2FBA A;  1H14 A;  1WZZ A;  2MJD A;  1SE4 A;  2W54 A;  3FC4 A;  3WIQ A;  4N6E B;  1G9G A;  1IA6 A;  5H8Y E;  1SB3 C;  3M7B A;  2WQY B;  1CJE A;  3L4P A;  3M7L A;  4GDL B;  3UI3 A;  2AQ1 B;  3URY A;  2RPV A;  2CQT A;  1TY0 A;  2BYT A;  3AB5 A;  4P16 A;  1H39 A;  1YN5 A;  2AHG A;  1FXA A;  4V1S A;  2KDM A;  3TSS A;  1J7A A;  4MU9 A;  4TXT A;  1NXC A;  3W7U A;  1L0X B;  2WU5 B;  1ZUD 2;  1O1T B;  3RX7 A;  3AH7 A;  1DOG A;  3BYT B;  4IKG A;  4L23 A;  4WIP A;  5AUK A;  5FKA C;  2GI9 A;  1AGM A;  1TN6 B;  2GH4 A;  4HKZ E;  1KF6 B;  3QSP A;  4YSY B;  1G6I A;  2NVP A;  2B76 B;  1O6R A;  3I57 A;  1KH0 A;  1YN3 A;  3SDR A;  1HXY D;  1XCQ L;  2XNA C;  2SAK A;  3H8H A;  3NZ3 A;  3H3K A;  3GB1 A;  2PVG C;  3AED B;  2VN7 A;  1IGC A;  4YSZ B;  3QFY A;  3TEZ A;  1FNU A;  1GXO A;  1KZP B;  3VW5 A;  4UDU C;  3SR6 A;  1OQR A;  3RX5 A;  4AYR A;  3QXQ A;  2EKI A;  5BMH A;  3SQC A;  4CJ1 A;  1N94 B;  2LHE A;  2BW2 A;  1W6J A;  2H6H B;  1R7S A;  4L2Y A;  3BII D;  3VQI A;  1V7W A;  2Z8L A;  1IS9 A;  3CWI A;  5FO8 B;  4GL3 A;  3G6J B;  4WVC A;  1WU5 A;  4D94 A;  3AFJ A;  1L4Z B;  1YQ3 B;  2IEJ B;  3M7C A;  3RSY A;  1EWC A;  2JQR B;  3W7S A;  1HZ6 A;  1QOG A;  1J7C A;  1VZ8 A;  2QIL A;  4N59 A;  2KWD A;  5I4D A;  5FO7 B;  1IBX A;  2ONQ A;  3BK2 A;  2MJ3 A;  4Z4L A;  4GTS B;  3DST B;  4ZH1 A;  4NAW B;  1XWQ A;  1LO5 D;  1PYW D;  3E56 A;  4YDO B;  1YQ4 B;  2AFA A;  2EAD A;  3AEC B;  4RFB A;  1KSD A;  4ZHP A;  2RGK A;  1VD5 A;  2Y5C A;  2RI8 A;  1FBO A;  3Q8E A;  1FT1 B;  4CQN A;  2L52 A;  1TS3 A;  1QBQ B;  3M72 A;  1ESF A;  1N5W A;  2H88 B;  2L32 A;  1JRO A;  3E30 B;  2D5G A;  4YCR A;  1ET6 A;  2MH7 A;  4LNV A;  1IBX B;  1N4Q B;  4ZH5 A;  2WIN B;  1RM6 C;  4KGS A;  3M74 A;  2G0D A;  1B1Z A;  5G5G A;  3PZ3 B;  1N62 A;  4A6Q A;  2WY7 A;  2K22 A;  1C9F A;  3GT5 A;  1GHQ A;  1GB1 A;  4KKJ A;  4JWU C;  3ANJ A;  3RRS A;  2PTL A;  4JWS C;  2ZIS B;  2GB1 A;  1T6B X;  5EE0 A;  1HEZ E;  3DSU B;  2CU3 A;  1T5X D;  3ZJT A;  1E10 A;  3SDT A;  4FXK B;  4V1R A;  4PT5 A;  3HXB B;  4JJJ A;  4YTP B;  2V8J A;  5BYS A;  1TNO B;  3E73 A;  1N61 A;  4RGN A;  1EWY C;  1QOF A;  2M0A A;  3MC0 B;  2PMV A;  3WKH A;  4DOE A;  1C77 A;  2LGI A;  1SJH D;  4LIX A;  2PLP A;  2PKO A;  3W2D A;  3QRY A;  1VR9 A;  1I4H A;  4GTO B;  3R2T A;  1D8D B;  2LUM A;  1L2A A;  1DYQ A;  4RNA A;  1V8C A;  4OZA A;  5CA3 A;  4WVB A;  1OFF A;  2RDG A;  3IT6 B;  2BED B;  2AHF A;  2XWB B;  2Y5P A;  1GLM A;  1QSJ A;  3WC3 A;  1ZPS A;  2FE8 A;  3KWV A;  1AYX A;  1FAE A;  1E6E B;  1OQQ A;  4D4A A;  1D8E B;  2IGH A;  2WXG A;  3PZ8 A;  2VZK B;  4KGR A;  1CLC A;  2INP E;  3O13 A;  4RF1 A;  3W5U B;  3W7W A;  2FUG 1;  1ZP0 B;  4OVZ A;  1YJJ A;  4WU0 A;  5AUI A;  3SDV A;  3WUX A;  1KFY B;  3T3N A;  3AE6 B;  5JXV A;  5BMG A;  5BYR A;  3E37 B;  3VR8 B;  1K52 A;  1WGK A;  1SA4 B;  3P4R B;  4L1B A;  4MT5 A;  3AE3 B;  3P4Q B;  1AWD A;  5LNK 1;  3D3I A;  4ZYS A;  1C79 A;  1NEN B;  4GTQ B;  5MEH A;  1QQR A;  4C56 C;  1YNT E;  2BS3 B;  2BTE A;  4ONT A;  3GS2 A;  4NJC A;  3KLS X;  2A73 B;  1M4V A;  1CQV A;  1XLN A;  3M77 A;  3AN1 A;  5DGQ A;  1ZOY B;  1QIL A;  1C4C A;  2K3U A;  3BVG A;  3E34 B;  3HXF B;  2ICI A;  4HEA 1;  3RJ3 A;  3V05 A;  3HXD B;  1KLU D;  4M76 A;  1JCK B;  1MHX A;  1O6H A;  1H35 A;  1IUE A;  3M7E A;  4GTV B;  1V7X A;  1EM7 A;  1MI0 A;  1SF0 A;  4Q88 A;  4XWT A;  4A90 A;  4TQ1 A;  2NTS A;  3IAM 1;  2W3R A;  3RPF C;  4AYO A;  1YN4 A;  1NYR A;  4FXG B;  1HCU A;  2H6F B;  1F2R I;  3PMM A;  1JWM D;  3QG0 A;  1X9D A;  1SBB B;  1HA5 A;  1TJE A;  1GPX A;  1HZF A;  1CZP A;  4D4D A;  4Q2B A;  1JCR B;  2JYE A;  2KQ4 X;  2TSS A;  2F6D A;  2LJI A;  4USA A;  1TKG A;  3AE8 B;  3PYB A;  1JAL A;  1NEK B;  2H89 B;  3NRZ A;  3W5M A;  2CJO A;  1O79 A;  3PZ4 B;  2BS4 B;  1PGB A;  5GY3 A;  4TQ0 A;  4IDI A;  4WQM A;  2JYT A;  4ARC A;  1EU3 A;  2DYO A;  3Q8F A;  3AE4 B;  4AS1 A;  5HI1 A;  4YTM B;  1WXQ A;  2QJL A;  1JML A;  2NTT A;  2I2Y A;  4RGO S;  4YTN B;  2DYM A;  3CIH A;  5M7I A;  1NYQ A;  2WDV B;  1ULV A;  2PW9 A;  2P0V A;  2V3P A;  2DRS A;  1A70 A;  1FM0 D;  1L5P A;  1QOA A;  2BS2 B;  1XW2 A;  5E2J A;  1Q10 A;  1TZO A;  2K9X A;  1QQF A;  1H3C A;  5GW7 A;  1PGX A;  1AYF A;  2QMT A;  1WU4 A;  3EU8 A;  3P5P A;  3M78 A;  2WXF A;  3NVZ A;  1TY2 A;  2LFI A;  1ZDX A;  1FCL A;  1MHH E;  3W1S A;  3S4B A;  4JE3 B;  2KAC A;  1QF6 A;  1LF9 A;  4OW0 A;  5DGR A;  5D7G A;  2JZP A;  1N95 B;  1F77 A;  1XLO A;  3ABV B;  3P42 A;  1JWB D;  1JRP A;  3TEW A;  1JWU D;  3EU5 B;  3Q79 B;  2SEB D;  2QNO A;  1GXN A;  3E9S A;  3AE9 B;  1SXT A;  3U7Z A;  3DSS B;  4LNB B;  4BOJ A;  2BBC A;  2WU2 B;  2D5J A;  2SQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...