2PMVA

Crystal structure of human intrinsic factor- cobalamin complex at 2.6 a resolution
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
378
Chain Sequence
b'SCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGHLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gastric intrinsic factor
publication title Crystal structure of human intrinsic factor: Cobalamin complex at 2.6-A resolution
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 112
structure length 378
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14478 DUF4430 Domain of unknown function (DUF4430)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2pmvA01
3.10.20.490 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pmvA02
4M76A 3C72B 2PMVA 4GTVB 1QSJA 1H35A 4ZRPA 1TN7B 3Q75B 3SFYB 1TNYB 3DSWB 3HXEB 3Q79B 3E32B 2WIIB 4EHMB 4D4AA 4LNGB 1FPPB 1GSZA 1H37A 1D8EB 4ZRQA 1FT1B 2WY7A 3Q73B 4ZH1A 1O6HA 4V1RA 5FO9B 1LTXB 1N4SB 3DSXB 4GTMB 3Q78B 3G6JB 3E34B 1H39A 1SA5B 5FO8B 1FT2B 2IEJB 4YDEB 2NOJA 2ZIRB 1NL4B 3E33B 4KKIA 5FO7B 4D4CA 3HXFB 1DCEB 3HXBB 2PN5A 1JCSB 4LNBB 2H6HB 1QBQB 2ZISB 3KSQB 1GXMA 2WY8A 3DSTB 3E30B 2GOXA 1C3DA 2XWBB 2BEDB 1GXOA 4D4DA 3SQCA 1MZCB 3OXUA 3E37B 4GTTB 1UMPA 1W6KA 1D8DB 1HZFA 1N4RB 1JCQB 3OEDA 1TNBB 3KLSA 5JPMB 2V3PA 4GTQB 3K7XA 2WINB 1X81B 3RJ3A 2H6IB 1N4QB 4FXGB 1KZPB 1R76A 1TNUB 4L9PB 1LD7B 2R2LB 3KSLB 1GXNA 1N94B 1N9AB 1GHQA 5JPNB 1O6RA 2V3NA 1H36A 2V8KA 3KQ4A 3PZ4B 4LNVA 2G0DA 3DSVB 4V1SA 1JCRB 1O1TB 2BB6A 1S63B 3DRAB 3HXCB 3SFXB 2V8IA 5FOBB 3Q7AB 4ONTA 1O1RB 4D94A 2B39A 2XWJB 3D5RA 1O79A 4D4BA 2G02A 1TNOB 4KKJA 3U7ZA 1H3BA 1TN6B 4BOKA 3DSSB 4BOJA 3DPYB 3Q7FB 4MBGB 5AGDA 4GTRB 1SQCA 2H6GB 1LD8B 1SA4B 2XQWA 1N4PB 3DSUB 4GTSB 3PZ1B 1O5MB 4C1SA 1W6JA 1H3AA 3PZ2B 2I07B 1QQFA 3CU7A 4MU9A 4GTPB 1KZOB 2A73B 4FXKB 1H3CA 1NI1B 3EU5B 2BBCA 4GTOB 2F0YB 3HXDB 2SQCA 2V8JA 4YDOB 1TN8B 1N95B 1S64B 3EUVB 1O6QA 3PZ3B 2H6FB 2BB5A 3D5SA 1TNZB 1O1SB
chains in the Genus database with same CATH superfamily
4US8A 2NBWB 5TR5A 1RWCA 2L83A 4XC2A 1HQRD 4MDKE 2WDVB 1HMUA 5J2RA 5EDSA 3DSWB 4KGSA 3KVFB 2DZIA 3NVVA 4KX6B 3M62B 4LNGB 5FR3A 2B3AA 3SR6A 3NOBA 3A9KA 4M8MA 2NR2A 1SE4A 2JX5A 2E6XA 3M73A 1J0GA 2WGSA 5C3JB 4AYOA 2MBHA 2BW2A 1WGKA 2CU1A 2O2VB 1J7CA 3A4SC 4KIKB 1WXVA 5IKHA 3VTWA 1ZGUB 1YX5B 2C7HA 3FILA 4OZWA 4S0RA 2HJ8A 2IY1B 2BS3B 3Q3JA 1G9JA 2XBBC 3G4FA 4KTRA 1CLCA 3GLYA 1X9DA 3PGEA 4DXFA 2EAEA 2XK5A 4FHJA 2AWTA 2KMMA 3CWIA 3RJ3A 2Q1FA 2X03A 3SHQA 4BKSD 4TXTA 1SE9A 1FMAD 1N1BA 5IM1A 2Z0EB 4HRSA 3VFKA 5JPNB 3ZXVA 3P4PB 3AE7B 4LK0M 4X57B 4GDLA 4LNVA 4ITKA 4GIVA 2YEPB 2J0MA 3Q7AB 3NS8A 3TEYA 2PE6B 2HTME 4DK5A 1PGAA 1RWGA 4IM3A 2M17A 3AH7A 1N21A 3M01A 1C79A 1TNOB 5ILIA 2MBEA 4CYEA 2FUTA 3PSEB 2H89B 2M1MA 3GZKA 1IA7A 4PK1A 2MJ3A 2AQ3B 1E7UA 1NI3A 1N4PB 5H8YE 3M72A 3A9JB 1PQSA 2R61A 4FLHA 2KLCA 5AZGA 1KTKA 3BK1A 2WP9B 4ZDVA 2NVPA 2WXIA 1H13A 3K9PB 1EGUA 1O6QA 2LGXA 2BB5A 3PRPB 1TNZB 2ZZRA 1O1SB 5LNK1 3IAM1 2RDHA 3AFLA 4J5TA 3UQBA 2J0KA 2RSUA 2WHIA 2WXGA 5L83A 1KS8A 1H12A 3ZNGC 4EHMB 3NRZA 3V6EB 2Z0DB 2LEKA 2GBNA 3L13A 3H7SA 2DWQA 3N9YC 4ANWA 4RGNA 3TIXA 1XCTL 2WYQA 2DAFA 4LNKA 3KWLA 2ZEQA 4I6NB 2NCNA 3PYBA 1TTNA 1WM2A 4YTNB 1N60A 3AEGB 4KZ0A 3B2FA 3PTFC 2AYOB 4MSMB 1WH3A 1C3DA 2XWBB 2DROA 3E37B 3I9V1 1JCQB 1EF1A 3DBLB 2FIDA 2LXCA 1TYGB 5EATA 3Q3MC 3IG3A 2LXAA 2H6IB 2BWFA 4E1YA 1TY2A 1TNUB 3Q8AA 1WZZA 2JWZA 1LOHA 1N7PA 3P4RB 3L17A 2NS5A 3RENA 3QWTA 2AHGA 4AYPA 4HROA 1GC7A 3NHEB 4M01A 2V8IA 1XXGA 2PVGC 1C1YB 2W54A 4K7SA 1C9FA 2GZ6A 4NNJB 2QSDA 3M78A 1LF9A 3DOWA 1GAHA 3P5PA 4GLSC 4LNIA 2X38A 1E5WA 3PV1A 3I63C 4OVUA 4Q2JA 3WIQA 1WSPA 1G6IA 4MELA 2M4NA 3P42A 1OJNA 2DHZA 3L16A 2HDEA 2I2YA 1J7BA 2ZVOA 4ARCA 1GOZA 5CA3A 2NTTA 2FV0A 2L7RA 4JWSC 4GDKB 1YQ3B 2KK8A 1TS4A 2J53A 1X1IA 5IA7A 4RCOA 1J19A 2D2QA 1KOTA 2O6VD 4P7IA 3E80A 2WXFA 1WMHB 3GS2A 2IO1B 2L0TA 4XWTA 1SEBD 5AUKA 3ZGZA 3HHMA 3PZ7A 3CSFA 3OJ3A 1EU3A 2V1YA 3AE9B 2GBKA 3RD2A 3E7JA 3JW0X 3DBRI 4OHJA 3Q3OC 4RNQA 1BT0A 3Q78B 4HPPA 2N9PC 3IXSA 3ACSA 3EUB2 4G50A 1YJ1A 4N6EB 2Y5PA 3AFJA 4CJ0A 3N1YC 3QXQA 3HVDA 1FO2A 3VR9B 2AX5A 2K8BA 5G5GA 1EWCA 3PLVA 3E30B 1MG4A 3SD5A 2KFKB 3ABVB 4C80A 3UF8A 2KNBA 2M56B 1TNBB 2JXXA 1E0ZA 1IGCA 3T33A 2D07B 3PVLA 2D5GA 1NBFC 2CQSA 3IT6B 4IOIE 2O6VB 4IW0A 4DXGA 4C4VB 3VAWA 3H7PA 1V5OA 1JRPA 1H36A 3S4BA 1JWAD 2DYBA 5JHAA 2CQTA 1HTOA 3AEEB 1F9OA 4EEWA 1N5XA 1CJEA 4YCRA 3VRAB 2RI9A 4CO7A 1TF4A 2G02A 1ZXHA 1NENB 3A9KB 2KTRB 3JVZX 2PVOD 3DSSB 2RDBC 4TMAB 1VD2A 4WJQA 4FJYA 2FUQA 3ZJVA 2J4XA 4HPLB 1LGRA 5DGQA 2RPVA 4I6PA 1C4CA 2CHXA 3GT5A 2K0PA 4P16A 1F2RI 5E6JA 1V7XA 2O2VA 4KSLC 2BRVX 4O1NA 2HE7A 3FILB 1HEZE 3OAWA 1JS4A 3AE3B 4JGHB 4NAWB 2BT6A 3SDUA 3PZ8A 1E9MA 4GTVB 3WCQA 4ZRPA 1F1HA 4PYZA 3ONSA 4HJKA 3R7QA 4BFRA 1OJOA 4JWUC 1ZKHA 2KQ4X 3AMZA 2KJHB 1RFKA 5EE0A 2ZW1A 4JLCA 1D4BA 2EABA 3LB8C 2HD5B 3H9DA 4CJ1A 3PZDA 1L0XB 2W55A 1E90A 2A4ZA 1N4SB 2OHFA 4LJPB 4TUUA 1K51A 3BIID 4GDLB 1HMWA 3RN9C 4AQ7A 4W9DA 3P5RA 1WI0A 2JVCA 3DVNU 1AWDA 2BRPA 4KKIA 2NMQA 2L1AA 4LNBB 3CSTA 4EUTA 2JQRB 4DOEA 3AEFB 3DHGC 2PKOA 3ETRA 3PPAA 4G0NB 1T0YA 1OQQA 4MGYE 4GTTB 2QJLA 2FBAA 1KSCA 3OEDA 2KACA 4FUSA 1SIFA 4IWPA 3GE3C 2JSVX 1VDVA 2IGGA 2D5JA 3DDCB 3AN1A 4FJQA 3VXDA 3Q2AC 1CK1A 2L32A 2GRIA 1SGHA 2AEHA 4XWWA 3KQ4A 1OFFA 4F1SA 1O1TB 1K8RB 1C3TA 2KOXA 1DGJA 4PT5A 1N22A 4QAYA 3TF4A 1T3QA 1VZ6A 2Y5BB 5IK0A 4OVZA 3QSPA 1LQBA 4USAA 3NZ3A 2XWJB 1FXTB 1N61A 5G55A 1H3BA 3W7UA 2GB1A 4MBGB 2K6QA 1F2RC 4E3CA 1I8QA 1G87A 2ONQA 1JWMD 3PZ1B 4GMVA 1L2NA 2IGHA 2J5CA 1E10A 4TF4A 4P1CC 3URYA 3CU7A 4DBGA 1PGBA 4WH4A 2JRIB 4MM3B 2K3UA 4B6WA 2BQQA 2WXKA 1FXAA 2MQJA 3EU5B 1WU4A 1HN0A 1RW9A 3CMMB 1KJTA 4W9EA 2L76A 1NXCA 3ANJA 2VH1A 4GL3A 3DBLI 3K9OB 3KLSX 3C72B 4NQKE 4YSXB 1AN8A 2LHEA 4H2AA 1YIWA 3Q75B 3T3NA 2KXJA 4UDUC 3RULA 2RD0A 2LVPA 2VN7A 4LDTD 1HE8A 3B9JA 4RM8A 2WS3B 1D5XC 2WY7A 2GI9A 1EWYC 3ON6A 1E7VA 3Q8CA 4YSYB 4KGRA 3U52E 3AE1B 5D3DA 4J3OD 3I3TB 2MW5A 2C60A 1OEYJ 2YVCA 3W7SA 1ZPSA 3QX1A 4FJZA 1GLMA 2H6HB 4DHZE 1TS3A 3E73A 2ONGA 3H1UA 1FP3A 1GXMA 4GGQA 2LUEA 2GLSA 4D4DA 1MFWA 2LGDA 1M94A 3BK2A 1K50A 5H92C 4D2KA 2Q5WD 1F52A 2K8HA 3ZO5B 4RM9A 1N4QB 3RNCC 4P6VF 1VRAB 1L7YA 2JF4A 1K72A 4OJZA 1U4AA 3KSLB 3PS6A 4GDKA 2V3NA 4LTUA 2V8KA 4MH8A 2KANA 3R7RA 3DVNV 2IDYA 4LDTB 5JHBA 5ILJA 3PT2B 3SAEA 2QHOA 1C78A 2L3ZA 4YWGG 2DBYA 2PTLA 1I42A 1QOFA 1WMHA 1J0MA 1CMXB 4MEMA 2MSED 4HJGE 3V61A 2BTEA 3NJTA 4JL9A 3TL5A 1WXQA 3M00A 2C9WB 3SDLC 4KV2A 5C1ZA 4FADA 5ILDA 2FCQA 2DNFA 5DPRA 1R4MB 3ZVVA 3M02A 4NJ6A 1NI1B 5L95C 1H4RA 2F0YB 1D6EC 1YOVB 3TMPB 2DZJA 4KGTA 5C05A 4BBNF 3K11A 2V9HA 3RZFA 1NYQA 4HEA1 1ROEA 2JYTA 2KVZA 1SE2A 1WGHA 1ACCA 1KLUD 3ZNID 1I4RA 3R2TA 1FBOA 2QILA 3I57A 4TQ1A 3CIRB 1RRBA 1X1MA 1N7QA 3FKYA 1FT1B 1TZOA 4B95A 5IL8A 3H7PB 2HJ1A 4LJOB 2O6VA 4JE3B 4C4VA 1HTQA 1SSNA 5GMVA 1I7HA 2LJ5A 4EFOA 2XNAC 1A70A 3W7WA 3QDEA 2ZISB 2IO3B 4CHKA 2M8SA 2JU6X 2ZNVC 3WIMA 3RRSA 3RX8A 3RX7A 1QZEA 2N7EA 2BEDB 2YEPF 2KTRA 4E71A 1TT5B 1KF6B 2E22A 2WINB 5M7YA 2RDGA 3WAPA 2C7MB 4ZYSA 3X0WA 4RFBA 2RPQA 4FXGB 1KZPB 2WXQA 1V9JA 2G4SA 2N1WA 4IWQA 5AZFA 1I4PA 3Q3NC 3MHSD 4OZBA 2XEWA 4XUVA 3HRDD 2HTHA 1V1OA 2WU2B 4V1SA 1JCRB 1S63B 4NAWA 5MPOA 4W9IA 3LDZE 5IO9A 3A3VA 1WXAA 3V60A 1I4HA 1FCCC 4A55A 5MEHA 4HKQA 1C4PA 2PLPA 4BOKA 3G4DA 5CHFA 1L6VA 4BOJA 1PYWD 3Q7FB 1R4NB 1W3YA 3WC3A 1LXDA 4N9F4 4LNOA 1KWFA 4GTSB 4OZVA 4FNVA 2OEDA 2EADA 3QFZA 2LI5A 2QMTA 1QQFA 1AARA 4ARIA 1KZOB 1OJPA 2IZVB 4FXKB 1FM0D 4M0WA 1XEEA 1ZXIA 3DPDA 1M4VA 1X1HA 4DQOC 1QSJA 1N63A 3TSSA 3ZRCA 2B4FA 1TN7B 1TGZB 1WGGA 2R2OA 4NPNA 1MVKA 5E6NA 1WY8A 3R8BA 1N1ZA 3M7LA 3ZNZB 1GB4A 3W5NA 3OJ4B 3L10B 1AGMA 1KFGA 2JJBA 2K22A 2N7DA 5ILKA 3MC9A 3QWZB 3Q73B 4FJVB 3M76A 5IK6A 4GSWA 1H14A 2C7NB 3W2DA 1NC5A 3G6JB 3T3OA 3S4DA 2ONHA 3OWEB 1PGXA 4L0GA 4RGMA 4RMAA 5GZKA 3ENEA 1YJJA 2QEJC 3E33B 4KSKC 1FO4A 1IBXB 4MGIE 2BYFA 1V5DA 3RUIB 1UBQA 4Q88A 4Z4LA 2LUMA 3AI5A 1ET9A 3DSTB 1UWMA 3GB1A 3E9SA 3NS1A 4HKZE 1FIQA 3KYDD 2RGFA 2V3PA 3S4CA 2KFJA 3K7XA 1R7SA 3OG5A 1WU5A 1X81B 5T8IA 4WWNA 5BYQA 4L9PB 2F6DA 1QKZA 4DDID 4MM3A 2NTSA 2K9XA 3M3JA 2BYTA 2WWZA 1N20A 1MJDA 2AQ1B 5I4DA 3VH3B 2MA9B 1WGRA 2EKIA 3V6CB 3KH0A 1SJHD 1L4DB 1V5TA 1WXSA 5AEKB 3VUYA 2VH2A 3O65B 4II2B 3RFZB 4KDLB 2MH7A 3ACTA 1PFDA 4NZLB 3SEBA 4KVGB 4ANUA 3RCZA 4N58A 2JF5A 4LCDE 3PRMB 5IKAA 2RR9A 3RZWC 2XQWA 1P0RA 3PHWB 5HG2A 4EZKA 1S1QB 3EC8A 2I07B 1C77A 3H2WA 2KC2A 2A73B 2ACZB 3ZTDA 1S3SG 5DPSA 1VJKA 1RFAA 4HK2A 4GAXA 4ZRKA 4IG7B 3N30A 4BKTA 3SDQA 4M76A 3H6NA 2J52A 3KW5B 4WAAA 2JUOA 3Q79B 4NEIA 4OW0A 1JWBD 1HM2A 1E8ZA 2ZPNA 1UD7A 3UI3A 1EF5A 5DPTA 3RMKC 3M95A 3JYUA 2ZNVB 1B9RA 2CS4A 5D6JB 1DOYA 2KMCA 2KD0A 1YN3A 4OVVA 2INPE 3U7DA 2BRWA 2BVCA 3EFUA 1ULVA 1AYFA 1QBQB 2DZMA 2DYOA 4WWPA 1STEA 1F0ZA 2ASQA 1V5CA 4GB9A 1WXMA 5LXIB 1R4MI 3MP9A 2G4DB 4C7ZA 1XQQA 1P98A 4XX5A 5E2JA 2WXRA 3P63A 4WU0A 2BS2B 1HXYD 4ANXA 2L0FA 3J9CA 2RMMA 3RPFC 3ZRFA 1DOIA 5JH5C 2G3QB 1F9DA 3WUXA 4YTMB 2BB6A 2Z59B 2KX0A 1FRRA 2ZZPB 3BWUD 4NY0A 5G5HA 2ZVNA 4RGOS 5CZLA 1XD3B 1YJIA 3Q8EA 3UIOB 3L0WB 4J6IA 4W9FA 3D5RA 2GOWA 1AW7A 2KN4A 3QT3A 5JXVA 3WAOA 4HDOA 1QOGA 1WYGA 1LD8B 3W7XA 3DVGX 1ZDXA 1GA2A 2FE8A 1XWQA 2NPTA 5DHIA 3MC8A 2JRHA 2JXTA 2K1FA 3PO0A 1D3ZA 5J17A 3RNFC 4DXAB 4XDDA 3B08A 4GN1A 3W7TA 1MG8A 4K7WA 1BUIC 3VQIA 2WLBA 3DVGY 4M00A 2IYDB 3U4EG 3N1ZC 2KWDA 4W9KA 2P0VA 2WIIB 1FAEA 3AECB 3TUOA 2KVRA 3QPFA 1P9DU 4ZH1A 1O6HA 3DBHB 3WKIA 3NVZA 1K52A 4K3BA 4F10A 4QT9A 4TSSA 3L54A 1DYQA 3NUHB 2IPKD 5FO8B 1MI0A 5EE3A 5IAAC 5CTRC 2JWUA 3RYTA 3I5JC 1LO5D 1R4NI 1Q0WB 3H8HA 3M75A 3ZXRA 2LJIA 1P1AA 1HZ5A 2BS4B 4L6XA 2BWES 3TBLD 3NFVA 1JCKB 3IT4B 1XT9B 1D8DB 2LWPA 3GP7A 3UGBB 3NG0A 5JMDA 5ILYA 4TKNA 3ZDTA 2KJ6A 3NVWA 1E8YA 4M0WB 2WXNA 1T5XD 2Y5CA 1RWFA 4A20A 1Q10A 3T9LA 3LXFA 5FK9C 4NQLB 3PZ4B 1IA6A 1F9GA 2FUHB 3DSVB 2D10A 3TEWA 2EELA 3HXCB 1IUEA 4G3XB 3C8YA 2N0SB 1VD5A 1WRDB 3VHTC 2KYWA 3U30A 2AFAA 4LNNA 4HPMB 1WR1A 1SQCA 1MPEA 1EM7A 4CE7A 3DSUB 1NYRA 2AQ2B 2FCMA 4EZLA 4NJCA 1ZOYB 3DQVA 4AJWA 3X17A 5IKCM 5DCNA 2C5LC 1Q1OA 1HM3A 5FR6A 2DRSA 2K39A 1UELA 3E6UA 2L00B 1VR9A 3PZ3B 1LXMA 4XYCA 1IBXA 4AS1A 1QLBB 2MRPA 3A1QB 4A3OA 1HXCA 3IFWB 1FCLA 2LMCA 3Q8FA 1YNTE 1G9GA 2MBBB 3VDZA 4AJYB 1UZXB 2JT4B 1V6EA 1YN4A 1OGWA 1FPPB 1L2AA 3EECA 2JG0A 4EKUA 4ZRQA 2L52A 1K53A 1CZPA 5FO9B 2Z07A 4A6QA 1YMHE 4PS7A 4OK4A 1QILA 3P2BA 2K5PA 2YLMA 4P1BC 4AUQC 1OJMA 4DODA 4ANVA 2IBIB 4US9A 3N1XC 1ZDVA 3UINB 2FUZA 2KMAA 2N9LA 1G6JA 1L6UA 3WIWA 1SIJA 2JZ3B 4F8CB 1FNVA 4HLEA 2XN9C 4W9JA 3T8MA 5GW7A 4HCPB 3DWMA 2ON8A 3N3KB 4GOCA 2VZKD 1GXOA 1OQYA 4PS3A 4YT0B 5E6OA 5BO4B 1WE6A 3HK0A 4ICVA 4N59A 4WJPA 4GTQB 2KAJA 4B9KA 4YXDB 4A9AA 3ML9A 3WIRA 3QQ8B 1J8CA 1TY0A 5IL3A 3DBSA 4BKGA 2INNE 1WIAA 1UBIA 2LGIA 3QIJA 1RLFA 2FAZA 3CIHA 3DCGA 1YD8U 3AU4A 5DPWA 4WJNA 1F1SA 2XFGA 1WX7A 3HUIA 1CEMA 1MHHE 3AEAB 4I6LB 4OK2A 4WVAA 5AGDA 1QOBA 3D32A 3PHXB 2KT7A 3DHIC 3RNGC 1O5MB 4C1SA 3ZJTA 1XO3A 2KHWB 3AEDB 1Y56A 2Z8LA 1Y8RC 1I4XA 3FC4A 3AV8A 2KKCA 2BBCA 3HXDB 3R2IA 4JQWC 1N95B 3VR8B 4DHZB 4C7YA 2VZKB 1WJ4A 4ACFA 2IO0B 5EASA 3ZTCA 1UGJA 1XWTA 1FXIA 2KDIA 2INCC 1TZ1A 3MTNB 3MFGA 3SU8X 5EE1A 3QXFA 3ANKA 4PS8A 2J0JA 2WXHA 2CJNA 1N7NA 4GXBA 4II3B 5EAUA 4F7ZA 2ZBLA 1FFUA 2LFIA 2KQ7A 1HA5A 4WWMA 1UNSA 4RH6A 3AE2B 2D3AA 4GU2A 4IWOA 2H88B 1VCBA 4ZYNA 2D8LA 1N6ZA 1V49A 3KSQB 2YIKA 4W9GA 3DBRB 3WKFA 3RNAC 2LASA 4E74A 3RT3B 1SB3C 4ZRJA 4IM2A 2V4IB 5FKAC 1N4RB 2BPSA 5KHOA 2RI8A 4NJ7A 2NPTB 1WX8A 2JY6A 4HWIB 4Q2BA 5HFYA 2NVUI 2KDEB 1XLQA 1N62A 1R76A 2FNJB 1UGMA 3AE4B 1NDDA 1WGYA 1N9AB 1GHQA 4W9LA 1L0YB 2J42A 4A3PA 1ZW7A 3KWVA 1V7WA 3SFXB 4FN2A 1LM8B 3BYYB 2L8JA 4MMHA 1L1YA 1J7AA 1FRDA 3DBHI 1WZ0A 3RSYA 4JPSA 4RF0A 1X1JA 1O79A 1HXGA 5BYSA 4ZG8A 1AYXA 3VW5A 3NZUA 2QCZA 3Q69A 3DPYB 5HI1A 1SF0A 1F9JA 2WXPA 3EGRA 5IN7A 1FFVA 1H3AA 3VUWA 3KUDB 3W1YA 1WM3A 4C00A 1S64B 4K81A 2JZZA 1XLPA 3NY5A 2CHWA 2PW9A 5BYRA 4IUMB 5IP4D 2IGDA 2FCSA 5D94A 4MMIA 3TJPA 3E32B 1P7EA 4D4AA 4AYQA 3N0GA 1FCEA 1D8EB 1WJNA 1YX6B 1LXKA 3PLUA 5BMGA 2AL3A 3R3MA 1EUVB 4K1RB 3N32A 3RNBC 1FPYA 3LJ3A 2ZIRB 2WU5B 4WVCA 2WQYB 4HVBA 3HXFB 1SJED 5C2TB 1JCSB 4S17A 1KFYB 2DENB 3N20C 3OLMD 2REXA 1WYWB 1IP9A 1KKTA 1I4GA 2EMTA 1DOXA 3GZNB 5BMHA 4MJSA 4BOZB 1N7RA 2W3SA 3HM3A 1ESFA 3C19A 2W3RA 3B0AA 5JPMB 1VLBA 5AUIA 1GB1A 2RGKA 1V1PA 3Q3FA 4RF1A 4EL8A 3MC0B 4BZAA 4CQNA 4F13A 2MJEA 2GBMA 1XLOA 1N94B 3VSMA 1D5ZC 2KN5A 1O6RA 2GBJA 4BVUC 1WJ6A 3DHHC 2LD9A 1D5MC 3DRAB 3ANIA 3A1QA 2BGFA 1O1RB 1FNWA 1GUAB 3QAQA 5J18A 1V86A 3CF6E 3IBEA 2MEKA 2JZPA 4ZRIA 2LRUA 2GH4A 1GPXA 1V97A 1OEYA 1SA4B 5GXGB 3RI7C 4A90A 2IJ0A 2FUG1 2WCOA 3VRBB 1W6JA 2MP2B 1WRIA 2FCNA 4MU9A 1NEKB 4GTPB 2I38A 2NBVB 2LGSA 2DX5B 4PYUA 3KUCB 1A5RA 3ZQ4A 2GMIC 2ZCBA 3D5SA 4NAMA 2WX0A 1KRFA 4K7UA 1WX9A 3QJZA 2PE9A 2MHJA 1XF5L 1H35A 1Z2MA 3VH4B 1TNYB 3AB5A 1UUPA 3HXEB 3GOEA 2DRQA 4WWOA 1Z5SB 2M0AA 1GSZA 1H37A 3SDTA 3QC8B 3X23A 1L4ZB 1KH0A 2BYEA 3M7EA 4V1RA 2WDAA 5LLIA 4EOYA 1LTXB 3DSXB 1WFYA 2INDC 3AE6B 2KWUB 1H39A 4DHJD 2ZJDA 1QAZA 1FT2B 5D3IB 4YDEB 2ICIA 2PJHA 5CX3A 2GBRA 2MLBA 3HXBB 4DDGD 5D2MB 4TQ0A 1N24A 1VZ8A 3MJ5A 3IHPC 3PMMA 3QG0A 1QF6A 1T6BX 1TS5A 2KX3A 3JSVB 3VTVA 2KLGA 3EHVA 3SQCA 3A0OA 2QIEB 3VVWB 1UMPA 3WKHA 3W9CB 3KLSA 3SFEB 5TSSA 2QNOA 2N7JA 1TS2A 2KC1A 2K8CA 1RM6C 3EA6A 1Q5WB 4KTPA 1LD7B 4MACA 4XDCA 3W1SA 2AHFA 3TCAA 3QARA 4A8XC 4EZJA 1HV6A 4LLGM 2G0DA 2PIAA 2R2QA 1V80A 2MBQA 2D3GA 3M7CA 1NI2A 4JJJA 2WXJA 2KDMA 3BVGA 5KHQA 2WXOA 2JYEA 4AWJA 2G9HD 1OTRB 2CKHB 4DHJB 1E8XA 1V7VA 2I1JA 1WZ3A 1HXAA 3M71A 3PZ2B 2I1KA 1YN5A 2QDFA 3AXCA 2OKXA 1I4QA 2K25A 3VXWA 2OJWA 2V8JA 2G1EA 3ZW3A 1V81A 4RGTA 1FEHA 3AE8B 3U8ZA 4WAFA 1N23A 2E24A 2JPHA 3WALA 2DAJA 3SFDB 4REZA 3B1LX 3QA8A 3ZIMA 3QCAA 2KJRA 2WXMA 1WJUA 2E3TA 1GNUA 2SEBD 3BZDB 3Q6BA 4EE2A 1TKYA 3ZDMC 3H3KA 3M77A 3IAS1 4HDQA 3E34B 3WANA 1WGDA 1EU4A 1WF9A 1SA5B 4ICUA 2ZPYA 1NL4B 2X8XX 2W82A 3MHZA 1N7OA 5FO7B 2N9EB 3EQAA 3ZLZA 3S4AA 1JWSD 3RNEC 1V2YA 5CHVC 3W1SC 2MCNB 1FMIA 3Q14C 2AL6A 1C76A 1H54A 2G45B 3M74A 3VSNA 3L4PA 1W6KA 1HZFA 1C4AA 1TBEA 1KREA 4XZ4A 2L05A 1IS9A 3W5VB 4ZHPA 4OZCA 4LIXA 3ZUNA 4KDIC 2BKFA 3KYCD 3TEZA 4WQMA 1DOGA 2FIFA 5BMIA 1SBBB 2LRWA 2EKEC 1JRUA 1ZP0B 5FOBB 3MJWA 4AYRA 2W9NA 1HCUA 1F77A 3EZ8A 4IDIA 4KIKA 2ZCCA 2PEAA 4MT5A 2A5UA 1RWAA 5C23A 3E56A 4MH0E 3WKGA 3EU8A 1UWXA 4FXCA 4L23A 4KKJA 3DWGC 3U7ZA 2KTFA 4ZH5A 3RX5A 3Q8BA 3P2CA 2UYZB 2Y3AA 1LF6A 4ZOHC 3HVZA 3QK0A 2XK5B 2KQSA 4RNAA 1E8WA 2FBWB 1GJZA 1PUTA 3KUZA 2V4LA 5G2NA 5ILHA 1H3CA 1T0QC 2B76B 3C0RB 4GTOB 5D7GA 3U2SC 3GZNI 4ASWC 1BXTA 1TN8B 5CHWA 1TKGA 1FNUA 2D3CA 3BVZA 2LZ6A 1RQ5A 4BAXA 1E6EB 1P3QU 2CU3A 3PYAA 5DHKA 4MJSB 3VTUA 2K6DB 2UU7A 3ZYYX 1NVID 3SFYB 1V8CA 2BF8B 4WURA 1GAQB 3QT9A 2IO2B 1KSDA 2LHDA 3P4SB 4WJOA 5DGRA 1V1PB 5JZEB 4W9HA 3LYYA 1N5WA 5ILZA 1OQRA 1QT9A 4AOFA 2MBOA 1JWUD 1QOAA 1YQ4B 3APFA 1KRHA 4GTMB 1JROA 1L5PA 4YSZB 1FO3A 3N0FA 3S9VA 3A9JA 1TJEA 2M0XA 3AEBB 5HKHA 1MHXA 4JX1C 1DCEB 1UT9A 2PN5A 2UWQA 4IM0A 1IPGA 4BBNC 1JMLA 3V3XA 5AZHA 2N4FA 1TIFA 1ZUD2 2SAKA 2MWSB 4HCNB 4K3CA 4M8NA 1MZCB 4JIOU 3OXUA 1RWSA 2WX1A 2DYMA 2N9KA 2VN4A 1XW2A 4BKSA 4Z4JA 3IVFA 2MP2A 2N9XA 4KZCA 2WDRB 1CB8A 2IY0B 2OJRA 2D3BA 4WQOB 3P4QB 3O13A 2QC8A 3SDVA 3B2GA 5IK9A 2BYVE 3AE5B 3V62A 4TV3A 2EACA 4ONTA 3A33B 5LXHA 2MX2A 1HX9A 3QFYA 4D94A 2DLBA 3BYTB 4AP4C 3NZSA 1HZ6A 2KWVB 3BVMA 2B39A 3AM9A 4R3DA 1EO6A 4URKA 3PREA 4D4BA 3GE8C 4BOSC 4C56C 1UH6A 1KM7A 2DRRA 2OOBB 1IGDA 3APDA 3PRZA 4W9CA 4G11A 1I35A 1BMLC 4YL8A 1LFDA 1WR6E 2J7QB 1WU6A 1B1ZA 3QHTA 4YDOB 3W5MA 1VZ7A 2H6FB 3VUXA 5GY3A 5EE9A 4IC7B 1SXTA 2PMVA 5E6PA 2PPHA 1UF0A 2KO3A 3APCA 1T0SC 3BINA 4FHKA 2ZW0A 3JSVA 4WIPA 3ZNHB 4B0MA 3ECIA 3EFCA 3M7BA 3TEXA 1CQVA 3HM6X 3BY4B 3S2AA 1TKEA 3L08A 1H8CA 1KLVA 2LGYA 3WAMA 1SE3A 1IYFA 1ISNA 2EMSA 2KZRA 1ZE3D 3V05A 2MJDA 2NBUA 2DZKA 2IEJB 1JQ4A 1FD6A 1WWTA 2NOJA 5KKBA 2D11A 1RWHA 4D4CA 3ZJUA 2M19A 1J0NA 1T0RC 2CJOA 3AULA 3UQAA 3HIZA 4WVBA 2WY8A 2GOXA 1XCQL 2TSSA 1JALA 3ZKJC 2V3SA 3QRYA 4OZAA 4ZHOA 1XLNA 4FBJB 4MGZE 5JMFA 4HXDA 3A4RA 4XE0A 3H7LA 2WDTB 2BKRB 1WE7A 1GAIA 1GG3A 3R66C 2CR5A 1DL2A 1GC6A 1RYJA 3ALBA 1L0VB 2R2LB 2LVOA 3ML8A 4XGAB 1GXNA 4L1BA 1PDXA 3M63B 2KDBA 1ENFA 3WA0A 4M02A 2FV1A 4FULA 1FBWA 2LVQA 5IOIA 5CD2A 2WNMA 2A8ZA 2KWCA 3AU5A 3NVYA 2CHZA 3D3IA 3LZ9A 5M7IA 1ET6A 1TN6B 1C82A 2WYNA 2N1VA 4LNFA 1E7PB 4GTRB 3FAHA 2H6GB 2KFKA 1QQRA 4DI5A 2VRRB 1P7FA 3W5UB 1YQBA 3UIPB 3P1MA 2WDQB 3SDRA 4YTPB 4MGKE 1JW9D 1KLGD 4DWFA 4IKGA 2V0GA 3NNBA 2WXLA 4B0EA 2SQCA 1RAXA 2KDFB 5HHDG 4FA6A 4L2YA 3EUVB 4MSQB 1UG9A
chains in the Genus database with same CATH topology
4US8A 4GLSC 4GL3A 1BUIC 3KLSX 3VQIA 3C72B 2WLBA 4YSXB 1AN8A 1XF5L 1H35A 2L83A 2LHEA 3U4EG 1HQRD 4H2AA 2WDVB 2KWDA 3Q75B 2P0VA 1TNYB 3DSWB 1UUPA 3AB5A 3T3NA 3HXEB 4UDUC 4KGSA 2VN7A 3NVVA 2WIIB 4KX6B 2DRQA 4LNGB 1FAEA 3B9JA 5FR3A 2M0AA 3AECB 1GSZA 2WS3B 3TUOA 1H37A 3SDTA 3SR6A 1D5XC 1L4ZB 2WY7A 3QPFA 4ZH1A 1KH0A 1O6HA 3M7EA 4V1RA 3WKIA 2GI9A 3NVZA 1EWYC 1K52A 1LTXB 1SE4A 3ON6A 2JX5A 3DSXB 2E6XA 3M73A 3Q8CA 4YSYB 4KGRA 3AE6B 3U52E 3AE1B 5C3JB 4QT9A 1H39A 4AYOA 1DYQA 3NUHB 2IPKD 4TSSA 5D3DA 5FO8B 2BW2A 1FT2B 1WGKA 4YDEB 4J3OD 5D3IB 2ICIA 1J7CA 1MI0A 3W7SA 1ZPSA 5EE3A 2JWUA 3HXBB 1LO5D 4TQ0A 1GLMA 1VZ8A 2H6HB 3MJ5A 3FILA 3H8HA 3M75A 3PMMA 1TS3A 3E73A 3QG0A 1QF6A 1T6BX 1TS5A 2LJIA 2BS3B 1FP3A 1HZ5A 1GXMA 4L6XA 2BS4B 1G9JA 4D4DA 4KTRA 3SQCA 1CLCA 1JCKB 3IT4B 2QIEB 3GLYA 1X9DA 1UMPA 3WKHA 1D8DB 3BK2A 3GP7A 3W9CB 4DXFA 3KLSA 2EAEA 1K50A 5H92C 3SFEB 2Q5WD 2QNOA 2N7JA 1TS2A 5TSSA 4D2KA 2KMMA 1RM6C 3EA6A 3CWIA 3RJ3A 3NVWA 1N4QB 2WXNA 1T5XD 4TXTA 4P6VF 1VRAB 4HKQA 2JF4A 1K72A 4KTPA 1FMAD 1LD7B 4MACA 4XDCA 3W1SA 2AHFA 3KSLB 2Y5CA 4HRSA 5JPNB 1Q10A 3LXFA 2V3NA 5FK9C 3P4PB 3AE7B 4LK0M 2V8KA 3PZ4B 4LLGM 4LTUA 4MH8A 1IA6A 4LNVA 4ITKA 2G0DA 3DSVB 3TEWA 2PIAA 2EELA 2YEPB 3HXCB 1IUEA 2IDYA 3Q7AB 3C8YA 3TEYA 2HTME 3SAEA 2N0SB 1VD5A 3M7CA 1C78A 4YWGG 2DBYA 2PTLA 1QOFA 4JJJA 1PGAA 2WXJA 2AFAA 2KDMA 3AH7A 1C79A 4L23A 3BVGA 2WXOA 2JYEA 1TNOB 3VRAB 2G9HD 4HJGE 2H89B 2BTEA 3GZKA 1IA7A 1SQCA 1V7VA 1MPEA 1EM7A 2MJ3A 1NI3A 2AQ3B 1WXQA 1N4PB 3DSUB 4CE7A 1NYRA 2AQ2B 5H8YE 3M71A 3M72A 4NJCA 1ZOYB 3PZ2B 3X17A 2R61A 1YN5A 2OKXA 1KTKA 3BK1A 1I4QA 1NI1B 2WP9B 2DRSA 2NVPA 2F0YB 2WXIA 2V8JA 2G1EA 1H13A 3E6UA 1D6EC 1VR9A 4RGTA 1FEHA 3AE8B 4KGTA 1O6QA 3PZ3B 4A55A 2BB5A 1IBXA 1TNZB 2ZZRA 1O1SB 1QLBB 3IAM1 5LNK1 4AS1A 4WAFA 3K11A 2RDHA 1FCLA 2LMCA 3Q8FA 4J5TA 1NYQA 4HEA1 1YNTE 3SFDB 3URYA 1ROEA 2JYTA 2WXGA 1G9GA 1SE2A 4REZA 1KS8A 1ACCA 1KLUD 1H12A 1I4RA 2WXMA 4EHMB 1NXCA 3R2TA 1FBOA 3NRZA 2E3TA 2SEBD 1YN4A 2QILA 3I57A 1FPPB 1L2AA 3BZDB 4TQ1A 2LEKA 2JG0A 3CIRB 4ZRQA 2L52A 1FT1B 4EE2A 1K53A 2DWQA 1CZPA 5FO9B 3N9YC 1GB4A 2Z07A 1TZOA 4A6QA 1TKYA 4RGNA 3H3KA 1YMHE 3M77A 1XCTL 1QILA 3IAS1 4JE3B 3KWLA 2K5PA 3E34B 1SSNA 1EU4A 1SA5B 3PYBA 4DODA 1I7HA 1NL4B 2W82A 3MHZA 4US9A 5FO7B 2XNAC 3EQAA 1ZDVA 3S4AA 1N60A 1JWSD 4YTNB 2FUZA 3AEGB 1A70A 2N9LA 3W7WA 1L6UA 3QDEA 3WIWA 1SIJA 1FMIA 3B2FA 1FNVA 2ZISB 2XN9C 2JU6X 1C76A 1H54A 5GW7A 3RRSA 3M74A 3RX7A 3RX8A 3DWMA 1C3DA 2XWBB 2ON8A 2BEDB 2DROA 2VZKD 1GXOA 2YEPF 4YT0B 3E37B 3I9V1 3L4PA 1KF6B 1W6KA 1HZFA 1C4AA 4N59A 1JCQB 1KREA 4A8XC 1IS9A 4GTQB 2KAJA 4YXDB 1TYGB 3W5VB 2WINB 5M7YA 2RDGA 4A9AA 4ZYSA 3WIRA 2H6IB 1TY2A 1TY0A 4RFBA 4ZHPA 4FXGB 1KZPB 1TNUB 2WXQA 3Q8AA 4OZCA 1WZZA 4LIXA 1I4PA 4OZBA 3TEZA 3P4RB 4XUVA 4WQMA 3HRDD 3RENA 1DOGA 3QWTA 5BMIA 2AHGA 4AYPA 1SBBB 1V1OA 4HROA 2WU2B 4V1SA 2INNE 1JCRB 1S63B 2LGIA 2V8IA 1XXGA 5FOBB 1ZP0B 2PVGC 5MPOA 3CIHA 4AYRA 1HCUA 1F77A 3EZ8A 4IDIA 2W54A 1C9FA 4MT5A 3A3VA 2XFGA 3E56A 2GZ6A 1I4HA 3WKGA 1FCCC 3HUIA 2QSDA 3M78A 3EU8A 1CEMA 1LF9A 1MHHE 4KKJA 1GAHA 1UWXA 5MEHA 3DWGC 1C4PA 3P5PA 3AEAB 4ZH5A 3RX5A 4BOKA 2PLPA 3P2CA 4WVAA 1L6VA 2Y3AA 2X38A 1LF6A 3Q8BA 4BOJA 1PYWD 3Q7FB 5AGDA 1QOBA 3HVZA 4Q2JA 4ZOHC 3WC3A 3WIQA 1WSPA 1G6IA 1KWFA 4GTSB 3P42A 2OEDA 1O5MB 2EADA 3QFZA 4C1SA 4RNAA 2HDEA 2FBWB 1XO3A 2I2YA 1J7BA 3ZJTA 2QMTA 1QQFA 1PUTA 3AEDB 1Y56A 2Z8LA 4ARIA 1I4XA 1KZOB 3FC4A 4ARCA 1GOZA 4FXKB 5CA3A 1FM0D 1H3CA 2NTTA 3AV8A 2FV0A 2B76B 4JWSC 4M0WA 2BBCA 3U2SC 4GTOB 4GDKB 1XEEA 5D7GA 3HXDB 1ZXIA 3R2IA 1YQ3B 1BXTA 1TN8B 1N95B 1M4VA 1TS4A 2J53A 3VR8B 1TKGA 4C7YA 2VZKB 1FNUA 4DQOC 3BVZA 1RQ5A 4RCOA 1E6EB 2CU3A 1UGJA 3PYAA 1XWTA 1FXIA 1QSJA 1N63A 3TSSA 3ZYYX 2B4FA 1TN7B 1NVID 3SFYB 2WXFA 3GS2A 1V8CA 1MVKA 3R8BA 3MFGA 4WURA 3M7LA 5EE1A 3FAHA 1GAQB 3QT9A 3W5NA 1SEBD 4XWTA 5AUKA 3ZGZA 1KSDA 3QXFA 3ANKA 2LHDA 3P4SB 1AGMA 1KFGA 5DGRA 2JJBA 1V1PB 2CJNA 2K22A 2WXHA 1EU3A 3PZ7A 3AE9B 3LYYA 1N5WA 3Q73B 3M76A 1OQRA 1QT9A 1JWUD 2ZBLA 1FFUA 1QOAA 1YQ4B 4OHJA 1KRHA 4GTMB 1H14A 2LFIA 1HA5A 1JROA 3W2DA 1NC5A 4WWMA 3Q78B 3G6JB 1L5PA 1UNSA 4YSZB 3T3OA 1FO3A 3S4DA 3S9VA 4FXCA 4RH6A 3AE2B 3OWEB 1PGXA 4L0GA 2H88B 3IXSA 1TJEA 4RGMA 5GZKA 3AEBB 3ACSA 1YJJA 3E33B 2QEJC 3EUB2 2Y5PA 4N6EB 3U7ZA 2D8LA 3AFJA 1MHXA 4JX1C 1DCEB 1FO4A 4CJ0A 1IBXB 1UT9A 3QXQA 1FO2A 2PN5A 3HVDA 3VR9B 1V5DA 2AX5A 4Q88A 3KSQB 1JMLA 2YIKA 1EWCA 5G5GA 4Z4LA 3V3XA 2LUMA 1ET9A 3DSTB 3E30B 3WKFA 1UWMA 1ZUD2 2SAKA 3GB1A 3E9SA 3NS1A 3ABVB 4HKZE 1FIQA 4C80A 1MZCB 3OXUA 1RWSA 2DYMA 2N9KA 1SB3C 2V4IB 5FKAC 1N4RB 2M56B 1TNBB 2RI8A 2V3PA 2VN4A 1XW2A 3S4CA 3K7XA 1R7SA 1E0ZA 1IGCA 3T33A 4Z4JA 1WU5A 4Q2BA 1X81B 5HFYA 5T8IA 2D5GA 2CQSA 5BYQA 3IT6B 4IOIE 1XLQA 1N62A 4L9PB 1R76A 2WDRB 2F6DA 1QKZA 4DXGA 3AE4B 2NTSA 2K9XA 3P4QB 1N9AB 1GHQA 2BYTA 1JRPA 3O13A 1H36A 3S4BA 3SDVA 1L0YB 2J42A 3B2GA 2AQ1B 1JWAD 5I4DA 2CQTA 2EKIA 3KWVA 3AE5B 1V7WA 3SFXB 1SJHD 2EACA 4ONTA 1L4DB 3BYYB 3QFYA 4D94A 3AEEB 1F9OA 2DLBA 3BYTB 1N5XA 1L1YA 1J7AA 1FRDA 1HZ6A 3BVMA 3RSYA 2B39A 4YCRA 1CJEA 3AM9A 4JPSA 2MH7A 2RI9A 3ACTA 4R3DA 1PFDA 4RF0A 1O79A 1TF4A 4NZLB 4C56C 4D4BA 2G02A 1ZXHA 1NENB 5BYSA 3SEBA 4ZG8A 1AYXA 3VW5A 2PVOD 3Q69A 3DSSB 4TMAB 4N58A 3DPYB 5HI1A 2DRRA 1IGDA 3ZJVA 2XQWA 1SF0A 2J4XA 5HG2A 2WXPA 5DGQA 3EGRA 2RPVA 1FFVA 1H3AA 1BMLC 2I07B 1C77A 3H2WA 2A73B 2ACZB 1C4CA 3GT5A 1WU6A 2K0PA 4P16A 1F2RI 5E6JA 1VJKA 1B1ZA 1V7XA 4O1NA 4YDOB 3W5MA 1VZ7A 1S64B 1HEZE 3SDQA 3FILB 2H6FB 1JS4A 1XLPA 5GY3A 3AE3B 5EE9A 2PW9A 4NAWB 5BYRA 4M76A 2BT6A 3SDUA 3PZ8A 2IGDA 1E9MA 4GTVB 2PMVA 1SXTA 2J52A 3WCQA 4ZRPA 2ZW0A 4WIPA 3Q79B 4B0MA 3E32B 1P7EA 4JWUC 3M7BA 4D4AA 4AYQA 1JWBD 2KQ4X 3AMZA 1CQVA 1RFKA 4OW0A 5EE0A 3TEXA 1TKEA 2ZW1A 1FCEA 1D8EB 1D4BA 3UI3A 2EABA 3LB8C 4CJ1A 1L0XB 2W55A 5BMGA 1SE3A 1N4SB 2OHFA 1B9RA 1K51A 1ZE3D 3V05A 3BIID 4GDLB 2MJDA 4AQ7A 3P5RA 2IEJB 1DOYA 1FD6A 1WWTA 1JQ4A 2NOJA 5KKBA 1AWDA 2ZIRB 2WU5B 1YN3A 4WVCA 2WQYB 4KKIA 2INPE 4D4CA 3HXFB 1SJED 2NMQA 2M19A 5C2TB 1ULVA 3ZJUA 1AYFA 2L1AA 1JCSB 4LNBB 2CJOA 1KFYB 4DOEA 2JQRB 1QBQB 2DYOA 3AEFB 1STEA 1F0ZA 1V5CA 2PKOA 4WVBA 3ETRA 1KKTA 1I4GA 2WY8A 1DOXA 5BMHA 1OQQA 2GOXA 1XCQL 3MP9A 2TSSA 2W3SA 1JALA 3QRYA 4GTTB 1ESFA 2QJLA 2FBAA 2W3RA 4OZAA 4ZHOA 1XLNA 1KSCA 3OEDA 4C7ZA 5JPMB 2KACA 1VLBA 4FUSA 5AUIA 5E2JA 1GB1A 2RGKA 2WXRA 2JSVX 1VDVA 4XE0A 3H7LA 2IGGA 3P63A 2D5JA 4WU0A 1V1PA 2BS2B 3AN1A 1GAIA 4EL8A 3MC0B 3VXDA 1HXYD 4RF1A 1CK1A 3J9CA 1DL2A 2L32A 1RYJA 4CQNA 2GRIA 2RMMA 3RPFC 1L0VB 2MJEA 2R2LB 1XLOA 1GXNA 1N94B 1DOIA 4L1BA 4XWWA 1D5ZC 1O6RA 1PDXA 1F9DA 3WUXA 3KQ4A 1OFFA 1D5MC 4YTMB 1ENFA 1O1TB 2BB6A 3DRAB 3ANIA 2FV1A 1FRRA 3BWUD 5G5HA 4RGOS 1DGJA 1FBWA 5CZLA 4PT5A 1YJIA 1O1RB 5CD2A 3TF4A 1T3QA 1VZ6A 2WNMA 3Q8EA 4OVZA 2A8ZA 1FNWA 3QSPA 3NVYA 4USAA 3NZ3A 3D3IA 2XWJB 3D5RA 1N61A 2MEKA 2JZPA 5M7IA 1AW7A 1ET6A 1H3BA 1TN6B 2WYNA 2KN4A 3W7UA 2GB1A 2GH4A 3QT3A 1GPXA 5JXVA 4MBGB 1E7PB 4GTRB 1QOGA 1F2RC 1WYGA 2H6GB 1V97A 1LD8B 1KRFA 3W7XA 1QQRA 1ZDXA 1GA2A 1SA4B 1P7FA 5GXGB 3W5UB 1G87A 2ONQA 4A90A 2IJ0A 1JWMD 3PZ1B 2FUG1 2IGHA 3P1MA 3VRBB 3RFZB 1W6JA 1WRIA 4TF4A 2FE8A 1E10A 1XWQA 2WDQB 3CU7A 4MU9A 4GTPB 3SDRA 1NEKB 1PGBA 2I38A 4WH4A 4YTPB 1JW9D 1KLGD 4MM3B 2K3UA 2JXTA 2WXKA 1FXAA 4IKGA 2V0GA 1WU4A 3EU5B 2WXLA 3PO0A 4B0EA 2SQCA 5HHDG 3ZQ4A 4L2YA 4XDDA 3EUVB 3W7TA 3D5SA 4NAMA 1UG9A 3ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M76 A;  3C72 B;  2PMV A;  4GTV B;  1QSJ A;  1H35 A;  4ZRP A;  1TN7 B;  3Q75 B;  3SFY B;  1TNY B;  3DSW B;  3HXE B;  3Q79 B;  3E32 B;  2WII B;  4EHM B;  4D4A A;  4LNG B;  1FPP B;  1GSZ A;  1H37 A;  1D8E B;  4ZRQ A;  1FT1 B;  2WY7 A;  3Q73 B;  4ZH1 A;  1O6H A;  4V1R A;  5FO9 B;  1LTX B;  1N4S B;  3DSX B;  4GTM B;  3Q78 B;  3G6J B;  3E34 B;  1H39 A;  1SA5 B;  5FO8 B;  1FT2 B;  2IEJ B;  4YDE B;  2NOJ A;  2ZIR B;  1NL4 B;  3E33 B;  4KKI A;  5FO7 B;  4D4C A;  3HXF B;  1DCE B;  3HXB B;  2PN5 A;  1JCS B;  4LNB B;  2H6H B;  1QBQ B;  2ZIS B;  3KSQ B;  1GXM A;  2WY8 A;  3DST B;  3E30 B;  2GOX A;  1C3D A;  2XWB B;  2BED B;  1GXO A;  4D4D A;  3SQC A;  1MZC B;  3OXU A;  3E37 B;  4GTT B;  1UMP A;  1W6K A;  1D8D B;  1HZF A;  1N4R B;  1JCQ B;  3OED A;  1TNB B;  3KLS A;  5JPM B;  2V3P A;  4GTQ B;  3K7X A;  2WIN B;  1X81 B;  3RJ3 A;  2H6I B;  1N4Q B;  4FXG B;  1KZP B;  1R76 A;  1TNU B;  4L9P B;  1LD7 B;  2R2L B;  3KSL B;  1GXN A;  1N94 B;  1N9A B;  1GHQ A;  5JPN B;  1O6R A;  2V3N A;  1H36 A;  2V8K A;  3KQ4 A;  3PZ4 B;  4LNV A;  2G0D A;  3DSV B;  4V1S A;  1JCR B;  1O1T B;  2BB6 A;  1S63 B;  3DRA B;  3HXC B;  3SFX B;  2V8I A;  5FOB B;  3Q7A B;  4ONT A;  1O1R B;  4D94 A;  2B39 A;  2XWJ B;  3D5R A;  1O79 A;  4D4B A;  2G02 A;  1TNO B;  4KKJ A;  3U7Z A;  1H3B A;  1TN6 B;  4BOK A;  3DSS B;  4BOJ A;  3DPY B;  3Q7F B;  4MBG B;  5AGD A;  4GTR B;  1SQC A;  2H6G B;  1LD8 B;  1SA4 B;  2XQW A;  1N4P B;  3DSU B;  4GTS B;  3PZ1 B;  1O5M B;  4C1S A;  1W6J A;  1H3A A;  3PZ2 B;  2I07 B;  1QQF A;  3CU7 A;  4MU9 A;  4GTP B;  1KZO B;  2A73 B;  4FXK B;  1H3C A;  1NI1 B;  3EU5 B;  2BBC A;  4GTO B;  2F0Y B;  3HXD B;  2SQC A;  2V8J A;  4YDO B;  1TN8 B;  1N95 B;  1S64 B;  3EUV B;  1O6Q A;  3PZ3 B;  2H6F B;  2BB5 A;  3D5S A;  1TNZ B;  1O1S B; 
#chains in the Genus database with same CATH topology
 4US8 A;  2NBW B;  5TR5 A;  1RWC A;  2L83 A;  4XC2 A;  1HQR D;  4MDK E;  2WDV B;  1HMU A;  5J2R A;  5EDS A;  3DSW B;  4KGS A;  3KVF B;  2DZI A;  3NVV A;  4KX6 B;  3M62 B;  4LNG B;  5FR3 A;  2B3A A;  3SR6 A;  3NOB A;  3A9K A;  4M8M A;  2NR2 A;  1SE4 A;  2JX5 A;  2E6X A;  3M73 A;  1J0G A;  2WGS A;  5C3J B;  4AYO A;  2MBH A;  2BW2 A;  1WGK A;  2CU1 A;  2O2V B;  1J7C A;  3A4S C;  4KIK B;  1WXV A;  5IKH A;  3VTW A;  1ZGU B;  1YX5 B;  2C7H A;  3FIL A;  4OZW A;  4S0R A;  2HJ8 A;  2IY1 B;  2BS3 B;  3Q3J A;  1G9J A;  2XBB C;  3G4F A;  4KTR A;  1CLC A;  3GLY A;  1X9D A;  3PGE A;  4DXF A;  2EAE A;  2XK5 A;  4FHJ A;  2AWT A;  2KMM A;  3CWI A;  3RJ3 A;  2Q1F A;  2X03 A;  3SHQ A;  4BKS D;  4TXT A;  1SE9 A;  1FMA D;  1N1B A;  5IM1 A;  2Z0E B;  4HRS A;  3VFK A;  5JPN B;  3ZXV A;  3P4P B;  3AE7 B;  4LK0 M;  4X57 B;  4GDL A;  4LNV A;  4ITK A;  4GIV A;  2YEP B;  2J0M A;  3Q7A B;  3NS8 A;  3TEY A;  2PE6 B;  2HTM E;  4DK5 A;  1PGA A;  1RWG A;  4IM3 A;  2M17 A;  3AH7 A;  1N21 A;  3M01 A;  1C79 A;  1TNO B;  5ILI A;  2MBE A;  4CYE A;  2FUT A;  3PSE B;  2H89 B;  2M1M A;  3GZK A;  1IA7 A;  4PK1 A;  2MJ3 A;  2AQ3 B;  1E7U A;  1NI3 A;  1N4P B;  5H8Y E;  3M72 A;  3A9J B;  1PQS A;  2R61 A;  4FLH A;  2KLC A;  5AZG A;  1KTK A;  3BK1 A;  2WP9 B;  4ZDV A;  2NVP A;  2WXI A;  1H13 A;  3K9P B;  1EGU A;  1O6Q A;  2LGX A;  2BB5 A;  3PRP B;  1TNZ B;  2ZZR A;  1O1S B;  5LNK 1;  3IAM 1;  2RDH A;  3AFL A;  4J5T A;  3UQB A;  2J0K A;  2RSU A;  2WHI A;  2WXG A;  5L83 A;  1KS8 A;  1H12 A;  3ZNG C;  4EHM B;  3NRZ A;  3V6E B;  2Z0D B;  2LEK A;  2GBN A;  3L13 A;  3H7S A;  2DWQ A;  3N9Y C;  4ANW A;  4RGN A;  3TIX A;  1XCT L;  2WYQ A;  2DAF A;  4LNK A;  3KWL A;  2ZEQ A;  4I6N B;  2NCN A;  3PYB A;  1TTN A;  1WM2 A;  4YTN B;  1N60 A;  3AEG B;  4KZ0 A;  3B2F A;  3PTF C;  2AYO B;  4MSM B;  1WH3 A;  1C3D A;  2XWB B;  2DRO A;  3E37 B;  3I9V 1;  1JCQ B;  1EF1 A;  3DBL B;  2FID A;  2LXC A;  1TYG B;  5EAT A;  3Q3M C;  3IG3 A;  2LXA A;  2H6I B;  2BWF A;  4E1Y A;  1TY2 A;  1TNU B;  3Q8A A;  1WZZ A;  2JWZ A;  1LOH A;  1N7P A;  3P4R B;  3L17 A;  2NS5 A;  3REN A;  3QWT A;  2AHG A;  4AYP A;  4HRO A;  1GC7 A;  3NHE B;  4M01 A;  2V8I A;  1XXG A;  2PVG C;  1C1Y B;  2W54 A;  4K7S A;  1C9F A;  2GZ6 A;  4NNJ B;  2QSD A;  3M78 A;  1LF9 A;  3DOW A;  1GAH A;  3P5P A;  4GLS C;  4LNI A;  2X38 A;  1E5W A;  3PV1 A;  3I63 C;  4OVU A;  4Q2J A;  3WIQ A;  1WSP A;  1G6I A;  4MEL A;  2M4N A;  3P42 A;  1OJN A;  2DHZ A;  3L16 A;  2HDE A;  2I2Y A;  1J7B A;  2ZVO A;  4ARC A;  1GOZ A;  5CA3 A;  2NTT A;  2FV0 A;  2L7R A;  4JWS C;  4GDK B;  1YQ3 B;  2KK8 A;  1TS4 A;  2J53 A;  1X1I A;  5IA7 A;  4RCO A;  1J19 A;  2D2Q A;  1KOT A;  2O6V D;  4P7I A;  3E80 A;  2WXF A;  1WMH B;  3GS2 A;  2IO1 B;  2L0T A;  4XWT A;  1SEB D;  5AUK A;  3ZGZ A;  3HHM A;  3PZ7 A;  3CSF A;  3OJ3 A;  1EU3 A;  2V1Y A;  3AE9 B;  2GBK A;  3RD2 A;  3E7J A;  3JW0 X;  3DBR I;  4OHJ A;  3Q3O C;  4RNQ A;  1BT0 A;  3Q78 B;  4HPP A;  2N9P C;  3IXS A;  3ACS A;  3EUB 2;  4G50 A;  1YJ1 A;  4N6E B;  2Y5P A;  3AFJ A;  4CJ0 A;  3N1Y C;  3QXQ A;  3HVD A;  1FO2 A;  3VR9 B;  2AX5 A;  2K8B A;  5G5G A;  1EWC A;  3PLV A;  3E30 B;  1MG4 A;  3SD5 A;  2KFK B;  3ABV B;  4C80 A;  3UF8 A;  2KNB A;  2M56 B;  1TNB B;  2JXX A;  1E0Z A;  1IGC A;  3T33 A;  2D07 B;  3PVL A;  2D5G A;  1NBF C;  2CQS A;  3IT6 B;  4IOI E;  2O6V B;  4IW0 A;  4DXG A;  4C4V B;  3VAW A;  3H7P A;  1V5O A;  1JRP A;  1H36 A;  3S4B A;  1JWA D;  2DYB A;  5JHA A;  2CQT A;  1HTO A;  3AEE B;  1F9O A;  4EEW A;  1N5X A;  1CJE A;  4YCR A;  3VRA B;  2RI9 A;  4CO7 A;  1TF4 A;  2G02 A;  1ZXH A;  1NEN B;  3A9K B;  2KTR B;  3JVZ X;  2PVO D;  3DSS B;  2RDB C;  4TMA B;  1VD2 A;  4WJQ A;  4FJY A;  2FUQ A;  3ZJV A;  2J4X A;  4HPL B;  1LGR A;  5DGQ A;  2RPV A;  4I6P A;  1C4C A;  2CHX A;  3GT5 A;  2K0P A;  4P16 A;  1F2R I;  5E6J A;  1V7X A;  2O2V A;  4KSL C;  2BRV X;  4O1N A;  2HE7 A;  3FIL B;  1HEZ E;  3OAW A;  1JS4 A;  3AE3 B;  4JGH B;  4NAW B;  2BT6 A;  3SDU A;  3PZ8 A;  1E9M A;  4GTV B;  3WCQ A;  4ZRP A;  1F1H A;  4PYZ A;  3ONS A;  4HJK A;  3R7Q A;  4BFR A;  1OJO A;  4JWU C;  1ZKH A;  2KQ4 X;  3AMZ A;  2KJH B;  1RFK A;  5EE0 A;  2ZW1 A;  4JLC A;  1D4B A;  2EAB A;  3LB8 C;  2HD5 B;  3H9D A;  4CJ1 A;  3PZD A;  1L0X B;  2W55 A;  1E90 A;  2A4Z A;  1N4S B;  2OHF A;  4LJP B;  4TUU A;  1K51 A;  3BII D;  4GDL B;  1HMW A;  3RN9 C;  4AQ7 A;  4W9D A;  3P5R A;  1WI0 A;  2JVC A;  3DVN U;  1AWD A;  2BRP A;  4KKI A;  2NMQ A;  2L1A A;  4LNB B;  3CST A;  4EUT A;  2JQR B;  4DOE A;  3AEF B;  3DHG C;  2PKO A;  3ETR A;  3PPA A;  4G0N B;  1T0Y A;  1OQQ A;  4MGY E;  4GTT B;  2QJL A;  2FBA A;  1KSC A;  3OED A;  2KAC A;  4FUS A;  1SIF A;  4IWP A;  3GE3 C;  2JSV X;  1VDV A;  2IGG A;  2D5J A;  3DDC B;  3AN1 A;  4FJQ A;  3VXD A;  3Q2A C;  1CK1 A;  2L32 A;  2GRI A;  1SGH A;  2AEH A;  4XWW A;  3KQ4 A;  1OFF A;  4F1S A;  1O1T B;  1K8R B;  1C3T A;  2KOX A;  1DGJ A;  4PT5 A;  1N22 A;  4QAY A;  3TF4 A;  1T3Q A;  1VZ6 A;  2Y5B B;  5IK0 A;  4OVZ A;  3QSP A;  1LQB A;  4USA A;  3NZ3 A;  2XWJ B;  1FXT B;  1N61 A;  5G55 A;  1H3B A;  3W7U A;  2GB1 A;  4MBG B;  2K6Q A;  1F2R C;  4E3C A;  1I8Q A;  1G87 A;  2ONQ A;  1JWM D;  3PZ1 B;  4GMV A;  1L2N A;  2IGH A;  2J5C A;  1E10 A;  4TF4 A;  4P1C C;  3URY A;  3CU7 A;  4DBG A;  1PGB A;  4WH4 A;  2JRI B;  4MM3 B;  2K3U A;  4B6W A;  2BQQ A;  2WXK A;  1FXA A;  2MQJ A;  3EU5 B;  1WU4 A;  1HN0 A;  1RW9 A;  3CMM B;  1KJT A;  4W9E A;  2L76 A;  1NXC A;  3ANJ A;  2VH1 A;  4GL3 A;  3DBL I;  3K9O B;  3KLS X;  3C72 B;  4NQK E;  4YSX B;  1AN8 A;  2LHE A;  4H2A A;  1YIW A;  3Q75 B;  3T3N A;  2KXJ A;  4UDU C;  3RUL A;  2RD0 A;  2LVP A;  2VN7 A;  4LDT D;  1HE8 A;  3B9J A;  4RM8 A;  2WS3 B;  1D5X C;  2WY7 A;  2GI9 A;  1EWY C;  3ON6 A;  1E7V A;  3Q8C A;  4YSY B;  4KGR A;  3U52 E;  3AE1 B;  5D3D A;  4J3O D;  3I3T B;  2MW5 A;  2C60 A;  1OEY J;  2YVC A;  3W7S A;  1ZPS A;  3QX1 A;  4FJZ A;  1GLM A;  2H6H B;  4DHZ E;  1TS3 A;  3E73 A;  2ONG A;  3H1U A;  1FP3 A;  1GXM A;  4GGQ A;  2LUE A;  2GLS A;  4D4D A;  1MFW A;  2LGD A;  1M94 A;  3BK2 A;  1K50 A;  5H92 C;  4D2K A;  2Q5W D;  1F52 A;  2K8H A;  3ZO5 B;  4RM9 A;  1N4Q B;  3RNC C;  4P6V F;  1VRA B;  1L7Y A;  2JF4 A;  1K72 A;  4OJZ A;  1U4A A;  3KSL B;  3PS6 A;  4GDK A;  2V3N A;  4LTU A;  2V8K A;  4MH8 A;  2KAN A;  3R7R A;  3DVN V;  2IDY A;  4LDT B;  5JHB A;  5ILJ A;  3PT2 B;  3SAE A;  2QHO A;  1C78 A;  2L3Z A;  4YWG G;  2DBY A;  2PTL A;  1I42 A;  1QOF A;  1WMH A;  1J0M A;  1CMX B;  4MEM A;  2MSE D;  4HJG E;  3V61 A;  2BTE A;  3NJT A;  4JL9 A;  3TL5 A;  1WXQ A;  3M00 A;  2C9W B;  3SDL C;  4KV2 A;  5C1Z A;  4FAD A;  5ILD A;  2FCQ A;  2DNF A;  5DPR A;  1R4M B;  3ZVV A;  3M02 A;  4NJ6 A;  1NI1 B;  5L95 C;  1H4R A;  2F0Y B;  1D6E C;  1YOV B;  3TMP B;  2DZJ A;  4KGT A;  5C05 A;  4BBN F;  3K11 A;  2V9H A;  3RZF A;  1NYQ A;  4HEA 1;  1ROE A;  2JYT A;  2KVZ A;  1SE2 A;  1WGH A;  1ACC A;  1KLU D;  3ZNI D;  1I4R A;  3R2T A;  1FBO A;  2QIL A;  3I57 A;  4TQ1 A;  3CIR B;  1RRB A;  1X1M A;  1N7Q A;  3FKY A;  1FT1 B;  1TZO A;  4B95 A;  5IL8 A;  3H7P B;  2HJ1 A;  4LJO B;  2O6V A;  4JE3 B;  4C4V A;  1HTQ A;  1SSN A;  5GMV A;  1I7H A;  2LJ5 A;  4EFO A;  2XNA C;  1A70 A;  3W7W A;  3QDE A;  2ZIS B;  2IO3 B;  4CHK A;  2M8S A;  2JU6 X;  2ZNV C;  3WIM A;  3RRS A;  3RX8 A;  3RX7 A;  1QZE A;  2N7E A;  2BED B;  2YEP F;  2KTR A;  4E71 A;  1TT5 B;  1KF6 B;  2E22 A;  2WIN B;  5M7Y A;  2RDG A;  3WAP A;  2C7M B;  4ZYS A;  3X0W A;  4RFB A;  2RPQ A;  4FXG B;  1KZP B;  2WXQ A;  1V9J A;  2G4S A;  2N1W A;  4IWQ A;  5AZF A;  1I4P A;  3Q3N C;  3MHS D;  4OZB A;  2XEW A;  4XUV A;  3HRD D;  2HTH A;  1V1O A;  2WU2 B;  4V1S A;  1JCR B;  1S63 B;  4NAW A;  5MPO A;  4W9I A;  3LDZ E;  5IO9 A;  3A3V A;  1WXA A;  3V60 A;  1I4H A;  1FCC C;  4A55 A;  5MEH A;  4HKQ A;  1C4P A;  2PLP A;  4BOK A;  3G4D A;  5CHF A;  1L6V A;  4BOJ A;  1PYW D;  3Q7F B;  1R4N B;  1W3Y A;  3WC3 A;  1LXD A;  4N9F 4;  4LNO A;  1KWF A;  4GTS B;  4OZV A;  4FNV A;  2OED A;  2EAD A;  3QFZ A;  2LI5 A;  2QMT A;  1QQF A;  1AAR A;  4ARI A;  1KZO B;  1OJP A;  2IZV B;  4FXK B;  1FM0 D;  4M0W A;  1XEE A;  1ZXI A;  3DPD A;  1M4V A;  1X1H A;  4DQO C;  1QSJ A;  1N63 A;  3TSS A;  3ZRC A;  2B4F A;  1TN7 B;  1TGZ B;  1WGG A;  2R2O A;  4NPN A;  1MVK A;  5E6N A;  1WY8 A;  3R8B A;  1N1Z A;  3M7L A;  3ZNZ B;  1GB4 A;  3W5N A;  3OJ4 B;  3L10 B;  1AGM A;  1KFG A;  2JJB A;  2K22 A;  2N7D A;  5ILK A;  3MC9 A;  3QWZ B;  3Q73 B;  4FJV B;  3M76 A;  5IK6 A;  4GSW A;  1H14 A;  2C7N B;  3W2D A;  1NC5 A;  3G6J B;  3T3O A;  3S4D A;  2ONH A;  3OWE B;  1PGX A;  4L0G A;  4RGM A;  4RMA A;  5GZK A;  3ENE A;  1YJJ A;  2QEJ C;  3E33 B;  4KSK C;  1FO4 A;  1IBX B;  4MGI E;  2BYF A;  1V5D A;  3RUI B;  1UBQ A;  4Q88 A;  4Z4L A;  2LUM A;  3AI5 A;  1ET9 A;  3DST B;  1UWM A;  3GB1 A;  3E9S A;  3NS1 A;  4HKZ E;  1FIQ A;  3KYD D;  2RGF A;  2V3P A;  3S4C A;  2KFJ A;  3K7X A;  1R7S A;  3OG5 A;  1WU5 A;  1X81 B;  5T8I A;  4WWN A;  5BYQ A;  4L9P B;  2F6D A;  1QKZ A;  4DDI D;  4MM3 A;  2NTS A;  2K9X A;  3M3J A;  2BYT A;  2WWZ A;  1N20 A;  1MJD A;  2AQ1 B;  5I4D A;  3VH3 B;  2MA9 B;  1WGR A;  2EKI A;  3V6C B;  3KH0 A;  1SJH D;  1L4D B;  1V5T A;  1WXS A;  5AEK B;  3VUY A;  2VH2 A;  3O65 B;  4II2 B;  3RFZ B;  4KDL B;  2MH7 A;  3ACT A;  1PFD A;  4NZL B;  3SEB A;  4KVG B;  4ANU A;  3RCZ A;  4N58 A;  2JF5 A;  4LCD E;  3PRM B;  5IKA A;  2RR9 A;  3RZW C;  2XQW A;  1P0R A;  3PHW B;  5HG2 A;  4EZK A;  1S1Q B;  3EC8 A;  2I07 B;  1C77 A;  3H2W A;  2KC2 A;  2A73 B;  2ACZ B;  3ZTD A;  1S3S G;  5DPS A;  1VJK A;  1RFA A;  4HK2 A;  4GAX A;  4ZRK A;  4IG7 B;  3N30 A;  4BKT A;  3SDQ A;  4M76 A;  3H6N A;  2J52 A;  3KW5 B;  4WAA A;  2JUO A;  3Q79 B;  4NEI A;  4OW0 A;  1JWB D;  1HM2 A;  1E8Z A;  2ZPN A;  1UD7 A;  3UI3 A;  1EF5 A;  5DPT A;  3RMK C;  3M95 A;  3JYU A;  2ZNV B;  1B9R A;  2CS4 A;  5D6J B;  1DOY A;  2KMC A;  2KD0 A;  1YN3 A;  4OVV A;  2INP E;  3U7D A;  2BRW A;  2BVC A;  3EFU A;  1ULV A;  1AYF A;  1QBQ B;  2DZM A;  2DYO A;  4WWP A;  1STE A;  1F0Z A;  2ASQ A;  1V5C A;  4GB9 A;  1WXM A;  5LXI B;  1R4M I;  3MP9 A;  2G4D B;  4C7Z A;  1XQQ A;  1P98 A;  4XX5 A;  5E2J A;  2WXR A;  3P63 A;  4WU0 A;  2BS2 B;  1HXY D;  4ANX A;  2L0F A;  3J9C A;  2RMM A;  3RPF C;  3ZRF A;  1DOI A;  5JH5 C;  2G3Q B;  1F9D A;  3WUX A;  4YTM B;  2BB6 A;  2Z59 B;  2KX0 A;  1FRR A;  2ZZP B;  3BWU D;  4NY0 A;  5G5H A;  2ZVN A;  4RGO S;  5CZL A;  1XD3 B;  1YJI A;  3Q8E A;  3UIO B;  3L0W B;  4J6I A;  4W9F A;  3D5R A;  2GOW A;  1AW7 A;  2KN4 A;  3QT3 A;  5JXV A;  3WAO A;  4HDO A;  1QOG A;  1WYG A;  1LD8 B;  3W7X A;  3DVG X;  1ZDX A;  1GA2 A;  2FE8 A;  1XWQ A;  2NPT A;  5DHI A;  3MC8 A;  2JRH A;  2JXT A;  2K1F A;  3PO0 A;  1D3Z A;  5J17 A;  3RNF C;  4DXA B;  4XDD A;  3B08 A;  4GN1 A;  3W7T A;  1MG8 A;  4K7W A;  1BUI C;  3VQI A;  2WLB A;  3DVG Y;  4M00 A;  2IYD B;  3U4E G;  3N1Z C;  2KWD A;  4W9K A;  2P0V A;  2WII B;  1FAE A;  3AEC B;  3TUO A;  2KVR A;  3QPF A;  1P9D U;  4ZH1 A;  1O6H A;  3DBH B;  3WKI A;  3NVZ A;  1K52 A;  4K3B A;  4F10 A;  4QT9 A;  4TSS A;  3L54 A;  1DYQ A;  3NUH B;  2IPK D;  5FO8 B;  1MI0 A;  5EE3 A;  5IAA C;  5CTR C;  2JWU A;  3RYT A;  3I5J C;  1LO5 D;  1R4N I;  1Q0W B;  3H8H A;  3M75 A;  3ZXR A;  2LJI A;  1P1A A;  1HZ5 A;  2BS4 B;  4L6X A;  2BWE S;  3TBL D;  3NFV A;  1JCK B;  3IT4 B;  1XT9 B;  1D8D B;  2LWP A;  3GP7 A;  3UGB B;  3NG0 A;  5JMD A;  5ILY A;  4TKN A;  3ZDT A;  2KJ6 A;  3NVW A;  1E8Y A;  4M0W B;  2WXN A;  1T5X D;  2Y5C A;  1RWF A;  4A20 A;  1Q10 A;  3T9L A;  3LXF A;  5FK9 C;  4NQL B;  3PZ4 B;  1IA6 A;  1F9G A;  2FUH B;  3DSV B;  2D10 A;  3TEW A;  2EEL A;  3HXC B;  1IUE A;  4G3X B;  3C8Y A;  2N0S B;  1VD5 A;  1WRD B;  3VHT C;  2KYW A;  3U30 A;  2AFA A;  4LNN A;  4HPM B;  1WR1 A;  1SQC A;  1MPE A;  1EM7 A;  4CE7 A;  3DSU B;  1NYR A;  2AQ2 B;  2FCM A;  4EZL A;  4NJC A;  1ZOY B;  3DQV A;  4AJW A;  3X17 A;  5IKC M;  5DCN A;  2C5L C;  1Q1O A;  1HM3 A;  5FR6 A;  2DRS A;  2K39 A;  1UEL A;  3E6U A;  2L00 B;  1VR9 A;  3PZ3 B;  1LXM A;  4XYC A;  1IBX A;  4AS1 A;  1QLB B;  2MRP A;  3A1Q B;  4A3O A;  1HXC A;  3IFW B;  1FCL A;  2LMC A;  3Q8F A;  1YNT E;  1G9G A;  2MBB B;  3VDZ A;  4AJY B;  1UZX B;  2JT4 B;  1V6E A;  1YN4 A;  1OGW A;  1FPP B;  1L2A A;  3EEC A;  2JG0 A;  4EKU A;  4ZRQ A;  2L52 A;  1K53 A;  1CZP A;  5FO9 B;  2Z07 A;  4A6Q A;  1YMH E;  4PS7 A;  4OK4 A;  1QIL A;  3P2B A;  2K5P A;  2YLM A;  4P1B C;  4AUQ C;  1OJM A;  4DOD A;  4ANV A;  2IBI B;  4US9 A;  3N1X C;  1ZDV A;  3UIN B;  2FUZ A;  2KMA A;  2N9L A;  1G6J A;  1L6U A;  3WIW A;  1SIJ A;  2JZ3 B;  4F8C B;  1FNV A;  4HLE A;  2XN9 C;  4W9J A;  3T8M A;  5GW7 A;  4HCP B;  3DWM A;  2ON8 A;  3N3K B;  4GOC A;  2VZK D;  1GXO A;  1OQY A;  4PS3 A;  4YT0 B;  5E6O A;  5BO4 B;  1WE6 A;  3HK0 A;  4ICV A;  4N59 A;  4WJP A;  4GTQ B;  2KAJ A;  4B9K A;  4YXD B;  4A9A A;  3ML9 A;  3WIR A;  3QQ8 B;  1J8C A;  1TY0 A;  5IL3 A;  3DBS A;  4BKG A;  2INN E;  1WIA A;  1UBI A;  2LGI A;  3QIJ A;  1RLF A;  2FAZ A;  3CIH A;  3DCG A;  1YD8 U;  3AU4 A;  5DPW A;  4WJN A;  1F1S A;  2XFG A;  1WX7 A;  3HUI A;  1CEM A;  1MHH E;  3AEA B;  4I6L B;  4OK2 A;  4WVA A;  5AGD A;  1QOB A;  3D32 A;  3PHX B;  2KT7 A;  3DHI C;  3RNG C;  1O5M B;  4C1S A;  3ZJT A;  1XO3 A;  2KHW B;  3AED B;  1Y56 A;  2Z8L A;  1Y8R C;  1I4X A;  3FC4 A;  3AV8 A;  2KKC A;  2BBC A;  3HXD B;  3R2I A;  4JQW C;  1N95 B;  3VR8 B;  4DHZ B;  4C7Y A;  2VZK B;  1WJ4 A;  4ACF A;  2IO0 B;  5EAS A;  3ZTC A;  1UGJ A;  1XWT A;  1FXI A;  2KDI A;  2INC C;  1TZ1 A;  3MTN B;  3MFG A;  3SU8 X;  5EE1 A;  3QXF A;  3ANK A;  4PS8 A;  2J0J A;  2WXH A;  2CJN A;  1N7N A;  4GXB A;  4II3 B;  5EAU A;  4F7Z A;  2ZBL A;  1FFU A;  2LFI A;  2KQ7 A;  1HA5 A;  4WWM A;  1UNS A;  4RH6 A;  3AE2 B;  2D3A A;  4GU2 A;  4IWO A;  2H88 B;  1VCB A;  4ZYN A;  2D8L A;  1N6Z A;  1V49 A;  3KSQ B;  2YIK A;  4W9G A;  3DBR B;  3WKF A;  3RNA C;  2LAS A;  4E74 A;  3RT3 B;  1SB3 C;  4ZRJ A;  4IM2 A;  2V4I B;  5FKA C;  1N4R B;  2BPS A;  5KHO A;  2RI8 A;  4NJ7 A;  2NPT B;  1WX8 A;  2JY6 A;  4HWI B;  4Q2B A;  5HFY A;  2NVU I;  2KDE B;  1XLQ A;  1N62 A;  1R76 A;  2FNJ B;  1UGM A;  3AE4 B;  1NDD A;  1WGY A;  1N9A B;  1GHQ A;  4W9L A;  1L0Y B;  2J42 A;  4A3P A;  1ZW7 A;  3KWV A;  1V7W A;  3SFX B;  4FN2 A;  1LM8 B;  3BYY B;  2L8J A;  4MMH A;  1L1Y A;  1J7A A;  1FRD A;  3DBH I;  1WZ0 A;  3RSY A;  4JPS A;  4RF0 A;  1X1J A;  1O79 A;  1HXG A;  5BYS A;  4ZG8 A;  1AYX A;  3VW5 A;  3NZU A;  2QCZ A;  3Q69 A;  3DPY B;  5HI1 A;  1SF0 A;  1F9J A;  2WXP A;  3EGR A;  5IN7 A;  1FFV A;  1H3A A;  3VUW A;  3KUD B;  3W1Y A;  1WM3 A;  4C00 A;  1S64 B;  4K81 A;  2JZZ A;  1XLP A;  3NY5 A;  2CHW A;  2PW9 A;  5BYR A;  4IUM B;  5IP4 D;  2IGD A;  2FCS A;  5D94 A;  4MMI A;  3TJP A;  3E32 B;  1P7E A;  4D4A A;  4AYQ A;  3N0G A;  1FCE A;  1D8E B;  1WJN A;  1YX6 B;  1LXK A;  3PLU A;  5BMG A;  2AL3 A;  3R3M A;  1EUV B;  4K1R B;  3N32 A;  3RNB C;  1FPY A;  3LJ3 A;  2ZIR B;  2WU5 B;  4WVC A;  2WQY B;  4HVB A;  3HXF B;  1SJE D;  5C2T B;  1JCS B;  4S17 A;  1KFY B;  2DEN B;  3N20 C;  3OLM D;  2REX A;  1WYW B;  1IP9 A;  1KKT A;  1I4G A;  2EMT A;  1DOX A;  3GZN B;  5BMH A;  4MJS A;  4BOZ B;  1N7R A;  2W3S A;  3HM3 A;  1ESF A;  3C19 A;  2W3R A;  3B0A A;  5JPM B;  1VLB A;  5AUI A;  1GB1 A;  2RGK A;  1V1P A;  3Q3F A;  4RF1 A;  4EL8 A;  3MC0 B;  4BZA A;  4CQN A;  4F13 A;  2MJE A;  2GBM A;  1XLO A;  1N94 B;  3VSM A;  1D5Z C;  2KN5 A;  1O6R A;  2GBJ A;  4BVU C;  1WJ6 A;  3DHH C;  2LD9 A;  1D5M C;  3DRA B;  3ANI A;  3A1Q A;  2BGF A;  1O1R B;  1FNW A;  1GUA B;  3QAQ A;  5J18 A;  1V86 A;  3CF6 E;  3IBE A;  2MEK A;  2JZP A;  4ZRI A;  2LRU A;  2GH4 A;  1GPX A;  1V97 A;  1OEY A;  1SA4 B;  5GXG B;  3RI7 C;  4A90 A;  2IJ0 A;  2FUG 1;  2WCO A;  3VRB B;  1W6J A;  2MP2 B;  1WRI A;  2FCN A;  4MU9 A;  1NEK B;  4GTP B;  2I38 A;  2NBV B;  2LGS A;  2DX5 B;  4PYU A;  3KUC B;  1A5R A;  3ZQ4 A;  2GMI C;  2ZCB A;  3D5S A;  4NAM A;  2WX0 A;  1KRF A;  4K7U A;  1WX9 A;  3QJZ A;  2PE9 A;  2MHJ A;  1XF5 L;  1H35 A;  1Z2M A;  3VH4 B;  1TNY B;  3AB5 A;  1UUP A;  3HXE B;  3GOE A;  2DRQ A;  4WWO A;  1Z5S B;  2M0A A;  1GSZ A;  1H37 A;  3SDT A;  3QC8 B;  3X23 A;  1L4Z B;  1KH0 A;  2BYE A;  3M7E A;  4V1R A;  2WDA A;  5LLI A;  4EOY A;  1LTX B;  3DSX B;  1WFY A;  2IND C;  3AE6 B;  2KWU B;  1H39 A;  4DHJ D;  2ZJD A;  1QAZ A;  1FT2 B;  5D3I B;  4YDE B;  2ICI A;  2PJH A;  5CX3 A;  2GBR A;  2MLB A;  3HXB B;  4DDG D;  5D2M B;  4TQ0 A;  1N24 A;  1VZ8 A;  3MJ5 A;  3IHP C;  3PMM A;  3QG0 A;  1QF6 A;  1T6B X;  1TS5 A;  2KX3 A;  3JSV B;  3VTV A;  2KLG A;  3EHV A;  3SQC A;  3A0O A;  2QIE B;  3VVW B;  1UMP A;  3WKH A;  3W9C B;  3KLS A;  3SFE B;  5TSS A;  2QNO A;  2N7J A;  1TS2 A;  2KC1 A;  2K8C A;  1RM6 C;  3EA6 A;  1Q5W B;  4KTP A;  1LD7 B;  4MAC A;  4XDC A;  3W1S A;  2AHF A;  3TCA A;  3QAR A;  4A8X C;  4EZJ A;  1HV6 A;  4LLG M;  2G0D A;  2PIA A;  2R2Q A;  1V80 A;  2MBQ A;  2D3G A;  3M7C A;  1NI2 A;  4JJJ A;  2WXJ A;  2KDM A;  3BVG A;  5KHQ A;  2WXO A;  2JYE A;  4AWJ A;  2G9H D;  1OTR B;  2CKH B;  4DHJ B;  1E8X A;  1V7V A;  2I1J A;  1WZ3 A;  1HXA A;  3M71 A;  3PZ2 B;  2I1K A;  1YN5 A;  2QDF A;  3AXC A;  2OKX A;  1I4Q A;  2K25 A;  3VXW A;  2OJW A;  2V8J A;  2G1E A;  3ZW3 A;  1V81 A;  4RGT A;  1FEH A;  3AE8 B;  3U8Z A;  4WAF A;  1N23 A;  2E24 A;  2JPH A;  3WAL A;  2DAJ A;  3SFD B;  4REZ A;  3B1L X;  3QA8 A;  3ZIM A;  3QCA A;  2KJR A;  2WXM A;  1WJU A;  2E3T A;  1GNU A;  2SEB D;  3BZD B;  3Q6B A;  4EE2 A;  1TKY A;  3ZDM C;  3H3K A;  3M77 A;  3IAS 1;  4HDQ A;  3E34 B;  3WAN A;  1WGD A;  1EU4 A;  1WF9 A;  1SA5 B;  4ICU A;  2ZPY A;  1NL4 B;  2X8X X;  2W82 A;  3MHZ A;  1N7O A;  5FO7 B;  2N9E B;  3EQA A;  3ZLZ A;  3S4A A;  1JWS D;  3RNE C;  1V2Y A;  5CHV C;  3W1S C;  2MCN B;  1FMI A;  3Q14 C;  2AL6 A;  1C76 A;  1H54 A;  2G45 B;  3M74 A;  3VSN A;  3L4P A;  1W6K A;  1HZF A;  1C4A A;  1TBE A;  1KRE A;  4XZ4 A;  2L05 A;  1IS9 A;  3W5V B;  4ZHP A;  4OZC A;  4LIX A;  3ZUN A;  4KDI C;  2BKF A;  3KYC D;  3TEZ A;  4WQM A;  1DOG A;  2FIF A;  5BMI A;  1SBB B;  2LRW A;  2EKE C;  1JRU A;  1ZP0 B;  5FOB B;  3MJW A;  4AYR A;  2W9N A;  1HCU A;  1F77 A;  3EZ8 A;  4IDI A;  4KIK A;  2ZCC A;  2PEA A;  4MT5 A;  2A5U A;  1RWA A;  5C23 A;  3E56 A;  4MH0 E;  3WKG A;  3EU8 A;  1UWX A;  4FXC A;  4L23 A;  4KKJ A;  3DWG C;  3U7Z A;  2KTF A;  4ZH5 A;  3RX5 A;  3Q8B A;  3P2C A;  2UYZ B;  2Y3A A;  1LF6 A;  4ZOH C;  3HVZ A;  3QK0 A;  2XK5 B;  2KQS A;  4RNA A;  1E8W A;  2FBW B;  1GJZ A;  1PUT A;  3KUZ A;  2V4L A;  5G2N A;  5ILH A;  1H3C A;  1T0Q C;  2B76 B;  3C0R B;  4GTO B;  5D7G A;  3U2S C;  3GZN I;  4ASW C;  1BXT A;  1TN8 B;  5CHW A;  1TKG A;  1FNU A;  2D3C A;  3BVZ A;  2LZ6 A;  1RQ5 A;  4BAX A;  1E6E B;  1P3Q U;  2CU3 A;  3PYA A;  5DHK A;  4MJS B;  3VTU A;  2K6D B;  2UU7 A;  3ZYY X;  1NVI D;  3SFY B;  1V8C A;  2BF8 B;  4WUR A;  1GAQ B;  3QT9 A;  2IO2 B;  1KSD A;  2LHD A;  3P4S B;  4WJO A;  5DGR A;  1V1P B;  5JZE B;  4W9H A;  3LYY A;  1N5W A;  5ILZ A;  1OQR A;  1QT9 A;  4AOF A;  2MBO A;  1JWU D;  1QOA A;  1YQ4 B;  3APF A;  1KRH A;  4GTM B;  1JRO A;  1L5P A;  4YSZ B;  1FO3 A;  3N0F A;  3S9V A;  3A9J A;  1TJE A;  2M0X A;  3AEB B;  5HKH A;  1MHX A;  4JX1 C;  1DCE B;  1UT9 A;  2PN5 A;  2UWQ A;  4IM0 A;  1IPG A;  4BBN C;  1JML A;  3V3X A;  5AZH A;  2N4F A;  1TIF A;  1ZUD 2;  2SAK A;  2MWS B;  4HCN B;  4K3C A;  4M8N A;  1MZC B;  4JIO U;  3OXU A;  1RWS A;  2WX1 A;  2DYM A;  2N9K A;  2VN4 A;  1XW2 A;  4BKS A;  4Z4J A;  3IVF A;  2MP2 A;  2N9X A;  4KZC A;  2WDR B;  1CB8 A;  2IY0 B;  2OJR A;  2D3B A;  4WQO B;  3P4Q B;  3O13 A;  2QC8 A;  3SDV A;  3B2G A;  5IK9 A;  2BYV E;  3AE5 B;  3V62 A;  4TV3 A;  2EAC A;  4ONT A;  3A33 B;  5LXH A;  2MX2 A;  1HX9 A;  3QFY A;  4D94 A;  2DLB A;  3BYT B;  4AP4 C;  3NZS A;  1HZ6 A;  2KWV B;  3BVM A;  2B39 A;  3AM9 A;  4R3D A;  1EO6 A;  4URK A;  3PRE A;  4D4B A;  3GE8 C;  4BOS C;  4C56 C;  1UH6 A;  1KM7 A;  2DRR A;  2OOB B;  1IGD A;  3APD A;  3PRZ A;  4W9C A;  4G11 A;  1I35 A;  1BML C;  4YL8 A;  1LFD A;  1WR6 E;  2J7Q B;  1WU6 A;  1B1Z A;  3QHT A;  4YDO B;  3W5M A;  1VZ7 A;  2H6F B;  3VUX A;  5GY3 A;  5EE9 A;  4IC7 B;  1SXT A;  2PMV A;  5E6P A;  2PPH A;  1UF0 A;  2KO3 A;  3APC A;  1T0S C;  3BIN A;  4FHK A;  2ZW0 A;  3JSV A;  4WIP A;  3ZNH B;  4B0M A;  3ECI A;  3EFC A;  3M7B A;  3TEX A;  1CQV A;  3HM6 X;  3BY4 B;  3S2A A;  1TKE A;  3L08 A;  1H8C A;  1KLV A;  2LGY A;  3WAM A;  1SE3 A;  1IYF A;  1ISN A;  2EMS A;  2KZR A;  1ZE3 D;  3V05 A;  2MJD A;  2NBU A;  2DZK A;  2IEJ B;  1JQ4 A;  1FD6 A;  1WWT A;  2NOJ A;  5KKB A;  2D11 A;  1RWH A;  4D4C A;  3ZJU A;  2M19 A;  1J0N A;  1T0R C;  2CJO A;  3AUL A;  3UQA A;  3HIZ A;  4WVB A;  2WY8 A;  2GOX A;  1XCQ L;  2TSS A;  1JAL A;  3ZKJ C;  2V3S A;  3QRY A;  4OZA A;  4ZHO A;  1XLN A;  4FBJ B;  4MGZ E;  5JMF A;  4HXD A;  3A4R A;  4XE0 A;  3H7L A;  2WDT B;  2BKR B;  1WE7 A;  1GAI A;  1GG3 A;  3R66 C;  2CR5 A;  1DL2 A;  1GC6 A;  1RYJ A;  3ALB A;  1L0V B;  2R2L B;  2LVO A;  3ML8 A;  4XGA B;  1GXN A;  4L1B A;  1PDX A;  3M63 B;  2KDB A;  1ENF A;  3WA0 A;  4M02 A;  2FV1 A;  4FUL A;  1FBW A;  2LVQ A;  5IOI A;  5CD2 A;  2WNM A;  2A8Z A;  2KWC A;  3AU5 A;  3NVY A;  2CHZ A;  3D3I A;  3LZ9 A;  5M7I A;  1ET6 A;  1TN6 B;  1C82 A;  2WYN A;  2N1V A;  4LNF A;  1E7P B;  4GTR B;  3FAH A;  2H6G B;  2KFK A;  1QQR A;  4DI5 A;  2VRR B;  1P7F A;  3W5U B;  1YQB A;  3UIP B;  3P1M A;  2WDQ B;  3SDR A;  4YTP B;  4MGK E;  1JW9 D;  1KLG D;  4DWF A;  4IKG A;  2V0G A;  3NNB A;  2WXL A;  4B0E A;  2SQC A;  1RAX A;  2KDF B;  5HHD G;  4FA6 A;  4L2Y A;  3EUV B;  4MSQ B;  1UG9 A; 
#chains in the Genus database with same CATH homology
 4US8 A;  4GLS C;  4GL3 A;  1BUI C;  3KLS X;  3VQI A;  3C72 B;  2WLB A;  4YSX B;  1AN8 A;  1XF5 L;  1H35 A;  2L83 A;  2LHE A;  3U4E G;  1HQR D;  4H2A A;  2WDV B;  2KWD A;  3Q75 B;  2P0V A;  1TNY B;  3DSW B;  1UUP A;  3AB5 A;  3T3N A;  3HXE B;  4UDU C;  4KGS A;  2VN7 A;  3NVV A;  2WII B;  4KX6 B;  2DRQ A;  4LNG B;  1FAE A;  3B9J A;  5FR3 A;  2M0A A;  3AEC B;  1GSZ A;  2WS3 B;  3TUO A;  1H37 A;  3SDT A;  3SR6 A;  1D5X C;  1L4Z B;  2WY7 A;  3QPF A;  4ZH1 A;  1KH0 A;  1O6H A;  3M7E A;  4V1R A;  3WKI A;  2GI9 A;  3NVZ A;  1EWY C;  1K52 A;  1LTX B;  1SE4 A;  3ON6 A;  2JX5 A;  3DSX B;  2E6X A;  3M73 A;  3Q8C A;  4YSY B;  4KGR A;  3AE6 B;  3U52 E;  3AE1 B;  5C3J B;  4QT9 A;  1H39 A;  4AYO A;  1DYQ A;  3NUH B;  2IPK D;  4TSS A;  5D3D A;  5FO8 B;  2BW2 A;  1FT2 B;  1WGK A;  4YDE B;  4J3O D;  5D3I B;  2ICI A;  1J7C A;  1MI0 A;  3W7S A;  1ZPS A;  5EE3 A;  2JWU A;  3HXB B;  1LO5 D;  4TQ0 A;  1GLM A;  1VZ8 A;  2H6H B;  3MJ5 A;  3FIL A;  3H8H A;  3M75 A;  3PMM A;  1TS3 A;  3E73 A;  3QG0 A;  1QF6 A;  1T6B X;  1TS5 A;  2LJI A;  2BS3 B;  1FP3 A;  1HZ5 A;  1GXM A;  4L6X A;  2BS4 B;  1G9J A;  4D4D A;  4KTR A;  3SQC A;  1CLC A;  1JCK B;  3IT4 B;  2QIE B;  3GLY A;  1X9D A;  1UMP A;  3WKH A;  1D8D B;  3BK2 A;  3GP7 A;  3W9C B;  4DXF A;  3KLS A;  2EAE A;  1K50 A;  5H92 C;  3SFE B;  2Q5W D;  2QNO A;  2N7J A;  1TS2 A;  5TSS A;  4D2K A;  2KMM A;  1RM6 C;  3EA6 A;  3CWI A;  3RJ3 A;  3NVW A;  1N4Q B;  2WXN A;  1T5X D;  4TXT A;  4P6V F;  1VRA B;  4HKQ A;  2JF4 A;  1K72 A;  4KTP A;  1FMA D;  1LD7 B;  4MAC A;  4XDC A;  3W1S A;  2AHF A;  3KSL B;  2Y5C A;  4HRS A;  5JPN B;  1Q10 A;  3LXF A;  2V3N A;  5FK9 C;  3P4P B;  3AE7 B;  4LK0 M;  2V8K A;  3PZ4 B;  4LLG M;  4LTU A;  4MH8 A;  1IA6 A;  4LNV A;  4ITK A;  2G0D A;  3DSV B;  3TEW A;  2PIA A;  2EEL A;  2YEP B;  3HXC B;  1IUE A;  2IDY A;  3Q7A B;  3C8Y A;  3TEY A;  2HTM E;  3SAE A;  2N0S B;  1VD5 A;  3M7C A;  1C78 A;  4YWG G;  2DBY A;  2PTL A;  1QOF A;  4JJJ A;  1PGA A;  2WXJ A;  2AFA A;  2KDM A;  3AH7 A;  1C79 A;  4L23 A;  3BVG A;  2WXO A;  2JYE A;  1TNO B;  3VRA B;  2G9H D;  4HJG E;  2H89 B;  2BTE A;  3GZK A;  1IA7 A;  1SQC A;  1V7V A;  1MPE A;  1EM7 A;  2MJ3 A;  1NI3 A;  2AQ3 B;  1WXQ A;  1N4P B;  3DSU B;  4CE7 A;  1NYR A;  2AQ2 B;  5H8Y E;  3M71 A;  3M72 A;  4NJC A;  1ZOY B;  3PZ2 B;  3X17 A;  2R61 A;  1YN5 A;  2OKX A;  1KTK A;  3BK1 A;  1I4Q A;  1NI1 B;  2WP9 B;  2DRS A;  2NVP A;  2F0Y B;  2WXI A;  2V8J A;  2G1E A;  1H13 A;  3E6U A;  1D6E C;  1VR9 A;  4RGT A;  1FEH A;  3AE8 B;  4KGT A;  1O6Q A;  3PZ3 B;  4A55 A;  2BB5 A;  1IBX A;  1TNZ B;  2ZZR A;  1O1S B;  1QLB B;  3IAM 1;  5LNK 1;  4AS1 A;  4WAF A;  3K11 A;  2RDH A;  1FCL A;  2LMC A;  3Q8F A;  4J5T A;  1NYQ A;  4HEA 1;  1YNT E;  3SFD B;  3URY A;  1ROE A;  2JYT A;  2WXG A;  1G9G A;  1SE2 A;  4REZ A;  1KS8 A;  1ACC A;  1KLU D;  1H12 A;  1I4R A;  2WXM A;  4EHM B;  1NXC A;  3R2T A;  1FBO A;  3NRZ A;  2E3T A;  2SEB D;  1YN4 A;  2QIL A;  3I57 A;  1FPP B;  1L2A A;  3BZD B;  4TQ1 A;  2LEK A;  2JG0 A;  3CIR B;  4ZRQ A;  2L52 A;  1FT1 B;  4EE2 A;  1K53 A;  2DWQ A;  1CZP A;  5FO9 B;  3N9Y C;  1GB4 A;  2Z07 A;  1TZO A;  4A6Q A;  1TKY A;  4RGN A;  3H3K A;  1YMH E;  3M77 A;  1XCT L;  1QIL A;  3IAS 1;  4JE3 B;  3KWL A;  2K5P A;  3E34 B;  1SSN A;  1EU4 A;  1SA5 B;  3PYB A;  4DOD A;  1I7H A;  1NL4 B;  2W82 A;  3MHZ A;  4US9 A;  5FO7 B;  2XNA C;  3EQA A;  1ZDV A;  3S4A A;  1N60 A;  1JWS D;  4YTN B;  2FUZ A;  3AEG B;  1A70 A;  2N9L A;  3W7W A;  1L6U A;  3QDE A;  3WIW A;  1SIJ A;  1FMI A;  3B2F A;  1FNV A;  2ZIS B;  2XN9 C;  2JU6 X;  1C76 A;  1H54 A;  5GW7 A;  3RRS A;  3M74 A;  3RX7 A;  3RX8 A;  3DWM A;  1C3D A;  2XWB B;  2ON8 A;  2BED B;  2DRO A;  2VZK D;  1GXO A;  2YEP F;  4YT0 B;  3E37 B;  3I9V 1;  3L4P A;  1KF6 B;  1W6K A;  1HZF A;  1C4A A;  4N59 A;  1JCQ B;  1KRE A;  4A8X C;  1IS9 A;  4GTQ B;  2KAJ A;  4YXD B;  1TYG B;  3W5V B;  2WIN B;  5M7Y A;  2RDG A;  4A9A A;  4ZYS A;  3WIR A;  2H6I B;  1TY2 A;  1TY0 A;  4RFB A;  4ZHP A;  4FXG B;  1KZP B;  1TNU B;  2WXQ A;  3Q8A A;  4OZC A;  1WZZ A;  4LIX A;  1I4P A;  4OZB A;  3TEZ A;  3P4R B;  4XUV A;  4WQM A;  3HRD D;  3REN A;  1DOG A;  3QWT A;  5BMI A;  2AHG A;  4AYP A;  1SBB B;  1V1O A;  4HRO A;  2WU2 B;  4V1S A;  2INN E;  1JCR B;  1S63 B;  2LGI A;  2V8I A;  1XXG A;  5FOB B;  1ZP0 B;  2PVG C;  5MPO A;  3CIH A;  4AYR A;  1HCU A;  1F77 A;  3EZ8 A;  4IDI A;  2W54 A;  1C9F A;  4MT5 A;  3A3V A;  2XFG A;  3E56 A;  2GZ6 A;  1I4H A;  3WKG A;  1FCC C;  3HUI A;  2QSD A;  3M78 A;  3EU8 A;  1CEM A;  1LF9 A;  1MHH E;  4KKJ A;  1GAH A;  1UWX A;  5MEH A;  3DWG C;  1C4P A;  3P5P A;  3AEA B;  4ZH5 A;  3RX5 A;  4BOK A;  2PLP A;  3P2C A;  4WVA A;  1L6V A;  2Y3A A;  2X38 A;  1LF6 A;  3Q8B A;  4BOJ A;  1PYW D;  3Q7F B;  5AGD A;  1QOB A;  3HVZ A;  4Q2J A;  4ZOH C;  3WC3 A;  3WIQ A;  1WSP A;  1G6I A;  1KWF A;  4GTS B;  3P42 A;  2OED A;  1O5M B;  2EAD A;  3QFZ A;  4C1S A;  4RNA A;  2HDE A;  2FBW B;  1XO3 A;  2I2Y A;  1J7B A;  3ZJT A;  2QMT A;  1QQF A;  1PUT A;  3AED B;  1Y56 A;  2Z8L A;  4ARI A;  1I4X A;  1KZO B;  3FC4 A;  4ARC A;  1GOZ A;  4FXK B;  5CA3 A;  1FM0 D;  1H3C A;  2NTT A;  3AV8 A;  2FV0 A;  2B76 B;  4JWS C;  4M0W A;  2BBC A;  3U2S C;  4GTO B;  4GDK B;  1XEE A;  5D7G A;  3HXD B;  1ZXI A;  3R2I A;  1YQ3 B;  1BXT A;  1TN8 B;  1N95 B;  1M4V A;  1TS4 A;  2J53 A;  3VR8 B;  1TKG A;  4C7Y A;  2VZK B;  1FNU A;  4DQO C;  3BVZ A;  1RQ5 A;  4RCO A;  1E6E B;  2CU3 A;  1UGJ A;  3PYA A;  1XWT A;  1FXI A;  1QSJ A;  1N63 A;  3TSS A;  3ZYY X;  2B4F A;  1TN7 B;  1NVI D;  3SFY B;  2WXF A;  3GS2 A;  1V8C A;  1MVK A;  3R8B A;  3MFG A;  4WUR A;  3M7L A;  5EE1 A;  3FAH A;  1GAQ B;  3QT9 A;  3W5N A;  1SEB D;  4XWT A;  5AUK A;  3ZGZ A;  1KSD A;  3QXF A;  3ANK A;  2LHD A;  3P4S B;  1AGM A;  1KFG A;  5DGR A;  2JJB A;  1V1P B;  2CJN A;  2K22 A;  2WXH A;  1EU3 A;  3PZ7 A;  3AE9 B;  3LYY A;  1N5W A;  3Q73 B;  3M76 A;  1OQR A;  1QT9 A;  1JWU D;  2ZBL A;  1FFU A;  1QOA A;  1YQ4 B;  4OHJ A;  1KRH A;  4GTM B;  1H14 A;  2LFI A;  1HA5 A;  1JRO A;  3W2D A;  1NC5 A;  4WWM A;  3Q78 B;  3G6J B;  1L5P A;  1UNS A;  4YSZ B;  3T3O A;  1FO3 A;  3S4D A;  3S9V A;  4FXC A;  4RH6 A;  3AE2 B;  3OWE B;  1PGX A;  4L0G A;  2H88 B;  3IXS A;  1TJE A;  4RGM A;  5GZK A;  3AEB B;  3ACS A;  1YJJ A;  3E33 B;  2QEJ C;  3EUB 2;  2Y5P A;  4N6E B;  3U7Z A;  2D8L A;  3AFJ A;  1MHX A;  4JX1 C;  1DCE B;  1FO4 A;  4CJ0 A;  1IBX B;  1UT9 A;  3QXQ A;  1FO2 A;  2PN5 A;  3HVD A;  3VR9 B;  1V5D A;  2AX5 A;  4Q88 A;  3KSQ B;  1JML A;  2YIK A;  1EWC A;  5G5G A;  4Z4L A;  3V3X A;  2LUM A;  1ET9 A;  3DST B;  3E30 B;  3WKF A;  1UWM A;  1ZUD 2;  2SAK A;  3GB1 A;  3E9S A;  3NS1 A;  3ABV B;  4HKZ E;  1FIQ A;  4C80 A;  1MZC B;  3OXU A;  1RWS A;  2DYM A;  2N9K A;  1SB3 C;  2V4I B;  5FKA C;  1N4R B;  2M56 B;  1TNB B;  2RI8 A;  2V3P A;  2VN4 A;  1XW2 A;  3S4C A;  3K7X A;  1R7S A;  1E0Z A;  1IGC A;  3T33 A;  4Z4J A;  1WU5 A;  4Q2B A;  1X81 B;  5HFY A;  5T8I A;  2D5G A;  2CQS A;  5BYQ A;  3IT6 B;  4IOI E;  1XLQ A;  1N62 A;  4L9P B;  1R76 A;  2WDR B;  2F6D A;  1QKZ A;  4DXG A;  3AE4 B;  2NTS A;  2K9X A;  3P4Q B;  1N9A B;  1GHQ A;  2BYT A;  1JRP A;  3O13 A;  1H36 A;  3S4B A;  3SDV A;  1L0Y B;  2J42 A;  3B2G A;  2AQ1 B;  1JWA D;  5I4D A;  2CQT A;  2EKI A;  3KWV A;  3AE5 B;  1V7W A;  3SFX B;  1SJH D;  2EAC A;  4ONT A;  1L4D B;  3BYY B;  3QFY A;  4D94 A;  3AEE B;  1F9O A;  2DLB A;  3BYT B;  1N5X A;  1L1Y A;  1J7A A;  1FRD A;  1HZ6 A;  3BVM A;  3RSY A;  2B39 A;  4YCR A;  1CJE A;  3AM9 A;  4JPS A;  2MH7 A;  2RI9 A;  3ACT A;  4R3D A;  1PFD A;  4RF0 A;  1O79 A;  1TF4 A;  4NZL B;  4C56 C;  4D4B A;  2G02 A;  1ZXH A;  1NEN B;  5BYS A;  3SEB A;  4ZG8 A;  1AYX A;  3VW5 A;  2PVO D;  3Q69 A;  3DSS B;  4TMA B;  4N58 A;  3DPY B;  5HI1 A;  2DRR A;  1IGD A;  3ZJV A;  2XQW A;  1SF0 A;  2J4X A;  5HG2 A;  2WXP A;  5DGQ A;  3EGR A;  2RPV A;  1FFV A;  1H3A A;  1BML C;  2I07 B;  1C77 A;  3H2W A;  2A73 B;  2ACZ B;  1C4C A;  3GT5 A;  1WU6 A;  2K0P A;  4P16 A;  1F2R I;  5E6J A;  1VJK A;  1B1Z A;  1V7X A;  4O1N A;  4YDO B;  3W5M A;  1VZ7 A;  1S64 B;  1HEZ E;  3SDQ A;  3FIL B;  2H6F B;  1JS4 A;  1XLP A;  5GY3 A;  3AE3 B;  5EE9 A;  2PW9 A;  4NAW B;  5BYR A;  4M76 A;  2BT6 A;  3SDU A;  3PZ8 A;  2IGD A;  1E9M A;  4GTV B;  2PMV A;  1SXT A;  2J52 A;  3WCQ A;  4ZRP A;  2ZW0 A;  4WIP A;  3Q79 B;  4B0M A;  3E32 B;  1P7E A;  4JWU C;  3M7B A;  4D4A A;  4AYQ A;  1JWB D;  2KQ4 X;  3AMZ A;  1CQV A;  1RFK A;  4OW0 A;  5EE0 A;  3TEX A;  1TKE A;  2ZW1 A;  1FCE A;  1D8E B;  1D4B A;  3UI3 A;  2EAB A;  3LB8 C;  4CJ1 A;  1L0X B;  2W55 A;  5BMG A;  1SE3 A;  1N4S B;  2OHF A;  1B9R A;  1K51 A;  1ZE3 D;  3V05 A;  3BII D;  4GDL B;  2MJD A;  4AQ7 A;  3P5R A;  2IEJ B;  1DOY A;  1FD6 A;  1WWT A;  1JQ4 A;  2NOJ A;  5KKB A;  1AWD A;  2ZIR B;  2WU5 B;  1YN3 A;  4WVC A;  2WQY B;  4KKI A;  2INP E;  4D4C A;  3HXF B;  1SJE D;  2NMQ A;  2M19 A;  5C2T B;  1ULV A;  3ZJU A;  1AYF A;  2L1A A;  1JCS B;  4LNB B;  2CJO A;  1KFY B;  4DOE A;  2JQR B;  1QBQ B;  2DYO A;  3AEF B;  1STE A;  1F0Z A;  1V5C A;  2PKO A;  4WVB A;  3ETR A;  1KKT A;  1I4G A;  2WY8 A;  1DOX A;  5BMH A;  1OQQ A;  2GOX A;  1XCQ L;  3MP9 A;  2TSS A;  2W3S A;  1JAL A;  3QRY A;  4GTT B;  1ESF A;  2QJL A;  2FBA A;  2W3R A;  4OZA A;  4ZHO A;  1XLN A;  1KSC A;  3OED A;  4C7Z A;  5JPM B;  2KAC A;  1VLB A;  4FUS A;  5AUI A;  5E2J A;  1GB1 A;  2RGK A;  2WXR A;  2JSV X;  1VDV A;  4XE0 A;  3H7L A;  2IGG A;  3P63 A;  2D5J A;  4WU0 A;  1V1P A;  2BS2 B;  3AN1 A;  1GAI A;  4EL8 A;  3MC0 B;  3VXD A;  1HXY D;  4RF1 A;  1CK1 A;  3J9C A;  1DL2 A;  2L32 A;  1RYJ A;  4CQN A;  2GRI A;  2RMM A;  3RPF C;  1L0V B;  2MJE A;  2R2L B;  1XLO A;  1GXN A;  1N94 B;  1DOI A;  4L1B A;  4XWW A;  1D5Z C;  1O6R A;  1PDX A;  1F9D A;  3WUX A;  3KQ4 A;  1OFF A;  1D5M C;  4YTM B;  1ENF A;  1O1T B;  2BB6 A;  3DRA B;  3ANI A;  2FV1 A;  1FRR A;  3BWU D;  5G5H A;  4RGO S;  1DGJ A;  1FBW A;  5CZL A;  4PT5 A;  1YJI A;  1O1R B;  5CD2 A;  3TF4 A;  1T3Q A;  1VZ6 A;  2WNM A;  3Q8E A;  4OVZ A;  2A8Z A;  1FNW A;  3QSP A;  3NVY A;  4USA A;  3NZ3 A;  3D3I A;  2XWJ B;  3D5R A;  1N61 A;  2MEK A;  2JZP A;  5M7I A;  1AW7 A;  1ET6 A;  1H3B A;  1TN6 B;  2WYN A;  2KN4 A;  3W7U A;  2GB1 A;  2GH4 A;  3QT3 A;  1GPX A;  5JXV A;  4MBG B;  1E7P B;  4GTR B;  1QOG A;  1F2R C;  1WYG A;  2H6G B;  1V97 A;  1LD8 B;  1KRF A;  3W7X A;  1QQR A;  1ZDX A;  1GA2 A;  1SA4 B;  1P7F A;  5GXG B;  3W5U B;  1G87 A;  2ONQ A;  4A90 A;  2IJ0 A;  1JWM D;  3PZ1 B;  2FUG 1;  2IGH A;  3P1M A;  3VRB B;  3RFZ B;  1W6J A;  1WRI A;  4TF4 A;  2FE8 A;  1E10 A;  1XWQ A;  2WDQ B;  3CU7 A;  4MU9 A;  4GTP B;  3SDR A;  1NEK B;  1PGB A;  2I38 A;  4WH4 A;  4YTP B;  1JW9 D;  1KLG D;  4MM3 B;  2K3U A;  2JXT A;  2WXK A;  1FXA A;  4IKG A;  2V0G A;  1WU4 A;  3EU5 B;  2WXL A;  3PO0 A;  4B0E A;  2SQC A;  5HHD G;  3ZQ4 A;  4L2Y A;  4XDD A;  3EUV B;  3W7T A;  3D5S A;  4NAM A;  1UG9 A;  3ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...