2D5JA

Unsaturated glucuronyl hydrolase triggers hydration of vinyl ether group but not of glycosidic bond
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords unsaturated glucuronyl hydrolase
publication title Crystal Structure of Unsaturated Glucuronyl Hydrolase Complexed with Substrate: MOLECULAR INSIGHTS INTO ITS CATALYTIC REACTION MECHANISM
pubmed doi rcsb
source organism Bacillus sp.
total genus 159
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2005-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2d5jA00
3ANJA 4WVCA 1V7XA 1GLMA 2D5JA 2P0VA 2GH4A 3P2CA 1FO2A 5CA3A 3WC3A 5CD2A 3S4DA 2RGKA 4AYRA 3QFZA 1DL2A 2JF4A 3QRYA 1KRFA 1AGMA 4Q2BA 1G9JA 1L2AA 1WU5A 1GAIA 2YIKA 2XFGA 1IA7A 1KREA 3WKHA 2JJBA 3RRSA 4AYOA 5KKBA 3W7WA 3ACTA 1VD5A 4AYQA 4CJ1A 1TF4A 2GZ6A 1CLCA 1G9GA 1FO3A 1F9OA 3WKIA 2OKXA 2D8LA 1X9DA 2EABA 3S4BA 1F9DA 4WVAA 4TXTA 2ZZRA 2ZBLA 3GT5A 3S4AA 4AYPA 2DRQA 2NVPA 1UG9A 4WU0A 3WIWA 2F6DA 4Q88A 5MEHA 1V7WA 3QXQA 4EL8A 3H7LA 4CJ0A 2VN4A 2FUZA 1XWTA 3AFJA 3QPFA 4KTRA 5M7YA 3RSYA 3WIRA 3K11A 3W5MA 1KSCA 4KTPA 4WVBA 1FBOA 3VXDA 1XWQA 3ON6A 2EADA 5E2JA 1L1YA 3QWTA 2EAEA 1KS8A 1AYXA 4XUVA 3QT9A 1LF9A 4ZG8A 1KWFA 1V5DA 3S4CA 1FBWA 1G6IA 4CE7A 3W7TA 3QG0A 3WUXA 2CQTA 3TF4A 5GW7A 3GLYA 3QSPA 3RX7A 2FV1A 2FBAA 3WKGA 3ANKA 4FUSA 2JG0A 1DOGA 3WIQA 3RX5A 1V7VA 5CZLA 2AHFA 4L6XA 3H3KA 3QFYA 1K72A 3W5NA 3ANIA 1XW2A 1LF6A 1KFGA 2AHGA 3A3VA 3QDEA 4J5TA 4ZH5A 1JS4A 1H14A 2CQSA 1G87A 1ULVA 3RX8A 4DOEA 1WZZA 1FMIA 1KSDA 3EQAA 2VN7A 3VW5A 1WU6A 2DROA 1H12A 4Z4JA 2B4FA 3GZKA 2AFAA 1FAEA 1H54A 3E6UA 5DGQA 2WYNA 1IA6A 2EACA 2Z07A 1IS9A 4Z4LA 3QT3A 5DGRA 5M7IA 1GAHA 3CIHA 3EZ8A 2A8ZA 1UT9A 2RI8A 2DRRA 1GA2A 1NC5A 3D3IA 4TF4A 4L0GA 3WKFA 3T33A 3X17A 3W7SA 3H2WA 1WU4A 1FP3A 1HCUA 1KKTA 3PMMA 2QNOA 3W7UA 1FCEA 1V5CA 3E73A 5GY3A 1NXCA 2DRSA 3QXFA 4JJJA 1H13A 2RI9A 2FV0A 3ACSA 4DODA 3RENA 1CEMA 3W7XA 1RQ5A
chains in the Genus database with same CATH superfamily
3SFYB 1TNZB 1O6RA 4GTMB 2P0VA 1X1JA 5CA3A 4AYRA 1F9GA 5FO9B 4MMIA 4GAXA 1D8EB 1IA7A 1KREA 4YDOB 1H36A 3D5SA 3ACTA 1HMUA 4QT9A 3SQCA 1J0NA 4GTSB 3C72B 2OKXA 3Q79B 4MBGB 2H6GB 1W3YA 4E1YA 5JPNB 2ZZRA 2ZBLA 4AYPA 1UG9A 4Q88A 3SFXB 5EATA 2WY8A 1H39A 3AFJA 5M7YA 3WIRA 1CB8A 4KTPA 1XWQA 1GXMA 3ON6A 5E2JA 5FO7B 1L1YA 1LD8B 2EAEA 3DSXB 1AYXA 3SDVA 4XUVA 1D8DB 5JMFA 3Q73B 3M74A 3PYBA 3QG0A 3WUXA 3DSSB 3QSPA 2ZISB 1HX9A 3ANKA 4FUSA 3OXUA 1V7VA 1FT1B 2F0YB 1N4QB 1I8QA 3Q75B 3E7JA 1NL4B 3QFYA 1JCRB 3D5RA 3LZ9A 1KFGA 2AHGA 2V8JA 3M02A 4RNQA 1JS4A 2CQSA 4GL3A 4DOEA 2B39A 3RX8A 3M75A 5ILJA 4FXKB 4Z4JA 2WDAA 2EACA 1IS9A 3QT3A 5DGRA 1FPPB 5ILIA 5M7IA 2A8ZA 1C82A 2RI8A 1F1SA 3E32B 4TF4A 3T33A 3X17A 3SDRA 1FP3A 1HCUA 1FCEA 3E73A 5GY3A 2DRSA 3HXFB 2RI9A 2FV0A 1GSZA 1CEMA 3ANJA 3DRAB 1R76A 1GLMA 2NOJA 1W6JA 5ILHA 2GH4A 1W6KA 5DHKA 2V3NA 3S4DA 1KZPB 1N4SB 4YDEB 1N94B 2RGKA 4Q2BA 1WU5A 1QAZA 2YIKA 3M7EA 4AYOA 5KKBA 1HV6A 2GZ6A 1H3CA 1G9GA 1RWCA 1X1HA 3G4DA 2X03A 1N1ZA 3M7CA 3KSQB 2H6IB 2EABA 1O1TB 1S63B 3Q78B 2BBCA 4TXTA 3S4AA 4LNVA 2F6DA 5MEHA 3QXQA 4MU9A 2ONHA 4EL8A 1O6HA 4V1RA 2SQCA 3QPFA 4KTRA 3M01A 4D4AA 3K11A 3W5MA 1RWGA 4WVBA 3VXDA 5IK6A 4YCRA 2WY7A 3DPYB 1KS8A 3AFLA 1N95B 1G6IA 1GHQA 3W7TA 1N4RB 3RJ3A 3N0GA 5GW7A 3GLYA 5ILZA 3PZ4B 1LD7B 3M00A 2JG0A 1DOGA 3WIQA 1LTXB 2AHFA 4ONTA 1X1IA 1XW2A 3A3VA 1N7PA 4NEIA 4ZH5A 4FXGB 1G87A 1FMIA 1OJNA 3NNBA 1LXKA 1KSDA 1TN7B 3VW5A 4FNVA 1S64B 1TNYB 1TN8B 2AFAA 1FAEA 3E6UA 3HXBB 2WYNA 1IA6A 1H35A 3KLSA 2E24A 2G0DA 2H6FB 4Z4LA 1GAHA 5ILYA 3E33B 5C05A 3W7SA 4D94A 3H2WA 4V1SA 1WU4A 1X81B 5ILDA 1TNBB 3PMMA 1DCEB 1V5CA 2A73B 1NXCA 3QXFA 2H6HB 4DODA 3RENA 1RQ5A 3VSNA 3TF4A 1HXAA 4WVCA 3K7XA 1C3DA 4FJQA 4OZWA 2D5JA 3P2CA 5IKHA 3SDTA 1FO2A 1NI1B 3M77A 3QFZA 1DL2A 1KRFA 1G9JA 3G6JB 1HXGA 2XFGA 3N0FA 1KZOB 3Q7FB 3W7WA 5JPMB 3PZ2B 1N7OA 2FUQA 2PN5A 3A0OA 1TF4A 3E37B 1F9OA 3WKIA 1QQFA 3DSWB 2D8LA 3KQ4A 1X9DA 4LNGB 3DSVB 1N23A 3PZ3B 1O1SB 3SAEA 1F9DA 2J5CA 3GT5A 2DRQA 2NVPA 4WU0A 3WIWA 1J0MA 1RWFA 1V7WA 2R2LB 1EGUA 1RWHA 2VN4A 2FUZA 1XWTA 1N22A 2BRWA 3E30B 4GTRB 4GTOB 3QWTA 2BRVX 5EASA 1OJMA 1FT2B 3S4CA 5FO8B 1FBWA 1N9AB 3EU8A 4LIXA 2FV1A 4D4DA 1H3BA 2BB6A 1GXNA 5CZLA 1HN0A 1H37A 2G02A 3H3KA 3M72A 1K72A 2PMVA 3ANIA 5EAUA 3W5NA 1LF6A 3QDEA 5IM1A 1MZCB 3EU5B 1H14A 1ULVA 2GOXA 3Q7AB 3OEDA 2FUTA 1WZZA 1QSJA 3EQAA 3HXCB 2VN7A 2XWJB 1TN6B 2DROA 4OK4A 4MMHA 1O1RB 3GZKA 1H54A 3SDUA 1HM3A 3EUVB 2V8KA 3CIHA 4L9PB 3D3IA 3WKFA 1N1BA 2E22A 5ILKA 4F10A 3M7LA 1KKTA 1N24A 3W7UA 4BOJA 1N20A 3DSTB 1N21A 4OZVA 1JCQB 1H13A 3ACSA 4GTPB 4EHMB 3NFVA 3WKGA 1N7NA 2Q1FA 1V7XA 2WCOA 3HXEB 3WC3A 5IK0A 5CD2A 3M78A 1N7RA 2JF4A 3QRYA 1AGMA 3P5RA 1L2AA 2ONGA 1GAIA 1O5MB 1HXCA 3WKHA 4LNBB 2JJBA 3RRSA 4KKIA 1VD5A 2IEJB 4AYQA 4BOKA 1SA4B 4ZH1A 3S9VA 4CJ1A 1CLCA 1FO3A 1HMWA 1GXOA 3HXDB 3S4BA 5IL3A 4WVAA 4C1SA 1UMPA 1N4PB 3KSLB 4ZRPA 4GTQB 2XWBB 3E34B 1HM2A 5IL8A 4D4CA 3M76A 1QBQB 1TNOB 3M73A 4OJZA 3H7LA 3G4FA 4CJ0A 3RSYA 5GZKA 1KSCA 1FBOA 2EADA 3M71A 3QT9A 1LF9A 1O79A 4ZG8A 1KWFA 1V5DA 4CE7A 1O6QA 2CQTA 1OJPA 1RWAA 2WINB 3RX7A 2BEDB 2FBAA 3RX5A 3E80A 3PYAA 2I07B 5JMDA 5IK9A 5IKAA 4F13A 4L6XA 1SA5B 2V3PA 1HZFA 4J5TA 3VSMA 2BRPA 3M7BA 4KKJA 4M76A 1WU6A 4D4BA 3DSUB 1SQCA 5DHIA 4ZRQA 1H12A 2B4FA 3SDQA 2ZIRB 5DGQA 1LXMA 2V8IA 2WIIB 2Z07A 3CU7A 5FOBB 1TNUB 3P5PA 1H3AA 1OJOA 1JCSB 3EZ8A 2BB5A 1UT9A 2XQWA 2DRRA 4DI5A 1GA2A 1NC5A 4GTVB 4L0GA 1N7QA 5AGDA 2QNOA 4OK2A 3PZ1B 1LOHA 1RW9A 4JJJA 4GTTB 3W7XA
chains in the Genus database with same CATH topology
3SFYB 1TNZB 1O6RA 4GTMB 2P0VA 5CA3A 4AYRA 5FO9B 1D8EB 1IA7A 1KREA 4YDOB 1H36A 3D5SA 3ACTA 4QT9A 3SQCA 4GTSB 3C72B 2OKXA 3Q79B 4MBGB 2H6GB 5JPNB 2ZZRA 2ZBLA 4AYPA 1UG9A 4Q88A 3SFXB 2WY8A 1H39A 3AFJA 5M7YA 3WIRA 4KTPA 1XWQA 1GXMA 3ON6A 5E2JA 5FO7B 1L1YA 1LD8B 2EAEA 3DSXB 1AYXA 3SDVA 4XUVA 1D8DB 3Q73B 3M74A 3PYBA 3QG0A 3WUXA 3DSSB 3QSPA 2ZISB 3ANKA 4FUSA 3OXUA 1V7VA 1FT1B 2F0YB 1N4QB 3Q75B 1NL4B 3QFYA 1JCRB 3D5RA 1KFGA 2AHGA 2V8JA 1JS4A 2CQSA 4GL3A 4DOEA 2B39A 3RX8A 3M75A 4FXKB 4Z4JA 2EACA 1IS9A 3QT3A 5DGRA 1FPPB 5M7IA 2A8ZA 2RI8A 3E32B 4TF4A 3T33A 3X17A 3SDRA 1FP3A 1HCUA 1FCEA 3E73A 5GY3A 2DRSA 3HXFB 2RI9A 2FV0A 1GSZA 1CEMA 3ANJA 3DRAB 1R76A 1GLMA 2NOJA 1W6JA 2GH4A 1W6KA 2V3NA 3S4DA 1KZPB 1N4SB 4YDEB 1N94B 2RGKA 4Q2BA 1WU5A 2YIKA 3M7EA 4AYOA 5KKBA 2GZ6A 1H3CA 1G9GA 3M7CA 3KSQB 2H6IB 2EABA 1O1TB 1S63B 3Q78B 2BBCA 4TXTA 3S4AA 4LNVA 2F6DA 5MEHA 3QXQA 4MU9A 4EL8A 1O6HA 4V1RA 2SQCA 3QPFA 4KTRA 4D4AA 3K11A 3W5MA 4WVBA 3VXDA 4YCRA 2WY7A 3DPYB 1KS8A 1N95B 1G6IA 1GHQA 3W7TA 1N4RB 3RJ3A 5GW7A 3GLYA 3PZ4B 1LD7B 2JG0A 1DOGA 3WIQA 1LTXB 2AHFA 4ONTA 1XW2A 3A3VA 4ZH5A 4FXGB 1G87A 1FMIA 1KSDA 1TN7B 3VW5A 1S64B 3HXBB 1TNYB 1TN8B 2AFAA 1FAEA 3E6UA 2WYNA 1IA6A 1H35A 3KLSA 2G0DA 2H6FB 4Z4LA 1GAHA 3E33B 3W7SA 4D94A 3H2WA 4V1SA 1WU4A 1X81B 1TNBB 3PMMA 1DCEB 1V5CA 2A73B 1NXCA 3QXFA 2H6HB 4DODA 3RENA 1RQ5A 3TF4A 4WVCA 3K7XA 1C3DA 2D5JA 3P2CA 3SDTA 1FO2A 1NI1B 3M77A 3QFZA 1DL2A 1KRFA 1G9JA 3G6JB 2XFGA 1KZOB 3Q7FB 3W7WA 5JPMB 3PZ2B 2PN5A 1TF4A 3E37B 1F9OA 3WKIA 1QQFA 3DSWB 2D8LA 3KQ4A 1X9DA 4LNGB 3DSVB 3PZ3B 1O1SB 3SAEA 1F9DA 3GT5A 2DRQA 2NVPA 4WU0A 3WIWA 1V7WA 2R2LB 2VN4A 2FUZA 1XWTA 3E30B 4GTRB 4GTOB 3QWTA 1FT2B 3S4CA 5FO8B 1FBWA 1N9AB 3EU8A 4LIXA 2FV1A 4D4DA 1H3BA 2BB6A 1GXNA 5CZLA 1H37A 2G02A 3H3KA 3M72A 1K72A 2PMVA 3ANIA 3W5NA 1LF6A 3QDEA 1MZCB 3EU5B 1H14A 1ULVA 2GOXA 3Q7AB 3OEDA 1WZZA 1QSJA 3EQAA 3HXCB 2VN7A 2XWJB 1TN6B 2DROA 1O1RB 3GZKA 1H54A 3SDUA 3EUVB 2V8KA 3CIHA 4L9PB 3D3IA 3WKFA 3M7LA 1KKTA 3W7UA 4BOJA 3DSTB 1JCQB 1H13A 3ACSA 4GTPB 4EHMB 3WKGA 1V7XA 3HXEB 3WC3A 5CD2A 3M78A 2JF4A 3QRYA 1AGMA 3P5RA 1L2AA 1GAIA 1O5MB 3WKHA 4LNBB 2JJBA 3RRSA 4KKIA 1VD5A 2IEJB 4AYQA 4BOKA 1SA4B 4ZH1A 3S9VA 4CJ1A 1CLCA 1FO3A 1GXOA 3HXDB 3S4BA 4WVAA 4C1SA 1UMPA 1N4PB 3KSLB 4ZRPA 4GTQB 2XWBB 3E34B 4D4CA 3M76A 1QBQB 1TNOB 3M73A 3H7LA 4CJ0A 3RSYA 5GZKA 1KSCA 1FBOA 2EADA 3M71A 3QT9A 1LF9A 1O79A 4ZG8A 1KWFA 1V5DA 4CE7A 1O6QA 2CQTA 2WINB 3RX7A 2BEDB 2FBAA 3RX5A 3PYAA 2I07B 4L6XA 1SA5B 2V3PA 1HZFA 4J5TA 3M7BA 4KKJA 4M76A 1WU6A 4D4BA 3DSUB 1SQCA 4ZRQA 1H12A 2B4FA 3SDQA 2ZIRB 5DGQA 2V8IA 2WIIB 2Z07A 3CU7A 5FOBB 1TNUB 3P5PA 1H3AA 1JCSB 3EZ8A 2BB5A 1UT9A 2XQWA 2DRRA 1GA2A 1NC5A 4GTVB 4L0GA 5AGDA 2QNOA 3PZ1B 4JJJA 4GTTB 3W7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANJ A;  4WVC A;  1V7X A;  1GLM A;  2D5J A;  2P0V A;  2GH4 A;  3P2C A;  1FO2 A;  5CA3 A;  3WC3 A;  5CD2 A;  3S4D A;  2RGK A;  4AYR A;  3QFZ A;  1DL2 A;  2JF4 A;  3QRY A;  1KRF A;  1AGM A;  4Q2B A;  1G9J A;  1L2A A;  1WU5 A;  1GAI A;  2YIK A;  2XFG A;  1IA7 A;  1KRE A;  3WKH A;  2JJB A;  3RRS A;  4AYO A;  5KKB A;  3W7W A;  3ACT A;  1VD5 A;  4AYQ A;  4CJ1 A;  1TF4 A;  2GZ6 A;  1CLC A;  1G9G A;  1FO3 A;  1F9O A;  3WKI A;  2OKX A;  2D8L A;  1X9D A;  2EAB A;  3S4B A;  1F9D A;  4WVA A;  4TXT A;  2ZZR A;  2ZBL A;  3GT5 A;  3S4A A;  4AYP A;  2DRQ A;  2NVP A;  1UG9 A;  4WU0 A;  3WIW A;  2F6D A;  4Q88 A;  5MEH A;  1V7W A;  3QXQ A;  4EL8 A;  3H7L A;  4CJ0 A;  2VN4 A;  2FUZ A;  1XWT A;  3AFJ A;  3QPF A;  4KTR A;  5M7Y A;  3RSY A;  3WIR A;  3K11 A;  3W5M A;  1KSC A;  4KTP A;  4WVB A;  1FBO A;  3VXD A;  1XWQ A;  3ON6 A;  2EAD A;  5E2J A;  1L1Y A;  3QWT A;  2EAE A;  1KS8 A;  1AYX A;  4XUV A;  3QT9 A;  1LF9 A;  4ZG8 A;  1KWF A;  1V5D A;  3S4C A;  1FBW A;  1G6I A;  4CE7 A;  3W7T A;  3QG0 A;  3WUX A;  2CQT A;  3TF4 A;  5GW7 A;  3GLY A;  3QSP A;  3RX7 A;  2FV1 A;  2FBA A;  3WKG A;  3ANK A;  4FUS A;  2JG0 A;  1DOG A;  3WIQ A;  3RX5 A;  1V7V A;  5CZL A;  2AHF A;  4L6X A;  3H3K A;  3QFY A;  1K72 A;  3W5N A;  3ANI A;  1XW2 A;  1LF6 A;  1KFG A;  2AHG A;  3A3V A;  3QDE A;  4J5T A;  4ZH5 A;  1JS4 A;  1H14 A;  2CQS A;  1G87 A;  1ULV A;  3RX8 A;  4DOE A;  1WZZ A;  1FMI A;  1KSD A;  3EQA A;  2VN7 A;  3VW5 A;  1WU6 A;  2DRO A;  1H12 A;  4Z4J A;  2B4F A;  3GZK A;  2AFA A;  1FAE A;  1H54 A;  3E6U A;  5DGQ A;  2WYN A;  1IA6 A;  2EAC A;  2Z07 A;  1IS9 A;  4Z4L A;  3QT3 A;  5DGR A;  5M7I A;  1GAH A;  3CIH A;  3EZ8 A;  2A8Z A;  1UT9 A;  2RI8 A;  2DRR A;  1GA2 A;  1NC5 A;  3D3I A;  4TF4 A;  4L0G A;  3WKF A;  3T33 A;  3X17 A;  3W7S A;  3H2W A;  1WU4 A;  1FP3 A;  1HCU A;  1KKT A;  3PMM A;  2QNO A;  3W7U A;  1FCE A;  1V5C A;  3E73 A;  5GY3 A;  1NXC A;  2DRS A;  3QXF A;  4JJJ A;  1H13 A;  2RI9 A;  2FV0 A;  3ACS A;  4DOD A;  3REN A;  1CEM A;  3W7X A;  1RQ5 A; 
#chains in the Genus database with same CATH topology
 3SFY B;  1TNZ B;  1O6R A;  4GTM B;  2P0V A;  1X1J A;  5CA3 A;  4AYR A;  1F9G A;  5FO9 B;  4MMI A;  4GAX A;  1D8E B;  1IA7 A;  1KRE A;  4YDO B;  1H36 A;  3D5S A;  3ACT A;  1HMU A;  4QT9 A;  3SQC A;  1J0N A;  4GTS B;  3C72 B;  2OKX A;  3Q79 B;  4MBG B;  2H6G B;  1W3Y A;  4E1Y A;  5JPN B;  2ZZR A;  2ZBL A;  4AYP A;  1UG9 A;  4Q88 A;  3SFX B;  5EAT A;  2WY8 A;  1H39 A;  3AFJ A;  5M7Y A;  3WIR A;  1CB8 A;  4KTP A;  1XWQ A;  1GXM A;  3ON6 A;  5E2J A;  5FO7 B;  1L1Y A;  1LD8 B;  2EAE A;  3DSX B;  1AYX A;  3SDV A;  4XUV A;  1D8D B;  5JMF A;  3Q73 B;  3M74 A;  3PYB A;  3QG0 A;  3WUX A;  3DSS B;  3QSP A;  2ZIS B;  1HX9 A;  3ANK A;  4FUS A;  3OXU A;  1V7V A;  1FT1 B;  2F0Y B;  1N4Q B;  1I8Q A;  3Q75 B;  3E7J A;  1NL4 B;  3QFY A;  1JCR B;  3D5R A;  3LZ9 A;  1KFG A;  2AHG A;  2V8J A;  3M02 A;  4RNQ A;  1JS4 A;  2CQS A;  4GL3 A;  4DOE A;  2B39 A;  3RX8 A;  3M75 A;  5ILJ A;  4FXK B;  4Z4J A;  2WDA A;  2EAC A;  1IS9 A;  3QT3 A;  5DGR A;  1FPP B;  5ILI A;  5M7I A;  2A8Z A;  1C82 A;  2RI8 A;  1F1S A;  3E32 B;  4TF4 A;  3T33 A;  3X17 A;  3SDR A;  1FP3 A;  1HCU A;  1FCE A;  3E73 A;  5GY3 A;  2DRS A;  3HXF B;  2RI9 A;  2FV0 A;  1GSZ A;  1CEM A;  3ANJ A;  3DRA B;  1R76 A;  1GLM A;  2NOJ A;  1W6J A;  5ILH A;  2GH4 A;  1W6K A;  5DHK A;  2V3N A;  3S4D A;  1KZP B;  1N4S B;  4YDE B;  1N94 B;  2RGK A;  4Q2B A;  1WU5 A;  1QAZ A;  2YIK A;  3M7E A;  4AYO A;  5KKB A;  1HV6 A;  2GZ6 A;  1H3C A;  1G9G A;  1RWC A;  1X1H A;  3G4D A;  2X03 A;  1N1Z A;  3M7C A;  3KSQ B;  2H6I B;  2EAB A;  1O1T B;  1S63 B;  3Q78 B;  2BBC A;  4TXT A;  3S4A A;  4LNV A;  2F6D A;  5MEH A;  3QXQ A;  4MU9 A;  2ONH A;  4EL8 A;  1O6H A;  4V1R A;  2SQC A;  3QPF A;  4KTR A;  3M01 A;  4D4A A;  3K11 A;  3W5M A;  1RWG A;  4WVB A;  3VXD A;  5IK6 A;  4YCR A;  2WY7 A;  3DPY B;  1KS8 A;  3AFL A;  1N95 B;  1G6I A;  1GHQ A;  3W7T A;  1N4R B;  3RJ3 A;  3N0G A;  5GW7 A;  3GLY A;  5ILZ A;  3PZ4 B;  1LD7 B;  3M00 A;  2JG0 A;  1DOG A;  3WIQ A;  1LTX B;  2AHF A;  4ONT A;  1X1I A;  1XW2 A;  3A3V A;  1N7P A;  4NEI A;  4ZH5 A;  4FXG B;  1G87 A;  1FMI A;  1OJN A;  3NNB A;  1LXK A;  1KSD A;  1TN7 B;  3VW5 A;  4FNV A;  1S64 B;  1TNY B;  1TN8 B;  2AFA A;  1FAE A;  3E6U A;  3HXB B;  2WYN A;  1IA6 A;  1H35 A;  3KLS A;  2E24 A;  2G0D A;  2H6F B;  4Z4L A;  1GAH A;  5ILY A;  3E33 B;  5C05 A;  3W7S A;  4D94 A;  3H2W A;  4V1S A;  1WU4 A;  1X81 B;  5ILD A;  1TNB B;  3PMM A;  1DCE B;  1V5C A;  2A73 B;  1NXC A;  3QXF A;  2H6H B;  4DOD A;  3REN A;  1RQ5 A;  3VSN A;  3TF4 A;  1HXA A;  4WVC A;  3K7X A;  1C3D A;  4FJQ A;  4OZW A;  2D5J A;  3P2C A;  5IKH A;  3SDT A;  1FO2 A;  1NI1 B;  3M77 A;  3QFZ A;  1DL2 A;  1KRF A;  1G9J A;  3G6J B;  1HXG A;  2XFG A;  3N0F A;  1KZO B;  3Q7F B;  3W7W A;  5JPM B;  3PZ2 B;  1N7O A;  2FUQ A;  2PN5 A;  3A0O A;  1TF4 A;  3E37 B;  1F9O A;  3WKI A;  1QQF A;  3DSW B;  2D8L A;  3KQ4 A;  1X9D A;  4LNG B;  3DSV B;  1N23 A;  3PZ3 B;  1O1S B;  3SAE A;  1F9D A;  2J5C A;  3GT5 A;  2DRQ A;  2NVP A;  4WU0 A;  3WIW A;  1J0M A;  1RWF A;  1V7W A;  2R2L B;  1EGU A;  1RWH A;  2VN4 A;  2FUZ A;  1XWT A;  1N22 A;  2BRW A;  3E30 B;  4GTR B;  4GTO B;  3QWT A;  2BRV X;  5EAS A;  1OJM A;  1FT2 B;  3S4C A;  5FO8 B;  1FBW A;  1N9A B;  3EU8 A;  4LIX A;  2FV1 A;  4D4D A;  1H3B A;  2BB6 A;  1GXN A;  5CZL A;  1HN0 A;  1H37 A;  2G02 A;  3H3K A;  3M72 A;  1K72 A;  2PMV A;  3ANI A;  5EAU A;  3W5N A;  1LF6 A;  3QDE A;  5IM1 A;  1MZC B;  3EU5 B;  1H14 A;  1ULV A;  2GOX A;  3Q7A B;  3OED A;  2FUT A;  1WZZ A;  1QSJ A;  3EQA A;  3HXC B;  2VN7 A;  2XWJ B;  1TN6 B;  2DRO A;  4OK4 A;  4MMH A;  1O1R B;  3GZK A;  1H54 A;  3SDU A;  1HM3 A;  3EUV B;  2V8K A;  3CIH A;  4L9P B;  3D3I A;  3WKF A;  1N1B A;  2E22 A;  5ILK A;  4F10 A;  3M7L A;  1KKT A;  1N24 A;  3W7U A;  4BOJ A;  1N20 A;  3DST B;  1N21 A;  4OZV A;  1JCQ B;  1H13 A;  3ACS A;  4GTP B;  4EHM B;  3NFV A;  3WKG A;  1N7N A;  2Q1F A;  1V7X A;  2WCO A;  3HXE B;  3WC3 A;  5IK0 A;  5CD2 A;  3M78 A;  1N7R A;  2JF4 A;  3QRY A;  1AGM A;  3P5R A;  1L2A A;  2ONG A;  1GAI A;  1O5M B;  1HXC A;  3WKH A;  4LNB B;  2JJB A;  3RRS A;  4KKI A;  1VD5 A;  2IEJ B;  4AYQ A;  4BOK A;  1SA4 B;  4ZH1 A;  3S9V A;  4CJ1 A;  1CLC A;  1FO3 A;  1HMW A;  1GXO A;  3HXD B;  3S4B A;  5IL3 A;  4WVA A;  4C1S A;  1UMP A;  1N4P B;  3KSL B;  4ZRP A;  4GTQ B;  2XWB B;  3E34 B;  1HM2 A;  5IL8 A;  4D4C A;  3M76 A;  1QBQ B;  1TNO B;  3M73 A;  4OJZ A;  3H7L A;  3G4F A;  4CJ0 A;  3RSY A;  5GZK A;  1KSC A;  1FBO A;  2EAD A;  3M71 A;  3QT9 A;  1LF9 A;  1O79 A;  4ZG8 A;  1KWF A;  1V5D A;  4CE7 A;  1O6Q A;  2CQT A;  1OJP A;  1RWA A;  2WIN B;  3RX7 A;  2BED B;  2FBA A;  3RX5 A;  3E80 A;  3PYA A;  2I07 B;  5JMD A;  5IK9 A;  5IKA A;  4F13 A;  4L6X A;  1SA5 B;  2V3P A;  1HZF A;  4J5T A;  3VSM A;  2BRP A;  3M7B A;  4KKJ A;  4M76 A;  1WU6 A;  4D4B A;  3DSU B;  1SQC A;  5DHI A;  4ZRQ A;  1H12 A;  2B4F A;  3SDQ A;  2ZIR B;  5DGQ A;  1LXM A;  2V8I A;  2WII B;  2Z07 A;  3CU7 A;  5FOB B;  1TNU B;  3P5P A;  1H3A A;  1OJO A;  1JCS B;  3EZ8 A;  2BB5 A;  1UT9 A;  2XQW A;  2DRR A;  4DI5 A;  1GA2 A;  1NC5 A;  4GTV B;  4L0G A;  1N7Q A;  5AGD A;  2QNO A;  4OK2 A;  3PZ1 B;  1LOH A;  1RW9 A;  4JJJ A;  4GTT B;  3W7X A; 
#chains in the Genus database with same CATH homology
 3SFY B;  1TNZ B;  1O6R A;  4GTM B;  2P0V A;  5CA3 A;  4AYR A;  5FO9 B;  1D8E B;  1IA7 A;  1KRE A;  4YDO B;  1H36 A;  3D5S A;  3ACT A;  4QT9 A;  3SQC A;  4GTS B;  3C72 B;  2OKX A;  3Q79 B;  4MBG B;  2H6G B;  5JPN B;  2ZZR A;  2ZBL A;  4AYP A;  1UG9 A;  4Q88 A;  3SFX B;  2WY8 A;  1H39 A;  3AFJ A;  5M7Y A;  3WIR A;  4KTP A;  1XWQ A;  1GXM A;  3ON6 A;  5E2J A;  5FO7 B;  1L1Y A;  1LD8 B;  2EAE A;  3DSX B;  1AYX A;  3SDV A;  4XUV A;  1D8D B;  3Q73 B;  3M74 A;  3PYB A;  3QG0 A;  3WUX A;  3DSS B;  3QSP A;  2ZIS B;  3ANK A;  4FUS A;  3OXU A;  1V7V A;  1FT1 B;  2F0Y B;  1N4Q B;  3Q75 B;  1NL4 B;  3QFY A;  1JCR B;  3D5R A;  1KFG A;  2AHG A;  2V8J A;  1JS4 A;  2CQS A;  4GL3 A;  4DOE A;  2B39 A;  3RX8 A;  3M75 A;  4FXK B;  4Z4J A;  2EAC A;  1IS9 A;  3QT3 A;  5DGR A;  1FPP B;  5M7I A;  2A8Z A;  2RI8 A;  3E32 B;  4TF4 A;  3T33 A;  3X17 A;  3SDR A;  1FP3 A;  1HCU A;  1FCE A;  3E73 A;  5GY3 A;  2DRS A;  3HXF B;  2RI9 A;  2FV0 A;  1GSZ A;  1CEM A;  3ANJ A;  3DRA B;  1R76 A;  1GLM A;  2NOJ A;  1W6J A;  2GH4 A;  1W6K A;  2V3N A;  3S4D A;  1KZP B;  1N4S B;  4YDE B;  1N94 B;  2RGK A;  4Q2B A;  1WU5 A;  2YIK A;  3M7E A;  4AYO A;  5KKB A;  2GZ6 A;  1H3C A;  1G9G A;  3M7C A;  3KSQ B;  2H6I B;  2EAB A;  1O1T B;  1S63 B;  3Q78 B;  2BBC A;  4TXT A;  3S4A A;  4LNV A;  2F6D A;  5MEH A;  3QXQ A;  4MU9 A;  4EL8 A;  1O6H A;  4V1R A;  2SQC A;  3QPF A;  4KTR A;  4D4A A;  3K11 A;  3W5M A;  4WVB A;  3VXD A;  4YCR A;  2WY7 A;  3DPY B;  1KS8 A;  1N95 B;  1G6I A;  1GHQ A;  3W7T A;  1N4R B;  3RJ3 A;  5GW7 A;  3GLY A;  3PZ4 B;  1LD7 B;  2JG0 A;  1DOG A;  3WIQ A;  1LTX B;  2AHF A;  4ONT A;  1XW2 A;  3A3V A;  4ZH5 A;  4FXG B;  1G87 A;  1FMI A;  1KSD A;  1TN7 B;  3VW5 A;  1S64 B;  3HXB B;  1TNY B;  1TN8 B;  2AFA A;  1FAE A;  3E6U A;  2WYN A;  1IA6 A;  1H35 A;  3KLS A;  2G0D A;  2H6F B;  4Z4L A;  1GAH A;  3E33 B;  3W7S A;  4D94 A;  3H2W A;  4V1S A;  1WU4 A;  1X81 B;  1TNB B;  3PMM A;  1DCE B;  1V5C A;  2A73 B;  1NXC A;  3QXF A;  2H6H B;  4DOD A;  3REN A;  1RQ5 A;  3TF4 A;  4WVC A;  3K7X A;  1C3D A;  2D5J A;  3P2C A;  3SDT A;  1FO2 A;  1NI1 B;  3M77 A;  3QFZ A;  1DL2 A;  1KRF A;  1G9J A;  3G6J B;  2XFG A;  1KZO B;  3Q7F B;  3W7W A;  5JPM B;  3PZ2 B;  2PN5 A;  1TF4 A;  3E37 B;  1F9O A;  3WKI A;  1QQF A;  3DSW B;  2D8L A;  3KQ4 A;  1X9D A;  4LNG B;  3DSV B;  3PZ3 B;  1O1S B;  3SAE A;  1F9D A;  3GT5 A;  2DRQ A;  2NVP A;  4WU0 A;  3WIW A;  1V7W A;  2R2L B;  2VN4 A;  2FUZ A;  1XWT A;  3E30 B;  4GTR B;  4GTO B;  3QWT A;  1FT2 B;  3S4C A;  5FO8 B;  1FBW A;  1N9A B;  3EU8 A;  4LIX A;  2FV1 A;  4D4D A;  1H3B A;  2BB6 A;  1GXN A;  5CZL A;  1H37 A;  2G02 A;  3H3K A;  3M72 A;  1K72 A;  2PMV A;  3ANI A;  3W5N A;  1LF6 A;  3QDE A;  1MZC B;  3EU5 B;  1H14 A;  1ULV A;  2GOX A;  3Q7A B;  3OED A;  1WZZ A;  1QSJ A;  3EQA A;  3HXC B;  2VN7 A;  2XWJ B;  1TN6 B;  2DRO A;  1O1R B;  3GZK A;  1H54 A;  3SDU A;  3EUV B;  2V8K A;  3CIH A;  4L9P B;  3D3I A;  3WKF A;  3M7L A;  1KKT A;  3W7U A;  4BOJ A;  3DST B;  1JCQ B;  1H13 A;  3ACS A;  4GTP B;  4EHM B;  3WKG A;  1V7X A;  3HXE B;  3WC3 A;  5CD2 A;  3M78 A;  2JF4 A;  3QRY A;  1AGM A;  3P5R A;  1L2A A;  1GAI A;  1O5M B;  3WKH A;  4LNB B;  2JJB A;  3RRS A;  4KKI A;  1VD5 A;  2IEJ B;  4AYQ A;  4BOK A;  1SA4 B;  4ZH1 A;  3S9V A;  4CJ1 A;  1CLC A;  1FO3 A;  1GXO A;  3HXD B;  3S4B A;  4WVA A;  4C1S A;  1UMP A;  1N4P B;  3KSL B;  4ZRP A;  4GTQ B;  2XWB B;  3E34 B;  4D4C A;  3M76 A;  1QBQ B;  1TNO B;  3M73 A;  3H7L A;  4CJ0 A;  3RSY A;  5GZK A;  1KSC A;  1FBO A;  2EAD A;  3M71 A;  3QT9 A;  1LF9 A;  1O79 A;  4ZG8 A;  1KWF A;  1V5D A;  4CE7 A;  1O6Q A;  2CQT A;  2WIN B;  3RX7 A;  2BED B;  2FBA A;  3RX5 A;  3PYA A;  2I07 B;  4L6X A;  1SA5 B;  2V3P A;  1HZF A;  4J5T A;  3M7B A;  4KKJ A;  4M76 A;  1WU6 A;  4D4B A;  3DSU B;  1SQC A;  4ZRQ A;  1H12 A;  2B4F A;  3SDQ A;  2ZIR B;  5DGQ A;  2V8I A;  2WII B;  2Z07 A;  3CU7 A;  5FOB B;  1TNU B;  3P5P A;  1H3A A;  1JCS B;  3EZ8 A;  2BB5 A;  1UT9 A;  2XQW A;  2DRR A;  1GA2 A;  1NC5 A;  4GTV B;  4L0G A;  5AGD A;  2QNO A;  3PZ1 B;  4JJJ A;  4GTT B;  3W7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...