4GAXA

Crystal structure of an alpha-bisabolol synthase mutant
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
534
structure length
525
Chain Sequence
ANFSPSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGARSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRNLMVEAQWANEGHIPTTEELDSVAVITGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAAKDAFTAMGEEYKNLVKSLLVYPMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
total genus 202
structure length 525
sequence length 534
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4gaxA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4gaxA02
5HN8A 2F94F 1WMWA 3LVSA 2Z4XA 4OGUA 1WL1A 3OABB 4P0WA 4LIXA 4LPHF 5DGMF 5IL3A 3VJEA 1N22A 3KRPA 1N20A 3PYAA 4LPGF 4JYXA 3N49F 3B7LA 3ACWA 1HXGA 3N45F 3WCAA 5H9DA 2Z7HA 3ICMA 5HNAA 5EATA 2ONGA 3WC9A 5A0JA 5ILIA 4GP1A 4MC3A 4MC0A 3WJNA 4F6XA 1YYQA 3CC9A 3NPRA 5DW7A 4F62A 3S4JA 4RXCA 3ZCDA 3QQVA 5JV0F 1UBXA 4DI5A 3KRFB 3LG5A 2J1PA 3BNYA 4XQTF 5ILKA 3DYGA 4DEMF 3M02A 3DYHA 5B0KA 2OGDA 2AETA 3SDUA 1KIZA 5ILZA 1YHMA 4RYPA 1UBWA 4LTVA 3ZMBA 1N1BA 2F9KF 5IL8A 5I1UA 2Q9YA 1YV5A 4LA6A 4GA3A 4NFIF 4OKMA 1RQJA 2E4OA 2ZEVA 4LA5A 4LLSA 5DJRF 3ZL6A 3CKEA 4LZ3A 4JVJF 3N6KF 3P41A 5AELA 2PS6A 1JFAA 5IKHA 4EA2A 2ZCSA 4NG6A 4KQUA 3WCFA 4LZCA 4KPDA 3PDEA 5IK0A 3Q30A 3CP6A 5DHKA 3LSNA 3OABA 3PYBA 1YQ7A 3RYEA 5IN8A 4FJQA 3IBAA 3W7FA 5JV1F 4LZ0A 4RXEA 5DGSF 3LZ9A 4LUUA 3WCCA 2OPNA 3PH7A 2Z7IA 3M0GA 3M00A 1RTRA 1V4EA 2FORA 3AQBB 4KVIA 3WCJA 2ONHA 3WEHA 1ZW5A 2Z78A 3KROB 1HM4A 2F8ZF 1HXAA 3KRFA 4GAXA 5ILHA 3ID0A 3ICKA 3TFNA 2E8WA 4NFKF 4N9UA 1N24A 4K10A 4XQSF 2E8XA 3LLWA 3AE0A 1PS1A 3LMDA 1DI1A 4KK2A 4HD1A 3LOMA 3P8RA 1VG4A 4N1ZF 3WCGA 4KFAA 3LGKA 2E93A 4DHDA 3LEEA 2Z4VA 3OACB 1RQIA 3WCIA 2F89F 1N23A 3QKCA 4MC8A 3APZA 2Z4YA 4PVYF 4OMHA 4JZXA 3AQ0A 4ZQ8A 2I19A 4OMGA 3ZMCA 1V4IA 5AFXA 2Z50A 2AZKA 3VJ9A 4KPJA 1DGPA 1KIYA 5IMIA 5JUZF 1FPSA 2J5CA 3G4FA 3N3LF 4RXAA 1HXCA 3WJKA 3TFPA 4LFGA 1YYTA 1WL3A 1EZFA 5EROA 2PS7A 4E9UA 5ER8A 3V1VA 5EAUA 3WCMA 1V4HA 4KQSA 4EA1A 4JXNA 3P5RA 3SDQA 5B0LA 5IMPA 2P1CA 5EASA 1YYUA 4WK5A 2E90A 1UBYA 3KRAB 1YHKA 4JZBA 3BNXA 2EWGA 3ZOUA 2F92F 3WEFA 3LDWA 5KSXF 3SDTA 2J1OA 5B0JA 3RYWA 2FTZA 3SDRA 3P5PA 2F7MF 3S9VA 5B02A 5CG6A 1V4KA 3N1VF 2VF6A 4QPFA 3WEGA 1WL0A 4F6VA 3KROA 4KWDA 2Z4WA 4LFEA 3WE9A 5IMNA 5IK9A 3KB9A 3RMGA 3LJIA 3TS7A 3WEIA 5E8HA 4RXDA 3N0FA 2RAHA 3LK5A 3NF2A 3VJDA 2OA6A 4DZWA 3VJ8A 4E9ZA 1VG7A 4KKMA 3P8LA 3OACA 3KRCB 2Q9ZA 5B00A 5ERNA 3WEKA 5A0IA 4KQ5A 3WEJA 4EA0A 5DGNF 3NPKA 4NUAA 2PS5A 2E95A 3RBMA 2F8CF 4KVWA 4L2XF 5DJVF 4NKEA 4DXJA 2Z4ZA 4UMJA 5E8KA 2H8OA 3N0GA 5E8LA 5ILDA 2E8VA 2AZLA 2PS8A 3SAEA 5ILJA 3WCHA 2ZCOA 2E8TA 3EZ3A 5AHUB 3PKOA 3ASXA 2Q80A 5HN9A 1V4JA 4QXSF 5IVGA 3VJAA 4GP2A 3ICNA 1N21A 3LGZB 3WSBA 3DYFA 4LFVF 3KRAA 2AZJA 3WCBA 3OYRA 5B0MA 2OPMA 4RNQA 2AEKA 2E94A 5CG5A 5IKAA 2ZEUA 5A0KA 4LOBA 4JXYA 2E92A 3Q1OA 3UCAA 2PS4A 3N46F 3KRPB 3M9UA 3TC1A 5HN7A 5IK6A 3VJBA 4OKZA 2DH4A 1HX9A 1WL2A 3N5HF 2ZY1A 1VG6A 1WY0A 3G4DA 5ERMA 3M01A 3N1WF 4Q23A 3WJOA 1VG2A 1JFGA 3WCEA 4NFJF 1HM7A 3ADZA 3WCLA 3NRIA 5B01A 3V66A 5C05A 3VJCA 3TFVA 5DHIA 3SDVA 3KRCA 3MZVA 1YYRA 3IPIA 4KUXA 1VG3A 3WCDA 3ACYA 4P0XA 5ILYA 3N5JF 1N1ZA 4LXWA 2E91A 4KVYA 5AYPA 4H5CF 1YYSA 2QISA 1WKZA 3ACXA 5JV2F 3ICZA 3Q2QA 3EFQA 3EGTA 1YHLA 3MAVA 5DZ2A 4KVDA 3AQCB 4E1EA 5B03A 5JA0F 4LLTA 4P0VA 5DIQF 4LTZA 4H5DF 1YJ4A 3N3DA 5B0IA 3WSAA 2Z52A 4FP4A 3V1XA 2O1OA 4XQRF 2ZCQA 4NKFA 4PVXF 5DJPF 1UBVA 2Q58A 2AELA 5IM1A 3KBKA 4H5EF 4DWGA 4DWBA 3Q2ZA 2ZCRA 2E8UA
chains in the Genus database with same CATH superfamily
5HN8A 3QXFA 2GH4A 2XWBB 3W7UA 3VSMA 2F94F 1WMWA 3LVSA 2Z4XA 4OGUA 3T33A 2CQTA 3WKGA 1WL1A 1N4SB 3D5SA 4E1YA 3OABB 4WVCA 4P0WA 4XUVA 4LIXA 4LPHF 5DGMF 5IL3A 3VJEA 2XFGA 3M7BA 3EQAA 4GTRB 1RWFA 4GTQB 1D8DB 1N22A 3KRPA 1N20A 3PYAA 1LTXB 1DOGA 4ONTA 4LPGF 4JYXA 3SQCA 3M75A 3N49F 3WIQA 4D4DA 3B7LA 3ACWA 1HXGA 3N45F 1H3CA 3M74A 3WCAA 5H9DA 2Z7HA 1N7QA 3ICMA 5HNAA 4Q88A 5EATA 1SQCA 2QNOA 4OZWA 3E73A 4LNVA 2ONGA 3WC9A 1G6IA 5A0JA 4EL8A 5ILIA 4GP1A 4MC3A 3DSXB 1GAHA 1IA7A 4MC0A 3WJNA 4F6XA 1OJMA 1YYQA 3CC9A 3NPRA 5DW7A 4F62A 1G9GA 1H37A 3M76A 3QXQA 2JJBA 1TN7B 3D5RA 3S4JA 4RXCA 3ZCDA 3QQVA 5JV0F 1V7VA 1UBXA 4DI5A 3KRFB 3LG5A 4NEIA 2J1PA 1LF9A 1WU5A 2Z07A 3BNYA 4XQTF 2R2LB 2NVPA 5ILKA 2WCOA 3S4DA 3DYGA 2V3PA 1O6RA 4DEMF 3M02A 3DYHA 5B0KA 3M72A 2OGDA 2AETA 3SDUA 4D4BA 1KIZA 4MMIA 5ILZA 1YHMA 4RYPA 1UBWA 1H13A 2WDAA 1N94B 4LTVA 3ZMBA 1N1BA 1HMUA 2F9KF 4YDOB 1HM2A 5IL8A 3SFXB 3DSTB 3W5MA 5I1UA 2Q9YA 1YV5A 4LA6A 1RW9A 4GA3A 3P2CA 3PZ4B 4NFIF 2B4FA 4OKMA 3WKIA 1RQJA 2D5JA 5DGRA 2E4OA 1H54A 2ZEVA 4LA5A 4LLSA 5DJRF 3ZL6A 1G87A 3HXCB 3CIHA 4ZRQA 1KSDA 3CKEA 3Q75B 3SFYB 1VD5A 1G9JA 1O1RB 1X1IA 4LZ3A 1HMWA 3Q78B 2ZIRB 4JVJF 3N6KF 3P41A 4EHMB 2V8JA 5AELA 2PS6A 1S64B 3M78A 4Z4LA 1JFAA 5IKHA 1F1SA 4EA2A 4CJ1A 2ZCSA 2EAEA 3AFLA 1DCEB 4KTPA 2I07B 1FP3A 4NG6A 4KQUA 3WCFA 4LZCA 3M71A 1MZCB 1TN8B 4KPDA 3PDEA 1FPPB 1O1TB 1JCQB 5IK0A 3Q30A 3ANJA 1HCUA 3CP6A 5DHKA 2JG0A 3LSNA 3OABA 3PYBA 3DRAB 3W7SA 3Q73B 1YQ7A 3RYEA 1W6KA 5IN8A 1FMIA 2BEDB 3ANKA 5MEHA 1FT2B 2Q1FA 4FJQA 3IBAA 3W7FA 1R76A 1X1JA 2WY8A 5CA3A 2EACA 5FOBB 1GA2A 1I8QA 2BRVX 5JV1F 4LZ0A 4RXEA 5DGSF 3H3KA 2FUQA 1IS9A 2BBCA 5FO9B 1WU4A 1JCRB 1O79A 3LZ9A 4MU9A 4LUUA 3WCCA 2OPNA 3PH7A 2Z7IA 1N7OA 1KZPB 3M0GA 5JPNB 2F6DA 2ZISB 3M00A 4WVAA 1RTRA 1V4EA 2FORA 3AQBB 1TNOB 3DSWB 4KVIA 3WCJA 1FT1B 1L2AA 1XW2A 2ONHA 3RJ3A 3WEHA 1ZW5A 2Z78A 3KROB 1HM4A 2F8ZF 1N7PA 2RI9A 4KKIA 3VSNA 1HXAA 1LF6A 3KRFA 2FV1A 4GAXA 5ILHA 3ID0A 1KREA 3ICKA 1N4RB 2G0DA 3A0OA 3TFNA 2E8WA 4NFKF 4N9UA 5JMDA 1N24A 4K10A 5CZLA 4XQSF 4Z4JA 2E8XA 2V3NA 3LLWA 1C82A 3AE0A 1PS1A 3LMDA 4ZG8A 2NOJA 1DI1A 4KK2A 1TNYB 4HD1A 1J0MA 1O6HA 3LOMA 3P8RA 2D8LA 1TNBB 2E24A 1VG4A 3DSVB 4N1ZF 3WCGA 4KFAA 3LGKA 2F0YB 2E93A 4DHDA 3LEEA 3WKHA 2Z4VA 4GTPB 3OACB 1RQIA 3C72B 3WCIA 3NNBA 2IEJB 2F89F 1N23A 1FBOA 3QKCA 2H6GB 1V5CA 4MC8A 3APZA 2FV0A 3K7XA 2X03A 2Z4YA 4PVYF 2BB6A 4Q2BA 3RENA 4OMHA 3RX5A 4JZXA 1N4PB 3X17A 3AQ0A 4ZQ8A 1H35A 2WIIB 3W7WA 2I19A 4FXGB 1LOHA 4OMGA 3ZMCA 1V4IA 5AFXA 1OJNA 1H36A 2Z50A 2AZKA 3PZ1B 2OKXA 2CQSA 3VJ9A 4KPJA 1DGPA 1KIYA 5IMIA 5JUZF 1FPSA 2J5CA 4V1RA 3G4FA 3S4AA 3N3LF 4RXAA 2PMVA 3WUXA 2E22A 1F9DA 1HXCA 3Q7FB 1UMPA 3WJKA 4OZVA 3TFPA 3QSPA 4LFGA 3NFVA 4FXKB 1YYTA 3GLYA 2DRQA 2YIKA 1ULVA 1WL3A 1EZFA 5EROA 1K72A 4TF4A 1HV6A 2PS7A 4E9UA 5ER8A 3V1VA 2DRRA 1TN6B 4FNVA 5EAUA 3WCMA 1AGMA 1V4HA 5KKBA 4KQSA 1KZOB 1AYXA 4EA1A 3DSSB 4GTTB 4JXNA 3P5RA 3SDQA 5B0LA 5IMPA 1H12A 2V8KA 3QFYA 2P1CA 2DROA 5EASA 1YYUA 4AYRA 4WVBA 4WK5A 3OEDA 3ACSA 2E90A 2BB5A 1UBYA 1LD7B 1TF4A 1HM3A 1JS4A 1W6JA 3KRAB 1YHKA 4JZBA 4LNGB 5CD2A 3E6UA 3BNXA 2EWGA 3ZOUA 2RGKA 4GTSB 4BOJA 2F92F 2GOXA 3WEFA 2P0VA 3QFZA 3LDWA 3E37B 5KSXF 1W3YA 1KS8A 2JF4A 3SDTA 1O5MB 4C1SA 2J1OA 5B0JA 3RYWA 2FTZA 3SDRA 3P5PA 1QAZA 1S63B 2F7MF 3S9VA 5B02A 2B39A 3DPYB 5CG6A 1V4KA 3N1VF 2VF6A 4DODA 1QQFA 3TF4A 3M7CA 3W7XA 4QPFA 3WEGA 4D4CA 1WL0A 5FO8B 2H6FB 3G6JB 4F6VA 1NL4B 3KROA 2SQCA 1CLCA 3QRYA 4KWDA 1QBQB 1TNUB 2Z4WA 1N95B 3QPFA 3QG0A 1H39A 3QWTA 2VN7A 3A3VA 4LFEA 3WE9A 5IMNA 3RX8A 5IK9A 3GZKA 4CE7A 3KB9A 3RMGA 3LJIA 3TS7A 1KRFA 3EU8A 3WEIA 5GZKA 5E8HA 1RQ5A 1H3BA 3E33B 4RXDA 3RRSA 2BRWA 3N0FA 1FAEA 3KSQB 3W7TA 3HXFB 2RAHA 3LK5A 3NF2A 3VJDA 3ON6A 1J0NA 1SA4B 2OA6A 4DZWA 3VJ8A 4E9ZA 1VG7A 4KKMA 3AFJA 3P8LA 1GXMA 3KLSA 3OACA 2FUZA 3QT3A 1X9DA 3KRCB 3S4BA 1KKTA 2V8IA 3E7JA 1OJOA 4BOKA 2Q9ZA 5B00A 1N7NA 1FBWA 3M77A 4F10A 3QT9A 1EGUA 2WY7A 1WZZA 4AYPA 5ERNA 3WEKA 3M7EA 1O1SB 5A0IA 4MMHA 4KQ5A 3WEJA 3E32B 3RSYA 4EA0A 5DGNF 4QT9A 3NPKA 4JJJA 4NUAA 1FO2A 2PS5A 2AFAA 2E95A 3RBMA 2F8CF 4KVWA 4MBGB 4J5TA 1N4QB 4L2XF 3H7LA 5DJVF 4NKEA 1KSCA 4DXJA 1QSJA 2Z4ZA 4UMJA 5E8KA 5GY3A 5FO7B 2H8OA 3QDEA 1GSZA 3N0GA 3HXDB 5E8LA 5ILDA 2E8VA 1UG9A 2AZLA 2PS8A 3SAEA 3W5NA 5ILJA 5M7YA 3WCHA 2ZCOA 2E8TA 3EZ3A 5AHUB 1N9AB 2WYNA 3PKOA 1F9OA 3ASXA 3KSLB 2Q80A 5HN9A 2ZZRA 3WC3A 4OK4A 3WIWA 1V4JA 2BRPA 4OK2A 4QXSF 5IVGA 3VJAA 4F13A 4GP2A 1RWGA 3ICNA 3ACTA 1GLMA 1N21A 3LGZB 3Q79B 3WSBA 1RWHA 3E80A 3DYFA 1GHQA 4LFVF 2H6IB 1GAIA 2AHGA 4D94A 1XWTA 1TNZB 3KRAA 3H2WA 2AZJA 3WCBA 3OYRA 4YCRA 2EADA 5B0MA 2ZBLA 3EZ8A 3KQ4A 3M73A 2OPMA 4RNQA 2AEKA 2E94A 5CG5A 5IKAA 4L0GA 2ZEUA 3E34B 1RWAA 5A0KA 1H3AA 4LOBA 2H6HB 4OJZA 4JXYA 1HZFA 4TXTA 2E92A 3Q1OA 1H14A 3UCAA 3PZ2B 2FUTA 2PS4A 4L9PB 3HXEB 3N46F 3KRPB 3M9UA 1F9GA 3EU5B 4L6XA 3TC1A 1FO3A 1KFGA 1SA5B 5HN7A 1IA6A 1V7XA 5IK6A 3VJBA 1XWQA 4AYQA 3WKFA 4OKZA 2DH4A 1L1YA 1HX9A 1WL2A 3N5HF 1V5DA 2ZY1A 1O6QA 3HXBB 1VG6A 3Q7AB 1WY0A 4LNBB 3G4DA 5ERMA 3ANIA 3M01A 3N1WF 4Q23A 3WJOA 3K11A 1VG2A 3PZ3B 4KTRA 4ZRPA 3VW5A 1JFGA 3WCEA 4NFJF 1HM7A 3M7LA 2PN5A 3ADZA 5E2JA 1GXOA 3WCLA 5JMFA 3NRIA 1D8EB 5B01A 3V66A 3E30B 2XQWA 5C05A 2RI8A 3VJCA 3TFVA 5DHIA 3SDVA 3KRCA 3MZVA 1YYRA 1LD8B 3IPIA 1RWCA 4KUXA 1VG3A 1WU6A 2WINB 3WCDA 3ACYA 1DL2A 1X1HA 1X81B 1JCSB 5DGQA 3GT5A 4GTVB 4GTOB 4P0XA 1LXKA 2A8ZA 5ILYA 3N5JF 1N1ZA 4KKJA 4LXWA 4V1SA 4FUSA 2E91A 2EABA 4GTMB 2VN4A 4KVYA 3D3IA 5AYPA 4H5CF 3EUVB 1UT9A 1YYSA 5JPMB 2QISA 1NI1B 1WKZA 3ACXA 3PMMA 4AYOA 3DSUB 5JV2F 3CU7A 3ICZA 3Q2QA 3EFQA 3EGTA 1FCEA 3S4CA 1YHLA 2AHFA 4WU0A 3MAVA 5DZ2A 2XWJB 4KVDA 3OXUA 4ZH1A 3AQCB 4E1EA 5B03A 1N7RA 5JA0F 4M76A 4GL3A 4LLTA 4P0VA 5DIQF 4LTZA 2DRSA 4H5DF 1YJ4A 3N3DA 4YDEB 5B0IA 4DOEA 3WSAA 1CEMA 2Z52A 1LXMA 5AGDA 3VXDA 4FP4A 1C3DA 3V1XA 2O1OA 4XQRF 1HN0A 3WIRA 2ZCQA 4NKFA 4PVXF 5DJPF 1UBVA 1CB8A 1GXNA 1OJPA 2Q58A 5GW7A 2AELA 5IM1A 1KWFA 1NXCA 1V7WA 2FBAA 4ZH5A 4CJ0A 2GZ6A 3RX7A 1NC5A 2A73B 3KBKA 4H5EF 4DWGA 4DWBA 5M7IA 3Q2ZA 2G02A 2ZCRA 4D4AA 2E8UA
chains in the Genus database with same CATH topology
5HN8A 2F94F 1WMWA 3LVSA 2Z4XA 4OGUA 1WL1A 3OABB 4P0WA 4LIXA 4LPHF 5DGMF 5IL3A 3VJEA 1N22A 3KRPA 1N20A 3PYAA 4LPGF 4JYXA 3N49F 3B7LA 3ACWA 1HXGA 3N45F 3WCAA 5H9DA 2Z7HA 3ICMA 5HNAA 5EATA 2ONGA 3WC9A 5A0JA 5ILIA 4GP1A 4MC3A 4MC0A 3WJNA 4F6XA 1YYQA 3CC9A 3NPRA 5DW7A 4F62A 3S4JA 4RXCA 3ZCDA 3QQVA 5JV0F 1UBXA 4DI5A 3KRFB 3LG5A 2J1PA 3BNYA 4XQTF 5ILKA 3DYGA 4DEMF 3M02A 3DYHA 5B0KA 2OGDA 2AETA 3SDUA 1KIZA 5ILZA 1YHMA 4RYPA 1UBWA 4LTVA 3ZMBA 1N1BA 2F9KF 5IL8A 5I1UA 2Q9YA 1YV5A 4LA6A 4GA3A 4NFIF 4OKMA 1RQJA 2E4OA 2ZEVA 4LA5A 4LLSA 5DJRF 3ZL6A 3CKEA 4LZ3A 4JVJF 3N6KF 3P41A 5AELA 2PS6A 1JFAA 5IKHA 4EA2A 2ZCSA 4NG6A 4KQUA 3WCFA 4LZCA 4KPDA 3PDEA 5IK0A 3Q30A 3CP6A 5DHKA 3LSNA 3OABA 3PYBA 1YQ7A 3RYEA 5IN8A 4FJQA 3IBAA 3W7FA 5JV1F 4LZ0A 4RXEA 5DGSF 3LZ9A 4LUUA 3WCCA 2OPNA 3PH7A 2Z7IA 3M0GA 3M00A 1RTRA 1V4EA 2FORA 3AQBB 4KVIA 3WCJA 2ONHA 3WEHA 1ZW5A 2Z78A 3KROB 1HM4A 2F8ZF 1HXAA 3KRFA 4GAXA 5ILHA 3ID0A 3ICKA 3TFNA 2E8WA 4NFKF 4N9UA 1N24A 4K10A 4XQSF 2E8XA 3LLWA 3AE0A 1PS1A 3LMDA 1DI1A 4KK2A 4HD1A 3LOMA 3P8RA 1VG4A 4N1ZF 3WCGA 4KFAA 3LGKA 2E93A 4DHDA 3LEEA 2Z4VA 3OACB 1RQIA 3WCIA 2F89F 1N23A 3QKCA 4MC8A 3APZA 2Z4YA 4PVYF 4OMHA 4JZXA 3AQ0A 4ZQ8A 2I19A 4OMGA 3ZMCA 1V4IA 5AFXA 2Z50A 2AZKA 3VJ9A 4KPJA 1DGPA 1KIYA 5IMIA 5JUZF 1FPSA 2J5CA 3G4FA 3N3LF 4RXAA 1HXCA 3WJKA 3TFPA 4LFGA 1YYTA 1WL3A 1EZFA 5EROA 2PS7A 4E9UA 5ER8A 3V1VA 5EAUA 3WCMA 1V4HA 4KQSA 4EA1A 4JXNA 3P5RA 3SDQA 5B0LA 5IMPA 2P1CA 5EASA 1YYUA 4WK5A 2E90A 1UBYA 3KRAB 1YHKA 4JZBA 3BNXA 2EWGA 3ZOUA 2F92F 3WEFA 3LDWA 5KSXF 3SDTA 2J1OA 5B0JA 3RYWA 2FTZA 3SDRA 3P5PA 2F7MF 3S9VA 5B02A 5CG6A 1V4KA 3N1VF 2VF6A 4QPFA 3WEGA 1WL0A 4F6VA 3KROA 4KWDA 2Z4WA 4LFEA 3WE9A 5IMNA 5IK9A 3KB9A 3RMGA 3LJIA 3TS7A 3WEIA 5E8HA 4RXDA 3N0FA 2RAHA 3LK5A 3NF2A 3VJDA 2OA6A 4DZWA 3VJ8A 4E9ZA 1VG7A 4KKMA 3P8LA 3OACA 3KRCB 2Q9ZA 5B00A 5ERNA 3WEKA 5A0IA 4KQ5A 3WEJA 4EA0A 5DGNF 3NPKA 4NUAA 2PS5A 2E95A 3RBMA 2F8CF 4KVWA 4L2XF 5DJVF 4NKEA 4DXJA 2Z4ZA 4UMJA 5E8KA 2H8OA 3N0GA 5E8LA 5ILDA 2E8VA 2AZLA 2PS8A 3SAEA 5ILJA 3WCHA 2ZCOA 2E8TA 3EZ3A 5AHUB 3PKOA 3ASXA 2Q80A 5HN9A 1V4JA 4QXSF 5IVGA 3VJAA 4GP2A 3ICNA 1N21A 3LGZB 3WSBA 3DYFA 4LFVF 3KRAA 2AZJA 3WCBA 3OYRA 5B0MA 2OPMA 4RNQA 2AEKA 2E94A 5CG5A 5IKAA 2ZEUA 5A0KA 4LOBA 4JXYA 2E92A 3Q1OA 3UCAA 2PS4A 3N46F 3KRPB 3M9UA 3TC1A 5HN7A 5IK6A 3VJBA 4OKZA 2DH4A 1HX9A 1WL2A 3N5HF 2ZY1A 1VG6A 1WY0A 3G4DA 5ERMA 3M01A 3N1WF 4Q23A 3WJOA 1VG2A 1JFGA 3WCEA 4NFJF 1HM7A 3ADZA 3WCLA 3NRIA 5B01A 3V66A 5C05A 3VJCA 3TFVA 5DHIA 3SDVA 3KRCA 3MZVA 1YYRA 3IPIA 4KUXA 1VG3A 3WCDA 3ACYA 4P0XA 5ILYA 3N5JF 1N1ZA 4LXWA 2E91A 4KVYA 5AYPA 4H5CF 1YYSA 2QISA 1WKZA 3ACXA 5JV2F 3ICZA 3Q2QA 3EFQA 3EGTA 1YHLA 3MAVA 5DZ2A 4KVDA 3AQCB 4E1EA 5B03A 5JA0F 4LLTA 4P0VA 5DIQF 4LTZA 4H5DF 1YJ4A 3N3DA 5B0IA 3WSAA 2Z52A 4FP4A 3V1XA 2O1OA 4XQRF 2ZCQA 4NKFA 4PVXF 5DJPF 1UBVA 2Q58A 2AELA 5IM1A 3KBKA 4H5EF 4DWGA 4DWBA 3Q2ZA 2ZCRA 2E8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HN8 A;  2F94 F;  1WMW A;  3LVS A;  2Z4X A;  4OGU A;  1WL1 A;  3OAB B;  4P0W A;  4LIX A;  4LPH F;  5DGM F;  5IL3 A;  3VJE A;  1N22 A;  3KRP A;  1N20 A;  3PYA A;  4LPG F;  4JYX A;  3N49 F;  3B7L A;  3ACW A;  1HXG A;  3N45 F;  3WCA A;  5H9D A;  2Z7H A;  3ICM A;  5HNA A;  5EAT A;  2ONG A;  3WC9 A;  5A0J A;  5ILI A;  4GP1 A;  4MC3 A;  4MC0 A;  3WJN A;  4F6X A;  1YYQ A;  3CC9 A;  3NPR A;  5DW7 A;  4F62 A;  3S4J A;  4RXC A;  3ZCD A;  3QQV A;  5JV0 F;  1UBX A;  4DI5 A;  3KRF B;  3LG5 A;  2J1P A;  3BNY A;  4XQT F;  5ILK A;  3DYG A;  4DEM F;  3M02 A;  3DYH A;  5B0K A;  2OGD A;  2AET A;  3SDU A;  1KIZ A;  5ILZ A;  1YHM A;  4RYP A;  1UBW A;  4LTV A;  3ZMB A;  1N1B A;  2F9K F;  5IL8 A;  5I1U A;  2Q9Y A;  1YV5 A;  4LA6 A;  4GA3 A;  4NFI F;  4OKM A;  1RQJ A;  2E4O A;  2ZEV A;  4LA5 A;  4LLS A;  5DJR F;  3ZL6 A;  3CKE A;  4LZ3 A;  4JVJ F;  3N6K F;  3P41 A;  5AEL A;  2PS6 A;  1JFA A;  5IKH A;  4EA2 A;  2ZCS A;  4NG6 A;  4KQU A;  3WCF A;  4LZC A;  4KPD A;  3PDE A;  5IK0 A;  3Q30 A;  3CP6 A;  5DHK A;  3LSN A;  3OAB A;  3PYB A;  1YQ7 A;  3RYE A;  5IN8 A;  4FJQ A;  3IBA A;  3W7F A;  5JV1 F;  4LZ0 A;  4RXE A;  5DGS F;  3LZ9 A;  4LUU A;  3WCC A;  2OPN A;  3PH7 A;  2Z7I A;  3M0G A;  3M00 A;  1RTR A;  1V4E A;  2FOR A;  3AQB B;  4KVI A;  3WCJ A;  2ONH A;  3WEH A;  1ZW5 A;  2Z78 A;  3KRO B;  1HM4 A;  2F8Z F;  1HXA A;  3KRF A;  4GAX A;  5ILH A;  3ID0 A;  3ICK A;  3TFN A;  2E8W A;  4NFK F;  4N9U A;  1N24 A;  4K10 A;  4XQS F;  2E8X A;  3LLW A;  3AE0 A;  1PS1 A;  3LMD A;  1DI1 A;  4KK2 A;  4HD1 A;  3LOM A;  3P8R A;  1VG4 A;  4N1Z F;  3WCG A;  4KFA A;  3LGK A;  2E93 A;  4DHD A;  3LEE A;  2Z4V A;  3OAC B;  1RQI A;  3WCI A;  2F89 F;  1N23 A;  3QKC A;  4MC8 A;  3APZ A;  2Z4Y A;  4PVY F;  4OMH A;  4JZX A;  3AQ0 A;  4ZQ8 A;  2I19 A;  4OMG A;  3ZMC A;  1V4I A;  5AFX A;  2Z50 A;  2AZK A;  3VJ9 A;  4KPJ A;  1DGP A;  1KIY A;  5IMI A;  5JUZ F;  1FPS A;  2J5C A;  3G4F A;  3N3L F;  4RXA A;  1HXC A;  3WJK A;  3TFP A;  4LFG A;  1YYT A;  1WL3 A;  1EZF A;  5ERO A;  2PS7 A;  4E9U A;  5ER8 A;  3V1V A;  5EAU A;  3WCM A;  1V4H A;  4KQS A;  4EA1 A;  4JXN A;  3P5R A;  3SDQ A;  5B0L A;  5IMP A;  2P1C A;  5EAS A;  1YYU A;  4WK5 A;  2E90 A;  1UBY A;  3KRA B;  1YHK A;  4JZB A;  3BNX A;  2EWG A;  3ZOU A;  2F92 F;  3WEF A;  3LDW A;  5KSX F;  3SDT A;  2J1O A;  5B0J A;  3RYW A;  2FTZ A;  3SDR A;  3P5P A;  2F7M F;  3S9V A;  5B02 A;  5CG6 A;  1V4K A;  3N1V F;  2VF6 A;  4QPF A;  3WEG A;  1WL0 A;  4F6V A;  3KRO A;  4KWD A;  2Z4W A;  4LFE A;  3WE9 A;  5IMN A;  5IK9 A;  3KB9 A;  3RMG A;  3LJI A;  3TS7 A;  3WEI A;  5E8H A;  4RXD A;  3N0F A;  2RAH A;  3LK5 A;  3NF2 A;  3VJD A;  2OA6 A;  4DZW A;  3VJ8 A;  4E9Z A;  1VG7 A;  4KKM A;  3P8L A;  3OAC A;  3KRC B;  2Q9Z A;  5B00 A;  5ERN A;  3WEK A;  5A0I A;  4KQ5 A;  3WEJ A;  4EA0 A;  5DGN F;  3NPK A;  4NUA A;  2PS5 A;  2E95 A;  3RBM A;  2F8C F;  4KVW A;  4L2X F;  5DJV F;  4NKE A;  4DXJ A;  2Z4Z A;  4UMJ A;  5E8K A;  2H8O A;  3N0G A;  5E8L A;  5ILD A;  2E8V A;  2AZL A;  2PS8 A;  3SAE A;  5ILJ A;  3WCH A;  2ZCO A;  2E8T A;  3EZ3 A;  5AHU B;  3PKO A;  3ASX A;  2Q80 A;  5HN9 A;  1V4J A;  4QXS F;  5IVG A;  3VJA A;  4GP2 A;  3ICN A;  1N21 A;  3LGZ B;  3WSB A;  3DYF A;  4LFV F;  3KRA A;  2AZJ A;  3WCB A;  3OYR A;  5B0M A;  2OPM A;  4RNQ A;  2AEK A;  2E94 A;  5CG5 A;  5IKA A;  2ZEU A;  5A0K A;  4LOB A;  4JXY A;  2E92 A;  3Q1O A;  3UCA A;  2PS4 A;  3N46 F;  3KRP B;  3M9U A;  3TC1 A;  5HN7 A;  5IK6 A;  3VJB A;  4OKZ A;  2DH4 A;  1HX9 A;  1WL2 A;  3N5H F;  2ZY1 A;  1VG6 A;  1WY0 A;  3G4D A;  5ERM A;  3M01 A;  3N1W F;  4Q23 A;  3WJO A;  1VG2 A;  1JFG A;  3WCE A;  4NFJ F;  1HM7 A;  3ADZ A;  3WCL A;  3NRI A;  5B01 A;  3V66 A;  5C05 A;  3VJC A;  3TFV A;  5DHI A;  3SDV A;  3KRC A;  3MZV A;  1YYR A;  3IPI A;  4KUX A;  1VG3 A;  3WCD A;  3ACY A;  4P0X A;  5ILY A;  3N5J F;  1N1Z A;  4LXW A;  2E91 A;  4KVY A;  5AYP A;  4H5C F;  1YYS A;  2QIS A;  1WKZ A;  3ACX A;  5JV2 F;  3ICZ A;  3Q2Q A;  3EFQ A;  3EGT A;  1YHL A;  3MAV A;  5DZ2 A;  4KVD A;  3AQC B;  4E1E A;  5B03 A;  5JA0 F;  4LLT A;  4P0V A;  5DIQ F;  4LTZ A;  4H5D F;  1YJ4 A;  3N3D A;  5B0I A;  3WSA A;  2Z52 A;  4FP4 A;  3V1X A;  2O1O A;  4XQR F;  2ZCQ A;  4NKF A;  4PVX F;  5DJP F;  1UBV A;  2Q58 A;  2AEL A;  5IM1 A;  3KBK A;  4H5E F;  4DWG A;  4DWB A;  3Q2Z A;  2ZCR A;  2E8U A; 
#chains in the Genus database with same CATH topology
 5HN8 A;  3QXF A;  2GH4 A;  2XWB B;  3W7U A;  3VSM A;  2F94 F;  1WMW A;  3LVS A;  2Z4X A;  4OGU A;  3T33 A;  2CQT A;  3WKG A;  1WL1 A;  1N4S B;  3D5S A;  4E1Y A;  3OAB B;  4WVC A;  4P0W A;  4XUV A;  4LIX A;  4LPH F;  5DGM F;  5IL3 A;  3VJE A;  2XFG A;  3M7B A;  3EQA A;  4GTR B;  1RWF A;  4GTQ B;  1D8D B;  1N22 A;  3KRP A;  1N20 A;  3PYA A;  1LTX B;  1DOG A;  4ONT A;  4LPG F;  4JYX A;  3SQC A;  3M75 A;  3N49 F;  3WIQ A;  4D4D A;  3B7L A;  3ACW A;  1HXG A;  3N45 F;  1H3C A;  3M74 A;  3WCA A;  5H9D A;  2Z7H A;  1N7Q A;  3ICM A;  5HNA A;  4Q88 A;  5EAT A;  1SQC A;  2QNO A;  4OZW A;  3E73 A;  4LNV A;  2ONG A;  3WC9 A;  1G6I A;  5A0J A;  4EL8 A;  5ILI A;  4GP1 A;  4MC3 A;  3DSX B;  1GAH A;  1IA7 A;  4MC0 A;  3WJN A;  4F6X A;  1OJM A;  1YYQ A;  3CC9 A;  3NPR A;  5DW7 A;  4F62 A;  1G9G A;  1H37 A;  3M76 A;  3QXQ A;  2JJB A;  1TN7 B;  3D5R A;  3S4J A;  4RXC A;  3ZCD A;  3QQV A;  5JV0 F;  1V7V A;  1UBX A;  4DI5 A;  3KRF B;  3LG5 A;  4NEI A;  2J1P A;  1LF9 A;  1WU5 A;  2Z07 A;  3BNY A;  4XQT F;  2R2L B;  2NVP A;  5ILK A;  2WCO A;  3S4D A;  3DYG A;  2V3P A;  1O6R A;  4DEM F;  3M02 A;  3DYH A;  5B0K A;  3M72 A;  2OGD A;  2AET A;  3SDU A;  4D4B A;  1KIZ A;  4MMI A;  5ILZ A;  1YHM A;  4RYP A;  1UBW A;  1H13 A;  2WDA A;  1N94 B;  4LTV A;  3ZMB A;  1N1B A;  1HMU A;  2F9K F;  4YDO B;  1HM2 A;  5IL8 A;  3SFX B;  3DST B;  3W5M A;  5I1U A;  2Q9Y A;  1YV5 A;  4LA6 A;  1RW9 A;  4GA3 A;  3P2C A;  3PZ4 B;  4NFI F;  2B4F A;  4OKM A;  3WKI A;  1RQJ A;  2D5J A;  5DGR A;  2E4O A;  1H54 A;  2ZEV A;  4LA5 A;  4LLS A;  5DJR F;  3ZL6 A;  1G87 A;  3HXC B;  3CIH A;  4ZRQ A;  1KSD A;  3CKE A;  3Q75 B;  3SFY B;  1VD5 A;  1G9J A;  1O1R B;  1X1I A;  4LZ3 A;  1HMW A;  3Q78 B;  2ZIR B;  4JVJ F;  3N6K F;  3P41 A;  4EHM B;  2V8J A;  5AEL A;  2PS6 A;  1S64 B;  3M78 A;  4Z4L A;  1JFA A;  5IKH A;  1F1S A;  4EA2 A;  4CJ1 A;  2ZCS A;  2EAE A;  3AFL A;  1DCE B;  4KTP A;  2I07 B;  1FP3 A;  4NG6 A;  4KQU A;  3WCF A;  4LZC A;  3M71 A;  1MZC B;  1TN8 B;  4KPD A;  3PDE A;  1FPP B;  1O1T B;  1JCQ B;  5IK0 A;  3Q30 A;  3ANJ A;  1HCU A;  3CP6 A;  5DHK A;  2JG0 A;  3LSN A;  3OAB A;  3PYB A;  3DRA B;  3W7S A;  3Q73 B;  1YQ7 A;  3RYE A;  1W6K A;  5IN8 A;  1FMI A;  2BED B;  3ANK A;  5MEH A;  1FT2 B;  2Q1F A;  4FJQ A;  3IBA A;  3W7F A;  1R76 A;  1X1J A;  2WY8 A;  5CA3 A;  2EAC A;  5FOB B;  1GA2 A;  1I8Q A;  2BRV X;  5JV1 F;  4LZ0 A;  4RXE A;  5DGS F;  3H3K A;  2FUQ A;  1IS9 A;  2BBC A;  5FO9 B;  1WU4 A;  1JCR B;  1O79 A;  3LZ9 A;  4MU9 A;  4LUU A;  3WCC A;  2OPN A;  3PH7 A;  2Z7I A;  1N7O A;  1KZP B;  3M0G A;  5JPN B;  2F6D A;  2ZIS B;  3M00 A;  4WVA A;  1RTR A;  1V4E A;  2FOR A;  3AQB B;  1TNO B;  3DSW B;  4KVI A;  3WCJ A;  1FT1 B;  1L2A A;  1XW2 A;  2ONH A;  3RJ3 A;  3WEH A;  1ZW5 A;  2Z78 A;  3KRO B;  1HM4 A;  2F8Z F;  1N7P A;  2RI9 A;  4KKI A;  3VSN A;  1HXA A;  1LF6 A;  3KRF A;  2FV1 A;  4GAX A;  5ILH A;  3ID0 A;  1KRE A;  3ICK A;  1N4R B;  2G0D A;  3A0O A;  3TFN A;  2E8W A;  4NFK F;  4N9U A;  5JMD A;  1N24 A;  4K10 A;  5CZL A;  4XQS F;  4Z4J A;  2E8X A;  2V3N A;  3LLW A;  1C82 A;  3AE0 A;  1PS1 A;  3LMD A;  4ZG8 A;  2NOJ A;  1DI1 A;  4KK2 A;  1TNY B;  4HD1 A;  1J0M A;  1O6H A;  3LOM A;  3P8R A;  2D8L A;  1TNB B;  2E24 A;  1VG4 A;  3DSV B;  4N1Z F;  3WCG A;  4KFA A;  3LGK A;  2F0Y B;  2E93 A;  4DHD A;  3LEE A;  3WKH A;  2Z4V A;  4GTP B;  3OAC B;  1RQI A;  3C72 B;  3WCI A;  3NNB A;  2IEJ B;  2F89 F;  1N23 A;  1FBO A;  3QKC A;  2H6G B;  1V5C A;  4MC8 A;  3APZ A;  2FV0 A;  3K7X A;  2X03 A;  2Z4Y A;  4PVY F;  2BB6 A;  4Q2B A;  3REN A;  4OMH A;  3RX5 A;  4JZX A;  1N4P B;  3X17 A;  3AQ0 A;  4ZQ8 A;  1H35 A;  2WII B;  3W7W A;  2I19 A;  4FXG B;  1LOH A;  4OMG A;  3ZMC A;  1V4I A;  5AFX A;  1OJN A;  1H36 A;  2Z50 A;  2AZK A;  3PZ1 B;  2OKX A;  2CQS A;  3VJ9 A;  4KPJ A;  1DGP A;  1KIY A;  5IMI A;  5JUZ F;  1FPS A;  2J5C A;  4V1R A;  3G4F A;  3S4A A;  3N3L F;  4RXA A;  2PMV A;  3WUX A;  2E22 A;  1F9D A;  1HXC A;  3Q7F B;  1UMP A;  3WJK A;  4OZV A;  3TFP A;  3QSP A;  4LFG A;  3NFV A;  4FXK B;  1YYT A;  3GLY A;  2DRQ A;  2YIK A;  1ULV A;  1WL3 A;  1EZF A;  5ERO A;  1K72 A;  4TF4 A;  1HV6 A;  2PS7 A;  4E9U A;  5ER8 A;  3V1V A;  2DRR A;  1TN6 B;  4FNV A;  5EAU A;  3WCM A;  1AGM A;  1V4H A;  5KKB A;  4KQS A;  1KZO B;  1AYX A;  4EA1 A;  3DSS B;  4GTT B;  4JXN A;  3P5R A;  3SDQ A;  5B0L A;  5IMP A;  1H12 A;  2V8K A;  3QFY A;  2P1C A;  2DRO A;  5EAS A;  1YYU A;  4AYR A;  4WVB A;  4WK5 A;  3OED A;  3ACS A;  2E90 A;  2BB5 A;  1UBY A;  1LD7 B;  1TF4 A;  1HM3 A;  1JS4 A;  1W6J A;  3KRA B;  1YHK A;  4JZB A;  4LNG B;  5CD2 A;  3E6U A;  3BNX A;  2EWG A;  3ZOU A;  2RGK A;  4GTS B;  4BOJ A;  2F92 F;  2GOX A;  3WEF A;  2P0V A;  3QFZ A;  3LDW A;  3E37 B;  5KSX F;  1W3Y A;  1KS8 A;  2JF4 A;  3SDT A;  1O5M B;  4C1S A;  2J1O A;  5B0J A;  3RYW A;  2FTZ A;  3SDR A;  3P5P A;  1QAZ A;  1S63 B;  2F7M F;  3S9V A;  5B02 A;  2B39 A;  3DPY B;  5CG6 A;  1V4K A;  3N1V F;  2VF6 A;  4DOD A;  1QQF A;  3TF4 A;  3M7C A;  3W7X A;  4QPF A;  3WEG A;  4D4C A;  1WL0 A;  5FO8 B;  2H6F B;  3G6J B;  4F6V A;  1NL4 B;  3KRO A;  2SQC A;  1CLC A;  3QRY A;  4KWD A;  1QBQ B;  1TNU B;  2Z4W A;  1N95 B;  3QPF A;  3QG0 A;  1H39 A;  3QWT A;  2VN7 A;  3A3V A;  4LFE A;  3WE9 A;  5IMN A;  3RX8 A;  5IK9 A;  3GZK A;  4CE7 A;  3KB9 A;  3RMG A;  3LJI A;  3TS7 A;  1KRF A;  3EU8 A;  3WEI A;  5GZK A;  5E8H A;  1RQ5 A;  1H3B A;  3E33 B;  4RXD A;  3RRS A;  2BRW A;  3N0F A;  1FAE A;  3KSQ B;  3W7T A;  3HXF B;  2RAH A;  3LK5 A;  3NF2 A;  3VJD A;  3ON6 A;  1J0N A;  1SA4 B;  2OA6 A;  4DZW A;  3VJ8 A;  4E9Z A;  1VG7 A;  4KKM A;  3AFJ A;  3P8L A;  1GXM A;  3KLS A;  3OAC A;  2FUZ A;  3QT3 A;  1X9D A;  3KRC B;  3S4B A;  1KKT A;  2V8I A;  3E7J A;  1OJO A;  4BOK A;  2Q9Z A;  5B00 A;  1N7N A;  1FBW A;  3M77 A;  4F10 A;  3QT9 A;  1EGU A;  2WY7 A;  1WZZ A;  4AYP A;  5ERN A;  3WEK A;  3M7E A;  1O1S B;  5A0I A;  4MMH A;  4KQ5 A;  3WEJ A;  3E32 B;  3RSY A;  4EA0 A;  5DGN F;  4QT9 A;  3NPK A;  4JJJ A;  4NUA A;  1FO2 A;  2PS5 A;  2AFA A;  2E95 A;  3RBM A;  2F8C F;  4KVW A;  4MBG B;  4J5T A;  1N4Q B;  4L2X F;  3H7L A;  5DJV F;  4NKE A;  1KSC A;  4DXJ A;  1QSJ A;  2Z4Z A;  4UMJ A;  5E8K A;  5GY3 A;  5FO7 B;  2H8O A;  3QDE A;  1GSZ A;  3N0G A;  3HXD B;  5E8L A;  5ILD A;  2E8V A;  1UG9 A;  2AZL A;  2PS8 A;  3SAE A;  3W5N A;  5ILJ A;  5M7Y A;  3WCH A;  2ZCO A;  2E8T A;  3EZ3 A;  5AHU B;  1N9A B;  2WYN A;  3PKO A;  1F9O A;  3ASX A;  3KSL B;  2Q80 A;  5HN9 A;  2ZZR A;  3WC3 A;  4OK4 A;  3WIW A;  1V4J A;  2BRP A;  4OK2 A;  4QXS F;  5IVG A;  3VJA A;  4F13 A;  4GP2 A;  1RWG A;  3ICN A;  3ACT A;  1GLM A;  1N21 A;  3LGZ B;  3Q79 B;  3WSB A;  1RWH A;  3E80 A;  3DYF A;  1GHQ A;  4LFV F;  2H6I B;  1GAI A;  2AHG A;  4D94 A;  1XWT A;  1TNZ B;  3KRA A;  3H2W A;  2AZJ A;  3WCB A;  3OYR A;  4YCR A;  2EAD A;  5B0M A;  2ZBL A;  3EZ8 A;  3KQ4 A;  3M73 A;  2OPM A;  4RNQ A;  2AEK A;  2E94 A;  5CG5 A;  5IKA A;  4L0G A;  2ZEU A;  3E34 B;  1RWA A;  5A0K A;  1H3A A;  4LOB A;  2H6H B;  4OJZ A;  4JXY A;  1HZF A;  4TXT A;  2E92 A;  3Q1O A;  1H14 A;  3UCA A;  3PZ2 B;  2FUT A;  2PS4 A;  4L9P B;  3HXE B;  3N46 F;  3KRP B;  3M9U A;  1F9G A;  3EU5 B;  4L6X A;  3TC1 A;  1FO3 A;  1KFG A;  1SA5 B;  5HN7 A;  1IA6 A;  1V7X A;  5IK6 A;  3VJB A;  1XWQ A;  4AYQ A;  3WKF A;  4OKZ A;  2DH4 A;  1L1Y A;  1HX9 A;  1WL2 A;  3N5H F;  1V5D A;  2ZY1 A;  1O6Q A;  3HXB B;  1VG6 A;  3Q7A B;  1WY0 A;  4LNB B;  3G4D A;  5ERM A;  3ANI A;  3M01 A;  3N1W F;  4Q23 A;  3WJO A;  3K11 A;  1VG2 A;  3PZ3 B;  4KTR A;  4ZRP A;  3VW5 A;  1JFG A;  3WCE A;  4NFJ F;  1HM7 A;  3M7L A;  2PN5 A;  3ADZ A;  5E2J A;  1GXO A;  3WCL A;  5JMF A;  3NRI A;  1D8E B;  5B01 A;  3V66 A;  3E30 B;  2XQW A;  5C05 A;  2RI8 A;  3VJC A;  3TFV A;  5DHI A;  3SDV A;  3KRC A;  3MZV A;  1YYR A;  1LD8 B;  3IPI A;  1RWC A;  4KUX A;  1VG3 A;  1WU6 A;  2WIN B;  3WCD A;  3ACY A;  1DL2 A;  1X1H A;  1X81 B;  1JCS B;  5DGQ A;  3GT5 A;  4GTV B;  4GTO B;  4P0X A;  1LXK A;  2A8Z A;  5ILY A;  3N5J F;  1N1Z A;  4KKJ A;  4LXW A;  4V1S A;  4FUS A;  2E91 A;  2EAB A;  4GTM B;  2VN4 A;  4KVY A;  3D3I A;  5AYP A;  4H5C F;  3EUV B;  1UT9 A;  1YYS A;  5JPM B;  2QIS A;  1NI1 B;  1WKZ A;  3ACX A;  3PMM A;  4AYO A;  3DSU B;  5JV2 F;  3CU7 A;  3ICZ A;  3Q2Q A;  3EFQ A;  3EGT A;  1FCE A;  3S4C A;  1YHL A;  2AHF A;  4WU0 A;  3MAV A;  5DZ2 A;  2XWJ B;  4KVD A;  3OXU A;  4ZH1 A;  3AQC B;  4E1E A;  5B03 A;  1N7R A;  5JA0 F;  4M76 A;  4GL3 A;  4LLT A;  4P0V A;  5DIQ F;  4LTZ A;  2DRS A;  4H5D F;  1YJ4 A;  3N3D A;  4YDE B;  5B0I A;  4DOE A;  3WSA A;  1CEM A;  2Z52 A;  1LXM A;  5AGD A;  3VXD A;  4FP4 A;  1C3D A;  3V1X A;  2O1O A;  4XQR F;  1HN0 A;  3WIR A;  2ZCQ A;  4NKF A;  4PVX F;  5DJP F;  1UBV A;  1CB8 A;  1GXN A;  1OJP A;  2Q58 A;  5GW7 A;  2AEL A;  5IM1 A;  1KWF A;  1NXC A;  1V7W A;  2FBA A;  4ZH5 A;  4CJ0 A;  2GZ6 A;  3RX7 A;  1NC5 A;  2A73 B;  3KBK A;  4H5E F;  4DWG A;  4DWB A;  5M7I A;  3Q2Z A;  2G02 A;  2ZCR A;  4D4A A;  2E8U A; 
#chains in the Genus database with same CATH homology
 5HN8 A;  2F94 F;  1WMW A;  3LVS A;  2Z4X A;  4OGU A;  1WL1 A;  3OAB B;  4P0W A;  4LIX A;  4LPH F;  5DGM F;  5IL3 A;  3VJE A;  1N22 A;  3KRP A;  1N20 A;  3PYA A;  4LPG F;  4JYX A;  3N49 F;  3B7L A;  3ACW A;  1HXG A;  3N45 F;  3WCA A;  5H9D A;  2Z7H A;  3ICM A;  5HNA A;  5EAT A;  2ONG A;  3WC9 A;  5A0J A;  5ILI A;  4GP1 A;  4MC3 A;  4MC0 A;  3WJN A;  4F6X A;  1YYQ A;  3CC9 A;  3NPR A;  5DW7 A;  4F62 A;  3S4J A;  4RXC A;  3ZCD A;  3QQV A;  5JV0 F;  1UBX A;  4DI5 A;  3KRF B;  3LG5 A;  2J1P A;  3BNY A;  4XQT F;  5ILK A;  3DYG A;  4DEM F;  3M02 A;  3DYH A;  5B0K A;  2OGD A;  2AET A;  3SDU A;  1KIZ A;  5ILZ A;  1YHM A;  4RYP A;  1UBW A;  4LTV A;  3ZMB A;  1N1B A;  2F9K F;  5IL8 A;  5I1U A;  2Q9Y A;  1YV5 A;  4LA6 A;  4GA3 A;  4NFI F;  4OKM A;  1RQJ A;  2E4O A;  2ZEV A;  4LA5 A;  4LLS A;  5DJR F;  3ZL6 A;  3CKE A;  4LZ3 A;  4JVJ F;  3N6K F;  3P41 A;  5AEL A;  2PS6 A;  1JFA A;  5IKH A;  4EA2 A;  2ZCS A;  4NG6 A;  4KQU A;  3WCF A;  4LZC A;  4KPD A;  3PDE A;  5IK0 A;  3Q30 A;  3CP6 A;  5DHK A;  3LSN A;  3OAB A;  3PYB A;  1YQ7 A;  3RYE A;  5IN8 A;  4FJQ A;  3IBA A;  3W7F A;  5JV1 F;  4LZ0 A;  4RXE A;  5DGS F;  3LZ9 A;  4LUU A;  3WCC A;  2OPN A;  3PH7 A;  2Z7I A;  3M0G A;  3M00 A;  1RTR A;  1V4E A;  2FOR A;  3AQB B;  4KVI A;  3WCJ A;  2ONH A;  3WEH A;  1ZW5 A;  2Z78 A;  3KRO B;  1HM4 A;  2F8Z F;  1HXA A;  3KRF A;  4GAX A;  5ILH A;  3ID0 A;  3ICK A;  3TFN A;  2E8W A;  4NFK F;  4N9U A;  1N24 A;  4K10 A;  4XQS F;  2E8X A;  3LLW A;  3AE0 A;  1PS1 A;  3LMD A;  1DI1 A;  4KK2 A;  4HD1 A;  3LOM A;  3P8R A;  1VG4 A;  4N1Z F;  3WCG A;  4KFA A;  3LGK A;  2E93 A;  4DHD A;  3LEE A;  2Z4V A;  3OAC B;  1RQI A;  3WCI A;  2F89 F;  1N23 A;  3QKC A;  4MC8 A;  3APZ A;  2Z4Y A;  4PVY F;  4OMH A;  4JZX A;  3AQ0 A;  4ZQ8 A;  2I19 A;  4OMG A;  3ZMC A;  1V4I A;  5AFX A;  2Z50 A;  2AZK A;  3VJ9 A;  4KPJ A;  1DGP A;  1KIY A;  5IMI A;  5JUZ F;  1FPS A;  2J5C A;  3G4F A;  3N3L F;  4RXA A;  1HXC A;  3WJK A;  3TFP A;  4LFG A;  1YYT A;  1WL3 A;  1EZF A;  5ERO A;  2PS7 A;  4E9U A;  5ER8 A;  3V1V A;  5EAU A;  3WCM A;  1V4H A;  4KQS A;  4EA1 A;  4JXN A;  3P5R A;  3SDQ A;  5B0L A;  5IMP A;  2P1C A;  5EAS A;  1YYU A;  4WK5 A;  2E90 A;  1UBY A;  3KRA B;  1YHK A;  4JZB A;  3BNX A;  2EWG A;  3ZOU A;  2F92 F;  3WEF A;  3LDW A;  5KSX F;  3SDT A;  2J1O A;  5B0J A;  3RYW A;  2FTZ A;  3SDR A;  3P5P A;  2F7M F;  3S9V A;  5B02 A;  5CG6 A;  1V4K A;  3N1V F;  2VF6 A;  4QPF A;  3WEG A;  1WL0 A;  4F6V A;  3KRO A;  4KWD A;  2Z4W A;  4LFE A;  3WE9 A;  5IMN A;  5IK9 A;  3KB9 A;  3RMG A;  3LJI A;  3TS7 A;  3WEI A;  5E8H A;  4RXD A;  3N0F A;  2RAH A;  3LK5 A;  3NF2 A;  3VJD A;  2OA6 A;  4DZW A;  3VJ8 A;  4E9Z A;  1VG7 A;  4KKM A;  3P8L A;  3OAC A;  3KRC B;  2Q9Z A;  5B00 A;  5ERN A;  3WEK A;  5A0I A;  4KQ5 A;  3WEJ A;  4EA0 A;  5DGN F;  3NPK A;  4NUA A;  2PS5 A;  2E95 A;  3RBM A;  2F8C F;  4KVW A;  4L2X F;  5DJV F;  4NKE A;  4DXJ A;  2Z4Z A;  4UMJ A;  5E8K A;  2H8O A;  3N0G A;  5E8L A;  5ILD A;  2E8V A;  2AZL A;  2PS8 A;  3SAE A;  5ILJ A;  3WCH A;  2ZCO A;  2E8T A;  3EZ3 A;  5AHU B;  3PKO A;  3ASX A;  2Q80 A;  5HN9 A;  1V4J A;  4QXS F;  5IVG A;  3VJA A;  4GP2 A;  3ICN A;  1N21 A;  3LGZ B;  3WSB A;  3DYF A;  4LFV F;  3KRA A;  2AZJ A;  3WCB A;  3OYR A;  5B0M A;  2OPM A;  4RNQ A;  2AEK A;  2E94 A;  5CG5 A;  5IKA A;  2ZEU A;  5A0K A;  4LOB A;  4JXY A;  2E92 A;  3Q1O A;  3UCA A;  2PS4 A;  3N46 F;  3KRP B;  3M9U A;  3TC1 A;  5HN7 A;  5IK6 A;  3VJB A;  4OKZ A;  2DH4 A;  1HX9 A;  1WL2 A;  3N5H F;  2ZY1 A;  1VG6 A;  1WY0 A;  3G4D A;  5ERM A;  3M01 A;  3N1W F;  4Q23 A;  3WJO A;  1VG2 A;  1JFG A;  3WCE A;  4NFJ F;  1HM7 A;  3ADZ A;  3WCL A;  3NRI A;  5B01 A;  3V66 A;  5C05 A;  3VJC A;  3TFV A;  5DHI A;  3SDV A;  3KRC A;  3MZV A;  1YYR A;  3IPI A;  4KUX A;  1VG3 A;  3WCD A;  3ACY A;  4P0X A;  5ILY A;  3N5J F;  1N1Z A;  4LXW A;  2E91 A;  4KVY A;  5AYP A;  4H5C F;  1YYS A;  2QIS A;  1WKZ A;  3ACX A;  5JV2 F;  3ICZ A;  3Q2Q A;  3EFQ A;  3EGT A;  1YHL A;  3MAV A;  5DZ2 A;  4KVD A;  3AQC B;  4E1E A;  5B03 A;  5JA0 F;  4LLT A;  4P0V A;  5DIQ F;  4LTZ A;  4H5D F;  1YJ4 A;  3N3D A;  5B0I A;  3WSA A;  2Z52 A;  4FP4 A;  3V1X A;  2O1O A;  4XQR F;  2ZCQ A;  4NKF A;  4PVX F;  5DJP F;  1UBV A;  2Q58 A;  2AEL A;  5IM1 A;  3KBK A;  4H5E F;  4DWG A;  4DWB A;  3Q2Z A;  2ZCR A;  2E8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...