4GAXA

Crystal structure of an alpha-bisabolol synthase mutant
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
534
structure length
525
Chain Sequence
ANFSPSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGARSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRNLMVEAQWANEGHIPTTEELDSVAVITGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAAKDAFTAMGEEYKNLVKSLLVYPMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
molecule tags Lyase
total genus 202
structure length 525
sequence length 534
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4gaxA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4gaxA02
5B02A 1YYRA 5IVGA 2E91A 4KVIA 4DI5A 1WL0A 2ZEUA 2EWGA 2AELA 3ZMBA 4OKZA 1ZW5A 4JYXA 2ZCOA 3ICZA 1UBXA 5E8KA 3SDQA 3OYRA 4KPJA 3TS7A 3CC9A 1DI1A 2F92F 1YQ7A 3N1WF 5DJVF 3ZOUA 2AZLA 4WK5A 2ZEVA 3N6KF 5A0JA 4HD1A 5A0KA 5B0LA 4KVDA 5ILHA 2F89F 4F6XA 2Z4VA 4LFVF 5IKHA 2PS4A 2ZCQA 3KBKA 2RAHA 2I19A 1VG6A 2E95A 4NFJF 5DIQF 5DGNF 3ZMCA 3N46F 5DZ2A 2Q58A 2VF6A 3P5RA 4H5EF 3VJEA 5ILKA 4RYPA 5ILJA 5ILZA 2AZKA 4H5CF 3OABA 3TFPA 3KRFB 3LZ9A 3KROB 3TFNA 4NG6A 3M00A 3KRAA 1YYSA 4JZBA 3IPIA 3G4FA 5EAUA 3ASXA 3P8LA 3VJDA 2J1PA 4E1EA 3WEGA 3N49F 4E9UA 2H8OA 3KRFA 3KROA 5HN8A 2Q9ZA 4DWGA 2Z4XA 4LLTA 1RTRA 3UCAA 2E8TA 3WJKA 1EZFA 1YYQA 1VG2A 2E4OA 3PYBA 2E8VA 4H5DF 3ZCDA 4DXJA 4UMJA 3QKCA 5B0MA 4RXAA 5IMPA 3KRCB 4KVWA 4LIXA 3M0GA 4KQUA 3WEKA 2OA6A 3ZL6A 5AYPA 5DJPF 5IL3A 5IMNA 4P0XA 5KSXF 3NF2A 5EROA 4RXCA 3KRCA 2DH4A 4EA1A 3WEIA 1KIZA 5JA0F 1HXCA 2J5CA 3WSAA 3ADZA 4GA3A 4QPFA 3ID0A 2Q9YA 3SDRA 2AEKA 1WY0A 5JV2F 3WCAA 3WCEA 3BNXA 3DYGA 3Q1OA 4FP4A 1HXGA 4OMGA 5H9DA 3LMDA 1V4HA 2Z50A 5DW7A 5CG5A 5IM1A 4LLSA 4L2XF 3IBAA 5CG6A 4P0WA 2F8CF 3DYFA 1N21A 3OABB 1JFGA 3EGTA 3Q2QA 3KRAB 5JUZF 3ICNA 5AFXA 2ZCSA 3ACYA 4GP2A 2Z4WA 1DGPA 2Z7HA 2O1OA 2Z4ZA 3S9VA 3ICMA 3NRIA 3BNYA 3LLWA 3RYWA 2F7MF 3PKOA 4OMHA 3WEHA 1YHMA 2PS5A 4XQRF 3WCGA 3LGKA 2PS7A 4RXEA 4Q23A 3CKEA 3ACWA 4DHDA 3RYEA 3P5PA 5ILDA 3WCMA 5DHIA 3PH7A 5EASA 4FJQA 4KK2A 1UBVA 2PS6A 4KWDA 4EA0A 3SDUA 5HN7A 3NPKA 4N1ZF 3N3DA 5DJRF 3WCCA 4LPGF 1UBYA 4NKEA 3SDTA 4KFAA 3WSBA 2E90A 4LFEA 2F9KF 4JXYA 4LFGA 4LZ3A 4P0VA 5ERNA 3EFQA 2E94A 2P1CA 4RXDA 4DWBA 3N5JF 3N3LF 3P8RA 5AELA 4KPDA 1N1BA 3RMGA 3G4DA 3WCHA 2Z78A 3ACXA 3N1VF 3MZVA 3LDWA 3WEFA 5I1UA 3N5HF 4OGUA 2FORA 4OKMA 3MAVA 4NFKF 3SDVA 1N22A 5B03A 4XQTF 4JXNA 3AQ0A 4LZCA 5DHKA 5IK0A 4KKMA 5EATA 5B00A 3KRPA 1V4JA 4LUUA 5ER8A 4DZWA 3LGZB 1JFAA 2Q80A 3WEJA 1YYTA 5B0KA 1UBWA 1YHKA 3Q2ZA 3LK5A 3LVSA 4XQSF 3OACA 4K10A 2E8WA 1RQIA 5DGSF 2AETA 2OPNA 3AQCB 1KIYA 3Q30A 3VJBA 5IN8A 2E93A 2ONGA 1YV5A 2Z4YA 5JV0F 5ILYA 1HM7A 5E8HA 4LTVA 3B7LA 4JVJF 4MC0A 3V1VA 3RBMA 3TC1A 4LZ0A 5E8LA 2E92A 3WE9A 1WKZA 3WCDA 3WCBA 5B0IA 1N1ZA 5A0IA 3VJCA 2PS8A 3EZ3A 3V66A 4N9UA 1N20A 4JZXA 3VJ8A 5B01A 3VJ9A 5HNAA 1VG7A 2QISA 1YHLA 4KVYA 3AE0A 5C05A 4ZQ8A 3PDEA 3QQVA 1V4EA 2F8ZF 3WCLA 1WL2A 4LOBA 2ZY1A 2ZCRA 2FTZA 4PVXF 1VG3A 2OGDA 3AQBB 1WMWA 5IMIA 3LSNA 3WJOA 4GAXA 2E8XA 2AZJA 4LTZA 1PS1A 4DEMF 1HM4A 3N45F 1N23A 3P41A 4NKFA 3APZA 4PVYF 4NUAA 2Z52A 4GP1A 1WL3A 3SAEA 3WCFA 4F6VA 3N0GA 3NPRA 5IK6A 1YYUA 1FPSA 2J1OA 3LOMA 3LEEA 4LXWA 1RQJA 2Z7IA 3TFVA 2F94F 3M9UA 4LA5A 3ICKA 5HN9A 5IK9A 3KRPB 3M02A 3LG5A 3WCIA 1V4KA 5DGMF 1WL1A 4NFIF 2E8UA 5AHUB 3W7FA 1YJ4A 3DYHA 4QXSF 3V1XA 3WCJA 3OACB 1HX9A 5IL8A 3S4JA 1VG4A 4E9ZA 4EA2A 5IKAA 4LA6A 4KUXA 3M01A 4LPHF 5B0JA 4MC8A 2OPMA 5JV1F 1V4IA 3WJNA 3LJIA 3N0FA 3CP6A 3KB9A 1HXAA 1N24A 4F62A 4RNQA 5ERMA 4KQ5A 3WC9A 3PYAA 2ONHA 4KQSA 4MC3A 5ILIA 3VJAA
chains in the Genus database with same CATH superfamily
2B39A 5B02A 3M7EA 1YYRA 1WZZA 5IVGA 2E91A 4KVIA 3M73A 4DI5A 1W6JA 3NNBA 2V3NA 1WL0A 2ZEUA 2EWGA 2AELA 1QAZA 3ZMBA 4OKZA 1ZW5A 1GLMA 5GW7A 4JYXA 2ZCOA 3ICZA 1UBXA 5E8KA 3SDQA 3OYRA 4KPJA 3TS7A 3CC9A 1DI1A 2F92F 5M7IA 2WY8A 3ON6A 1YQ7A 3N1WF 3T33A 1LD7B 5DJVF 3ZOUA 3QWTA 2AZLA 4WK5A 2ZEVA 3N6KF 5A0JA 4HD1A 5A0KA 5B0LA 1ULVA 2V3PA 4KVDA 1F9GA 1GXNA 3OXUA 5ILHA 2F89F 4EL8A 4F6XA 4GL3A 4EHMB 3QRYA 2Z4VA 4LFVF 4ZH5A 5JPNB 5IKHA 1FP3A 2BEDB 2PS4A 2EABA 2ZCQA 1KRFA 1JCSB 4GTOB 2BRPA 1HMUA 1OJMA 4D4DA 3KBKA 2RAHA 1G87A 2FUZA 3DSWB 2I19A 1GSZA 1VG6A 2E95A 4NFJF 1NI1B 3OEDA 3PZ1B 3QT9A 5KKBA 5DIQF 1HCUA 5DGNF 4GTMB 3ZMCA 3E30B 3N46F 5DZ2A 3Q73B 3Q7AB 2Q58A 2VF6A 3P5RA 4H5EF 4TXTA 3VJEA 5ILKA 1NL4B 4RYPA 5ILJA 5ILZA 2AZKA 1G6IA 4H5CF 1O79A 3OABA 3TFPA 3EUVB 3WKHA 3KRFB 3LZ9A 1SA4B 3M78A 3KROB 3TFNA 3E6UA 4NG6A 3M00A 3KRAA 1YYSA 3E33B 2H6GB 2RGKA 5JMDA 4JZBA 3IPIA 3E32B 1RWAA 3G4FA 5EAUA 4LNBB 3ASXA 3Q78B 1D8DB 1S64B 2A73B 3P8LA 4E1YA 3VJDA 4F10A 3WUXA 2J1PA 4E1EA 3WKFA 3WEGA 1H54A 1TN8B 3N49F 4GTSB 4E9UA 2H8OA 1J0MA 1OJNA 3KRFA 4D4AA 2DRRA 3KROA 5HN8A 2Q9ZA 1MZCB 2JJBA 4DWGA 4KTRA 1H37A 1LF6A 3PMMA 2Z4XA 4LLTA 1TN7B 2RI8A 2XQWA 1RTRA 4KTPA 3UCAA 2E8TA 3WJKA 4MMHA 1EZFA 3S4CA 1YYQA 1VG2A 2E4OA 3WIQA 3PYBA 1KKTA 2E8VA 4H5DF 3ZCDA 4DXJA 4UMJA 1I8QA 3QKCA 5B0MA 2BBCA 4MU9A 3C72B 1FT1B 4FXKB 5AGDA 2JF4A 4JJJA 1JCQB 1K72A 4RXAA 5IMPA 4C1SA 2B4FA 2EAEA 3KRCB 2BB5A 4KVWA 5GY3A 3H2WA 3K7XA 3S4DA 4LIXA 2GOXA 3M0GA 4KQUA 3QT3A 1QSJA 3WEKA 2OA6A 1GAHA 1UT9A 3ZL6A 1QBQB 1N7QA 1KSCA 5AYPA 5DJPF 5IL3A 5IMNA 4P0XA 5KSXF 4WVBA 3NF2A 1GA2A 4OJZA 5EROA 3CIHA 4RXCA 3KRCA 5JMFA 2DH4A 3W7UA 2ZISB 4EA1A 4AYQA 4DOEA 3WEIA 3E80A 4AYRA 5CA3A 2XWBB 1V7VA 3M77A 1N7RA 3SFYB 3ANJA 1TNZB 1KIZA 2FV1A 5JA0F 1HXCA 2J5CA 1FCEA 3WSAA 3ADZA 1G9GA 2CQSA 4GA3A 1WU4A 4ZRPA 4DODA 4QPFA 4V1SA 3RJ3A 2NOJA 3ID0A 3A0OA 1CB8A 2Q9YA 3SDRA 1D8EB 3Q7FB 2AEKA 1WY0A 5JV2F 1TNUB 3DSUB 4WU0A 3WCAA 5CZLA 1TNOB 3WCEA 4OZWA 3BNXA 3DYGA 2V8JA 3Q1OA 1G9JA 2NVPA 1NC5A 4FP4A 1OJOA 2F0YB 2GZ6A 1EGUA 1HXGA 2X03A 4Q2BA 3VXDA 5E2JA 3GZKA 3M7BA 4OMGA 5H9DA 1X81B 2VN7A 3LMDA 1XW2A 3RRSA 1V4HA 2Z50A 5DW7A 3WIRA 4Z4LA 5CG5A 1RWHA 5IM1A 4LLSA 1JS4A 4L2XF 2JG0A 1FAEA 3QSPA 3IBAA 1RWFA 4L0GA 5CG6A 4P0WA 1LXKA 2F8CF 3DYFA 1GXMA 1N21A 1H14A 2EACA 3OABB 2CQTA 1JFGA 3EGTA 3Q2QA 3KRAB 5JUZF 3ICNA 5AFXA 3KSQB 4KKIA 2ZCSA 1IA6A 4LNGB 3ACYA 1WU6A 4L9PB 4GP2A 2Z4WA 1HZFA 2ZIRB 5JPMB 1DGPA 3E7JA 3QDEA 2Z7HA 4YCRA 2O1OA 2Z4ZA 1N7OA 3W7SA 3SFXB 3S9VA 3PZ4B 1O1SB 3ICMA 3NRIA 1W3YA 3M74A 3BNYA 1AYXA 1DCEB 4LNVA 3Q79B 1RWGA 3QXQA 3LLWA 4ZG8A 2V8IA 1O6HA 1N4QB 3RYWA 1QQFA 2F7MF 3PKOA 4OMHA 3WEHA 3E73A 1X9DA 2H6HB 3EZ8A 3SQCA 1YHMA 1V5DA 2PS5A 4XQRF 3WCGA 3PZ3B 4M76A 3LGKA 1FO3A 1J0NA 2PS7A 4RXEA 4Q23A 3CKEA 3ACWA 4DHDA 1XWQA 3RYEA 4V1RA 2OKXA 3P5PA 5ILDA 1H13A 4GTRB 3WCMA 5DHIA 4MMIA 3DSXB 3ANKA 4CE7A 3PH7A 4AYPA 5EASA 4FJQA 4KK2A 1RQ5A 2D8LA 1AGMA 4YDOB 3M72A 1UBVA 2XFGA 4ONTA 1IA7A 2PS6A 2D5JA 2PN5A 4KWDA 3HXEB 3DSTB 4EA0A 3SDUA 5HN7A 4XUVA 2Q1FA 1LXMA 3NPKA 4N1ZF 3N3DA 3H7LA 5DJRF 3WCCA 3W7TA 4LPGF 1UBYA 4NKEA 3SDTA 4KFAA 3WSBA 4GTQB 1TN6B 2E90A 4LFEA 3DSVB 2F9KF 4JXYA 3WKIA 4LFGA 4LZ3A 3QPFA 4CJ1A 3W7WA 2WYNA 4P0VA 5ERNA 2XWJB 2FBAA 3EFQA 1FBOA 2WINB 4OK4A 2E94A 2P1CA 3HXCB 4RXDA 3M7LA 4DWBA 3N5JF 3N3LF 1KS8A 3P8RA 5AELA 4KPDA 1N1BA 3RMGA 3G4DA 3WCHA 1IS9A 2Z78A 3ACXA 3N1VF 3P2CA 3MZVA 3LDWA 3WEFA 4Q88A 1LOHA 2E24A 2WIIB 5I1UA 4J5TA 3HXDB 3N5HF 3WC3A 4OGUA 2H6IB 4BOJA 1FBWA 2FORA 1F9OA 3GLYA 4OKMA 1TNBB 1FT2B 4OZVA 4FXGB 3MAVA 4NFKF 3KSLB 3AFJA 4QT9A 3SDVA 2ZZRA 3G6JB 1N22A 1SA5B 5B03A 4XQTF 1DOGA 4JXNA 1GHQA 3AQ0A 1XWTA 1HV6A 1N4RB 3D5SA 3EU8A 4GTVB 4ZH1A 3S4BA 2EADA 3VSMA 4LZCA 5DHKA 5IK0A 1KREA 1V7WA 4KKMA 3DRAB 5EATA 3HXFB 5B00A 3KRPA 1C3DA 1V4JA 4LUUA 5ER8A 4DZWA 3H3KA 3LGZB 1JFAA 2Q80A 1S63B 3WEJA 1YYTA 4BOKA 3WKGA 2BRWA 5B0KA 3E34B 1UBWA 1YHKA 5FO7B 2Z07A 4FNVA 3RX5A 4F13A 3W7XA 4D4BA 3Q2ZA 1X1IA 1H39A 2FV0A 3RENA 1L2AA 1HM2A 1HM3A 3LK5A 3LVSA 4XQSF 1V5CA 1LD8B 5DGRA 3OACA 4K10A 1H3AA 2IEJB 3KQ4A 3NFVA 2E8WA 5FO9B 1RQIA 5DGSF 2DROA 2AETA 2OPNA 3AQCB 1KIYA 3Q30A 3VJBA 1CLCA 1GAIA 5IN8A 1JCRB 2E93A 2ONGA 1YV5A 2Z4YA 3A3VA 3HXBB 5JV0F 1H3CA 5ILYA 4CJ0A 2G02A 1HM7A 5E8HA 4LTVA 1W6KA 3B7LA 4JVJF 2RI9A 3S4AA 4MC0A 1O6RA 3PZ2B 3V1VA 3X17A 3ACSA 3KLSA 3RBMA 1H35A 3M7CA 3TC1A 4LZ0A 2SQCA 1GXOA 5E8LA 2E92A 3M75A 3WE9A 1WKZA 3WCDA 3EU5B 3WCBA 1KSDA 5B0IA 4KKJA 4WVAA 4NEIA 1N1ZA 5A0IA 4OK2A 1KFGA 1HN0A 3VJCA 3QG0A 2PS8A 3EZ3A 3V66A 4N9UA 1TF4A 1N20A 4JZXA 3VJ8A 5B01A 1KZPB 2GH4A 1O6QA 2H6FB 2ZBLA 3VJ9A 4AYOA 5HNAA 1VG7A 2QISA 4MBGB 2FUTA 1YHLA 3DSSB 5MEHA 4KVYA 1N94B 1H12A 3AE0A 1N7NA 1H36A 1SQCA 4Z4JA 4GTTB 3VW5A 5C05A 4YDEB 4ZQ8A 1R76A 3PDEA 1TNYB 2WY7A 3E37B 3QQVA 1LF9A 1N95B 3CU7A 1V4EA 2F8ZF 3WCLA 1WL2A 4LOBA 2ZY1A 2ZCRA 1KWFA 2FTZA 4PVXF 1VG3A 2OGDA 3AQBB 4TF4A 3M76A 1F1SA 1WMWA 5IMIA 3LSNA 3QFZA 2FUQA 3TF4A 3ANIA 3WJOA 2AFAA 4GAXA 2E8XA 3K11A 3VSNA 2AZJA 3WIWA 3W5NA 1N4PB 4LTZA 1PS1A 3DPYB 4DEMF 2F6DA 1HM4A 3N45F 1N23A 3P41A 2VN4A 4NKFA 1N7PA 5DGQA 1VD5A 3APZA 4PVYF 4FUSA 2WDAA 4NUAA 2Z52A 1O5MB 4GP1A 1WL3A 3SAEA 1FMIA 1UG9A 3WCFA 4F6VA 3RSYA 2AHFA 3N0GA 3ACTA 1O1RB 3NPRA 1CEMA 5IK6A 2QNOA 1X1JA 1YYUA 2G0DA 1FPSA 2J1OA 4ZRQA 3LOMA 2AHGA 3LEEA 3QFYA 4LXWA 1RQJA 1N9AB 2BRVX 3M71A 1WU5A 2Z7IA 3TFVA 2F94F 1LTXB 3M9UA 4LA5A 3RX8A 1FO2A 5GZKA 3ICKA 5HN9A 5IK9A 1O1TB 3KRPB 3M02A 2DRSA 5CD2A 3AFLA 3LG5A 1HMWA 4L6XA 1V7XA 3WCIA 1X1HA 3QXFA 1V4KA 5DGMF 5M7YA 1WL1A 3W5MA 4WVCA 2A8ZA 4NFIF 2E8UA 5AHUB 2I07B 3W7FA 1YJ4A 2V8KA 3DYHA 1KZOB 2YIKA 5FO8B 4QXSF 3V1XA 3WCJA 3OACB 1HX9A 1RWCA 4D94A 5IL8A 2P0VA 3S4JA 1VG4A 4E9ZA 1N4SB 2R2LB 4D4CA 3D3IA 4EA2A 5IKAA 5FOBB 4LA6A 4KUXA 3M01A 3D5RA 4LPHF 5B0JA 1DL2A 4MC8A 1L1YA 1NXCA 2OPMA 5JV1F 2BB6A 1V4IA 1F9DA 3WJNA 3RX7A 3LJIA 3N0FA 3CP6A 1OJPA 1H3BA 3KB9A 1HXAA 1N24A 4F62A 1C82A 3GT5A 2DRQA 4RNQA 3Q75B 5ERMA 4KQ5A 3WC9A 3PYAA 1FPPB 2WCOA 2ONHA 1RW9A 1UMPA 4KQSA 2PMVA 4MC3A 4GTPB 3EQAA 5ILIA 2E22A 3VJAA
chains in the Genus database with same CATH topology
5B02A 1YYRA 5IVGA 2E91A 4KVIA 4DI5A 1WL0A 2ZEUA 2EWGA 2AELA 3ZMBA 4OKZA 1ZW5A 4JYXA 2ZCOA 3ICZA 1UBXA 5E8KA 3SDQA 3OYRA 4KPJA 3TS7A 3CC9A 1DI1A 2F92F 1YQ7A 3N1WF 5DJVF 3ZOUA 2AZLA 4WK5A 2ZEVA 3N6KF 5A0JA 4HD1A 5A0KA 5B0LA 4KVDA 5ILHA 2F89F 4F6XA 2Z4VA 4LFVF 5IKHA 2PS4A 2ZCQA 3KBKA 2RAHA 2I19A 1VG6A 2E95A 4NFJF 5DIQF 5DGNF 3ZMCA 3N46F 5DZ2A 2Q58A 2VF6A 3P5RA 4H5EF 3VJEA 5ILKA 4RYPA 5ILJA 5ILZA 2AZKA 4H5CF 3OABA 3TFPA 3KRFB 3LZ9A 3KROB 3TFNA 4NG6A 3M00A 3KRAA 1YYSA 4JZBA 3IPIA 3G4FA 5EAUA 3ASXA 3P8LA 3VJDA 2J1PA 4E1EA 3WEGA 3N49F 4E9UA 2H8OA 3KRFA 3KROA 5HN8A 2Q9ZA 4DWGA 2Z4XA 4LLTA 1RTRA 3UCAA 2E8TA 3WJKA 1EZFA 1YYQA 1VG2A 2E4OA 3PYBA 2E8VA 4H5DF 3ZCDA 4DXJA 4UMJA 3QKCA 5B0MA 4RXAA 5IMPA 3KRCB 4KVWA 4LIXA 3M0GA 4KQUA 3WEKA 2OA6A 3ZL6A 5AYPA 5DJPF 5IL3A 5IMNA 4P0XA 5KSXF 3NF2A 5EROA 4RXCA 3KRCA 2DH4A 4EA1A 3WEIA 1KIZA 5JA0F 1HXCA 2J5CA 3WSAA 3ADZA 4GA3A 4QPFA 3ID0A 2Q9YA 3SDRA 2AEKA 1WY0A 5JV2F 3WCAA 3WCEA 3BNXA 3DYGA 3Q1OA 4FP4A 1HXGA 4OMGA 5H9DA 3LMDA 1V4HA 2Z50A 5DW7A 5CG5A 5IM1A 4LLSA 4L2XF 3IBAA 5CG6A 4P0WA 2F8CF 3DYFA 1N21A 3OABB 1JFGA 3EGTA 3Q2QA 3KRAB 5JUZF 3ICNA 5AFXA 2ZCSA 3ACYA 4GP2A 2Z4WA 1DGPA 2Z7HA 2O1OA 2Z4ZA 3S9VA 3ICMA 3NRIA 3BNYA 3LLWA 3RYWA 2F7MF 3PKOA 4OMHA 3WEHA 1YHMA 2PS5A 4XQRF 3WCGA 3LGKA 2PS7A 4RXEA 4Q23A 3CKEA 3ACWA 4DHDA 3RYEA 3P5PA 5ILDA 3WCMA 5DHIA 3PH7A 5EASA 4FJQA 4KK2A 1UBVA 2PS6A 4KWDA 4EA0A 3SDUA 5HN7A 3NPKA 4N1ZF 3N3DA 5DJRF 3WCCA 4LPGF 1UBYA 4NKEA 3SDTA 4KFAA 3WSBA 2E90A 4LFEA 2F9KF 4JXYA 4LFGA 4LZ3A 4P0VA 5ERNA 3EFQA 2E94A 2P1CA 4RXDA 4DWBA 3N5JF 3N3LF 3P8RA 5AELA 4KPDA 1N1BA 3RMGA 3G4DA 3WCHA 2Z78A 3ACXA 3N1VF 3MZVA 3LDWA 3WEFA 5I1UA 3N5HF 4OGUA 2FORA 4OKMA 3MAVA 4NFKF 3SDVA 1N22A 5B03A 4XQTF 4JXNA 3AQ0A 4LZCA 5DHKA 5IK0A 4KKMA 5EATA 5B00A 3KRPA 1V4JA 4LUUA 5ER8A 4DZWA 3LGZB 1JFAA 2Q80A 3WEJA 1YYTA 5B0KA 1UBWA 1YHKA 3Q2ZA 3LK5A 3LVSA 4XQSF 3OACA 4K10A 2E8WA 1RQIA 5DGSF 2AETA 2OPNA 3AQCB 1KIYA 3Q30A 3VJBA 5IN8A 2E93A 2ONGA 1YV5A 2Z4YA 5JV0F 5ILYA 1HM7A 5E8HA 4LTVA 3B7LA 4JVJF 4MC0A 3V1VA 3RBMA 3TC1A 4LZ0A 5E8LA 2E92A 3WE9A 1WKZA 3WCDA 3WCBA 5B0IA 1N1ZA 5A0IA 3VJCA 2PS8A 3EZ3A 3V66A 4N9UA 1N20A 4JZXA 3VJ8A 5B01A 3VJ9A 5HNAA 1VG7A 2QISA 1YHLA 4KVYA 3AE0A 5C05A 4ZQ8A 3PDEA 3QQVA 1V4EA 2F8ZF 3WCLA 1WL2A 4LOBA 2ZY1A 2ZCRA 2FTZA 4PVXF 1VG3A 2OGDA 3AQBB 1WMWA 5IMIA 3LSNA 3WJOA 4GAXA 2E8XA 2AZJA 4LTZA 1PS1A 4DEMF 1HM4A 3N45F 1N23A 3P41A 4NKFA 3APZA 4PVYF 4NUAA 2Z52A 4GP1A 1WL3A 3SAEA 3WCFA 4F6VA 3N0GA 3NPRA 5IK6A 1YYUA 1FPSA 2J1OA 3LOMA 3LEEA 4LXWA 1RQJA 2Z7IA 3TFVA 2F94F 3M9UA 4LA5A 3ICKA 5HN9A 5IK9A 3KRPB 3M02A 3LG5A 3WCIA 1V4KA 5DGMF 1WL1A 4NFIF 2E8UA 5AHUB 3W7FA 1YJ4A 3DYHA 4QXSF 3V1XA 3WCJA 3OACB 1HX9A 5IL8A 3S4JA 1VG4A 4E9ZA 4EA2A 5IKAA 4LA6A 4KUXA 3M01A 4LPHF 5B0JA 4MC8A 2OPMA 5JV1F 1V4IA 3WJNA 3LJIA 3N0FA 3CP6A 3KB9A 1HXAA 1N24A 4F62A 4RNQA 5ERMA 4KQ5A 3WC9A 3PYAA 2ONHA 4KQSA 4MC3A 5ILIA 3VJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B02 A;  1YYR A;  5IVG A;  2E91 A;  4KVI A;  4DI5 A;  1WL0 A;  2ZEU A;  2EWG A;  2AEL A;  3ZMB A;  4OKZ A;  1ZW5 A;  4JYX A;  2ZCO A;  3ICZ A;  1UBX A;  5E8K A;  3SDQ A;  3OYR A;  4KPJ A;  3TS7 A;  3CC9 A;  1DI1 A;  2F92 F;  1YQ7 A;  3N1W F;  5DJV F;  3ZOU A;  2AZL A;  4WK5 A;  2ZEV A;  3N6K F;  5A0J A;  4HD1 A;  5A0K A;  5B0L A;  4KVD A;  5ILH A;  2F89 F;  4F6X A;  2Z4V A;  4LFV F;  5IKH A;  2PS4 A;  2ZCQ A;  3KBK A;  2RAH A;  2I19 A;  1VG6 A;  2E95 A;  4NFJ F;  5DIQ F;  5DGN F;  3ZMC A;  3N46 F;  5DZ2 A;  2Q58 A;  2VF6 A;  3P5R A;  4H5E F;  3VJE A;  5ILK A;  4RYP A;  5ILJ A;  5ILZ A;  2AZK A;  4H5C F;  3OAB A;  3TFP A;  3KRF B;  3LZ9 A;  3KRO B;  3TFN A;  4NG6 A;  3M00 A;  3KRA A;  1YYS A;  4JZB A;  3IPI A;  3G4F A;  5EAU A;  3ASX A;  3P8L A;  3VJD A;  2J1P A;  4E1E A;  3WEG A;  3N49 F;  4E9U A;  2H8O A;  3KRF A;  3KRO A;  5HN8 A;  2Q9Z A;  4DWG A;  2Z4X A;  4LLT A;  1RTR A;  3UCA A;  2E8T A;  3WJK A;  1EZF A;  1YYQ A;  1VG2 A;  2E4O A;  3PYB A;  2E8V A;  4H5D F;  3ZCD A;  4DXJ A;  4UMJ A;  3QKC A;  5B0M A;  4RXA A;  5IMP A;  3KRC B;  4KVW A;  4LIX A;  3M0G A;  4KQU A;  3WEK A;  2OA6 A;  3ZL6 A;  5AYP A;  5DJP F;  5IL3 A;  5IMN A;  4P0X A;  5KSX F;  3NF2 A;  5ERO A;  4RXC A;  3KRC A;  2DH4 A;  4EA1 A;  3WEI A;  1KIZ A;  5JA0 F;  1HXC A;  2J5C A;  3WSA A;  3ADZ A;  4GA3 A;  4QPF A;  3ID0 A;  2Q9Y A;  3SDR A;  2AEK A;  1WY0 A;  5JV2 F;  3WCA A;  3WCE A;  3BNX A;  3DYG A;  3Q1O A;  4FP4 A;  1HXG A;  4OMG A;  5H9D A;  3LMD A;  1V4H A;  2Z50 A;  5DW7 A;  5CG5 A;  5IM1 A;  4LLS A;  4L2X F;  3IBA A;  5CG6 A;  4P0W A;  2F8C F;  3DYF A;  1N21 A;  3OAB B;  1JFG A;  3EGT A;  3Q2Q A;  3KRA B;  5JUZ F;  3ICN A;  5AFX A;  2ZCS A;  3ACY A;  4GP2 A;  2Z4W A;  1DGP A;  2Z7H A;  2O1O A;  2Z4Z A;  3S9V A;  3ICM A;  3NRI A;  3BNY A;  3LLW A;  3RYW A;  2F7M F;  3PKO A;  4OMH A;  3WEH A;  1YHM A;  2PS5 A;  4XQR F;  3WCG A;  3LGK A;  2PS7 A;  4RXE A;  4Q23 A;  3CKE A;  3ACW A;  4DHD A;  3RYE A;  3P5P A;  5ILD A;  3WCM A;  5DHI A;  3PH7 A;  5EAS A;  4FJQ A;  4KK2 A;  1UBV A;  2PS6 A;  4KWD A;  4EA0 A;  3SDU A;  5HN7 A;  3NPK A;  4N1Z F;  3N3D A;  5DJR F;  3WCC A;  4LPG F;  1UBY A;  4NKE A;  3SDT A;  4KFA A;  3WSB A;  2E90 A;  4LFE A;  2F9K F;  4JXY A;  4LFG A;  4LZ3 A;  4P0V A;  5ERN A;  3EFQ A;  2E94 A;  2P1C A;  4RXD A;  4DWB A;  3N5J F;  3N3L F;  3P8R A;  5AEL A;  4KPD A;  1N1B A;  3RMG A;  3G4D A;  3WCH A;  2Z78 A;  3ACX A;  3N1V F;  3MZV A;  3LDW A;  3WEF A;  5I1U A;  3N5H F;  4OGU A;  2FOR A;  4OKM A;  3MAV A;  4NFK F;  3SDV A;  1N22 A;  5B03 A;  4XQT F;  4JXN A;  3AQ0 A;  4LZC A;  5DHK A;  5IK0 A;  4KKM A;  5EAT A;  5B00 A;  3KRP A;  1V4J A;  4LUU A;  5ER8 A;  4DZW A;  3LGZ B;  1JFA A;  2Q80 A;  3WEJ A;  1YYT A;  5B0K A;  1UBW A;  1YHK A;  3Q2Z A;  3LK5 A;  3LVS A;  4XQS F;  3OAC A;  4K10 A;  2E8W A;  1RQI A;  5DGS F;  2AET A;  2OPN A;  3AQC B;  1KIY A;  3Q30 A;  3VJB A;  5IN8 A;  2E93 A;  2ONG A;  1YV5 A;  2Z4Y A;  5JV0 F;  5ILY A;  1HM7 A;  5E8H A;  4LTV A;  3B7L A;  4JVJ F;  4MC0 A;  3V1V A;  3RBM A;  3TC1 A;  4LZ0 A;  5E8L A;  2E92 A;  3WE9 A;  1WKZ A;  3WCD A;  3WCB A;  5B0I A;  1N1Z A;  5A0I A;  3VJC A;  2PS8 A;  3EZ3 A;  3V66 A;  4N9U A;  1N20 A;  4JZX A;  3VJ8 A;  5B01 A;  3VJ9 A;  5HNA A;  1VG7 A;  2QIS A;  1YHL A;  4KVY A;  3AE0 A;  5C05 A;  4ZQ8 A;  3PDE A;  3QQV A;  1V4E A;  2F8Z F;  3WCL A;  1WL2 A;  4LOB A;  2ZY1 A;  2ZCR A;  2FTZ A;  4PVX F;  1VG3 A;  2OGD A;  3AQB B;  1WMW A;  5IMI A;  3LSN A;  3WJO A;  4GAX A;  2E8X A;  2AZJ A;  4LTZ A;  1PS1 A;  4DEM F;  1HM4 A;  3N45 F;  1N23 A;  3P41 A;  4NKF A;  3APZ A;  4PVY F;  4NUA A;  2Z52 A;  4GP1 A;  1WL3 A;  3SAE A;  3WCF A;  4F6V A;  3N0G A;  3NPR A;  5IK6 A;  1YYU A;  1FPS A;  2J1O A;  3LOM A;  3LEE A;  4LXW A;  1RQJ A;  2Z7I A;  3TFV A;  2F94 F;  3M9U A;  4LA5 A;  3ICK A;  5HN9 A;  5IK9 A;  3KRP B;  3M02 A;  3LG5 A;  3WCI A;  1V4K A;  5DGM F;  1WL1 A;  4NFI F;  2E8U A;  5AHU B;  3W7F A;  1YJ4 A;  3DYH A;  4QXS F;  3V1X A;  3WCJ A;  3OAC B;  1HX9 A;  5IL8 A;  3S4J A;  1VG4 A;  4E9Z A;  4EA2 A;  5IKA A;  4LA6 A;  4KUX A;  3M01 A;  4LPH F;  5B0J A;  4MC8 A;  2OPM A;  5JV1 F;  1V4I A;  3WJN A;  3LJI A;  3N0F A;  3CP6 A;  3KB9 A;  1HXA A;  1N24 A;  4F62 A;  4RNQ A;  5ERM A;  4KQ5 A;  3WC9 A;  3PYA A;  2ONH A;  4KQS A;  4MC3 A;  5ILI A;  3VJA A; 
#chains in the Genus database with same CATH topology
 2B39 A;  5B02 A;  3M7E A;  1YYR A;  1WZZ A;  5IVG A;  2E91 A;  4KVI A;  3M73 A;  4DI5 A;  1W6J A;  3NNB A;  2V3N A;  1WL0 A;  2ZEU A;  2EWG A;  2AEL A;  1QAZ A;  3ZMB A;  4OKZ A;  1ZW5 A;  1GLM A;  5GW7 A;  4JYX A;  2ZCO A;  3ICZ A;  1UBX A;  5E8K A;  3SDQ A;  3OYR A;  4KPJ A;  3TS7 A;  3CC9 A;  1DI1 A;  2F92 F;  5M7I A;  2WY8 A;  3ON6 A;  1YQ7 A;  3N1W F;  3T33 A;  1LD7 B;  5DJV F;  3ZOU A;  3QWT A;  2AZL A;  4WK5 A;  2ZEV A;  3N6K F;  5A0J A;  4HD1 A;  5A0K A;  5B0L A;  1ULV A;  2V3P A;  4KVD A;  1F9G A;  1GXN A;  3OXU A;  5ILH A;  2F89 F;  4EL8 A;  4F6X A;  4GL3 A;  4EHM B;  3QRY A;  2Z4V A;  4LFV F;  4ZH5 A;  5JPN B;  5IKH A;  1FP3 A;  2BED B;  2PS4 A;  2EAB A;  2ZCQ A;  1KRF A;  1JCS B;  4GTO B;  2BRP A;  1HMU A;  1OJM A;  4D4D A;  3KBK A;  2RAH A;  1G87 A;  2FUZ A;  3DSW B;  2I19 A;  1GSZ A;  1VG6 A;  2E95 A;  4NFJ F;  1NI1 B;  3OED A;  3PZ1 B;  3QT9 A;  5KKB A;  5DIQ F;  1HCU A;  5DGN F;  4GTM B;  3ZMC A;  3E30 B;  3N46 F;  5DZ2 A;  3Q73 B;  3Q7A B;  2Q58 A;  2VF6 A;  3P5R A;  4H5E F;  4TXT A;  3VJE A;  5ILK A;  1NL4 B;  4RYP A;  5ILJ A;  5ILZ A;  2AZK A;  1G6I A;  4H5C F;  1O79 A;  3OAB A;  3TFP A;  3EUV B;  3WKH A;  3KRF B;  3LZ9 A;  1SA4 B;  3M78 A;  3KRO B;  3TFN A;  3E6U A;  4NG6 A;  3M00 A;  3KRA A;  1YYS A;  3E33 B;  2H6G B;  2RGK A;  5JMD A;  4JZB A;  3IPI A;  3E32 B;  1RWA A;  3G4F A;  5EAU A;  4LNB B;  3ASX A;  3Q78 B;  1D8D B;  1S64 B;  2A73 B;  3P8L A;  4E1Y A;  3VJD A;  4F10 A;  3WUX A;  2J1P A;  4E1E A;  3WKF A;  3WEG A;  1H54 A;  1TN8 B;  3N49 F;  4GTS B;  4E9U A;  2H8O A;  1J0M A;  1OJN A;  3KRF A;  4D4A A;  2DRR A;  3KRO A;  5HN8 A;  2Q9Z A;  1MZC B;  2JJB A;  4DWG A;  4KTR A;  1H37 A;  1LF6 A;  3PMM A;  2Z4X A;  4LLT A;  1TN7 B;  2RI8 A;  2XQW A;  1RTR A;  4KTP A;  3UCA A;  2E8T A;  3WJK A;  4MMH A;  1EZF A;  3S4C A;  1YYQ A;  1VG2 A;  2E4O A;  3WIQ A;  3PYB A;  1KKT A;  2E8V A;  4H5D F;  3ZCD A;  4DXJ A;  4UMJ A;  1I8Q A;  3QKC A;  5B0M A;  2BBC A;  4MU9 A;  3C72 B;  1FT1 B;  4FXK B;  5AGD A;  2JF4 A;  4JJJ A;  1JCQ B;  1K72 A;  4RXA A;  5IMP A;  4C1S A;  2B4F A;  2EAE A;  3KRC B;  2BB5 A;  4KVW A;  5GY3 A;  3H2W A;  3K7X A;  3S4D A;  4LIX A;  2GOX A;  3M0G A;  4KQU A;  3QT3 A;  1QSJ A;  3WEK A;  2OA6 A;  1GAH A;  1UT9 A;  3ZL6 A;  1QBQ B;  1N7Q A;  1KSC A;  5AYP A;  5DJP F;  5IL3 A;  5IMN A;  4P0X A;  5KSX F;  4WVB A;  3NF2 A;  1GA2 A;  4OJZ A;  5ERO A;  3CIH A;  4RXC A;  3KRC A;  5JMF A;  2DH4 A;  3W7U A;  2ZIS B;  4EA1 A;  4AYQ A;  4DOE A;  3WEI A;  3E80 A;  4AYR A;  5CA3 A;  2XWB B;  1V7V A;  3M77 A;  1N7R A;  3SFY B;  3ANJ A;  1TNZ B;  1KIZ A;  2FV1 A;  5JA0 F;  1HXC A;  2J5C A;  1FCE A;  3WSA A;  3ADZ A;  1G9G A;  2CQS A;  4GA3 A;  1WU4 A;  4ZRP A;  4DOD A;  4QPF A;  4V1S A;  3RJ3 A;  2NOJ A;  3ID0 A;  3A0O A;  1CB8 A;  2Q9Y A;  3SDR A;  1D8E B;  3Q7F B;  2AEK A;  1WY0 A;  5JV2 F;  1TNU B;  3DSU B;  4WU0 A;  3WCA A;  5CZL A;  1TNO B;  3WCE A;  4OZW A;  3BNX A;  3DYG A;  2V8J A;  3Q1O A;  1G9J A;  2NVP A;  1NC5 A;  4FP4 A;  1OJO A;  2F0Y B;  2GZ6 A;  1EGU A;  1HXG A;  2X03 A;  4Q2B A;  3VXD A;  5E2J A;  3GZK A;  3M7B A;  4OMG A;  5H9D A;  1X81 B;  2VN7 A;  3LMD A;  1XW2 A;  3RRS A;  1V4H A;  2Z50 A;  5DW7 A;  3WIR A;  4Z4L A;  5CG5 A;  1RWH A;  5IM1 A;  4LLS A;  1JS4 A;  4L2X F;  2JG0 A;  1FAE A;  3QSP A;  3IBA A;  1RWF A;  4L0G A;  5CG6 A;  4P0W A;  1LXK A;  2F8C F;  3DYF A;  1GXM A;  1N21 A;  1H14 A;  2EAC A;  3OAB B;  2CQT A;  1JFG A;  3EGT A;  3Q2Q A;  3KRA B;  5JUZ F;  3ICN A;  5AFX A;  3KSQ B;  4KKI A;  2ZCS A;  1IA6 A;  4LNG B;  3ACY A;  1WU6 A;  4L9P B;  4GP2 A;  2Z4W A;  1HZF A;  2ZIR B;  5JPM B;  1DGP A;  3E7J A;  3QDE A;  2Z7H A;  4YCR A;  2O1O A;  2Z4Z A;  1N7O A;  3W7S A;  3SFX B;  3S9V A;  3PZ4 B;  1O1S B;  3ICM A;  3NRI A;  1W3Y A;  3M74 A;  3BNY A;  1AYX A;  1DCE B;  4LNV A;  3Q79 B;  1RWG A;  3QXQ A;  3LLW A;  4ZG8 A;  2V8I A;  1O6H A;  1N4Q B;  3RYW A;  1QQF A;  2F7M F;  3PKO A;  4OMH A;  3WEH A;  3E73 A;  1X9D A;  2H6H B;  3EZ8 A;  3SQC A;  1YHM A;  1V5D A;  2PS5 A;  4XQR F;  3WCG A;  3PZ3 B;  4M76 A;  3LGK A;  1FO3 A;  1J0N A;  2PS7 A;  4RXE A;  4Q23 A;  3CKE A;  3ACW A;  4DHD A;  1XWQ A;  3RYE A;  4V1R A;  2OKX A;  3P5P A;  5ILD A;  1H13 A;  4GTR B;  3WCM A;  5DHI A;  4MMI A;  3DSX B;  3ANK A;  4CE7 A;  3PH7 A;  4AYP A;  5EAS A;  4FJQ A;  4KK2 A;  1RQ5 A;  2D8L A;  1AGM A;  4YDO B;  3M72 A;  1UBV A;  2XFG A;  4ONT A;  1IA7 A;  2PS6 A;  2D5J A;  2PN5 A;  4KWD A;  3HXE B;  3DST B;  4EA0 A;  3SDU A;  5HN7 A;  4XUV A;  2Q1F A;  1LXM A;  3NPK A;  4N1Z F;  3N3D A;  3H7L A;  5DJR F;  3WCC A;  3W7T A;  4LPG F;  1UBY A;  4NKE A;  3SDT A;  4KFA A;  3WSB A;  4GTQ B;  1TN6 B;  2E90 A;  4LFE A;  3DSV B;  2F9K F;  4JXY A;  3WKI A;  4LFG A;  4LZ3 A;  3QPF A;  4CJ1 A;  3W7W A;  2WYN A;  4P0V A;  5ERN A;  2XWJ B;  2FBA A;  3EFQ A;  1FBO A;  2WIN B;  4OK4 A;  2E94 A;  2P1C A;  3HXC B;  4RXD A;  3M7L A;  4DWB A;  3N5J F;  3N3L F;  1KS8 A;  3P8R A;  5AEL A;  4KPD A;  1N1B A;  3RMG A;  3G4D A;  3WCH A;  1IS9 A;  2Z78 A;  3ACX A;  3N1V F;  3P2C A;  3MZV A;  3LDW A;  3WEF A;  4Q88 A;  1LOH A;  2E24 A;  2WII B;  5I1U A;  4J5T A;  3HXD B;  3N5H F;  3WC3 A;  4OGU A;  2H6I B;  4BOJ A;  1FBW A;  2FOR A;  1F9O A;  3GLY A;  4OKM A;  1TNB B;  1FT2 B;  4OZV A;  4FXG B;  3MAV A;  4NFK F;  3KSL B;  3AFJ A;  4QT9 A;  3SDV A;  2ZZR A;  3G6J B;  1N22 A;  1SA5 B;  5B03 A;  4XQT F;  1DOG A;  4JXN A;  1GHQ A;  3AQ0 A;  1XWT A;  1HV6 A;  1N4R B;  3D5S A;  3EU8 A;  4GTV B;  4ZH1 A;  3S4B A;  2EAD A;  3VSM A;  4LZC A;  5DHK A;  5IK0 A;  1KRE A;  1V7W A;  4KKM A;  3DRA B;  5EAT A;  3HXF B;  5B00 A;  3KRP A;  1C3D A;  1V4J A;  4LUU A;  5ER8 A;  4DZW A;  3H3K A;  3LGZ B;  1JFA A;  2Q80 A;  1S63 B;  3WEJ A;  1YYT A;  4BOK A;  3WKG A;  2BRW A;  5B0K A;  3E34 B;  1UBW A;  1YHK A;  5FO7 B;  2Z07 A;  4FNV A;  3RX5 A;  4F13 A;  3W7X A;  4D4B A;  3Q2Z A;  1X1I A;  1H39 A;  2FV0 A;  3REN A;  1L2A A;  1HM2 A;  1HM3 A;  3LK5 A;  3LVS A;  4XQS F;  1V5C A;  1LD8 B;  5DGR A;  3OAC A;  4K10 A;  1H3A A;  2IEJ B;  3KQ4 A;  3NFV A;  2E8W A;  5FO9 B;  1RQI A;  5DGS F;  2DRO A;  2AET A;  2OPN A;  3AQC B;  1KIY A;  3Q30 A;  3VJB A;  1CLC A;  1GAI A;  5IN8 A;  1JCR B;  2E93 A;  2ONG A;  1YV5 A;  2Z4Y A;  3A3V A;  3HXB B;  5JV0 F;  1H3C A;  5ILY A;  4CJ0 A;  2G02 A;  1HM7 A;  5E8H A;  4LTV A;  1W6K A;  3B7L A;  4JVJ F;  2RI9 A;  3S4A A;  4MC0 A;  1O6R A;  3PZ2 B;  3V1V A;  3X17 A;  3ACS A;  3KLS A;  3RBM A;  1H35 A;  3M7C A;  3TC1 A;  4LZ0 A;  2SQC A;  1GXO A;  5E8L A;  2E92 A;  3M75 A;  3WE9 A;  1WKZ A;  3WCD A;  3EU5 B;  3WCB A;  1KSD A;  5B0I A;  4KKJ A;  4WVA A;  4NEI A;  1N1Z A;  5A0I A;  4OK2 A;  1KFG A;  1HN0 A;  3VJC A;  3QG0 A;  2PS8 A;  3EZ3 A;  3V66 A;  4N9U A;  1TF4 A;  1N20 A;  4JZX A;  3VJ8 A;  5B01 A;  1KZP B;  2GH4 A;  1O6Q A;  2H6F B;  2ZBL A;  3VJ9 A;  4AYO A;  5HNA A;  1VG7 A;  2QIS A;  4MBG B;  2FUT A;  1YHL A;  3DSS B;  5MEH A;  4KVY A;  1N94 B;  1H12 A;  3AE0 A;  1N7N A;  1H36 A;  1SQC A;  4Z4J A;  4GTT B;  3VW5 A;  5C05 A;  4YDE B;  4ZQ8 A;  1R76 A;  3PDE A;  1TNY B;  2WY7 A;  3E37 B;  3QQV A;  1LF9 A;  1N95 B;  3CU7 A;  1V4E A;  2F8Z F;  3WCL A;  1WL2 A;  4LOB A;  2ZY1 A;  2ZCR A;  1KWF A;  2FTZ A;  4PVX F;  1VG3 A;  2OGD A;  3AQB B;  4TF4 A;  3M76 A;  1F1S A;  1WMW A;  5IMI A;  3LSN A;  3QFZ A;  2FUQ A;  3TF4 A;  3ANI A;  3WJO A;  2AFA A;  4GAX A;  2E8X A;  3K11 A;  3VSN A;  2AZJ A;  3WIW A;  3W5N A;  1N4P B;  4LTZ A;  1PS1 A;  3DPY B;  4DEM F;  2F6D A;  1HM4 A;  3N45 F;  1N23 A;  3P41 A;  2VN4 A;  4NKF A;  1N7P A;  5DGQ A;  1VD5 A;  3APZ A;  4PVY F;  4FUS A;  2WDA A;  4NUA A;  2Z52 A;  1O5M B;  4GP1 A;  1WL3 A;  3SAE A;  1FMI A;  1UG9 A;  3WCF A;  4F6V A;  3RSY A;  2AHF A;  3N0G A;  3ACT A;  1O1R B;  3NPR A;  1CEM A;  5IK6 A;  2QNO A;  1X1J A;  1YYU A;  2G0D A;  1FPS A;  2J1O A;  4ZRQ A;  3LOM A;  2AHG A;  3LEE A;  3QFY A;  4LXW A;  1RQJ A;  1N9A B;  2BRV X;  3M71 A;  1WU5 A;  2Z7I A;  3TFV A;  2F94 F;  1LTX B;  3M9U A;  4LA5 A;  3RX8 A;  1FO2 A;  5GZK A;  3ICK A;  5HN9 A;  5IK9 A;  1O1T B;  3KRP B;  3M02 A;  2DRS A;  5CD2 A;  3AFL A;  3LG5 A;  1HMW A;  4L6X A;  1V7X A;  3WCI A;  1X1H A;  3QXF A;  1V4K A;  5DGM F;  5M7Y A;  1WL1 A;  3W5M A;  4WVC A;  2A8Z A;  4NFI F;  2E8U A;  5AHU B;  2I07 B;  3W7F A;  1YJ4 A;  2V8K A;  3DYH A;  1KZO B;  2YIK A;  5FO8 B;  4QXS F;  3V1X A;  3WCJ A;  3OAC B;  1HX9 A;  1RWC A;  4D94 A;  5IL8 A;  2P0V A;  3S4J A;  1VG4 A;  4E9Z A;  1N4S B;  2R2L B;  4D4C A;  3D3I A;  4EA2 A;  5IKA A;  5FOB B;  4LA6 A;  4KUX A;  3M01 A;  3D5R A;  4LPH F;  5B0J A;  1DL2 A;  4MC8 A;  1L1Y A;  1NXC A;  2OPM A;  5JV1 F;  2BB6 A;  1V4I A;  1F9D A;  3WJN A;  3RX7 A;  3LJI A;  3N0F A;  3CP6 A;  1OJP A;  1H3B A;  3KB9 A;  1HXA A;  1N24 A;  4F62 A;  1C82 A;  3GT5 A;  2DRQ A;  4RNQ A;  3Q75 B;  5ERM A;  4KQ5 A;  3WC9 A;  3PYA A;  1FPP B;  2WCO A;  2ONH A;  1RW9 A;  1UMP A;  4KQS A;  2PMV A;  4MC3 A;  4GTP B;  3EQA A;  5ILI A;  2E22 A;  3VJA A; 
#chains in the Genus database with same CATH homology
 5B02 A;  1YYR A;  5IVG A;  2E91 A;  4KVI A;  4DI5 A;  1WL0 A;  2ZEU A;  2EWG A;  2AEL A;  3ZMB A;  4OKZ A;  1ZW5 A;  4JYX A;  2ZCO A;  3ICZ A;  1UBX A;  5E8K A;  3SDQ A;  3OYR A;  4KPJ A;  3TS7 A;  3CC9 A;  1DI1 A;  2F92 F;  1YQ7 A;  3N1W F;  5DJV F;  3ZOU A;  2AZL A;  4WK5 A;  2ZEV A;  3N6K F;  5A0J A;  4HD1 A;  5A0K A;  5B0L A;  4KVD A;  5ILH A;  2F89 F;  4F6X A;  2Z4V A;  4LFV F;  5IKH A;  2PS4 A;  2ZCQ A;  3KBK A;  2RAH A;  2I19 A;  1VG6 A;  2E95 A;  4NFJ F;  5DIQ F;  5DGN F;  3ZMC A;  3N46 F;  5DZ2 A;  2Q58 A;  2VF6 A;  3P5R A;  4H5E F;  3VJE A;  5ILK A;  4RYP A;  5ILJ A;  5ILZ A;  2AZK A;  4H5C F;  3OAB A;  3TFP A;  3KRF B;  3LZ9 A;  3KRO B;  3TFN A;  4NG6 A;  3M00 A;  3KRA A;  1YYS A;  4JZB A;  3IPI A;  3G4F A;  5EAU A;  3ASX A;  3P8L A;  3VJD A;  2J1P A;  4E1E A;  3WEG A;  3N49 F;  4E9U A;  2H8O A;  3KRF A;  3KRO A;  5HN8 A;  2Q9Z A;  4DWG A;  2Z4X A;  4LLT A;  1RTR A;  3UCA A;  2E8T A;  3WJK A;  1EZF A;  1YYQ A;  1VG2 A;  2E4O A;  3PYB A;  2E8V A;  4H5D F;  3ZCD A;  4DXJ A;  4UMJ A;  3QKC A;  5B0M A;  4RXA A;  5IMP A;  3KRC B;  4KVW A;  4LIX A;  3M0G A;  4KQU A;  3WEK A;  2OA6 A;  3ZL6 A;  5AYP A;  5DJP F;  5IL3 A;  5IMN A;  4P0X A;  5KSX F;  3NF2 A;  5ERO A;  4RXC A;  3KRC A;  2DH4 A;  4EA1 A;  3WEI A;  1KIZ A;  5JA0 F;  1HXC A;  2J5C A;  3WSA A;  3ADZ A;  4GA3 A;  4QPF A;  3ID0 A;  2Q9Y A;  3SDR A;  2AEK A;  1WY0 A;  5JV2 F;  3WCA A;  3WCE A;  3BNX A;  3DYG A;  3Q1O A;  4FP4 A;  1HXG A;  4OMG A;  5H9D A;  3LMD A;  1V4H A;  2Z50 A;  5DW7 A;  5CG5 A;  5IM1 A;  4LLS A;  4L2X F;  3IBA A;  5CG6 A;  4P0W A;  2F8C F;  3DYF A;  1N21 A;  3OAB B;  1JFG A;  3EGT A;  3Q2Q A;  3KRA B;  5JUZ F;  3ICN A;  5AFX A;  2ZCS A;  3ACY A;  4GP2 A;  2Z4W A;  1DGP A;  2Z7H A;  2O1O A;  2Z4Z A;  3S9V A;  3ICM A;  3NRI A;  3BNY A;  3LLW A;  3RYW A;  2F7M F;  3PKO A;  4OMH A;  3WEH A;  1YHM A;  2PS5 A;  4XQR F;  3WCG A;  3LGK A;  2PS7 A;  4RXE A;  4Q23 A;  3CKE A;  3ACW A;  4DHD A;  3RYE A;  3P5P A;  5ILD A;  3WCM A;  5DHI A;  3PH7 A;  5EAS A;  4FJQ A;  4KK2 A;  1UBV A;  2PS6 A;  4KWD A;  4EA0 A;  3SDU A;  5HN7 A;  3NPK A;  4N1Z F;  3N3D A;  5DJR F;  3WCC A;  4LPG F;  1UBY A;  4NKE A;  3SDT A;  4KFA A;  3WSB A;  2E90 A;  4LFE A;  2F9K F;  4JXY A;  4LFG A;  4LZ3 A;  4P0V A;  5ERN A;  3EFQ A;  2E94 A;  2P1C A;  4RXD A;  4DWB A;  3N5J F;  3N3L F;  3P8R A;  5AEL A;  4KPD A;  1N1B A;  3RMG A;  3G4D A;  3WCH A;  2Z78 A;  3ACX A;  3N1V F;  3MZV A;  3LDW A;  3WEF A;  5I1U A;  3N5H F;  4OGU A;  2FOR A;  4OKM A;  3MAV A;  4NFK F;  3SDV A;  1N22 A;  5B03 A;  4XQT F;  4JXN A;  3AQ0 A;  4LZC A;  5DHK A;  5IK0 A;  4KKM A;  5EAT A;  5B00 A;  3KRP A;  1V4J A;  4LUU A;  5ER8 A;  4DZW A;  3LGZ B;  1JFA A;  2Q80 A;  3WEJ A;  1YYT A;  5B0K A;  1UBW A;  1YHK A;  3Q2Z A;  3LK5 A;  3LVS A;  4XQS F;  3OAC A;  4K10 A;  2E8W A;  1RQI A;  5DGS F;  2AET A;  2OPN A;  3AQC B;  1KIY A;  3Q30 A;  3VJB A;  5IN8 A;  2E93 A;  2ONG A;  1YV5 A;  2Z4Y A;  5JV0 F;  5ILY A;  1HM7 A;  5E8H A;  4LTV A;  3B7L A;  4JVJ F;  4MC0 A;  3V1V A;  3RBM A;  3TC1 A;  4LZ0 A;  5E8L A;  2E92 A;  3WE9 A;  1WKZ A;  3WCD A;  3WCB A;  5B0I A;  1N1Z A;  5A0I A;  3VJC A;  2PS8 A;  3EZ3 A;  3V66 A;  4N9U A;  1N20 A;  4JZX A;  3VJ8 A;  5B01 A;  3VJ9 A;  5HNA A;  1VG7 A;  2QIS A;  1YHL A;  4KVY A;  3AE0 A;  5C05 A;  4ZQ8 A;  3PDE A;  3QQV A;  1V4E A;  2F8Z F;  3WCL A;  1WL2 A;  4LOB A;  2ZY1 A;  2ZCR A;  2FTZ A;  4PVX F;  1VG3 A;  2OGD A;  3AQB B;  1WMW A;  5IMI A;  3LSN A;  3WJO A;  4GAX A;  2E8X A;  2AZJ A;  4LTZ A;  1PS1 A;  4DEM F;  1HM4 A;  3N45 F;  1N23 A;  3P41 A;  4NKF A;  3APZ A;  4PVY F;  4NUA A;  2Z52 A;  4GP1 A;  1WL3 A;  3SAE A;  3WCF A;  4F6V A;  3N0G A;  3NPR A;  5IK6 A;  1YYU A;  1FPS A;  2J1O A;  3LOM A;  3LEE A;  4LXW A;  1RQJ A;  2Z7I A;  3TFV A;  2F94 F;  3M9U A;  4LA5 A;  3ICK A;  5HN9 A;  5IK9 A;  3KRP B;  3M02 A;  3LG5 A;  3WCI A;  1V4K A;  5DGM F;  1WL1 A;  4NFI F;  2E8U A;  5AHU B;  3W7F A;  1YJ4 A;  3DYH A;  4QXS F;  3V1X A;  3WCJ A;  3OAC B;  1HX9 A;  5IL8 A;  3S4J A;  1VG4 A;  4E9Z A;  4EA2 A;  5IKA A;  4LA6 A;  4KUX A;  3M01 A;  4LPH F;  5B0J A;  4MC8 A;  2OPM A;  5JV1 F;  1V4I A;  3WJN A;  3LJI A;  3N0F A;  3CP6 A;  3KB9 A;  1HXA A;  1N24 A;  4F62 A;  4RNQ A;  5ERM A;  4KQ5 A;  3WC9 A;  3PYA A;  2ONH A;  4KQS A;  4MC3 A;  5ILI A;  3VJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...