4F13A

Alginate lyase a1-iii y246f complexed with tetrasaccharide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
SHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHFQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alginate lyase
publication title Induced-fit motion of a lid loop involved in catalysis in alginate lyase A1-III
pubmed doi rcsb
source organism Sphingomonas
total genus 138
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4f13A00
4MMIA 2WDAA 4OZVA 4NEIA 1N7PA 1OJOA 2Q1FA 2WCOA 5JMFA 4OJZA 3VSMA 1X1IA 1LXMA 3VSNA 1HV6A 2FUQA 1HM3A 1CB8A 1OJNA 4OK2A 3AFLA 1RW9A 1HN0A 1N7RA 2BRVX 3NNBA 1EGUA 1HMUA 1F1SA 4E1YA 1J0MA 1OJMA 1RWHA 1F9GA 3E80A 4F10A 1I8QA 1HMWA 1N7OA 3NFVA 1N7NA 1X1HA 2BRPA 2E24A 1RWCA 2E22A 3E7JA 3A0OA 1HM2A 1LOHA 4OK4A 1RWGA 1J0NA 5JMDA 2BRWA 1W3YA 1N7QA 1C82A 4MMHA 1QAZA 2FUTA 4FNVA 1OJPA 1RWFA 4OZWA 4F13A 2X03A 1X1JA 1RWAA 1LXKA
chains in the Genus database with same CATH superfamily
2EAEA 4EHMB 1KKTA 2CQSA 2EACA 3QG0A 3WIWA 1QBQB 1W6KA 3S4CA 3QWTA 2WY8A 3Q75B 5IL8A 3S9VA 3ANJA 3PZ4B 3SQCA 3A3VA 4GTOB 4YDEB 1N95B 2RI9A 2DROA 2XFGA 3DSTB 3PZ3B 1H37A 2X03A 1LTXB 5DHIA 1G9JA 2B4FA 2JJBA 3SFXB 4NEIA 3W7UA 3Q79B 3WIRA 1KWFA 1GSZA 3RSYA 2ZISB 1V5DA 3QFYA 2BEDB 4F10A 4YDOB 1H36A 4GTVB 1N7NA 1S64B 1V7XA 3KLSA 3EZ8A 4ZRQA 1V7WA 2E24A 2WINB 1NXCA 4DODA 1JCSB 4LIXA 3M77A 1TN6B 3HXDB 4F13A 2H6FB 3G4FA 4MMIA 2AFAA 1FMIA 1QSJA 5JMFA 5FOBB 1IA6A 2WY7A 4GTSB 4L9PB 1XW2A 2VN4A 1N94B 1UG9A 3DRAB 1J0MA 3E80A 3W7XA 1HXGA 1GAHA 4GTTB 2E22A 2G02A 2JF4A 4QT9A 3Q73B 2SQCA 1JCRB 1KSCA 1LXKA 3QFZA 3WUXA 1N4PB 4CE7A 4ZH1A 2BB6A 1N4RB 1XWTA 3DSWB 1LD7B 5CZLA 3NFVA 4Z4LA 1HZFA 2H6HB 1N20A 3PZ2B 3PYAA 4LNGB 4WVAA 1X9DA 1KSDA 1J0NA 2BBCA 1D8EB 3DSVB 2FUTA 2VN7A 4FNVA 3WIQA 4ZG8A 1FP3A 5EASA 3WKFA 1N7PA 1W6JA 3WKGA 4OJZA 3QDEA 3SDTA 1X1IA 4J5TA 5IKHA 2V8KA 3HXCB 1GAIA 2R2LB 1GXOA 4OK2A 4ZH5A 2FV0A 2D8LA 1DL2A 3PMMA 2F0YB 3PYBA 3OEDA 1TF4A 3DSXB 4AYQA 1N1BA 3C72B 1N1ZA 3K7XA 3A0OA 3OXUA 2A73B 3M7CA 2ONGA 4D4CA 3SDRA 3E73A 2ZBLA 2NVPA 3D5SA 1TNYB 1V7VA 3P2CA 5DGQA 2DRSA 1H12A 1KRFA 1FT2B 1KREA 3Q7AB 1OJMA 1F9GA 1H39A 1HXCA 2H6IB 1KS8A 2BRPA 1TN8B 1RWCA 1O5MB 3ANKA 4FUSA 4AYPA 3N0GA 2IEJB 4D4AA 3D3IA 1N7QA 4Q2BA 1CEMA 1O1TB 3K11A 5ILZA 1X1JA 3W7TA 1GHQA 3QT9A 1LXMA 1QQFA 5ILJA 3KSLB 1HM3A 3E32B 1JCQB 1ULVA 5IM1A 1G6IA 1IA7A 2CQTA 1IS9A 3QRYA 4D94A 2B39A 2Z07A 4AYRA 2AHFA 2GOXA 4XUVA 3HXFB 1NC5A 1H3CA 1WU5A 5IL3A 1LOHA 5IK9A 1RQ5A 1W3YA 4MMHA 1S63B 1N4SB 3Q78B 3M00A 1L1YA 1TNBB 5ILKA 3VXDA 3X17A 2YIKA 5JPNB 3DSUB 5EAUA 5M7IA 2BRVX 1H54A 4MU9A 4C1SA 4L0GA 1TNZB 5E2JA 1VD5A 1JS4A 1R76A 3RRSA 1WU6A 5JPMB 1HM2A 1LD8B 5GZKA 1WU4A 1UT9A 3H7LA 4ONTA 3RX5A 4FXGB 2V3NA 5GW7A 2WDAA 3D5RA 1GA2A 1TN7B 3RX7A 1GLMA 3SDVA 1KZPB 3VSNA 3H2WA 3SDQA 3AFJA 5FO8B 3N0FA 2D5JA 2XWBB 1HMWA 3WC3A 2OKXA 2GZ6A 1N4QB 1X1HA 1FPPB 1L2AA 3M74A 1TNOB 2PN5A 4CJ1A 1QAZA 3VW5A 3W5NA 1X81B 1NI1B 3G6JB 1SA5B 3GT5A 5FO9B 1N22A 3EQAA 1K72A 3E34B 1OJNA 5AGDA 1N7RA 1H3AA 3RX8A 3ANIA 4L6XA 4KKJA 3M78A 1FO2A 3EU8A 1N9AB 4FXKB 5GY3A 2NOJA 1KZOB 5IK0A 3TF4A 1RWGA 2WYNA 3W5MA 3QPFA 3M02A 1N24A 1GXMA 3EU5B 1O6QA 5ILHA 3VSMA 2H6GB 3E37B 2DRRA 3E30B 1HV6A 1CB8A 4M76A 3T33A 3AFLA 1RW9A 1SQCA 2ONHA 4MBGB 1F9OA 2ZZRA 3GLYA 2G0DA 4GTQB 2FUZA 2WIIB 4TF4A 1HX9A 5C05A 3SDUA 4AYOA 5JMDA 1CLCA 5DGRA 3CIHA 3EUVB 1V5CA 1FCEA 1XWQA 3M71A 1O6RA 2JG0A 1F9DA 3ACSA 4LNBB 4KTPA 4TXTA 4D4BA 4KKIA 3P5RA 3M7LA 4BOJA 5FO7B 1TNUB 1EGUA 1HMUA 1F1SA 2AHGA 3GZKA 1N7OA 2I07B 2A8ZA 3SAEA 3LZ9A 3S4BA 1N23A 2V8IA 2PMVA 1G9GA 2EABA 5ILYA 4ZRPA 3M01A 1O6HA 3PZ1B 1H14A 3QT3A 4EL8A 3RENA 3CU7A 1AGMA 1HN0A 4Z4JA 4GTRB 1OJOA 2GH4A 1MZCB 3WKIA 1LF6A 1N21A 3M7BA 2FUQA 3P5PA 3KSQB 1HXAA 3S4AA 5CA3A 4BOKA 4RNQA 1FT1B 3KQ4A 3ACTA 5KKBA 2EADA 1H35A 2FV1A 4DI5A 5IKAA 4GTPB 1OJPA 1RWFA 1UMPA 3HXEB 1RWAA 3M7EA 2QNOA 3QXQA 3M76A 4WVBA 3G4DA 4CJ0A 2V3PA 5DHKA 3M73A 3NNBA 4E1YA 1FO3A 3W7SA 2ZIRB 1O1SB 2J5CA 4YCRA 5MEHA 4DOEA 2DRQA 3E7JA 1LF9A 3QSPA 4Q88A 2BRWA 1FAEA 2XQWA 4FJQA 4V1RA 2V8JA 4LNVA 1KFGA 2P0VA 1H13A 4KTRA 2Q1FA 3E33B 4D4DA 3DPYB 3HXBB 4GAXA 1C3DA 1HCUA 3H3KA 1RWHA 3RJ3A 5ILDA 3DSSB 3M72A 4JJJA 1DCEB 4OK4A 5IK6A 1FBOA 1AYXA 1C82A 1H3BA 3ON6A 1O79A 4OZWA 3Q7FB 1DOGA 4OZVA 3WKHA 2WCOA 3S4DA 4GL3A 5M7YA 3M75A 1WZZA 5CD2A 1FBWA 1I8QA 2F6DA 3E6UA 4GTMB 1D8DB 3W7WA 2RI8A 4WVCA 2FBAA 4WU0A 1O1RB 3QXFA 1NL4B 1SA4B 3SFYB 1G87A 5ILIA 2RGKA 2XWJB 1GXNA 4V1SA 5EATA 2BB5A
chains in the Genus database with same CATH topology
4MMIA 2WDAA 4OZVA 4NEIA 1N7PA 1OJOA 2Q1FA 2WCOA 5JMFA 4OJZA 3VSMA 1X1IA 1LXMA 3VSNA 1HV6A 2FUQA 1HM3A 1CB8A 1OJNA 4OK2A 3AFLA 1RW9A 1HN0A 1N7RA 2BRVX 3NNBA 1EGUA 1HMUA 1F1SA 4E1YA 1J0MA 1OJMA 1RWHA 1F9GA 3E80A 4F10A 1I8QA 1HMWA 1N7OA 3NFVA 1N7NA 1X1HA 2BRPA 2E24A 1RWCA 2E22A 3E7JA 3A0OA 1HM2A 1LOHA 4OK4A 1RWGA 1J0NA 5JMDA 2BRWA 1W3YA 1N7QA 1C82A 4MMHA 1QAZA 2FUTA 4FNVA 1OJPA 1RWFA 4OZWA 4F13A 2X03A 1X1JA 1RWAA 1LXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMI A;  2WDA A;  4OZV A;  4NEI A;  1N7P A;  1OJO A;  2Q1F A;  2WCO A;  5JMF A;  4OJZ A;  3VSM A;  1X1I A;  1LXM A;  3VSN A;  1HV6 A;  2FUQ A;  1HM3 A;  1CB8 A;  1OJN A;  4OK2 A;  3AFL A;  1RW9 A;  1HN0 A;  1N7R A;  2BRV X;  3NNB A;  1EGU A;  1HMU A;  1F1S A;  4E1Y A;  1J0M A;  1OJM A;  1RWH A;  1F9G A;  3E80 A;  4F10 A;  1I8Q A;  1HMW A;  1N7O A;  3NFV A;  1N7N A;  1X1H A;  2BRP A;  2E24 A;  1RWC A;  2E22 A;  3E7J A;  3A0O A;  1HM2 A;  1LOH A;  4OK4 A;  1RWG A;  1J0N A;  5JMD A;  2BRW A;  1W3Y A;  1N7Q A;  1C82 A;  4MMH A;  1QAZ A;  2FUT A;  4FNV A;  1OJP A;  1RWF A;  4OZW A;  4F13 A;  2X03 A;  1X1J A;  1RWA A;  1LXK A; 
#chains in the Genus database with same CATH topology
 2EAE A;  4EHM B;  1KKT A;  2CQS A;  2EAC A;  3QG0 A;  3WIW A;  1QBQ B;  1W6K A;  3S4C A;  3QWT A;  2WY8 A;  3Q75 B;  5IL8 A;  3S9V A;  3ANJ A;  3PZ4 B;  3SQC A;  3A3V A;  4GTO B;  4YDE B;  1N95 B;  2RI9 A;  2DRO A;  2XFG A;  3DST B;  3PZ3 B;  1H37 A;  2X03 A;  1LTX B;  5DHI A;  1G9J A;  2B4F A;  2JJB A;  3SFX B;  4NEI A;  3W7U A;  3Q79 B;  3WIR A;  1KWF A;  1GSZ A;  3RSY A;  2ZIS B;  1V5D A;  3QFY A;  2BED B;  4F10 A;  4YDO B;  1H36 A;  4GTV B;  1N7N A;  1S64 B;  1V7X A;  3KLS A;  3EZ8 A;  4ZRQ A;  1V7W A;  2E24 A;  2WIN B;  1NXC A;  4DOD A;  1JCS B;  4LIX A;  3M77 A;  1TN6 B;  3HXD B;  4F13 A;  2H6F B;  3G4F A;  4MMI A;  2AFA A;  1FMI A;  1QSJ A;  5JMF A;  5FOB B;  1IA6 A;  2WY7 A;  4GTS B;  4L9P B;  1XW2 A;  2VN4 A;  1N94 B;  1UG9 A;  3DRA B;  1J0M A;  3E80 A;  3W7X A;  1HXG A;  1GAH A;  4GTT B;  2E22 A;  2G02 A;  2JF4 A;  4QT9 A;  3Q73 B;  2SQC A;  1JCR B;  1KSC A;  1LXK A;  3QFZ A;  3WUX A;  1N4P B;  4CE7 A;  4ZH1 A;  2BB6 A;  1N4R B;  1XWT A;  3DSW B;  1LD7 B;  5CZL A;  3NFV A;  4Z4L A;  1HZF A;  2H6H B;  1N20 A;  3PZ2 B;  3PYA A;  4LNG B;  4WVA A;  1X9D A;  1KSD A;  1J0N A;  2BBC A;  1D8E B;  3DSV B;  2FUT A;  2VN7 A;  4FNV A;  3WIQ A;  4ZG8 A;  1FP3 A;  5EAS A;  3WKF A;  1N7P A;  1W6J A;  3WKG A;  4OJZ A;  3QDE A;  3SDT A;  1X1I A;  4J5T A;  5IKH A;  2V8K A;  3HXC B;  1GAI A;  2R2L B;  1GXO A;  4OK2 A;  4ZH5 A;  2FV0 A;  2D8L A;  1DL2 A;  3PMM A;  2F0Y B;  3PYB A;  3OED A;  1TF4 A;  3DSX B;  4AYQ A;  1N1B A;  3C72 B;  1N1Z A;  3K7X A;  3A0O A;  3OXU A;  2A73 B;  3M7C A;  2ONG A;  4D4C A;  3SDR A;  3E73 A;  2ZBL A;  2NVP A;  3D5S A;  1TNY B;  1V7V A;  3P2C A;  5DGQ A;  2DRS A;  1H12 A;  1KRF A;  1FT2 B;  1KRE A;  3Q7A B;  1OJM A;  1F9G A;  1H39 A;  1HXC A;  2H6I B;  1KS8 A;  2BRP A;  1TN8 B;  1RWC A;  1O5M B;  3ANK A;  4FUS A;  4AYP A;  3N0G A;  2IEJ B;  4D4A A;  3D3I A;  1N7Q A;  4Q2B A;  1CEM A;  1O1T B;  3K11 A;  5ILZ A;  1X1J A;  3W7T A;  1GHQ A;  3QT9 A;  1LXM A;  1QQF A;  5ILJ A;  3KSL B;  1HM3 A;  3E32 B;  1JCQ B;  1ULV A;  5IM1 A;  1G6I A;  1IA7 A;  2CQT A;  1IS9 A;  3QRY A;  4D94 A;  2B39 A;  2Z07 A;  4AYR A;  2AHF A;  2GOX A;  4XUV A;  3HXF B;  1NC5 A;  1H3C A;  1WU5 A;  5IL3 A;  1LOH A;  5IK9 A;  1RQ5 A;  1W3Y A;  4MMH A;  1S63 B;  1N4S B;  3Q78 B;  3M00 A;  1L1Y A;  1TNB B;  5ILK A;  3VXD A;  3X17 A;  2YIK A;  5JPN B;  3DSU B;  5EAU A;  5M7I A;  2BRV X;  1H54 A;  4MU9 A;  4C1S A;  4L0G A;  1TNZ B;  5E2J A;  1VD5 A;  1JS4 A;  1R76 A;  3RRS A;  1WU6 A;  5JPM B;  1HM2 A;  1LD8 B;  5GZK A;  1WU4 A;  1UT9 A;  3H7L A;  4ONT A;  3RX5 A;  4FXG B;  2V3N A;  5GW7 A;  2WDA A;  3D5R A;  1GA2 A;  1TN7 B;  3RX7 A;  1GLM A;  3SDV A;  1KZP B;  3VSN A;  3H2W A;  3SDQ A;  3AFJ A;  5FO8 B;  3N0F A;  2D5J A;  2XWB B;  1HMW A;  3WC3 A;  2OKX A;  2GZ6 A;  1N4Q B;  1X1H A;  1FPP B;  1L2A A;  3M74 A;  1TNO B;  2PN5 A;  4CJ1 A;  1QAZ A;  3VW5 A;  3W5N A;  1X81 B;  1NI1 B;  3G6J B;  1SA5 B;  3GT5 A;  5FO9 B;  1N22 A;  3EQA A;  1K72 A;  3E34 B;  1OJN A;  5AGD A;  1N7R A;  1H3A A;  3RX8 A;  3ANI A;  4L6X A;  4KKJ A;  3M78 A;  1FO2 A;  3EU8 A;  1N9A B;  4FXK B;  5GY3 A;  2NOJ A;  1KZO B;  5IK0 A;  3TF4 A;  1RWG A;  2WYN A;  3W5M A;  3QPF A;  3M02 A;  1N24 A;  1GXM A;  3EU5 B;  1O6Q A;  5ILH A;  3VSM A;  2H6G B;  3E37 B;  2DRR A;  3E30 B;  1HV6 A;  1CB8 A;  4M76 A;  3T33 A;  3AFL A;  1RW9 A;  1SQC A;  2ONH A;  4MBG B;  1F9O A;  2ZZR A;  3GLY A;  2G0D A;  4GTQ B;  2FUZ A;  2WII B;  4TF4 A;  1HX9 A;  5C05 A;  3SDU A;  4AYO A;  5JMD A;  1CLC A;  5DGR A;  3CIH A;  3EUV B;  1V5C A;  1FCE A;  1XWQ A;  3M71 A;  1O6R A;  2JG0 A;  1F9D A;  3ACS A;  4LNB B;  4KTP A;  4TXT A;  4D4B A;  4KKI A;  3P5R A;  3M7L A;  4BOJ A;  5FO7 B;  1TNU B;  1EGU A;  1HMU A;  1F1S A;  2AHG A;  3GZK A;  1N7O A;  2I07 B;  2A8Z A;  3SAE A;  3LZ9 A;  3S4B A;  1N23 A;  2V8I A;  2PMV A;  1G9G A;  2EAB A;  5ILY A;  4ZRP A;  3M01 A;  1O6H A;  3PZ1 B;  1H14 A;  3QT3 A;  4EL8 A;  3REN A;  3CU7 A;  1AGM A;  1HN0 A;  4Z4J A;  4GTR B;  1OJO A;  2GH4 A;  1MZC B;  3WKI A;  1LF6 A;  1N21 A;  3M7B A;  2FUQ A;  3P5P A;  3KSQ B;  1HXA A;  3S4A A;  5CA3 A;  4BOK A;  4RNQ A;  1FT1 B;  3KQ4 A;  3ACT A;  5KKB A;  2EAD A;  1H35 A;  2FV1 A;  4DI5 A;  5IKA A;  4GTP B;  1OJP A;  1RWF A;  1UMP A;  3HXE B;  1RWA A;  3M7E A;  2QNO A;  3QXQ A;  3M76 A;  4WVB A;  3G4D A;  4CJ0 A;  2V3P A;  5DHK A;  3M73 A;  3NNB A;  4E1Y A;  1FO3 A;  3W7S A;  2ZIR B;  1O1S B;  2J5C A;  4YCR A;  5MEH A;  4DOE A;  2DRQ A;  3E7J A;  1LF9 A;  3QSP A;  4Q88 A;  2BRW A;  1FAE A;  2XQW A;  4FJQ A;  4V1R A;  2V8J A;  4LNV A;  1KFG A;  2P0V A;  1H13 A;  4KTR A;  2Q1F A;  3E33 B;  4D4D A;  3DPY B;  3HXB B;  4GAX A;  1C3D A;  1HCU A;  3H3K A;  1RWH A;  3RJ3 A;  5ILD A;  3DSS B;  3M72 A;  4JJJ A;  1DCE B;  4OK4 A;  5IK6 A;  1FBO A;  1AYX A;  1C82 A;  1H3B A;  3ON6 A;  1O79 A;  4OZW A;  3Q7F B;  1DOG A;  4OZV A;  3WKH A;  2WCO A;  3S4D A;  4GL3 A;  5M7Y A;  3M75 A;  1WZZ A;  5CD2 A;  1FBW A;  1I8Q A;  2F6D A;  3E6U A;  4GTM B;  1D8D B;  3W7W A;  2RI8 A;  4WVC A;  2FBA A;  4WU0 A;  1O1R B;  3QXF A;  1NL4 B;  1SA4 B;  3SFY B;  1G87 A;  5ILI A;  2RGK A;  2XWJ B;  1GXN A;  4V1S A;  5EAT A;  2BB5 A; 
#chains in the Genus database with same CATH homology
 4MMI A;  2WDA A;  4OZV A;  4NEI A;  1N7P A;  1OJO A;  2Q1F A;  2WCO A;  5JMF A;  4OJZ A;  3VSM A;  1X1I A;  1LXM A;  3VSN A;  1HV6 A;  2FUQ A;  1HM3 A;  1CB8 A;  1OJN A;  4OK2 A;  3AFL A;  1RW9 A;  1HN0 A;  1N7R A;  2BRV X;  3NNB A;  1EGU A;  1HMU A;  1F1S A;  4E1Y A;  1J0M A;  1OJM A;  1RWH A;  1F9G A;  3E80 A;  4F10 A;  1I8Q A;  1HMW A;  1N7O A;  3NFV A;  1N7N A;  1X1H A;  2BRP A;  2E24 A;  1RWC A;  2E22 A;  3E7J A;  3A0O A;  1HM2 A;  1LOH A;  4OK4 A;  1RWG A;  1J0N A;  5JMD A;  2BRW A;  1W3Y A;  1N7Q A;  1C82 A;  4MMH A;  1QAZ A;  2FUT A;  4FNV A;  1OJP A;  1RWF A;  4OZW A;  4F13 A;  2X03 A;  1X1J A;  1RWA A;  1LXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...