4F13A

Alginate lyase a1-iii y246f complexed with tetrasaccharide
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
352
structure length
352
Chain Sequence
SHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHFQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Induced-fit motion of a lid loop involved in catalysis in alginate lyase A1-III
pubmed doi rcsb
source organism Sphingomonas
molecule tags Lyase
total genus 138
structure length 352
sequence length 352
chains with identical sequence B
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4f13A00
1N7QA 5JMFA 1I8QA 1N7PA 3NFVA 1RWCA 1EGUA 1X1IA 2E24A 2FUTA 1F1SA 1HMUA 1OJOA 1C82A 2WDAA 1RWGA 1HN0A 5JMDA 4OZVA 1RWFA 1LXKA 2FUQA 1RWAA 3A0OA 3E7JA 4F10A 3NNBA 1CB8A 2BRWA 3E80A 4MMHA 2E22A 4OZWA 4OK4A 1J0MA 3VSMA 1HMWA 2BRPA 1LXMA 4OJZA 2Q1FA 2BRVX 1RW9A 2WCOA 1N7RA 4OK2A 4FNVA 4F13A 1J0NA 4E1YA 1X1HA 1LOHA 4NEIA 1N7OA 1N7NA 2X03A 3AFLA 4MMIA 1HM2A 1QAZA 1RWHA 3VSNA 1HV6A 1HM3A 1OJMA 1F9GA 1OJNA 1W3YA 1X1JA 1OJPA
chains in the Genus database with same CATH superfamily
2H6HB 1F9OA 1FT1B 1WU4A 5C05A 2IEJB 4M76A 1WU6A 2BB6A 2ZBLA 1MZCB 1HXCA 4MU9A 4ZH1A 2H6GB 2E22A 1J0MA 2NVPA 3PZ4B 3WKIA 1KFGA 4TF4A 3GT5A 1FBWA 3QDEA 1NL4B 4EL8A 3ACTA 4KKIA 3SDVA 1GSZA 3P5RA 1FO3A 3W7XA 4YDEB 1WZZA 1W6KA 1OJPA 2EAEA 1TNYB 2WY7A 3M7CA 2DRQA 1AGMA 1LF6A 3M74A 1RWFA 3E7JA 1KSDA 1RWAA 2PN5A 1N95B 1KWFA 4CE7A 4MMHA 2JG0A 3SDRA 3S4BA 3DSSB 1JCSB 4AYOA 1N7OA 4C1SA 2RI9A 1TN7B 4GTOB 1GLMA 2H6IB 4LNGB 2BBCA 5EAUA 4BOJA 4DOEA 1N22A 3ANJA 4WVCA 1F9DA 1JS4A 3SFYB 3CIHA 4JJJA 5E2JA 2WDAA 3WIRA 3M00A 1N21A 3NNBA 3M7BA 4GL3A 4Q2BA 3M77A 3WKGA 4FXKB 2RGKA 3QT9A 1N24A 3SFXB 4WVBA 2WYNA 4ZH5A 1XWQA 5JPMB 2AHFA 1N94B 3LZ9A 3Q78B 1FAEA 3QXFA 1I8QA 1N1BA 1RWCA 3EQAA 2A8ZA 3M02A 1GAHA 1TNOB 1KKTA 1L2AA 3H3KA 1N4QB 1K72A 3WC3A 3SDUA 3QT3A 1N7RA 1KRFA 3X17A 1HCUA 4FXGB 3G6JB 2JF4A 2FV0A 3E33B 1RWHA 5ILJA 1TF4A 5FOBB 4RNQA 1QQFA 3PZ1B 4ZRQA 3RSYA 1X81B 5DGRA 1FO2A 4Z4JA 2BB5A 1UT9A 3M76A 1H13A 3S4DA 2V8KA 2QNOA 3RRSA 3DRAB 3EU5B 4V1RA 1H36A 5FO8B 4OK4A 2SQCA 4OJZA 4FJQA 2DRSA 5EATA 1V5DA 1H3CA 1FMIA 1N7NA 2P0VA 2X03A 1L1YA 3QPFA 1CEMA 2CQSA 1KZOB 5KKBA 2PMVA 1N7QA 3EZ8A 1EGUA 5ILDA 2EABA 3E34B 3ACSA 2EACA 2I07B 3C72B 5ILKA 4D4DA 2H6FB 3VSMA 1GA2A 1N20A 2ONHA 4NEIA 1AYXA 1TNBB 1H14A 3N0FA 4DI5A 5AGDA 2R2LB 1NI1B 1XWTA 3EUVB 3Q75B 1JCRB 2JJBA 2WINB 3DSWB 3CU7A 5JMDA 1O1RB 3S4CA 2BRWA 4AYQA 1N4SB 3AFJA 5ILHA 3KQ4A 2WIIB 2GZ6A 1V7XA 4J5TA 5DHKA 1FCEA 3Q79B 3S4AA 5ILIA 1RQ5A 3RX7A 5DGQA 1DL2A 1KS8A 2F0YB 4ZRPA 2YIKA 3P5PA 3VXDA 2BRVX 2DRRA 5IKHA 1XW2A 1X1HA 1D8DB 1G9GA 2Z07A 3DPYB 3D5SA 1QAZA 4DODA 1HM3A 3W5NA 4EHMB 2G0DA 3DSTB 2XWJB 4D4AA 3W7TA 5IKAA 3SDTA 1C82A 4ZG8A 3W7SA 4GTTB 1ULVA 5M7YA 1O6RA 1HXAA 2NOJA 1HMWA 2BRPA 1LXMA 2Q1FA 3KLSA 3K7XA 5MEHA 1LD8B 5IK0A 1J0NA 1V7WA 5CZLA 1QSJA 4GTSB 1N4RB 5IL8A 3E37B 4E1YA 3RX8A 3H7LA 4FUSA 3M71A 1TNUB 3E32B 1G6IA 2FUTA 2VN4A 1O6HA 2OKXA 5IK9A 3ANIA 2V3NA 1FP3A 3PZ2B 2AHGA 2G02A 3VW5A 1GXMA 3EU8A 1UG9A 4OK2A 4XUVA 4F13A 3PZ3B 3OEDA 1JCQB 3QFZA 3QWTA 5IK6A 4LNBB 4MMIA 3SAEA 3VSNA 3G4FA 1WU5A 1O79A 1QBQB 3GZKA 3KSLB 1FPPB 1F9GA 5EASA 1X1JA 3W7UA 2XQWA 1H3BA 1H3AA 1HZFA 3RJ3A 2EADA 4ONTA 4Q88A 3M72A 4D94A 3A3VA 3TF4A 3WKHA 4WU0A 3D3IA 3P2CA 2V8JA 2XWBB 4FNVA 2F6DA 4GTMB 5M7IA 3E30B 1CLCA 1HM2A 1SQCA 1IA7A 3Q7AB 5CD2A 4GTPB 1N1ZA 5ILYA 5IM1A 1S64B 1LTXB 3M73A 4L0GA 2E24A 3HXBB 3KSQB 1FBOA 2V3PA 3E6UA 3ON6A 4OZVA 4KTPA 4Z4LA 1LXKA 3SDQA 1CB8A 1FT2B 4GTRB 1TNZB 5FO9B 1GXOA 2GH4A 4GTQB 5GW7A 3Q7FB 3PYAA 4L6XA 3GLYA 1W6JA 1NXCA 2FV1A 3ANKA 1OJNA 1S63B 3E73A 5GY3A 4GAXA 1H35A 1TN8B 2B39A 1O1SB 1HMUA 3QRYA 3RENA 2FBAA 1G87A 2ZZRA 4GTVB 4F10A 1N9AB 2GOXA 3A0OA 3E80A 3W5MA 4KTRA 1X9DA 2ONGA 3WIQA 1KREA 1HV6A 3H2WA 1KSCA 1SA4B 3M75A 4CJ0A 1D8EB 1H39A 1GAIA 3WKFA 5JMFA 3PMMA 1N7PA 3QG0A 1DCEB 1IA6A 3OXUA 1X1IA 2J5CA 2RI8A 3QSPA 5JPNB 3W7WA 3RX5A 1RWGA 2DROA 1HN0A 4MBGB 1IS9A 2FUZA 5CA3A 3HXCB 2V8IA 2VN7A 3HXEB 1V7VA 3QFYA 4L9PB 1RW9A 4D4CA 1G9JA 2D8LA 3G4DA 1R76A 4WVAA 2BEDB 1DOGA 3AFLA 3K11A 4LNVA 3WUXA 3D5RA 4AYRA 3S9VA 5IL3A 1NC5A 1C3DA 1TN6B 4AYPA 4D4BA 3NFVA 2CQTA 1GXNA 3N0GA 1V5CA 3DSXB 1LD7B 2B4FA 3SQCA 5ILZA 3HXDB 1H12A 1HXGA 1N4PB 3M01A 4OZWA 4QT9A 2D5JA 1H54A 4LIXA 1UMPA 4TXTA 1KZPB 2WCOA 4KKJA 1H37A 2WY8A 2ZIRB 3T33A 1O6QA 3DSVB 1OJMA 1W3YA 2A73B 1HX9A 4YCRA 1O1TB 3M7LA 5DHIA 1F1SA 1OJOA 2AFAA 3HXFB 1GHQA 3M7EA 5GZKA 3WIWA 2FUQA 4YDOB 3DSUB 1LF9A 1SA5B 4BOKA 4CJ1A 1O5MB 3M78A 3PYBA 2ZISB 4V1SA 1LOHA 1VD5A 3Q73B 1N23A 5FO7B 3QXQA 2XFGA
chains in the Genus database with same CATH topology
1N7QA 5JMFA 1I8QA 1N7PA 3NFVA 1RWCA 1EGUA 1X1IA 2E24A 2FUTA 1F1SA 1HMUA 1OJOA 1C82A 2WDAA 1RWGA 1HN0A 5JMDA 4OZVA 1RWFA 1LXKA 2FUQA 1RWAA 3A0OA 3E7JA 4F10A 3NNBA 1CB8A 2BRWA 3E80A 4MMHA 2E22A 4OZWA 4OK4A 1J0MA 3VSMA 1HMWA 2BRPA 1LXMA 4OJZA 2Q1FA 2BRVX 1RW9A 2WCOA 1N7RA 4OK2A 4FNVA 4F13A 1J0NA 4E1YA 1X1HA 1LOHA 4NEIA 1N7OA 1N7NA 2X03A 3AFLA 4MMIA 1HM2A 1QAZA 1RWHA 3VSNA 1HV6A 1HM3A 1OJMA 1F9GA 1OJNA 1W3YA 1X1JA 1OJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7Q A;  5JMF A;  1I8Q A;  1N7P A;  3NFV A;  1RWC A;  1EGU A;  1X1I A;  2E24 A;  2FUT A;  1F1S A;  1HMU A;  1OJO A;  1C82 A;  2WDA A;  1RWG A;  1HN0 A;  5JMD A;  4OZV A;  1RWF A;  1LXK A;  2FUQ A;  1RWA A;  3A0O A;  3E7J A;  4F10 A;  3NNB A;  1CB8 A;  2BRW A;  3E80 A;  4MMH A;  2E22 A;  4OZW A;  4OK4 A;  1J0M A;  3VSM A;  1HMW A;  2BRP A;  1LXM A;  4OJZ A;  2Q1F A;  2BRV X;  1RW9 A;  2WCO A;  1N7R A;  4OK2 A;  4FNV A;  4F13 A;  1J0N A;  4E1Y A;  1X1H A;  1LOH A;  4NEI A;  1N7O A;  1N7N A;  2X03 A;  3AFL A;  4MMI A;  1HM2 A;  1QAZ A;  1RWH A;  3VSN A;  1HV6 A;  1HM3 A;  1OJM A;  1F9G A;  1OJN A;  1W3Y A;  1X1J A;  1OJP A; 
#chains in the Genus database with same CATH topology
 2H6H B;  1F9O A;  1FT1 B;  1WU4 A;  5C05 A;  2IEJ B;  4M76 A;  1WU6 A;  2BB6 A;  2ZBL A;  1MZC B;  1HXC A;  4MU9 A;  4ZH1 A;  2H6G B;  2E22 A;  1J0M A;  2NVP A;  3PZ4 B;  3WKI A;  1KFG A;  4TF4 A;  3GT5 A;  1FBW A;  3QDE A;  1NL4 B;  4EL8 A;  3ACT A;  4KKI A;  3SDV A;  1GSZ A;  3P5R A;  1FO3 A;  3W7X A;  4YDE B;  1WZZ A;  1W6K A;  1OJP A;  2EAE A;  1TNY B;  2WY7 A;  3M7C A;  2DRQ A;  1AGM A;  1LF6 A;  3M74 A;  1RWF A;  3E7J A;  1KSD A;  1RWA A;  2PN5 A;  1N95 B;  1KWF A;  4CE7 A;  4MMH A;  2JG0 A;  3SDR A;  3S4B A;  3DSS B;  1JCS B;  4AYO A;  1N7O A;  4C1S A;  2RI9 A;  1TN7 B;  4GTO B;  1GLM A;  2H6I B;  4LNG B;  2BBC A;  5EAU A;  4BOJ A;  4DOE A;  1N22 A;  3ANJ A;  4WVC A;  1F9D A;  1JS4 A;  3SFY B;  3CIH A;  4JJJ A;  5E2J A;  2WDA A;  3WIR A;  3M00 A;  1N21 A;  3NNB A;  3M7B A;  4GL3 A;  4Q2B A;  3M77 A;  3WKG A;  4FXK B;  2RGK A;  3QT9 A;  1N24 A;  3SFX B;  4WVB A;  2WYN A;  4ZH5 A;  1XWQ A;  5JPM B;  2AHF A;  1N94 B;  3LZ9 A;  3Q78 B;  1FAE A;  3QXF A;  1I8Q A;  1N1B A;  1RWC A;  3EQA A;  2A8Z A;  3M02 A;  1GAH A;  1TNO B;  1KKT A;  1L2A A;  3H3K A;  1N4Q B;  1K72 A;  3WC3 A;  3SDU A;  3QT3 A;  1N7R A;  1KRF A;  3X17 A;  1HCU A;  4FXG B;  3G6J B;  2JF4 A;  2FV0 A;  3E33 B;  1RWH A;  5ILJ A;  1TF4 A;  5FOB B;  4RNQ A;  1QQF A;  3PZ1 B;  4ZRQ A;  3RSY A;  1X81 B;  5DGR A;  1FO2 A;  4Z4J A;  2BB5 A;  1UT9 A;  3M76 A;  1H13 A;  3S4D A;  2V8K A;  2QNO A;  3RRS A;  3DRA B;  3EU5 B;  4V1R A;  1H36 A;  5FO8 B;  4OK4 A;  2SQC A;  4OJZ A;  4FJQ A;  2DRS A;  5EAT A;  1V5D A;  1H3C A;  1FMI A;  1N7N A;  2P0V A;  2X03 A;  1L1Y A;  3QPF A;  1CEM A;  2CQS A;  1KZO B;  5KKB A;  2PMV A;  1N7Q A;  3EZ8 A;  1EGU A;  5ILD A;  2EAB A;  3E34 B;  3ACS A;  2EAC A;  2I07 B;  3C72 B;  5ILK A;  4D4D A;  2H6F B;  3VSM A;  1GA2 A;  1N20 A;  2ONH A;  4NEI A;  1AYX A;  1TNB B;  1H14 A;  3N0F A;  4DI5 A;  5AGD A;  2R2L B;  1NI1 B;  1XWT A;  3EUV B;  3Q75 B;  1JCR B;  2JJB A;  2WIN B;  3DSW B;  3CU7 A;  5JMD A;  1O1R B;  3S4C A;  2BRW A;  4AYQ A;  1N4S B;  3AFJ A;  5ILH A;  3KQ4 A;  2WII B;  2GZ6 A;  1V7X A;  4J5T A;  5DHK A;  1FCE A;  3Q79 B;  3S4A A;  5ILI A;  1RQ5 A;  3RX7 A;  5DGQ A;  1DL2 A;  1KS8 A;  2F0Y B;  4ZRP A;  2YIK A;  3P5P A;  3VXD A;  2BRV X;  2DRR A;  5IKH A;  1XW2 A;  1X1H A;  1D8D B;  1G9G A;  2Z07 A;  3DPY B;  3D5S A;  1QAZ A;  4DOD A;  1HM3 A;  3W5N A;  4EHM B;  2G0D A;  3DST B;  2XWJ B;  4D4A A;  3W7T A;  5IKA A;  3SDT A;  1C82 A;  4ZG8 A;  3W7S A;  4GTT B;  1ULV A;  5M7Y A;  1O6R A;  1HXA A;  2NOJ A;  1HMW A;  2BRP A;  1LXM A;  2Q1F A;  3KLS A;  3K7X A;  5MEH A;  1LD8 B;  5IK0 A;  1J0N A;  1V7W A;  5CZL A;  1QSJ A;  4GTS B;  1N4R B;  5IL8 A;  3E37 B;  4E1Y A;  3RX8 A;  3H7L A;  4FUS A;  3M71 A;  1TNU B;  3E32 B;  1G6I A;  2FUT A;  2VN4 A;  1O6H A;  2OKX A;  5IK9 A;  3ANI A;  2V3N A;  1FP3 A;  3PZ2 B;  2AHG A;  2G02 A;  3VW5 A;  1GXM A;  3EU8 A;  1UG9 A;  4OK2 A;  4XUV A;  4F13 A;  3PZ3 B;  3OED A;  1JCQ B;  3QFZ A;  3QWT A;  5IK6 A;  4LNB B;  4MMI A;  3SAE A;  3VSN A;  3G4F A;  1WU5 A;  1O79 A;  1QBQ B;  3GZK A;  3KSL B;  1FPP B;  1F9G A;  5EAS A;  1X1J A;  3W7U A;  2XQW A;  1H3B A;  1H3A A;  1HZF A;  3RJ3 A;  2EAD A;  4ONT A;  4Q88 A;  3M72 A;  4D94 A;  3A3V A;  3TF4 A;  3WKH A;  4WU0 A;  3D3I A;  3P2C A;  2V8J A;  2XWB B;  4FNV A;  2F6D A;  4GTM B;  5M7I A;  3E30 B;  1CLC A;  1HM2 A;  1SQC A;  1IA7 A;  3Q7A B;  5CD2 A;  4GTP B;  1N1Z A;  5ILY A;  5IM1 A;  1S64 B;  1LTX B;  3M73 A;  4L0G A;  2E24 A;  3HXB B;  3KSQ B;  1FBO A;  2V3P A;  3E6U A;  3ON6 A;  4OZV A;  4KTP A;  4Z4L A;  1LXK A;  3SDQ A;  1CB8 A;  1FT2 B;  4GTR B;  1TNZ B;  5FO9 B;  1GXO A;  2GH4 A;  4GTQ B;  5GW7 A;  3Q7F B;  3PYA A;  4L6X A;  3GLY A;  1W6J A;  1NXC A;  2FV1 A;  3ANK A;  1OJN A;  1S63 B;  3E73 A;  5GY3 A;  4GAX A;  1H35 A;  1TN8 B;  2B39 A;  1O1S B;  1HMU A;  3QRY A;  3REN A;  2FBA A;  1G87 A;  2ZZR A;  4GTV B;  4F10 A;  1N9A B;  2GOX A;  3A0O A;  3E80 A;  3W5M A;  4KTR A;  1X9D A;  2ONG A;  3WIQ A;  1KRE A;  1HV6 A;  3H2W A;  1KSC A;  1SA4 B;  3M75 A;  4CJ0 A;  1D8E B;  1H39 A;  1GAI A;  3WKF A;  5JMF A;  3PMM A;  1N7P A;  3QG0 A;  1DCE B;  1IA6 A;  3OXU A;  1X1I A;  2J5C A;  2RI8 A;  3QSP A;  5JPN B;  3W7W A;  3RX5 A;  1RWG A;  2DRO A;  1HN0 A;  4MBG B;  1IS9 A;  2FUZ A;  5CA3 A;  3HXC B;  2V8I A;  2VN7 A;  3HXE B;  1V7V A;  3QFY A;  4L9P B;  1RW9 A;  4D4C A;  1G9J A;  2D8L A;  3G4D A;  1R76 A;  4WVA A;  2BED B;  1DOG A;  3AFL A;  3K11 A;  4LNV A;  3WUX A;  3D5R A;  4AYR A;  3S9V A;  5IL3 A;  1NC5 A;  1C3D A;  1TN6 B;  4AYP A;  4D4B A;  3NFV A;  2CQT A;  1GXN A;  3N0G A;  1V5C A;  3DSX B;  1LD7 B;  2B4F A;  3SQC A;  5ILZ A;  3HXD B;  1H12 A;  1HXG A;  1N4P B;  3M01 A;  4OZW A;  4QT9 A;  2D5J A;  1H54 A;  4LIX A;  1UMP A;  4TXT A;  1KZP B;  2WCO A;  4KKJ A;  1H37 A;  2WY8 A;  2ZIR B;  3T33 A;  1O6Q A;  3DSV B;  1OJM A;  1W3Y A;  2A73 B;  1HX9 A;  4YCR A;  1O1T B;  3M7L A;  5DHI A;  1F1S A;  1OJO A;  2AFA A;  3HXF B;  1GHQ A;  3M7E A;  5GZK A;  3WIW A;  2FUQ A;  4YDO B;  3DSU B;  1LF9 A;  1SA5 B;  4BOK A;  4CJ1 A;  1O5M B;  3M78 A;  3PYB A;  2ZIS B;  4V1S A;  1LOH A;  1VD5 A;  3Q73 B;  1N23 A;  5FO7 B;  3QXQ A;  2XFG A; 
#chains in the Genus database with same CATH homology
 1N7Q A;  5JMF A;  1I8Q A;  1N7P A;  3NFV A;  1RWC A;  1EGU A;  1X1I A;  2E24 A;  2FUT A;  1F1S A;  1HMU A;  1OJO A;  1C82 A;  2WDA A;  1RWG A;  1HN0 A;  5JMD A;  4OZV A;  1RWF A;  1LXK A;  2FUQ A;  1RWA A;  3A0O A;  3E7J A;  4F10 A;  3NNB A;  1CB8 A;  2BRW A;  3E80 A;  4MMH A;  2E22 A;  4OZW A;  4OK4 A;  1J0M A;  3VSM A;  1HMW A;  2BRP A;  1LXM A;  4OJZ A;  2Q1F A;  2BRV X;  1RW9 A;  2WCO A;  1N7R A;  4OK2 A;  4FNV A;  4F13 A;  1J0N A;  4E1Y A;  1X1H A;  1LOH A;  4NEI A;  1N7O A;  1N7N A;  2X03 A;  3AFL A;  4MMI A;  1HM2 A;  1QAZ A;  1RWH A;  3VSN A;  1HV6 A;  1HM3 A;  1OJM A;  1F9G A;  1OJN A;  1W3Y A;  1X1J A;  1OJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...