4QT9A

Crystal structure of a putative glucoamylase (baccac_03554) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
414
structure length
414
Chain Sequence
LSDDALMDTVQRRTFLYFWEGAEPNSGLAPERYHVDGVYPQNDANVVTSGGSGFGIMAILAGIDRGYVTREEGLARMERIVSFLEKADRFHGAYPHWWYGDTGKVKPFGQKDNGGDLVETAFLMQGLLAVHQYYANGNDKEKAIAQRIDRLWREVDWDWYRKGGQNVLYWHWSPTYGWEMDFPIHGYNECMIMYILAAASPTHGVPAAVYHDGWAQNGAIVSPHKVEGIELHLRYQGTEAGPLFWAQYSFLGLDPVGLKDEYCPSYFHEMRNLTLVNRAYCIRNPKHYKGFGPDCWGLTASYSVDGYAAHSPNEQDDKGVISPTAALSSIVYTPEYSLQVMRHLYNMGDKVFGPFGFYDAFSETDNWYPQRYLAIDQGPIAVMIENYRTGLLWKLFMSHPDVQAGLTKLGFNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords putative glucoamylase
publication title Crystal structure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae atcc 43185
total genus 149
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10091 Glycoamylase Putative glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.140 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4qt9A00
5GZKA 4GL3A 3EU8A 4QT9A
chains in the Genus database with same CATH superfamily
5C05A 5CA3A 4WU0A 1O5MB 1IS9A 1UT9A 3CU7A 3M75A 1O6QA 3P5RA 3HXFB 1FO3A 1JS4A 1FPPB 4EHMB 1N4QB 4Z4LA 3M7BA 1HM3A 1R76A 5AGDA 3M00A 3WKHA 2FUZA 4TF4A 3KLSA 1FMIA 3Q75B 2IEJB 1GA2A 3WIRA 1LF9A 1X81B 3QG0A 4M76A 3M71A 3QXQA 1WU6A 5FO7B 1FT1B 2EABA 1RW9A 1N7PA 1OJPA 2XFGA 1CLCA 3WUXA 1S63B 3PZ4B 3E6UA 5IK0A 3HXEB 3PMMA 1TN8B 1NC5A 2E24A 3DSSB 2ZBLA 3D5SA 1O1TB 2BEDB 1WZZA 4ZH1A 4GTQB 5JPMB 3M7LA 1FAEA 3TF4A 4GTRB 1G6IA 2WCOA 3EU5B 4FUSA 1DL2A 3E37B 1LXKA 2V8IA 3GT5A 5IL8A 4KKJA 4LNGB 3S9VA 1GXMA 1L2AA 2JJBA 2VN7A 1X1IA 4C1SA 3K11A 5EASA 2QNOA 3E7JA 4V1RA 1AYXA 3AFJA 4ZH5A 4DODA 3H7LA 5CZLA 4NEIA 3Q78B 3W7SA 4OJZA 1DOGA 5FOBB 4E1YA 5ILYA 1KKTA 4LNVA 3SDVA 4KTPA 3NFVA 4AYRA 3DPYB 3W5MA 1N94B 1N95B 4JJJA 3G4FA 2Q1FA 4F13A 3HXDB 3RX8A 1N21A 2NOJA 1EGUA 3E73A 1F1SA 5IK9A 1N7OA 1H14A 5ILHA 1TN6B 2FUTA 3LZ9A 2BRVX 1GXNA 3QPFA 3PZ3B 2RI9A 2D8LA 4TXTA 2BRPA 3W7TA 2H6IB 3S4BA 1LXMA 3QXFA 3ACSA 3M76A 1WU5A 1DCEB 3M01A 3M7CA 1OJNA 2EAEA 4L9PB 4RNQA 1X9DA 3QFYA 3SDUA 4AYOA 1QSJA 5GZKA 1ULVA 2JG0A 3HXCB 3P5PA 1F9OA 4AYPA 4XUVA 1KFGA 3H3KA 4L0GA 1RWCA 1HMWA 3S4AA 1RWHA 3HXBB 1LF6A 1RWFA 1LTXB 3E33B 2H6GB 4L6XA 2WIIB 2G0DA 3RENA 4EL8A 3D3IA 2BBCA 1F9DA 4J5TA 3DSUB 2AFAA 3KQ4A 2NVPA 3SQCA 4CJ1A 4FXGB 1N7RA 3Q79B 3RSYA 3EUVB 4D4BA 3SAEA 1C82A 5JMFA 1N24A 1SQCA 5GW7A 1GAIA 2XWBB 3Q7FB 1N23A 4GAXA 1KZPB 1TF4A 4MBGB 2V8JA 4GTTB 3QT3A 3WC3A 4OZVA 1HXCA 1N4PB 2SQCA 3QT9A 1H13A 1IA6A 2R2LB 1VD5A 3EZ8A 4Q88A 5ILDA 1UMPA 3N0GA 2V8KA 4QT9A 4YDOB 1HXAA 3RX7A 1HX9A 3E80A 5IKHA 4DOEA 1HMUA 3GLYA 3OXUA 2OKXA 4FJQA 4GTSB 1XWQA 3E34B 5M7IA 2XQWA 1JCRB 1N7NA 3GZKA 1H36A 3ACTA 4GTOB 3QFZA 1N22A 1G87A 1O1RB 2BB5A 4YCRA 3WIQA 1QAZA 3E32B 1HCUA 1LD8B 1TN7B 2V3PA 4WVBA 1KREA 2WDAA 1X1JA 3SFXB 1W6KA 3W7WA 2F6DA 1O1SB 2PN5A 1TNYB 2P0VA 5MEHA 4D4DA 1V7VA 2Z07A 2EACA 1WU4A 3DSWB 1H39A 1N1BA 3QDEA 5CD2A 3NNBA 2ONHA 3W7XA 5FO8B 2E22A 5JPNB 2RGKA 1D8EB 2DRSA 3VW5A 2DRQA 5IKAA 3M7EA 1N20A 5ILZA 4Q2BA 1SA5B 2ZISB 1KS8A 1H54A 3CIHA 3QWTA 3EQAA 1N4SB 3ANJA 4MMHA 4AYQA 2J5CA 2G02A 1GXOA 2I07B 1J0NA 1HZFA 2ZZRA 3AFLA 3PYBA 2FBAA 1HN0A 2X03A 3SDQA 4GTVB 2BRWA 2CQTA 3KSQB 3M72A 5M7YA 2WINB 4Z4JA 3G6JB 3QSPA 3M73A 3DRAB 3H2WA 4GTMB 3PYAA 2YIKA 3SFYB 5KKBA 2PMVA 1J0MA 2V3NA 4MMIA 4OK2A 1TNZB 2FV0A 4D4CA 4CE7A 2WY7A 3K7XA 2FV1A 5JMDA 3OEDA 5EAUA 2AHFA 2B4FA 3RJ3A 1SA4B 1G9GA 1FT2B 4KTRA 3QRYA 4YDEB 3ANKA 4WVCA 4ZRQA 5EATA 1JCSB 1MZCB 4D4AA 1V7WA 5GY3A 1N7QA 4D94A 2DROA 4GTPB 1AGMA 5ILKA 3WKGA 3A0OA 3KSLB 4V1SA 1K72A 3X17A 5E2JA 1X1HA 2F0YB 3SDTA 4LNBB 3RRSA 1S64B 3Q7AB 3P2CA 1W3YA 3PZ1B 1N4RB 4F10A 1JCQB 1V5DA 2GOXA 4WVAA 3C72B 3VSNA 1FCEA 3G4DA 3WKIA 1H37A 4GL3A 4KKIA 1CEMA 2EADA 3RX5A 2A8ZA 3D5RA 1FP3A 1LOHA 5ILJA 1GLMA 1I8QA 2H6FB 1FO2A 3S4DA 1H35A 1RWAA 2XWJB 1KSDA 1O6RA 1TNUB 3ON6A 1V5CA 2GZ6A 1NI1B 1XWTA 1FBWA 2AHGA 5IK6A 1NXCA 1H3AA 1G9JA 2WYNA 2GH4A 1CB8A 3DSTB 1HV6A 3DSXB 2RI8A 3DSVB 4ZG8A 5DHIA 1NL4B 4FXKB 1FBOA 3SDRA 1OJOA 3ANIA 1IA7A 3E30B 1KZOB 1TNBB 3S4CA 5FO9B 3M74A 3WKFA 3M77A 1KRFA 2ONGA 3VSMA 4BOJA 4OK4A 3W5NA 2CQSA 2FUQA 2B39A 3WIWA 4MU9A 5ILIA 1D8DB 1LD7B 1N9AB 5IL3A 4ONTA 2DRRA 1W6JA 1L1YA 3M78A 2WY8A 1HM2A 3T33A 2BB6A 2H6HB 1F9GA 1GAHA 5IM1A 2A73B 1H3CA 1V7XA 5DGQA 1RWGA 2JF4A 2VN4A 3A3VA 1O79A 3PZ2B 1H12A 2D5JA 1QQFA 5DHKA 3W7UA 3EU8A 4FNVA 1RQ5A 1QBQB 1N1ZA 4LIXA 4DI5A 1H3BA 1XW2A 1KWFA 4BOKA 1HXGA 1UG9A 1C3DA 1KSCA 3N0FA 3Q73B 4ZRPA 1TNOB 1GHQA 1OJMA 1O6HA 5DGRA 4OZWA 2ZIRB 1GSZA 4CJ0A 3VXDA 3M02A
chains in the Genus database with same CATH topology
5CA3A 4WU0A 1O5MB 1IS9A 1UT9A 3CU7A 3M75A 1O6QA 3P5RA 3HXFB 1FO3A 1JS4A 1FPPB 4EHMB 1N4QB 4Z4LA 3M7BA 1R76A 5AGDA 3WKHA 2FUZA 4TF4A 3KLSA 1FMIA 3Q75B 2IEJB 1GA2A 3WIRA 1LF9A 1X81B 3QG0A 4M76A 3M71A 3QXQA 1WU6A 5FO7B 1FT1B 2EABA 2XFGA 1CLCA 3WUXA 1S63B 3PZ4B 3E6UA 3HXEB 3PMMA 1TN8B 1NC5A 3DSSB 2ZBLA 3D5SA 1O1TB 2BEDB 1WZZA 4ZH1A 4GTQB 5JPMB 3M7LA 1FAEA 3TF4A 4GTRB 1G6IA 3EU5B 4FUSA 1DL2A 3E37B 2V8IA 3GT5A 4KKJA 4LNGB 3S9VA 1GXMA 1L2AA 2JJBA 2VN7A 4C1SA 3K11A 2QNOA 4V1RA 1AYXA 3AFJA 4ZH5A 4DODA 3H7LA 5CZLA 3Q78B 3W7SA 1DOGA 5FOBB 1KKTA 4LNVA 3SDVA 4KTPA 4AYRA 3DPYB 3W5MA 1N94B 1N95B 4JJJA 3HXDB 3RX8A 2NOJA 3E73A 1H14A 1TN6B 1GXNA 3QPFA 3PZ3B 2RI9A 2D8LA 4TXTA 3W7TA 2H6IB 3S4BA 3QXFA 3ACSA 3M76A 1WU5A 1DCEB 3M7CA 2EAEA 4L9PB 1X9DA 3QFYA 3SDUA 4AYOA 1QSJA 5GZKA 1ULVA 2JG0A 3HXCB 3P5PA 1F9OA 4AYPA 4XUVA 1KFGA 3H3KA 4L0GA 3S4AA 3HXBB 1LF6A 1LTXB 3E33B 2H6GB 4L6XA 2WIIB 2G0DA 3RENA 4EL8A 3D3IA 2BBCA 1F9DA 4J5TA 3DSUB 2AFAA 3KQ4A 2NVPA 3SQCA 4CJ1A 4FXGB 3Q79B 3RSYA 3EUVB 4D4BA 3SAEA 1SQCA 5GW7A 1GAIA 2XWBB 3Q7FB 1KZPB 1TF4A 4MBGB 2V8JA 4GTTB 3QT3A 3WC3A 1N4PB 2SQCA 3QT9A 1H13A 1IA6A 2R2LB 1VD5A 3EZ8A 4Q88A 1UMPA 2V8KA 4QT9A 4YDOB 3RX7A 4DOEA 3GLYA 3OXUA 2OKXA 4GTSB 1XWQA 3E34B 5M7IA 2XQWA 1JCRB 3GZKA 1H36A 3ACTA 4GTOB 3QFZA 1G87A 1O1RB 2BB5A 4YCRA 3WIQA 3E32B 1HCUA 1LD8B 1TN7B 2V3PA 4WVBA 1KREA 3SFXB 1W6KA 3W7WA 2F6DA 1O1SB 2PN5A 1TNYB 2P0VA 5MEHA 4D4DA 1V7VA 2Z07A 2EACA 1WU4A 3DSWB 1H39A 3QDEA 5CD2A 3W7XA 5FO8B 5JPNB 2RGKA 1D8EB 2DRSA 3VW5A 2DRQA 3M7EA 4Q2BA 1SA5B 2ZISB 1KS8A 1H54A 3CIHA 3QWTA 3EQAA 1N4SB 3ANJA 4AYQA 2G02A 1GXOA 2I07B 1HZFA 2ZZRA 3PYBA 2FBAA 3SDQA 4GTVB 3M72A 2CQTA 3KSQB 5M7YA 2WINB 4Z4JA 3G6JB 3QSPA 3M73A 3DRAB 3H2WA 4GTMB 3PYAA 2YIKA 3SFYB 5KKBA 2PMVA 2V3NA 1TNZB 2FV0A 4D4CA 4CE7A 2WY7A 3K7XA 2FV1A 3OEDA 2AHFA 2B4FA 3RJ3A 1SA4B 1G9GA 1FT2B 4KTRA 3QRYA 4YDEB 3ANKA 4WVCA 4ZRQA 1JCSB 1MZCB 4D4AA 1V7WA 5GY3A 4D94A 2DROA 4GTPB 1AGMA 3WKGA 3KSLB 4V1SA 1K72A 3X17A 5E2JA 2F0YB 3SDTA 4LNBB 3RRSA 1S64B 3Q7AB 3P2CA 3PZ1B 1N4RB 1JCQB 1V5DA 2GOXA 4WVAA 3C72B 1FCEA 3WKIA 1H37A 4GL3A 4KKIA 1CEMA 2EADA 3RX5A 2A8ZA 3D5RA 1FP3A 1GLMA 2H6FB 1FO2A 3S4DA 1H35A 2XWJB 1KSDA 1O6RA 1TNUB 3ON6A 1V5CA 2GZ6A 1NI1B 1XWTA 1FBWA 2AHGA 1NXCA 1H3AA 1G9JA 2WYNA 2GH4A 3DSTB 3DSXB 2RI8A 3DSVB 4ZG8A 1NL4B 4FXKB 1FBOA 3SDRA 3ANIA 1IA7A 3E30B 1KZOB 1TNBB 3S4CA 5FO9B 3M74A 3WKFA 3M77A 1KRFA 4BOJA 3W5NA 2CQSA 2B39A 3WIWA 4MU9A 1D8DB 1LD7B 1N9AB 4ONTA 2DRRA 1W6JA 1L1YA 3M78A 2WY8A 3T33A 2BB6A 2H6HB 1GAHA 2A73B 1H3CA 1V7XA 5DGQA 2JF4A 2VN4A 3A3VA 1O79A 3PZ2B 1H12A 2D5JA 1QQFA 3W7UA 3EU8A 1RQ5A 1QBQB 4LIXA 1H3BA 1XW2A 1KWFA 4BOKA 1UG9A 1C3DA 1KSCA 3Q73B 4ZRPA 1TNOB 1GHQA 1O6HA 5DGRA 2ZIRB 1GSZA 4CJ0A 3VXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GZK A;  4GL3 A;  3EU8 A;  4QT9 A; 
#chains in the Genus database with same CATH topology
 5C05 A;  5CA3 A;  4WU0 A;  1O5M B;  1IS9 A;  1UT9 A;  3CU7 A;  3M75 A;  1O6Q A;  3P5R A;  3HXF B;  1FO3 A;  1JS4 A;  1FPP B;  4EHM B;  1N4Q B;  4Z4L A;  3M7B A;  1HM3 A;  1R76 A;  5AGD A;  3M00 A;  3WKH A;  2FUZ A;  4TF4 A;  3KLS A;  1FMI A;  3Q75 B;  2IEJ B;  1GA2 A;  3WIR A;  1LF9 A;  1X81 B;  3QG0 A;  4M76 A;  3M71 A;  3QXQ A;  1WU6 A;  5FO7 B;  1FT1 B;  2EAB A;  1RW9 A;  1N7P A;  1OJP A;  2XFG A;  1CLC A;  3WUX A;  1S63 B;  3PZ4 B;  3E6U A;  5IK0 A;  3HXE B;  3PMM A;  1TN8 B;  1NC5 A;  2E24 A;  3DSS B;  2ZBL A;  3D5S A;  1O1T B;  2BED B;  1WZZ A;  4ZH1 A;  4GTQ B;  5JPM B;  3M7L A;  1FAE A;  3TF4 A;  4GTR B;  1G6I A;  2WCO A;  3EU5 B;  4FUS A;  1DL2 A;  3E37 B;  1LXK A;  2V8I A;  3GT5 A;  5IL8 A;  4KKJ A;  4LNG B;  3S9V A;  1GXM A;  1L2A A;  2JJB A;  2VN7 A;  1X1I A;  4C1S A;  3K11 A;  5EAS A;  2QNO A;  3E7J A;  4V1R A;  1AYX A;  3AFJ A;  4ZH5 A;  4DOD A;  3H7L A;  5CZL A;  4NEI A;  3Q78 B;  3W7S A;  4OJZ A;  1DOG A;  5FOB B;  4E1Y A;  5ILY A;  1KKT A;  4LNV A;  3SDV A;  4KTP A;  3NFV A;  4AYR A;  3DPY B;  3W5M A;  1N94 B;  1N95 B;  4JJJ A;  3G4F A;  2Q1F A;  4F13 A;  3HXD B;  3RX8 A;  1N21 A;  2NOJ A;  1EGU A;  3E73 A;  1F1S A;  5IK9 A;  1N7O A;  1H14 A;  5ILH A;  1TN6 B;  2FUT A;  3LZ9 A;  2BRV X;  1GXN A;  3QPF A;  3PZ3 B;  2RI9 A;  2D8L A;  4TXT A;  2BRP A;  3W7T A;  2H6I B;  3S4B A;  1LXM A;  3QXF A;  3ACS A;  3M76 A;  1WU5 A;  1DCE B;  3M01 A;  3M7C A;  1OJN A;  2EAE A;  4L9P B;  4RNQ A;  1X9D A;  3QFY A;  3SDU A;  4AYO A;  1QSJ A;  5GZK A;  1ULV A;  2JG0 A;  3HXC B;  3P5P A;  1F9O A;  4AYP A;  4XUV A;  1KFG A;  3H3K A;  4L0G A;  1RWC A;  1HMW A;  3S4A A;  1RWH A;  3HXB B;  1LF6 A;  1RWF A;  1LTX B;  3E33 B;  2H6G B;  4L6X A;  2WII B;  2G0D A;  3REN A;  4EL8 A;  3D3I A;  2BBC A;  1F9D A;  4J5T A;  3DSU B;  2AFA A;  3KQ4 A;  2NVP A;  3SQC A;  4CJ1 A;  4FXG B;  1N7R A;  3Q79 B;  3RSY A;  3EUV B;  4D4B A;  3SAE A;  1C82 A;  5JMF A;  1N24 A;  1SQC A;  5GW7 A;  1GAI A;  2XWB B;  3Q7F B;  1N23 A;  4GAX A;  1KZP B;  1TF4 A;  4MBG B;  2V8J A;  4GTT B;  3QT3 A;  3WC3 A;  4OZV A;  1HXC A;  1N4P B;  2SQC A;  3QT9 A;  1H13 A;  1IA6 A;  2R2L B;  1VD5 A;  3EZ8 A;  4Q88 A;  5ILD A;  1UMP A;  3N0G A;  2V8K A;  4QT9 A;  4YDO B;  1HXA A;  3RX7 A;  1HX9 A;  3E80 A;  5IKH A;  4DOE A;  1HMU A;  3GLY A;  3OXU A;  2OKX A;  4FJQ A;  4GTS B;  1XWQ A;  3E34 B;  5M7I A;  2XQW A;  1JCR B;  1N7N A;  3GZK A;  1H36 A;  3ACT A;  4GTO B;  3QFZ A;  1N22 A;  1G87 A;  1O1R B;  2BB5 A;  4YCR A;  3WIQ A;  1QAZ A;  3E32 B;  1HCU A;  1LD8 B;  1TN7 B;  2V3P A;  4WVB A;  1KRE A;  2WDA A;  1X1J A;  3SFX B;  1W6K A;  3W7W A;  2F6D A;  1O1S B;  2PN5 A;  1TNY B;  2P0V A;  5MEH A;  4D4D A;  1V7V A;  2Z07 A;  2EAC A;  1WU4 A;  3DSW B;  1H39 A;  1N1B A;  3QDE A;  5CD2 A;  3NNB A;  2ONH A;  3W7X A;  5FO8 B;  2E22 A;  5JPN B;  2RGK A;  1D8E B;  2DRS A;  3VW5 A;  2DRQ A;  5IKA A;  3M7E A;  1N20 A;  5ILZ A;  4Q2B A;  1SA5 B;  2ZIS B;  1KS8 A;  1H54 A;  3CIH A;  3QWT A;  3EQA A;  1N4S B;  3ANJ A;  4MMH A;  4AYQ A;  2J5C A;  2G02 A;  1GXO A;  2I07 B;  1J0N A;  1HZF A;  2ZZR A;  3AFL A;  3PYB A;  2FBA A;  1HN0 A;  2X03 A;  3SDQ A;  4GTV B;  2BRW A;  2CQT A;  3KSQ B;  3M72 A;  5M7Y A;  2WIN B;  4Z4J A;  3G6J B;  3QSP A;  3M73 A;  3DRA B;  3H2W A;  4GTM B;  3PYA A;  2YIK A;  3SFY B;  5KKB A;  2PMV A;  1J0M A;  2V3N A;  4MMI A;  4OK2 A;  1TNZ B;  2FV0 A;  4D4C A;  4CE7 A;  2WY7 A;  3K7X A;  2FV1 A;  5JMD A;  3OED A;  5EAU A;  2AHF A;  2B4F A;  3RJ3 A;  1SA4 B;  1G9G A;  1FT2 B;  4KTR A;  3QRY A;  4YDE B;  3ANK A;  4WVC A;  4ZRQ A;  5EAT A;  1JCS B;  1MZC B;  4D4A A;  1V7W A;  5GY3 A;  1N7Q A;  4D94 A;  2DRO A;  4GTP B;  1AGM A;  5ILK A;  3WKG A;  3A0O A;  3KSL B;  4V1S A;  1K72 A;  3X17 A;  5E2J A;  1X1H A;  2F0Y B;  3SDT A;  4LNB B;  3RRS A;  1S64 B;  3Q7A B;  3P2C A;  1W3Y A;  3PZ1 B;  1N4R B;  4F10 A;  1JCQ B;  1V5D A;  2GOX A;  4WVA A;  3C72 B;  3VSN A;  1FCE A;  3G4D A;  3WKI A;  1H37 A;  4GL3 A;  4KKI A;  1CEM A;  2EAD A;  3RX5 A;  2A8Z A;  3D5R A;  1FP3 A;  1LOH A;  5ILJ A;  1GLM A;  1I8Q A;  2H6F B;  1FO2 A;  3S4D A;  1H35 A;  1RWA A;  2XWJ B;  1KSD A;  1O6R A;  1TNU B;  3ON6 A;  1V5C A;  2GZ6 A;  1NI1 B;  1XWT A;  1FBW A;  2AHG A;  5IK6 A;  1NXC A;  1H3A A;  1G9J A;  2WYN A;  2GH4 A;  1CB8 A;  3DST B;  1HV6 A;  3DSX B;  2RI8 A;  3DSV B;  4ZG8 A;  5DHI A;  1NL4 B;  4FXK B;  1FBO A;  3SDR A;  1OJO A;  3ANI A;  1IA7 A;  3E30 B;  1KZO B;  1TNB B;  3S4C A;  5FO9 B;  3M74 A;  3WKF A;  3M77 A;  1KRF A;  2ONG A;  3VSM A;  4BOJ A;  4OK4 A;  3W5N A;  2CQS A;  2FUQ A;  2B39 A;  3WIW A;  4MU9 A;  5ILI A;  1D8D B;  1LD7 B;  1N9A B;  5IL3 A;  4ONT A;  2DRR A;  1W6J A;  1L1Y A;  3M78 A;  2WY8 A;  1HM2 A;  3T33 A;  2BB6 A;  2H6H B;  1F9G A;  1GAH A;  5IM1 A;  2A73 B;  1H3C A;  1V7X A;  5DGQ A;  1RWG A;  2JF4 A;  2VN4 A;  3A3V A;  1O79 A;  3PZ2 B;  1H12 A;  2D5J A;  1QQF A;  5DHK A;  3W7U A;  3EU8 A;  4FNV A;  1RQ5 A;  1QBQ B;  1N1Z A;  4LIX A;  4DI5 A;  1H3B A;  1XW2 A;  1KWF A;  4BOK A;  1HXG A;  1UG9 A;  1C3D A;  1KSC A;  3N0F A;  3Q73 B;  4ZRP A;  1TNO B;  1GHQ A;  1OJM A;  1O6H A;  5DGR A;  4OZW A;  2ZIR B;  1GSZ A;  4CJ0 A;  3VXD A;  3M02 A; 
#chains in the Genus database with same CATH homology
 5CA3 A;  4WU0 A;  1O5M B;  1IS9 A;  1UT9 A;  3CU7 A;  3M75 A;  1O6Q A;  3P5R A;  3HXF B;  1FO3 A;  1JS4 A;  1FPP B;  4EHM B;  1N4Q B;  4Z4L A;  3M7B A;  1R76 A;  5AGD A;  3WKH A;  2FUZ A;  4TF4 A;  3KLS A;  1FMI A;  3Q75 B;  2IEJ B;  1GA2 A;  3WIR A;  1LF9 A;  1X81 B;  3QG0 A;  4M76 A;  3M71 A;  3QXQ A;  1WU6 A;  5FO7 B;  1FT1 B;  2EAB A;  2XFG A;  1CLC A;  3WUX A;  1S63 B;  3PZ4 B;  3E6U A;  3HXE B;  3PMM A;  1TN8 B;  1NC5 A;  3DSS B;  2ZBL A;  3D5S A;  1O1T B;  2BED B;  1WZZ A;  4ZH1 A;  4GTQ B;  5JPM B;  3M7L A;  1FAE A;  3TF4 A;  4GTR B;  1G6I A;  3EU5 B;  4FUS A;  1DL2 A;  3E37 B;  2V8I A;  3GT5 A;  4KKJ A;  4LNG B;  3S9V A;  1GXM A;  1L2A A;  2JJB A;  2VN7 A;  4C1S A;  3K11 A;  2QNO A;  4V1R A;  1AYX A;  3AFJ A;  4ZH5 A;  4DOD A;  3H7L A;  5CZL A;  3Q78 B;  3W7S A;  1DOG A;  5FOB B;  1KKT A;  4LNV A;  3SDV A;  4KTP A;  4AYR A;  3DPY B;  3W5M A;  1N94 B;  1N95 B;  4JJJ A;  3HXD B;  3RX8 A;  2NOJ A;  3E73 A;  1H14 A;  1TN6 B;  1GXN A;  3QPF A;  3PZ3 B;  2RI9 A;  2D8L A;  4TXT A;  3W7T A;  2H6I B;  3S4B A;  3QXF A;  3ACS A;  3M76 A;  1WU5 A;  1DCE B;  3M7C A;  2EAE A;  4L9P B;  1X9D A;  3QFY A;  3SDU A;  4AYO A;  1QSJ A;  5GZK A;  1ULV A;  2JG0 A;  3HXC B;  3P5P A;  1F9O A;  4AYP A;  4XUV A;  1KFG A;  3H3K A;  4L0G A;  3S4A A;  3HXB B;  1LF6 A;  1LTX B;  3E33 B;  2H6G B;  4L6X A;  2WII B;  2G0D A;  3REN A;  4EL8 A;  3D3I A;  2BBC A;  1F9D A;  4J5T A;  3DSU B;  2AFA A;  3KQ4 A;  2NVP A;  3SQC A;  4CJ1 A;  4FXG B;  3Q79 B;  3RSY A;  3EUV B;  4D4B A;  3SAE A;  1SQC A;  5GW7 A;  1GAI A;  2XWB B;  3Q7F B;  1KZP B;  1TF4 A;  4MBG B;  2V8J A;  4GTT B;  3QT3 A;  3WC3 A;  1N4P B;  2SQC A;  3QT9 A;  1H13 A;  1IA6 A;  2R2L B;  1VD5 A;  3EZ8 A;  4Q88 A;  1UMP A;  2V8K A;  4QT9 A;  4YDO B;  3RX7 A;  4DOE A;  3GLY A;  3OXU A;  2OKX A;  4GTS B;  1XWQ A;  3E34 B;  5M7I A;  2XQW A;  1JCR B;  3GZK A;  1H36 A;  3ACT A;  4GTO B;  3QFZ A;  1G87 A;  1O1R B;  2BB5 A;  4YCR A;  3WIQ A;  3E32 B;  1HCU A;  1LD8 B;  1TN7 B;  2V3P A;  4WVB A;  1KRE A;  3SFX B;  1W6K A;  3W7W A;  2F6D A;  1O1S B;  2PN5 A;  1TNY B;  2P0V A;  5MEH A;  4D4D A;  1V7V A;  2Z07 A;  2EAC A;  1WU4 A;  3DSW B;  1H39 A;  3QDE A;  5CD2 A;  3W7X A;  5FO8 B;  5JPN B;  2RGK A;  1D8E B;  2DRS A;  3VW5 A;  2DRQ A;  3M7E A;  4Q2B A;  1SA5 B;  2ZIS B;  1KS8 A;  1H54 A;  3CIH A;  3QWT A;  3EQA A;  1N4S B;  3ANJ A;  4AYQ A;  2G02 A;  1GXO A;  2I07 B;  1HZF A;  2ZZR A;  3PYB A;  2FBA A;  3SDQ A;  4GTV B;  3M72 A;  2CQT A;  3KSQ B;  5M7Y A;  2WIN B;  4Z4J A;  3G6J B;  3QSP A;  3M73 A;  3DRA B;  3H2W A;  4GTM B;  3PYA A;  2YIK A;  3SFY B;  5KKB A;  2PMV A;  2V3N A;  1TNZ B;  2FV0 A;  4D4C A;  4CE7 A;  2WY7 A;  3K7X A;  2FV1 A;  3OED A;  2AHF A;  2B4F A;  3RJ3 A;  1SA4 B;  1G9G A;  1FT2 B;  4KTR A;  3QRY A;  4YDE B;  3ANK A;  4WVC A;  4ZRQ A;  1JCS B;  1MZC B;  4D4A A;  1V7W A;  5GY3 A;  4D94 A;  2DRO A;  4GTP B;  1AGM A;  3WKG A;  3KSL B;  4V1S A;  1K72 A;  3X17 A;  5E2J A;  2F0Y B;  3SDT A;  4LNB B;  3RRS A;  1S64 B;  3Q7A B;  3P2C A;  3PZ1 B;  1N4R B;  1JCQ B;  1V5D A;  2GOX A;  4WVA A;  3C72 B;  1FCE A;  3WKI A;  1H37 A;  4GL3 A;  4KKI A;  1CEM A;  2EAD A;  3RX5 A;  2A8Z A;  3D5R A;  1FP3 A;  1GLM A;  2H6F B;  1FO2 A;  3S4D A;  1H35 A;  2XWJ B;  1KSD A;  1O6R A;  1TNU B;  3ON6 A;  1V5C A;  2GZ6 A;  1NI1 B;  1XWT A;  1FBW A;  2AHG A;  1NXC A;  1H3A A;  1G9J A;  2WYN A;  2GH4 A;  3DST B;  3DSX B;  2RI8 A;  3DSV B;  4ZG8 A;  1NL4 B;  4FXK B;  1FBO A;  3SDR A;  3ANI A;  1IA7 A;  3E30 B;  1KZO B;  1TNB B;  3S4C A;  5FO9 B;  3M74 A;  3WKF A;  3M77 A;  1KRF A;  4BOJ A;  3W5N A;  2CQS A;  2B39 A;  3WIW A;  4MU9 A;  1D8D B;  1LD7 B;  1N9A B;  4ONT A;  2DRR A;  1W6J A;  1L1Y A;  3M78 A;  2WY8 A;  3T33 A;  2BB6 A;  2H6H B;  1GAH A;  2A73 B;  1H3C A;  1V7X A;  5DGQ A;  2JF4 A;  2VN4 A;  3A3V A;  1O79 A;  3PZ2 B;  1H12 A;  2D5J A;  1QQF A;  3W7U A;  3EU8 A;  1RQ5 A;  1QBQ B;  4LIX A;  1H3B A;  1XW2 A;  1KWF A;  4BOK A;  1UG9 A;  1C3D A;  1KSC A;  3Q73 B;  4ZRP A;  1TNO B;  1GHQ A;  1O6H A;  5DGR A;  2ZIR B;  1GSZ A;  4CJ0 A;  3VXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...