4QT9A

Crystal structure of a putative glucoamylase (baccac_03554) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
414
structure length
414
Chain Sequence
LSDDALMDTVQRRTFLYFWEGAEPNSGLAPERYHVDGVYPQNDANVVTSGGSGFGIMAILAGIDRGYVTREEGLARMERIVSFLEKADRFHGAYPHWWYGDTGKVKPFGQKDNGGDLVETAFLMQGLLAVHQYYANGNDKEKAIAQRIDRLWREVDWDWYRKGGQNVLYWHWSPTYGWEMDFPIHGYNECMIMYILAAASPTHGVPAAVYHDGWAQNGAIVSPHKVEGIELHLRYQGTEAGPLFWAQYSFLGLDPVGLKDEYCPSYFHEMRNLTLVNRAYCIRNPKHYKGFGPDCWGLTASYSVDGYAAHSPNEQDDKGVISPTAALSSIVYTPEYSLQVMRHLYNMGDKVFGPFGFYDAFSETDNWYPQRYLAIDQGPIAVMIENYRTGLLWKLFMSHPDVQAGLTKLGFNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords putative glucoamylase
publication title Crystal structure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae atcc 43185
molecule tags Hydrolase
total genus 149
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10091 Glycoamylase Putative glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.140 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4qt9A00
4GL3A 4QT9A 3EU8A 5GZKA
chains in the Genus database with same CATH superfamily
1CB8A 1WU5A 3HXFB 3M01A 1H37A 3QFYA 3PYAA 1G6IA 3AFLA 2H6FB 5ILYA 1H35A 1TN8B 2R2LB 1KZOB 1RQ5A 1N95B 4YCRA 3SFXB 3QG0A 4KTPA 4WVBA 3SDVA 4MMIA 1N4PB 5CZLA 1X1IA 2G02A 3W7SA 3W5NA 3W7WA 3RENA 4V1SA 1O1SB 4ZRQA 5C05A 3DSWB 2V8KA 1N94B 2BEDB 3PZ1B 2ZBLA 3E32B 2WDAA 4FJQA 2BRWA 2E22A 4AYOA 2WYNA 1D8DB 1WU6A 3D3IA 2GZ6A 3EUVB 1NXCA 3ANJA 3E33B 3M78A 5CD2A 1V7VA 3DSTB 3PZ2B 3EU5B 3DSXB 3SDQA 2VN4A 1RWAA 4GTMB 3M73A 4L0GA 1JCRB 1VD5A 3Q7AB 4L9PB 3KLSA 5IM1A 1N1BA 2XWBB 3HXCB 1KKTA 4OZWA 1XW2A 2EABA 4YDEB 1JCSB 3E7JA 1NI1B 3ACTA 4FUSA 2DROA 1GXMA 2DRQA 4BOKA 2WINB 1W6KA 4GTSB 1RWFA 1O79A 2FBAA 2DRSA 4Q2BA 1F9OA 1GHQA 5DGQA 1RWCA 3NNBA 3M76A 4JJJA 2ZZRA 3M71A 1V5CA 1I8QA 5AGDA 2JF4A 3PMMA 5GZKA 1N4RB 2FUZA 3CIHA 3M77A 1N4SB 2G0DA 3RX8A 2P0VA 4ZH1A 1N21A 4MMHA 3H2WA 1TNBB 5DGRA 5ILZA 1KSDA 1XWQA 1KSCA 2CQTA 5EASA 3OXUA 4C1SA 1LTXB 3T33A 1UMPA 5GY3A 2JG0A 4V1RA 1X9DA 3E6UA 4E1YA 3WC3A 4Q88A 2WY7A 4D4CA 5ILJA 4DI5A 1N7QA 1KREA 1FMIA 1W6JA 3QXFA 1O6HA 1S63B 5GW7A 1G87A 4ZRPA 4GTOB 2Q1FA 1O1TB 4OK4A 2RGKA 2EACA 2D5JA 5ILIA 3N0FA 3G4DA 1HM2A 4D94A 1H3BA 2XFGA 1L2AA 2B39A 3QXQA 4D4DA 4KTRA 2FUQA 4OK2A 5ILKA 1FO3A 3G4FA 3S4CA 5JPMB 1O6QA 2V3PA 1JS4A 3PZ4B 1HX9A 2QNOA 5IK6A 5DHKA 4AYRA 5M7IA 3WKFA 4DODA 3E30B 1LXKA 1IA7A 1G9GA 2J5CA 2PMVA 3E80A 3ANKA 2H6HB 1LF9A 3HXEB 1J0MA 2BRPA 1X1JA 4CJ1A 5ILDA 4L6XA 1EGUA 2F0YB 2RI8A 2A8ZA 4XUVA 1IS9A 2V8IA 3LZ9A 4D4AA 1LXMA 3ANIA 1R76A 1HXGA 5IL8A 1N7PA 1L1YA 4OJZA 1OJNA 5IK9A 3M02A 1N7NA 1KS8A 5IK0A 3K7XA 1K72A 1OJMA 2FUTA 3QWTA 4QT9A 1LD7B 1J0NA 1H13A 1N22A 1V5DA 3QT9A 4AYPA 4WVAA 2BB5A 1XWTA 1FBOA 1TN7B 1OJPA 3M74A 4M76A 3WIWA 3RX5A 4KKIA 1FT2B 3A0OA 3TF4A 1LF6A 1N24A 1TNUB 4FNVA 4D4BA 4Z4JA 5FO9B 1N1ZA 2DRRA 2AHGA 1F9GA 1GAIA 4EL8A 1CEMA 1HCUA 2XWJB 2V8JA 1WZZA 5KKBA 1AYXA 1HV6A 1RW9A 1N4QB 1SA5B 3QDEA 4LNBB 1FPPB 3QRYA 3PYBA 2CQSA 3QFZA 4ONTA 4GAXA 3GT5A 4ZH5A 3QT3A 2FV1A 3VSNA 1RWGA 1TF4A 1HM3A 5CA3A 2AFAA 4MBGB 3RJ3A 1C3DA 3W7TA 2GOXA 4GL3A 1HMUA 4Z4LA 1HXCA 5FO8B 1FCEA 2FV0A 3D5SA 3HXDB 1V7WA 1LOHA 3Q75B 1H3AA 4TF4A 2GH4A 2WY8A 1UT9A 2H6GB 4GTTB 3S4AA 4F10A 4CE7A 1F9DA 1HN0A 1TNZB 1X81B 3ACSA 1TNOB 5E2JA 3Q73B 4F13A 1GA2A 1KFGA 1SA4B 2I07B 3GLYA 3WKGA 2EADA 3P5RA 4EHMB 3G6JB 2PN5A 2B4FA 1RWHA 1LD8B 3M75A 3M7EA 2D8LA 2YIKA 1KWFA 1KZPB 3EZ8A 4YDOB 3WKIA 3Q78B 3W7UA 3HXBB 2BBCA 3Q7FB 4DOEA 1DOGA 1N7OA 1H39A 3NFVA 2X03A 3VW5A 2V3NA 1HZFA 5EATA 1H3CA 1TN6B 1H14A 1N9AB 1DL2A 1FT1B 1HMWA 3CU7A 5EAUA 3RX7A 3H7LA 4GTPB 4GTRB 5JPNB 3P5PA 1NL4B 3SDTA 2OKXA 2BRVX 4RNQA 4NEIA 1QAZA 3GZKA 2BB6A 3ON6A 2SQCA 3EQAA 3KSLB 3P2CA 1S64B 2H6IB 2EAEA 2VN7A 3WIQA 3DRAB 4BOJA 4WU0A 2NOJA 1QSJA 4OZVA 3X17A 3VSMA 4KKJA 3SAEA 3DPYB 3D5RA 4CJ0A 1H36A 3A3VA 3AFJA 3W5MA 2F6DA 3QSPA 1UG9A 1IA6A 3S4BA 2JJBA 3E37B 3EU8A 4FXKB 2ZISB 5IL3A 1FBWA 2XQWA 2IEJB 3OEDA 4GTVB 1GSZA 3WKHA 2ONHA 2A73B 1TNYB 2ZIRB 2E24A 3RSYA 1FP3A 1FAEA 1F1SA 1JCQB 5DHIA 3QPFA 1KRFA 1GXNA 1CLCA 3WUXA 4GTQB 1DCEB 3SQCA 1GAHA 3SFYB 5M7YA 4ZG8A 5JMFA 1HXAA 1OJOA 3M7BA 2NVPA 4FXGB 2AHFA 5ILHA 1X1HA 1WU4A 2ONGA 3KSQB 5FOBB 3S9VA 3VXDA 1QQFA 3KQ4A 3E73A 2WCOA 3Q79B 2Z07A 5MEHA 1H12A 3DSSB 1GLMA 1AGMA 1C82A 3M7CA 4LNGB 1NC5A 3S4DA 4LNVA 3M00A 1O5MB 1W3YA 4WVCA 3SDRA 3DSUB 3M7LA 4AYQA 2RI9A 3H3KA 1N7RA 4TXTA 3WIRA 5JMDA 1H54A 1O6RA 5IKAA 3E34B 3RRSA 1D8EB 5FO7B 3K11A 3W7XA 3PZ3B 3SDUA 1G9JA 1N23A 4MU9A 1N20A 5IKHA 1GXOA 1SQCA 2WIIB 3DSVB 4J5TA 1V7XA 1MZCB 1QBQB 1FO2A 3C72B 3M72A 3N0GA 1O1RB 1ULVA 4LIXA
chains in the Genus database with same CATH topology
1WU5A 3HXFB 1H37A 3QFYA 3PYAA 1G6IA 2H6FB 1H35A 1TN8B 2R2LB 1KZOB 1RQ5A 1N95B 4YCRA 3SFXB 3QG0A 4KTPA 4WVBA 3SDVA 1N4PB 5CZLA 2G02A 3W7SA 3W5NA 3W7WA 3RENA 4V1SA 1O1SB 4ZRQA 3DSWB 2V8KA 1N94B 2BEDB 3PZ1B 2ZBLA 3E32B 4AYOA 2WYNA 1D8DB 1WU6A 3D3IA 2GZ6A 3EUVB 1NXCA 3ANJA 3E33B 3M78A 5CD2A 1V7VA 3DSTB 3PZ2B 3EU5B 3DSXB 3SDQA 2VN4A 4GTMB 3M73A 4L0GA 1JCRB 1VD5A 3Q7AB 4L9PB 3KLSA 2XWBB 3HXCB 1KKTA 1XW2A 2EABA 4YDEB 1JCSB 1NI1B 3ACTA 4FUSA 2DROA 1GXMA 2DRQA 4BOKA 2WINB 1W6KA 4GTSB 1O79A 2FBAA 2DRSA 4Q2BA 1F9OA 1GHQA 5DGQA 3M76A 4JJJA 2ZZRA 3M71A 1V5CA 5AGDA 2JF4A 3PMMA 5GZKA 1N4RB 2FUZA 3CIHA 3M77A 1N4SB 2G0DA 3RX8A 2P0VA 4ZH1A 3H2WA 1TNBB 5DGRA 1KSDA 1XWQA 1KSCA 2CQTA 3OXUA 4C1SA 1LTXB 3T33A 1UMPA 5GY3A 2JG0A 4V1RA 1X9DA 3E6UA 3WC3A 4Q88A 2WY7A 4D4CA 1KREA 1FMIA 1W6JA 3QXFA 1O6HA 1S63B 5GW7A 1G87A 4ZRPA 4GTOB 1O1TB 2RGKA 2EACA 2D5JA 4D94A 1H3BA 2XFGA 1L2AA 2B39A 3QXQA 4D4DA 4KTRA 1FO3A 3S4CA 5JPMB 1O6QA 2V3PA 1JS4A 3PZ4B 2QNOA 4AYRA 5M7IA 3WKFA 4DODA 3E30B 1IA7A 1G9GA 2PMVA 3ANKA 2H6HB 1LF9A 3HXEB 4CJ1A 4L6XA 2F0YB 2RI8A 2A8ZA 4XUVA 1IS9A 2V8IA 4D4AA 3ANIA 1R76A 1L1YA 1KS8A 3K7XA 1K72A 3QWTA 4QT9A 1LD7B 1H13A 4AYPA 1V5DA 3QT9A 4WVAA 2BB5A 1XWTA 1FBOA 1TN7B 3M74A 4M76A 3WIWA 3RX5A 4KKIA 1FT2B 3TF4A 1LF6A 1TNUB 4D4BA 4Z4JA 5FO9B 2DRRA 2AHGA 1GAIA 4EL8A 1CEMA 1HCUA 2XWJB 2V8JA 1WZZA 5KKBA 1AYXA 1N4QB 1SA5B 3QDEA 4LNBB 1FPPB 3QRYA 3PYBA 2CQSA 3QFZA 4ONTA 3GT5A 4ZH5A 3QT3A 2FV1A 1TF4A 5CA3A 2AFAA 4MBGB 3RJ3A 1C3DA 3W7TA 2GOXA 4GL3A 4Z4LA 5FO8B 1FCEA 2FV0A 3D5SA 3HXDB 1V7WA 3Q75B 1H3AA 4TF4A 2GH4A 2WY8A 1UT9A 2H6GB 4GTTB 3S4AA 4CE7A 1F9DA 1TNZB 1X81B 3ACSA 1TNOB 5E2JA 3Q73B 1GA2A 1KFGA 1SA4B 2I07B 3GLYA 3WKGA 2EADA 3P5RA 4EHMB 3G6JB 2PN5A 2B4FA 1LD8B 3M75A 3M7EA 2D8LA 2YIKA 1KWFA 1KZPB 3EZ8A 4YDOB 3WKIA 3Q78B 3W7UA 3HXBB 2BBCA 3Q7FB 4DOEA 1DOGA 1H39A 3VW5A 2V3NA 1HZFA 1H3CA 1TN6B 1H14A 1N9AB 1DL2A 1FT1B 3CU7A 3RX7A 3H7LA 4GTPB 4GTRB 5JPNB 3P5PA 1NL4B 3SDTA 2OKXA 3GZKA 2BB6A 3ON6A 2SQCA 3EQAA 3KSLB 3P2CA 1S64B 2H6IB 2EAEA 2VN7A 3WIQA 3DRAB 4BOJA 4WU0A 2NOJA 1QSJA 3X17A 4KKJA 3SAEA 3DPYB 3D5RA 4CJ0A 1H36A 3A3VA 3AFJA 3W5MA 2F6DA 3QSPA 1UG9A 1IA6A 3S4BA 2JJBA 3E37B 3EU8A 4FXKB 2ZISB 1FBWA 2XQWA 2IEJB 3OEDA 4GTVB 1GSZA 3WKHA 2A73B 1TNYB 2ZIRB 3RSYA 1FP3A 1FAEA 1JCQB 3QPFA 1KRFA 1GXNA 1CLCA 3WUXA 4GTQB 1DCEB 3SQCA 1GAHA 3SFYB 5M7YA 4ZG8A 3M7BA 2NVPA 4FXGB 2AHFA 1WU4A 3KSQB 5FOBB 3S9VA 3VXDA 1QQFA 3KQ4A 3E73A 3Q79B 2Z07A 5MEHA 1H12A 3DSSB 1GLMA 1AGMA 3M7CA 4LNGB 1NC5A 3S4DA 4LNVA 1O5MB 4WVCA 3SDRA 3DSUB 3M7LA 4AYQA 2RI9A 3H3KA 4TXTA 3WIRA 1H54A 1O6RA 3E34B 3RRSA 1D8EB 5FO7B 3K11A 3W7XA 3PZ3B 3SDUA 1G9JA 4MU9A 1GXOA 1SQCA 2WIIB 3DSVB 4J5TA 1V7XA 1MZCB 1QBQB 1FO2A 3C72B 3M72A 1O1RB 1ULVA 4LIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL3 A;  4QT9 A;  3EU8 A;  5GZK A; 
#chains in the Genus database with same CATH topology
 1CB8 A;  1WU5 A;  3HXF B;  3M01 A;  1H37 A;  3QFY A;  3PYA A;  1G6I A;  3AFL A;  2H6F B;  5ILY A;  1H35 A;  1TN8 B;  2R2L B;  1KZO B;  1RQ5 A;  1N95 B;  4YCR A;  3SFX B;  3QG0 A;  4KTP A;  4WVB A;  3SDV A;  4MMI A;  1N4P B;  5CZL A;  1X1I A;  2G02 A;  3W7S A;  3W5N A;  3W7W A;  3REN A;  4V1S A;  1O1S B;  4ZRQ A;  5C05 A;  3DSW B;  2V8K A;  1N94 B;  2BED B;  3PZ1 B;  2ZBL A;  3E32 B;  2WDA A;  4FJQ A;  2BRW A;  2E22 A;  4AYO A;  2WYN A;  1D8D B;  1WU6 A;  3D3I A;  2GZ6 A;  3EUV B;  1NXC A;  3ANJ A;  3E33 B;  3M78 A;  5CD2 A;  1V7V A;  3DST B;  3PZ2 B;  3EU5 B;  3DSX B;  3SDQ A;  2VN4 A;  1RWA A;  4GTM B;  3M73 A;  4L0G A;  1JCR B;  1VD5 A;  3Q7A B;  4L9P B;  3KLS A;  5IM1 A;  1N1B A;  2XWB B;  3HXC B;  1KKT A;  4OZW A;  1XW2 A;  2EAB A;  4YDE B;  1JCS B;  3E7J A;  1NI1 B;  3ACT A;  4FUS A;  2DRO A;  1GXM A;  2DRQ A;  4BOK A;  2WIN B;  1W6K A;  4GTS B;  1RWF A;  1O79 A;  2FBA A;  2DRS A;  4Q2B A;  1F9O A;  1GHQ A;  5DGQ A;  1RWC A;  3NNB A;  3M76 A;  4JJJ A;  2ZZR A;  3M71 A;  1V5C A;  1I8Q A;  5AGD A;  2JF4 A;  3PMM A;  5GZK A;  1N4R B;  2FUZ A;  3CIH A;  3M77 A;  1N4S B;  2G0D A;  3RX8 A;  2P0V A;  4ZH1 A;  1N21 A;  4MMH A;  3H2W A;  1TNB B;  5DGR A;  5ILZ A;  1KSD A;  1XWQ A;  1KSC A;  2CQT A;  5EAS A;  3OXU A;  4C1S A;  1LTX B;  3T33 A;  1UMP A;  5GY3 A;  2JG0 A;  4V1R A;  1X9D A;  3E6U A;  4E1Y A;  3WC3 A;  4Q88 A;  2WY7 A;  4D4C A;  5ILJ A;  4DI5 A;  1N7Q A;  1KRE A;  1FMI A;  1W6J A;  3QXF A;  1O6H A;  1S63 B;  5GW7 A;  1G87 A;  4ZRP A;  4GTO B;  2Q1F A;  1O1T B;  4OK4 A;  2RGK A;  2EAC A;  2D5J A;  5ILI A;  3N0F A;  3G4D A;  1HM2 A;  4D94 A;  1H3B A;  2XFG A;  1L2A A;  2B39 A;  3QXQ A;  4D4D A;  4KTR A;  2FUQ A;  4OK2 A;  5ILK A;  1FO3 A;  3G4F A;  3S4C A;  5JPM B;  1O6Q A;  2V3P A;  1JS4 A;  3PZ4 B;  1HX9 A;  2QNO A;  5IK6 A;  5DHK A;  4AYR A;  5M7I A;  3WKF A;  4DOD A;  3E30 B;  1LXK A;  1IA7 A;  1G9G A;  2J5C A;  2PMV A;  3E80 A;  3ANK A;  2H6H B;  1LF9 A;  3HXE B;  1J0M A;  2BRP A;  1X1J A;  4CJ1 A;  5ILD A;  4L6X A;  1EGU A;  2F0Y B;  2RI8 A;  2A8Z A;  4XUV A;  1IS9 A;  2V8I A;  3LZ9 A;  4D4A A;  1LXM A;  3ANI A;  1R76 A;  1HXG A;  5IL8 A;  1N7P A;  1L1Y A;  4OJZ A;  1OJN A;  5IK9 A;  3M02 A;  1N7N A;  1KS8 A;  5IK0 A;  3K7X A;  1K72 A;  1OJM A;  2FUT A;  3QWT A;  4QT9 A;  1LD7 B;  1J0N A;  1H13 A;  1N22 A;  1V5D A;  3QT9 A;  4AYP A;  4WVA A;  2BB5 A;  1XWT A;  1FBO A;  1TN7 B;  1OJP A;  3M74 A;  4M76 A;  3WIW A;  3RX5 A;  4KKI A;  1FT2 B;  3A0O A;  3TF4 A;  1LF6 A;  1N24 A;  1TNU B;  4FNV A;  4D4B A;  4Z4J A;  5FO9 B;  1N1Z A;  2DRR A;  2AHG A;  1F9G A;  1GAI A;  4EL8 A;  1CEM A;  1HCU A;  2XWJ B;  2V8J A;  1WZZ A;  5KKB A;  1AYX A;  1HV6 A;  1RW9 A;  1N4Q B;  1SA5 B;  3QDE A;  4LNB B;  1FPP B;  3QRY A;  3PYB A;  2CQS A;  3QFZ A;  4ONT A;  4GAX A;  3GT5 A;  4ZH5 A;  3QT3 A;  2FV1 A;  3VSN A;  1RWG A;  1TF4 A;  1HM3 A;  5CA3 A;  2AFA A;  4MBG B;  3RJ3 A;  1C3D A;  3W7T A;  2GOX A;  4GL3 A;  1HMU A;  4Z4L A;  1HXC A;  5FO8 B;  1FCE A;  2FV0 A;  3D5S A;  3HXD B;  1V7W A;  1LOH A;  3Q75 B;  1H3A A;  4TF4 A;  2GH4 A;  2WY8 A;  1UT9 A;  2H6G B;  4GTT B;  3S4A A;  4F10 A;  4CE7 A;  1F9D A;  1HN0 A;  1TNZ B;  1X81 B;  3ACS A;  1TNO B;  5E2J A;  3Q73 B;  4F13 A;  1GA2 A;  1KFG A;  1SA4 B;  2I07 B;  3GLY A;  3WKG A;  2EAD A;  3P5R A;  4EHM B;  3G6J B;  2PN5 A;  2B4F A;  1RWH A;  1LD8 B;  3M75 A;  3M7E A;  2D8L A;  2YIK A;  1KWF A;  1KZP B;  3EZ8 A;  4YDO B;  3WKI A;  3Q78 B;  3W7U A;  3HXB B;  2BBC A;  3Q7F B;  4DOE A;  1DOG A;  1N7O A;  1H39 A;  3NFV A;  2X03 A;  3VW5 A;  2V3N A;  1HZF A;  5EAT A;  1H3C A;  1TN6 B;  1H14 A;  1N9A B;  1DL2 A;  1FT1 B;  1HMW A;  3CU7 A;  5EAU A;  3RX7 A;  3H7L A;  4GTP B;  4GTR B;  5JPN B;  3P5P A;  1NL4 B;  3SDT A;  2OKX A;  2BRV X;  4RNQ A;  4NEI A;  1QAZ A;  3GZK A;  2BB6 A;  3ON6 A;  2SQC A;  3EQA A;  3KSL B;  3P2C A;  1S64 B;  2H6I B;  2EAE A;  2VN7 A;  3WIQ A;  3DRA B;  4BOJ A;  4WU0 A;  2NOJ A;  1QSJ A;  4OZV A;  3X17 A;  3VSM A;  4KKJ A;  3SAE A;  3DPY B;  3D5R A;  4CJ0 A;  1H36 A;  3A3V A;  3AFJ A;  3W5M A;  2F6D A;  3QSP A;  1UG9 A;  1IA6 A;  3S4B A;  2JJB A;  3E37 B;  3EU8 A;  4FXK B;  2ZIS B;  5IL3 A;  1FBW A;  2XQW A;  2IEJ B;  3OED A;  4GTV B;  1GSZ A;  3WKH A;  2ONH A;  2A73 B;  1TNY B;  2ZIR B;  2E24 A;  3RSY A;  1FP3 A;  1FAE A;  1F1S A;  1JCQ B;  5DHI A;  3QPF A;  1KRF A;  1GXN A;  1CLC A;  3WUX A;  4GTQ B;  1DCE B;  3SQC A;  1GAH A;  3SFY B;  5M7Y A;  4ZG8 A;  5JMF A;  1HXA A;  1OJO A;  3M7B A;  2NVP A;  4FXG B;  2AHF A;  5ILH A;  1X1H A;  1WU4 A;  2ONG A;  3KSQ B;  5FOB B;  3S9V A;  3VXD A;  1QQF A;  3KQ4 A;  3E73 A;  2WCO A;  3Q79 B;  2Z07 A;  5MEH A;  1H12 A;  3DSS B;  1GLM A;  1AGM A;  1C82 A;  3M7C A;  4LNG B;  1NC5 A;  3S4D A;  4LNV A;  3M00 A;  1O5M B;  1W3Y A;  4WVC A;  3SDR A;  3DSU B;  3M7L A;  4AYQ A;  2RI9 A;  3H3K A;  1N7R A;  4TXT A;  3WIR A;  5JMD A;  1H54 A;  1O6R A;  5IKA A;  3E34 B;  3RRS A;  1D8E B;  5FO7 B;  3K11 A;  3W7X A;  3PZ3 B;  3SDU A;  1G9J A;  1N23 A;  4MU9 A;  1N20 A;  5IKH A;  1GXO A;  1SQC A;  2WII B;  3DSV B;  4J5T A;  1V7X A;  1MZC B;  1QBQ B;  1FO2 A;  3C72 B;  3M72 A;  3N0G A;  1O1R B;  1ULV A;  4LIX A; 
#chains in the Genus database with same CATH homology
 1WU5 A;  3HXF B;  1H37 A;  3QFY A;  3PYA A;  1G6I A;  2H6F B;  1H35 A;  1TN8 B;  2R2L B;  1KZO B;  1RQ5 A;  1N95 B;  4YCR A;  3SFX B;  3QG0 A;  4KTP A;  4WVB A;  3SDV A;  1N4P B;  5CZL A;  2G02 A;  3W7S A;  3W5N A;  3W7W A;  3REN A;  4V1S A;  1O1S B;  4ZRQ A;  3DSW B;  2V8K A;  1N94 B;  2BED B;  3PZ1 B;  2ZBL A;  3E32 B;  4AYO A;  2WYN A;  1D8D B;  1WU6 A;  3D3I A;  2GZ6 A;  3EUV B;  1NXC A;  3ANJ A;  3E33 B;  3M78 A;  5CD2 A;  1V7V A;  3DST B;  3PZ2 B;  3EU5 B;  3DSX B;  3SDQ A;  2VN4 A;  4GTM B;  3M73 A;  4L0G A;  1JCR B;  1VD5 A;  3Q7A B;  4L9P B;  3KLS A;  2XWB B;  3HXC B;  1KKT A;  1XW2 A;  2EAB A;  4YDE B;  1JCS B;  1NI1 B;  3ACT A;  4FUS A;  2DRO A;  1GXM A;  2DRQ A;  4BOK A;  2WIN B;  1W6K A;  4GTS B;  1O79 A;  2FBA A;  2DRS A;  4Q2B A;  1F9O A;  1GHQ A;  5DGQ A;  3M76 A;  4JJJ A;  2ZZR A;  3M71 A;  1V5C A;  5AGD A;  2JF4 A;  3PMM A;  5GZK A;  1N4R B;  2FUZ A;  3CIH A;  3M77 A;  1N4S B;  2G0D A;  3RX8 A;  2P0V A;  4ZH1 A;  3H2W A;  1TNB B;  5DGR A;  1KSD A;  1XWQ A;  1KSC A;  2CQT A;  3OXU A;  4C1S A;  1LTX B;  3T33 A;  1UMP A;  5GY3 A;  2JG0 A;  4V1R A;  1X9D A;  3E6U A;  3WC3 A;  4Q88 A;  2WY7 A;  4D4C A;  1KRE A;  1FMI A;  1W6J A;  3QXF A;  1O6H A;  1S63 B;  5GW7 A;  1G87 A;  4ZRP A;  4GTO B;  1O1T B;  2RGK A;  2EAC A;  2D5J A;  4D94 A;  1H3B A;  2XFG A;  1L2A A;  2B39 A;  3QXQ A;  4D4D A;  4KTR A;  1FO3 A;  3S4C A;  5JPM B;  1O6Q A;  2V3P A;  1JS4 A;  3PZ4 B;  2QNO A;  4AYR A;  5M7I A;  3WKF A;  4DOD A;  3E30 B;  1IA7 A;  1G9G A;  2PMV A;  3ANK A;  2H6H B;  1LF9 A;  3HXE B;  4CJ1 A;  4L6X A;  2F0Y B;  2RI8 A;  2A8Z A;  4XUV A;  1IS9 A;  2V8I A;  4D4A A;  3ANI A;  1R76 A;  1L1Y A;  1KS8 A;  3K7X A;  1K72 A;  3QWT A;  4QT9 A;  1LD7 B;  1H13 A;  4AYP A;  1V5D A;  3QT9 A;  4WVA A;  2BB5 A;  1XWT A;  1FBO A;  1TN7 B;  3M74 A;  4M76 A;  3WIW A;  3RX5 A;  4KKI A;  1FT2 B;  3TF4 A;  1LF6 A;  1TNU B;  4D4B A;  4Z4J A;  5FO9 B;  2DRR A;  2AHG A;  1GAI A;  4EL8 A;  1CEM A;  1HCU A;  2XWJ B;  2V8J A;  1WZZ A;  5KKB A;  1AYX A;  1N4Q B;  1SA5 B;  3QDE A;  4LNB B;  1FPP B;  3QRY A;  3PYB A;  2CQS A;  3QFZ A;  4ONT A;  3GT5 A;  4ZH5 A;  3QT3 A;  2FV1 A;  1TF4 A;  5CA3 A;  2AFA A;  4MBG B;  3RJ3 A;  1C3D A;  3W7T A;  2GOX A;  4GL3 A;  4Z4L A;  5FO8 B;  1FCE A;  2FV0 A;  3D5S A;  3HXD B;  1V7W A;  3Q75 B;  1H3A A;  4TF4 A;  2GH4 A;  2WY8 A;  1UT9 A;  2H6G B;  4GTT B;  3S4A A;  4CE7 A;  1F9D A;  1TNZ B;  1X81 B;  3ACS A;  1TNO B;  5E2J A;  3Q73 B;  1GA2 A;  1KFG A;  1SA4 B;  2I07 B;  3GLY A;  3WKG A;  2EAD A;  3P5R A;  4EHM B;  3G6J B;  2PN5 A;  2B4F A;  1LD8 B;  3M75 A;  3M7E A;  2D8L A;  2YIK A;  1KWF A;  1KZP B;  3EZ8 A;  4YDO B;  3WKI A;  3Q78 B;  3W7U A;  3HXB B;  2BBC A;  3Q7F B;  4DOE A;  1DOG A;  1H39 A;  3VW5 A;  2V3N A;  1HZF A;  1H3C A;  1TN6 B;  1H14 A;  1N9A B;  1DL2 A;  1FT1 B;  3CU7 A;  3RX7 A;  3H7L A;  4GTP B;  4GTR B;  5JPN B;  3P5P A;  1NL4 B;  3SDT A;  2OKX A;  3GZK A;  2BB6 A;  3ON6 A;  2SQC A;  3EQA A;  3KSL B;  3P2C A;  1S64 B;  2H6I B;  2EAE A;  2VN7 A;  3WIQ A;  3DRA B;  4BOJ A;  4WU0 A;  2NOJ A;  1QSJ A;  3X17 A;  4KKJ A;  3SAE A;  3DPY B;  3D5R A;  4CJ0 A;  1H36 A;  3A3V A;  3AFJ A;  3W5M A;  2F6D A;  3QSP A;  1UG9 A;  1IA6 A;  3S4B A;  2JJB A;  3E37 B;  3EU8 A;  4FXK B;  2ZIS B;  1FBW A;  2XQW A;  2IEJ B;  3OED A;  4GTV B;  1GSZ A;  3WKH A;  2A73 B;  1TNY B;  2ZIR B;  3RSY A;  1FP3 A;  1FAE A;  1JCQ B;  3QPF A;  1KRF A;  1GXN A;  1CLC A;  3WUX A;  4GTQ B;  1DCE B;  3SQC A;  1GAH A;  3SFY B;  5M7Y A;  4ZG8 A;  3M7B A;  2NVP A;  4FXG B;  2AHF A;  1WU4 A;  3KSQ B;  5FOB B;  3S9V A;  3VXD A;  1QQF A;  3KQ4 A;  3E73 A;  3Q79 B;  2Z07 A;  5MEH A;  1H12 A;  3DSS B;  1GLM A;  1AGM A;  3M7C A;  4LNG B;  1NC5 A;  3S4D A;  4LNV A;  1O5M B;  4WVC A;  3SDR A;  3DSU B;  3M7L A;  4AYQ A;  2RI9 A;  3H3K A;  4TXT A;  3WIR A;  1H54 A;  1O6R A;  3E34 B;  3RRS A;  1D8E B;  5FO7 B;  3K11 A;  3W7X A;  3PZ3 B;  3SDU A;  1G9J A;  4MU9 A;  1GXO A;  1SQC A;  2WII B;  3DSV B;  4J5T A;  1V7X A;  1MZC B;  1QBQ B;  1FO2 A;  3C72 B;  3M72 A;  1O1R B;  1ULV A;  4LIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...