4QT9A

Crystal structure of a putative glucoamylase (baccac_03554) from bacteroides caccae atcc 43185 at 2.05 a resolution
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
414
structure length
414
Chain Sequence
LSDDALMDTVQRRTFLYFWEGAEPNSGLAPERYHVDGVYPQNDANVVTSGGSGFGIMAILAGIDRGYVTREEGLARMERIVSFLEKADRFHGAYPHWWYGDTGKVKPFGQKDNGGDLVETAFLMQGLLAVHQYYANGNDKEKAIAQRIDRLWREVDWDWYRKGGQNVLYWHWSPTYGWEMDFPIHGYNECMIMYILAAASPTHGVPAAVYHDGWAQNGAIVSPHKVEGIELHLRYQGTEAGPLFWAQYSFLGLDPVGLKDEYCPSYFHEMRNLTLVNRAYCIRNPKHYKGFGPDCWGLTASYSVDGYAAHSPNEQDDKGVISPTAALSSIVYTPEYSLQVMRHLYNMGDKVFGPFGFYDAFSETDNWYPQRYLAIDQGPIAVMIENYRTGLLWKLFMSHPDVQAGLTKLGFNTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords putative glucoamylase
publication title Crystal structure of a putative glucoamylase (BACCAC_03554) from Bacteroides caccae ATCC 43185 at 2.05 A resolution
rcsb
source organism Bacteroides caccae atcc 43185
molecule tags Hydrolase
total genus 149
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10091 Glycoamylase Putative glucoamylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.140 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4qt9A00
4GL3A 4QT9A 3EU8A 5GZKA
chains in the Genus database with same CATH superfamily
4OK4A 1HM3A 2ZISB 2V8JA 4AYRA 1FP3A 3RENA 2P0VA 4XUVA 1DCEB 4ZRPA 3C72B 3D5RA 1TN8B 1H36A 3S4AA 3HXFB 3E6UA 2WINB 3ANIA 1DOGA 1N95B 3M74A 3M75A 1QQFA 1SQCA 5JMFA 1S64B 1N4RB 2NVPA 3ACTA 3HXEB 3E30B 3ACSA 1IA7A 3EZ8A 1LD8B 3M77A 1D8DB 1OJMA 4F10A 1FT2B 3Q78B 4M76A 5IL3A 2ONGA 3D3IA 1G9GA 1TNBB 1H3AA 2VN4A 2GH4A 3QXQA 5IL8A 3QXFA 5DHKA 3M7EA 1LTXB 3CU7A 2FBAA 4MMIA 4EL8A 4TF4A 3PZ2B 3WIQA 1FO3A 3SFYB 2X03A 3S4CA 4KTPA 2EABA 1TNUB 1WU4A 3WKFA 1O1TB 1J0NA 1N7NA 4TXTA 1GXNA 2F6DA 1JS4A 1C3DA 3P5RA 5IK0A 3G4DA 3HXBB 1D8EB 1NL4B 1MZCB 4FNVA 3QFYA 3E34B 3OXUA 2ZZRA 2RI8A 3Q7FB 5FO7B 1J0MA 1O1SB 2BRVX 2WIIB 4OZVA 3RJ3A 3WKIA 3QWTA 1HXCA 1HN0A 3SDVA 1FBOA 3W5MA 2DRSA 1HMUA 3H7LA 1RQ5A 3SDQA 3EU5B 1SA4B 4YDEB 3PYAA 1N23A 2GZ6A 5E2JA 3CIHA 2F0YB 3M00A 4FUSA 3PZ1B 1OJOA 4FXGB 1N22A 2V3PA 1TN6B 3H2WA 4V1SA 1IA6A 2D5JA 3G6JB 2YIKA 4DODA 3VSNA 1FBWA 3Q75B 5ILJA 1XWQA 1DL2A 3X17A 2ZIRB 3NFVA 4D4CA 3EU8A 2Z07A 4D94A 1L1YA 2PN5A 2WY7A 1C82A 2DRRA 1OJNA 1W6KA 1UG9A 3M73A 1ULVA 3QT9A 3DPYB 3S4BA 3P5PA 2J5CA 4LNGB 4WVBA 1F9GA 5FO8B 3HXCB 4GTQB 3H3KA 1RWFA 1TN7B 2G02A 2WDAA 3W7XA 5ILDA 1X9DA 1XWTA 4C1SA 1V5CA 3WC3A 2ZBLA 3E73A 1HXGA 1LOHA 1TNOB 2R2LB 4GTPB 3W7UA 5JPMB 5EATA 5DGQA 3HXDB 5FOBB 1UT9A 3E32B 3D5SA 1FPPB 1KS8A 4GL3A 1N7RA 2BB5A 2G0DA 3ANJA 3OEDA 4GTRB 1HZFA 2FUTA 3SQCA 3W7WA 3A3VA 1JCSB 1XW2A 4YDOB 1GXMA 2SQCA 1N1ZA 5FO9B 2E22A 2AHFA 1W3YA 1LXMA 4AYOA 3QFZA 1AYXA 5MEHA 4L6XA 3WKGA 2BB6A 4GTMB 2VN7A 2RGKA 1RWGA 1H39A 1N7QA 1GHQA 5CD2A 1IS9A 4E1YA 4GTSB 1SA5B 1HCUA 4Z4LA 1G9JA 1LD7B 1RW9A 1FCEA 1CLCA 4GAXA 4WVCA 5M7YA 3QSPA 3QT3A 5GZKA 3P2CA 4NEIA 4DI5A 4OZWA 1HX9A 2WCOA 1WZZA 2B4FA 1I8QA 1N7OA 3WIRA 1GAHA 3M7CA 1KZPB 4OJZA 4KKJA 3DSUB 3M7LA 3G4FA 3SDTA 3W5NA 3GLYA 4L0GA 3KQ4A 3Q7AB 2FV1A 4ZH5A 4EHMB 5JPNB 2DRQA 3W7SA 4KTRA 1KSCA 1KZOB 1EGUA 3E7JA 1KFGA 2JG0A 1N20A 1OJPA 2BRPA 2NOJA 4Z4JA 1JCQB 4D4AA 5AGDA 1X1IA 4BOKA 4MMHA 3K11A 5IKHA 1LXKA 5DHIA 3QRYA 3GZKA 5ILIA 1JCRB 1N4QB 1RWAA 1N1BA 1N24A 1HV6A 1K72A 4CE7A 2H6IB 4V1RA 3EQAA 1N7PA 2FUQA 1X1JA 3N0FA 5ILHA 3M78A 4LNVA 5ILZA 1WU6A 2AFAA 4AYPA 2XWJB 3RRSA 1X1HA 4AYQA 1O6RA 1H54A 1WU5A 3DSXB 4CJ1A 1F9OA 5GY3A 3M7BA 4GTOB 4GTTB 1NI1B 3DSTB 1UMPA 3RSYA 3NNBA 1GSZA 3AFJA 1CB8A 1NXCA 1RWCA 2JJBA 3EUVB 3SDRA 4OK2A 4MU9A 3DSVB 2RI9A 2EADA 2H6GB 1TF4A 3AFLA 5EAUA 4D4BA 1N21A 1H3CA 2QNOA 2XQWA 2IEJB 2H6FB 2WY8A 1HM2A 1V7XA 1H37A 1VD5A 5IKAA 5GW7A 5CA3A 2BBCA 3GT5A 1KWFA 4LIXA 3M71A 1HMWA 1H35A 4QT9A 1R76A 2V8IA 3SDUA 2V3NA 3T33A 3S4DA 4Q88A 2H6HB 1LF9A 3PZ4B 3Q79B 3QDEA 2FUZA 3E80A 3K7XA 2DROA 3S9VA 4D4DA 1N4SB 4J5TA 1FO2A 3PZ3B 1V5DA 2B39A 1GAIA 3WIWA 1KKTA 3M76A 1KSDA 5C05A 2AHGA 1N9AB 2JF4A 1O6HA 1O6QA 1KRFA 4FXKB 3W7TA 1V7VA 3RX8A 3VSMA 1H14A 4JJJA 3DSWB 1F1SA 1W6JA 4Q2BA 1H13A 4WU0A 1HXAA 4GTVB 3QG0A 3SFXB 2XWBB 1QBQB 2CQTA 1O1RB 2FV0A 1G6IA 1NC5A 1RWHA 1FAEA 4ZG8A 1H3BA 2EAEA 2I07B 5ILKA 2A73B 1GLMA 3SAEA 4LNBB 3M72A 5M7IA 3M02A 4F13A 3PMMA 2A8ZA 3A0OA 3KSLB 2PMVA 3TF4A 1L2AA 3PYBA 3WKHA 4ZRQA 1AGMA 1GXOA 1G87A 1TNYB 2Q1FA 5JMDA 3QPFA 3KLSA 3VXDA 4CJ0A 4ZH1A 1QSJA 4KKIA 4WVAA 3DSSB 4FJQA 1F9DA 2V8KA 2ONHA 2XFGA 5IK6A 3ON6A 1KREA 3RX7A 3DRAB 2BEDB 2E24A 1X81B 2CQSA 4MBGB 5DGRA 2D8LA 1GA2A 2GOXA 3ANKA 3VW5A 4RNQA 5CZLA 5KKBA 5IM1A 1TNZB 4ONTA 5ILYA 3LZ9A 4BOJA 5IK9A 3N0GA 3E37B 3Q73B 3RX5A 3E33B 1V7WA 1N94B 2EACA 4YCRA 1H12A 3M01A 3WUXA 1LF6A 2BRWA 5EASA 1O79A 2WYNA 1S63B 1N4PB 1QAZA 1CEMA 3KSQB 1O5MB 2OKXA 4DOEA 1FT1B 1FMIA 4L9PB
chains in the Genus database with same CATH topology
2ZISB 2V8JA 4AYRA 1FP3A 3RENA 2P0VA 4XUVA 1DCEB 4ZRPA 3C72B 3D5RA 1TN8B 1H36A 3S4AA 3HXFB 3E6UA 2WINB 3ANIA 1DOGA 1N95B 3M74A 3M75A 1QQFA 1SQCA 1S64B 1N4RB 2NVPA 3ACTA 3HXEB 3E30B 3ACSA 1IA7A 3EZ8A 1LD8B 3M77A 1D8DB 1FT2B 3Q78B 4M76A 3D3IA 1G9GA 1TNBB 1H3AA 2VN4A 2GH4A 3QXQA 3QXFA 3M7EA 1LTXB 3CU7A 2FBAA 4EL8A 4TF4A 3PZ2B 3WIQA 1FO3A 3SFYB 3S4CA 4KTPA 2EABA 1TNUB 1WU4A 3WKFA 1O1TB 4TXTA 1GXNA 2F6DA 1JS4A 1C3DA 3P5RA 3HXBB 1D8EB 1NL4B 1MZCB 3QFYA 3E34B 3OXUA 2ZZRA 2RI8A 3Q7FB 5FO7B 1O1SB 2WIIB 3RJ3A 3WKIA 3QWTA 3SDVA 1FBOA 3W5MA 2DRSA 3H7LA 1RQ5A 3SDQA 3EU5B 1SA4B 4YDEB 3PYAA 2GZ6A 5E2JA 3CIHA 2F0YB 4FUSA 3PZ1B 4FXGB 2V3PA 1TN6B 3H2WA 4V1SA 1IA6A 2D5JA 3G6JB 2YIKA 4DODA 1FBWA 3Q75B 1XWQA 1DL2A 3X17A 2ZIRB 4D4CA 3EU8A 2Z07A 4D94A 1L1YA 2PN5A 2WY7A 2DRRA 1W6KA 1UG9A 3M73A 1ULVA 3QT9A 3DPYB 3S4BA 3P5PA 4LNGB 4WVBA 5FO8B 3HXCB 4GTQB 3H3KA 1TN7B 2G02A 3W7XA 1X9DA 1XWTA 4C1SA 1V5CA 3WC3A 2ZBLA 3E73A 1TNOB 2R2LB 4GTPB 3W7UA 5JPMB 5DGQA 3HXDB 5FOBB 1UT9A 3E32B 3D5SA 1FPPB 1KS8A 4GL3A 2BB5A 2G0DA 3ANJA 3OEDA 4GTRB 1HZFA 3SQCA 3W7WA 3A3VA 1JCSB 1XW2A 4YDOB 1GXMA 2SQCA 5FO9B 2AHFA 4AYOA 3QFZA 1AYXA 5MEHA 4L6XA 3WKGA 2BB6A 4GTMB 2VN7A 2RGKA 1H39A 1GHQA 5CD2A 1IS9A 4GTSB 1SA5B 1HCUA 4Z4LA 1G9JA 1LD7B 1FCEA 1CLCA 5M7YA 4WVCA 3QSPA 3QT3A 5GZKA 3P2CA 1WZZA 2B4FA 3WIRA 1GAHA 3M7CA 1KZPB 4KKJA 3DSUB 3M7LA 3SDTA 3W5NA 3GLYA 4L0GA 3KQ4A 3Q7AB 2FV1A 4ZH5A 4EHMB 5JPNB 2DRQA 3W7SA 4KTRA 1KSCA 1KZOB 1KFGA 2JG0A 2NOJA 4Z4JA 1JCQB 4D4AA 5AGDA 4BOKA 3K11A 3QRYA 3GZKA 1JCRB 1N4QB 1K72A 4CE7A 2H6IB 4V1RA 3EQAA 3M78A 4LNVA 1WU6A 2AFAA 4AYPA 2XWJB 3RRSA 4AYQA 1O6RA 1H54A 1WU5A 3DSXB 4CJ1A 1F9OA 5GY3A 3M7BA 4GTOB 4GTTB 1NI1B 3DSTB 1UMPA 3RSYA 1GSZA 3AFJA 1NXCA 2JJBA 3EUVB 3SDRA 4MU9A 3DSVB 2RI9A 2EADA 2H6GB 1TF4A 4D4BA 1H3CA 2QNOA 2XQWA 2IEJB 2H6FB 2WY8A 1V7XA 1H37A 1VD5A 5GW7A 5CA3A 2BBCA 3GT5A 1KWFA 4LIXA 3M71A 1H35A 4QT9A 1R76A 2V8IA 3SDUA 2V3NA 3T33A 3S4DA 4Q88A 2H6HB 1LF9A 3PZ4B 3Q79B 3QDEA 2FUZA 3K7XA 2DROA 3S9VA 4D4DA 1N4SB 4J5TA 1FO2A 3PZ3B 1V5DA 2B39A 1GAIA 3WIWA 1KKTA 3M76A 1KSDA 2AHGA 1N9AB 2JF4A 1O6HA 1O6QA 1KRFA 4FXKB 3W7TA 1V7VA 3RX8A 1H14A 4JJJA 3DSWB 1W6JA 4Q2BA 1H13A 4WU0A 4GTVB 3QG0A 3SFXB 2XWBB 1QBQB 2CQTA 1O1RB 2FV0A 1G6IA 1NC5A 1FAEA 4ZG8A 1H3BA 2EAEA 2I07B 2A73B 1GLMA 3SAEA 4LNBB 3M72A 5M7IA 3PMMA 2A8ZA 3KSLB 2PMVA 3TF4A 1L2AA 3PYBA 3WKHA 4ZRQA 1AGMA 1GXOA 1G87A 1TNYB 3QPFA 3KLSA 3VXDA 4CJ0A 4ZH1A 1QSJA 4KKIA 4WVAA 3DSSB 1F9DA 2V8KA 2XFGA 3ON6A 1KREA 3RX7A 3DRAB 2BEDB 1X81B 2CQSA 4MBGB 5DGRA 2D8LA 1GA2A 2GOXA 3ANKA 3VW5A 5CZLA 5KKBA 1TNZB 4ONTA 4BOJA 3E37B 3Q73B 3RX5A 3E33B 1V7WA 1N94B 2EACA 4YCRA 1H12A 1LF6A 3WUXA 1O79A 2WYNA 1S63B 1N4PB 3KSQB 1CEMA 1O5MB 2OKXA 4DOEA 1FT1B 1FMIA 4L9PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GL3 A;  4QT9 A;  3EU8 A;  5GZK A; 
#chains in the Genus database with same CATH topology
 4OK4 A;  1HM3 A;  2ZIS B;  2V8J A;  4AYR A;  1FP3 A;  3REN A;  2P0V A;  4XUV A;  1DCE B;  4ZRP A;  3C72 B;  3D5R A;  1TN8 B;  1H36 A;  3S4A A;  3HXF B;  3E6U A;  2WIN B;  3ANI A;  1DOG A;  1N95 B;  3M74 A;  3M75 A;  1QQF A;  1SQC A;  5JMF A;  1S64 B;  1N4R B;  2NVP A;  3ACT A;  3HXE B;  3E30 B;  3ACS A;  1IA7 A;  3EZ8 A;  1LD8 B;  3M77 A;  1D8D B;  1OJM A;  4F10 A;  1FT2 B;  3Q78 B;  4M76 A;  5IL3 A;  2ONG A;  3D3I A;  1G9G A;  1TNB B;  1H3A A;  2VN4 A;  2GH4 A;  3QXQ A;  5IL8 A;  3QXF A;  5DHK A;  3M7E A;  1LTX B;  3CU7 A;  2FBA A;  4MMI A;  4EL8 A;  4TF4 A;  3PZ2 B;  3WIQ A;  1FO3 A;  3SFY B;  2X03 A;  3S4C A;  4KTP A;  2EAB A;  1TNU B;  1WU4 A;  3WKF A;  1O1T B;  1J0N A;  1N7N A;  4TXT A;  1GXN A;  2F6D A;  1JS4 A;  1C3D A;  3P5R A;  5IK0 A;  3G4D A;  3HXB B;  1D8E B;  1NL4 B;  1MZC B;  4FNV A;  3QFY A;  3E34 B;  3OXU A;  2ZZR A;  2RI8 A;  3Q7F B;  5FO7 B;  1J0M A;  1O1S B;  2BRV X;  2WII B;  4OZV A;  3RJ3 A;  3WKI A;  3QWT A;  1HXC A;  1HN0 A;  3SDV A;  1FBO A;  3W5M A;  2DRS A;  1HMU A;  3H7L A;  1RQ5 A;  3SDQ A;  3EU5 B;  1SA4 B;  4YDE B;  3PYA A;  1N23 A;  2GZ6 A;  5E2J A;  3CIH A;  2F0Y B;  3M00 A;  4FUS A;  3PZ1 B;  1OJO A;  4FXG B;  1N22 A;  2V3P A;  1TN6 B;  3H2W A;  4V1S A;  1IA6 A;  2D5J A;  3G6J B;  2YIK A;  4DOD A;  3VSN A;  1FBW A;  3Q75 B;  5ILJ A;  1XWQ A;  1DL2 A;  3X17 A;  2ZIR B;  3NFV A;  4D4C A;  3EU8 A;  2Z07 A;  4D94 A;  1L1Y A;  2PN5 A;  2WY7 A;  1C82 A;  2DRR A;  1OJN A;  1W6K A;  1UG9 A;  3M73 A;  1ULV A;  3QT9 A;  3DPY B;  3S4B A;  3P5P A;  2J5C A;  4LNG B;  4WVB A;  1F9G A;  5FO8 B;  3HXC B;  4GTQ B;  3H3K A;  1RWF A;  1TN7 B;  2G02 A;  2WDA A;  3W7X A;  5ILD A;  1X9D A;  1XWT A;  4C1S A;  1V5C A;  3WC3 A;  2ZBL A;  3E73 A;  1HXG A;  1LOH A;  1TNO B;  2R2L B;  4GTP B;  3W7U A;  5JPM B;  5EAT A;  5DGQ A;  3HXD B;  5FOB B;  1UT9 A;  3E32 B;  3D5S A;  1FPP B;  1KS8 A;  4GL3 A;  1N7R A;  2BB5 A;  2G0D A;  3ANJ A;  3OED A;  4GTR B;  1HZF A;  2FUT A;  3SQC A;  3W7W A;  3A3V A;  1JCS B;  1XW2 A;  4YDO B;  1GXM A;  2SQC A;  1N1Z A;  5FO9 B;  2E22 A;  2AHF A;  1W3Y A;  1LXM A;  4AYO A;  3QFZ A;  1AYX A;  5MEH A;  4L6X A;  3WKG A;  2BB6 A;  4GTM B;  2VN7 A;  2RGK A;  1RWG A;  1H39 A;  1N7Q A;  1GHQ A;  5CD2 A;  1IS9 A;  4E1Y A;  4GTS B;  1SA5 B;  1HCU A;  4Z4L A;  1G9J A;  1LD7 B;  1RW9 A;  1FCE A;  1CLC A;  4GAX A;  4WVC A;  5M7Y A;  3QSP A;  3QT3 A;  5GZK A;  3P2C A;  4NEI A;  4DI5 A;  4OZW A;  1HX9 A;  2WCO A;  1WZZ A;  2B4F A;  1I8Q A;  1N7O A;  3WIR A;  1GAH A;  3M7C A;  1KZP B;  4OJZ A;  4KKJ A;  3DSU B;  3M7L A;  3G4F A;  3SDT A;  3W5N A;  3GLY A;  4L0G A;  3KQ4 A;  3Q7A B;  2FV1 A;  4ZH5 A;  4EHM B;  5JPN B;  2DRQ A;  3W7S A;  4KTR A;  1KSC A;  1KZO B;  1EGU A;  3E7J A;  1KFG A;  2JG0 A;  1N20 A;  1OJP A;  2BRP A;  2NOJ A;  4Z4J A;  1JCQ B;  4D4A A;  5AGD A;  1X1I A;  4BOK A;  4MMH A;  3K11 A;  5IKH A;  1LXK A;  5DHI A;  3QRY A;  3GZK A;  5ILI A;  1JCR B;  1N4Q B;  1RWA A;  1N1B A;  1N24 A;  1HV6 A;  1K72 A;  4CE7 A;  2H6I B;  4V1R A;  3EQA A;  1N7P A;  2FUQ A;  1X1J A;  3N0F A;  5ILH A;  3M78 A;  4LNV A;  5ILZ A;  1WU6 A;  2AFA A;  4AYP A;  2XWJ B;  3RRS A;  1X1H A;  4AYQ A;  1O6R A;  1H54 A;  1WU5 A;  3DSX B;  4CJ1 A;  1F9O A;  5GY3 A;  3M7B A;  4GTO B;  4GTT B;  1NI1 B;  3DST B;  1UMP A;  3RSY A;  3NNB A;  1GSZ A;  3AFJ A;  1CB8 A;  1NXC A;  1RWC A;  2JJB A;  3EUV B;  3SDR A;  4OK2 A;  4MU9 A;  3DSV B;  2RI9 A;  2EAD A;  2H6G B;  1TF4 A;  3AFL A;  5EAU A;  4D4B A;  1N21 A;  1H3C A;  2QNO A;  2XQW A;  2IEJ B;  2H6F B;  2WY8 A;  1HM2 A;  1V7X A;  1H37 A;  1VD5 A;  5IKA A;  5GW7 A;  5CA3 A;  2BBC A;  3GT5 A;  1KWF A;  4LIX A;  3M71 A;  1HMW A;  1H35 A;  4QT9 A;  1R76 A;  2V8I A;  3SDU A;  2V3N A;  3T33 A;  3S4D A;  4Q88 A;  2H6H B;  1LF9 A;  3PZ4 B;  3Q79 B;  3QDE A;  2FUZ A;  3E80 A;  3K7X A;  2DRO A;  3S9V A;  4D4D A;  1N4S B;  4J5T A;  1FO2 A;  3PZ3 B;  1V5D A;  2B39 A;  1GAI A;  3WIW A;  1KKT A;  3M76 A;  1KSD A;  5C05 A;  2AHG A;  1N9A B;  2JF4 A;  1O6H A;  1O6Q A;  1KRF A;  4FXK B;  3W7T A;  1V7V A;  3RX8 A;  3VSM A;  1H14 A;  4JJJ A;  3DSW B;  1F1S A;  1W6J A;  4Q2B A;  1H13 A;  4WU0 A;  1HXA A;  4GTV B;  3QG0 A;  3SFX B;  2XWB B;  1QBQ B;  2CQT A;  1O1R B;  2FV0 A;  1G6I A;  1NC5 A;  1RWH A;  1FAE A;  4ZG8 A;  1H3B A;  2EAE A;  2I07 B;  5ILK A;  2A73 B;  1GLM A;  3SAE A;  4LNB B;  3M72 A;  5M7I A;  3M02 A;  4F13 A;  3PMM A;  2A8Z A;  3A0O A;  3KSL B;  2PMV A;  3TF4 A;  1L2A A;  3PYB A;  3WKH A;  4ZRQ A;  1AGM A;  1GXO A;  1G87 A;  1TNY B;  2Q1F A;  5JMD A;  3QPF A;  3KLS A;  3VXD A;  4CJ0 A;  4ZH1 A;  1QSJ A;  4KKI A;  4WVA A;  3DSS B;  4FJQ A;  1F9D A;  2V8K A;  2ONH A;  2XFG A;  5IK6 A;  3ON6 A;  1KRE A;  3RX7 A;  3DRA B;  2BED B;  2E24 A;  1X81 B;  2CQS A;  4MBG B;  5DGR A;  2D8L A;  1GA2 A;  2GOX A;  3ANK A;  3VW5 A;  4RNQ A;  5CZL A;  5KKB A;  5IM1 A;  1TNZ B;  4ONT A;  5ILY A;  3LZ9 A;  4BOJ A;  5IK9 A;  3N0G A;  3E37 B;  3Q73 B;  3RX5 A;  3E33 B;  1V7W A;  1N94 B;  2EAC A;  4YCR A;  1H12 A;  3M01 A;  3WUX A;  1LF6 A;  2BRW A;  5EAS A;  1O79 A;  2WYN A;  1S63 B;  1N4P B;  1QAZ A;  1CEM A;  3KSQ B;  1O5M B;  2OKX A;  4DOE A;  1FT1 B;  1FMI A;  4L9P B; 
#chains in the Genus database with same CATH homology
 2ZIS B;  2V8J A;  4AYR A;  1FP3 A;  3REN A;  2P0V A;  4XUV A;  1DCE B;  4ZRP A;  3C72 B;  3D5R A;  1TN8 B;  1H36 A;  3S4A A;  3HXF B;  3E6U A;  2WIN B;  3ANI A;  1DOG A;  1N95 B;  3M74 A;  3M75 A;  1QQF A;  1SQC A;  1S64 B;  1N4R B;  2NVP A;  3ACT A;  3HXE B;  3E30 B;  3ACS A;  1IA7 A;  3EZ8 A;  1LD8 B;  3M77 A;  1D8D B;  1FT2 B;  3Q78 B;  4M76 A;  3D3I A;  1G9G A;  1TNB B;  1H3A A;  2VN4 A;  2GH4 A;  3QXQ A;  3QXF A;  3M7E A;  1LTX B;  3CU7 A;  2FBA A;  4EL8 A;  4TF4 A;  3PZ2 B;  3WIQ A;  1FO3 A;  3SFY B;  3S4C A;  4KTP A;  2EAB A;  1TNU B;  1WU4 A;  3WKF A;  1O1T B;  4TXT A;  1GXN A;  2F6D A;  1JS4 A;  1C3D A;  3P5R A;  3HXB B;  1D8E B;  1NL4 B;  1MZC B;  3QFY A;  3E34 B;  3OXU A;  2ZZR A;  2RI8 A;  3Q7F B;  5FO7 B;  1O1S B;  2WII B;  3RJ3 A;  3WKI A;  3QWT A;  3SDV A;  1FBO A;  3W5M A;  2DRS A;  3H7L A;  1RQ5 A;  3SDQ A;  3EU5 B;  1SA4 B;  4YDE B;  3PYA A;  2GZ6 A;  5E2J A;  3CIH A;  2F0Y B;  4FUS A;  3PZ1 B;  4FXG B;  2V3P A;  1TN6 B;  3H2W A;  4V1S A;  1IA6 A;  2D5J A;  3G6J B;  2YIK A;  4DOD A;  1FBW A;  3Q75 B;  1XWQ A;  1DL2 A;  3X17 A;  2ZIR B;  4D4C A;  3EU8 A;  2Z07 A;  4D94 A;  1L1Y A;  2PN5 A;  2WY7 A;  2DRR A;  1W6K A;  1UG9 A;  3M73 A;  1ULV A;  3QT9 A;  3DPY B;  3S4B A;  3P5P A;  4LNG B;  4WVB A;  5FO8 B;  3HXC B;  4GTQ B;  3H3K A;  1TN7 B;  2G02 A;  3W7X A;  1X9D A;  1XWT A;  4C1S A;  1V5C A;  3WC3 A;  2ZBL A;  3E73 A;  1TNO B;  2R2L B;  4GTP B;  3W7U A;  5JPM B;  5DGQ A;  3HXD B;  5FOB B;  1UT9 A;  3E32 B;  3D5S A;  1FPP B;  1KS8 A;  4GL3 A;  2BB5 A;  2G0D A;  3ANJ A;  3OED A;  4GTR B;  1HZF A;  3SQC A;  3W7W A;  3A3V A;  1JCS B;  1XW2 A;  4YDO B;  1GXM A;  2SQC A;  5FO9 B;  2AHF A;  4AYO A;  3QFZ A;  1AYX A;  5MEH A;  4L6X A;  3WKG A;  2BB6 A;  4GTM B;  2VN7 A;  2RGK A;  1H39 A;  1GHQ A;  5CD2 A;  1IS9 A;  4GTS B;  1SA5 B;  1HCU A;  4Z4L A;  1G9J A;  1LD7 B;  1FCE A;  1CLC A;  5M7Y A;  4WVC A;  3QSP A;  3QT3 A;  5GZK A;  3P2C A;  1WZZ A;  2B4F A;  3WIR A;  1GAH A;  3M7C A;  1KZP B;  4KKJ A;  3DSU B;  3M7L A;  3SDT A;  3W5N A;  3GLY A;  4L0G A;  3KQ4 A;  3Q7A B;  2FV1 A;  4ZH5 A;  4EHM B;  5JPN B;  2DRQ A;  3W7S A;  4KTR A;  1KSC A;  1KZO B;  1KFG A;  2JG0 A;  2NOJ A;  4Z4J A;  1JCQ B;  4D4A A;  5AGD A;  4BOK A;  3K11 A;  3QRY A;  3GZK A;  1JCR B;  1N4Q B;  1K72 A;  4CE7 A;  2H6I B;  4V1R A;  3EQA A;  3M78 A;  4LNV A;  1WU6 A;  2AFA A;  4AYP A;  2XWJ B;  3RRS A;  4AYQ A;  1O6R A;  1H54 A;  1WU5 A;  3DSX B;  4CJ1 A;  1F9O A;  5GY3 A;  3M7B A;  4GTO B;  4GTT B;  1NI1 B;  3DST B;  1UMP A;  3RSY A;  1GSZ A;  3AFJ A;  1NXC A;  2JJB A;  3EUV B;  3SDR A;  4MU9 A;  3DSV B;  2RI9 A;  2EAD A;  2H6G B;  1TF4 A;  4D4B A;  1H3C A;  2QNO A;  2XQW A;  2IEJ B;  2H6F B;  2WY8 A;  1V7X A;  1H37 A;  1VD5 A;  5GW7 A;  5CA3 A;  2BBC A;  3GT5 A;  1KWF A;  4LIX A;  3M71 A;  1H35 A;  4QT9 A;  1R76 A;  2V8I A;  3SDU A;  2V3N A;  3T33 A;  3S4D A;  4Q88 A;  2H6H B;  1LF9 A;  3PZ4 B;  3Q79 B;  3QDE A;  2FUZ A;  3K7X A;  2DRO A;  3S9V A;  4D4D A;  1N4S B;  4J5T A;  1FO2 A;  3PZ3 B;  1V5D A;  2B39 A;  1GAI A;  3WIW A;  1KKT A;  3M76 A;  1KSD A;  2AHG A;  1N9A B;  2JF4 A;  1O6H A;  1O6Q A;  1KRF A;  4FXK B;  3W7T A;  1V7V A;  3RX8 A;  1H14 A;  4JJJ A;  3DSW B;  1W6J A;  4Q2B A;  1H13 A;  4WU0 A;  4GTV B;  3QG0 A;  3SFX B;  2XWB B;  1QBQ B;  2CQT A;  1O1R B;  2FV0 A;  1G6I A;  1NC5 A;  1FAE A;  4ZG8 A;  1H3B A;  2EAE A;  2I07 B;  2A73 B;  1GLM A;  3SAE A;  4LNB B;  3M72 A;  5M7I A;  3PMM A;  2A8Z A;  3KSL B;  2PMV A;  3TF4 A;  1L2A A;  3PYB A;  3WKH A;  4ZRQ A;  1AGM A;  1GXO A;  1G87 A;  1TNY B;  3QPF A;  3KLS A;  3VXD A;  4CJ0 A;  4ZH1 A;  1QSJ A;  4KKI A;  4WVA A;  3DSS B;  1F9D A;  2V8K A;  2XFG A;  3ON6 A;  1KRE A;  3RX7 A;  3DRA B;  2BED B;  1X81 B;  2CQS A;  4MBG B;  5DGR A;  2D8L A;  1GA2 A;  2GOX A;  3ANK A;  3VW5 A;  5CZL A;  5KKB A;  1TNZ B;  4ONT A;  4BOJ A;  3E37 B;  3Q73 B;  3RX5 A;  3E33 B;  1V7W A;  1N94 B;  2EAC A;  4YCR A;  1H12 A;  1LF6 A;  3WUX A;  1O79 A;  2WYN A;  1S63 B;  1N4P B;  3KSQ B;  1CEM A;  1O5M B;  2OKX A;  4DOE A;  1FT1 B;  1FMI A;  4L9P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...