4FJQA

Crystal structure of an alpha-bisabolol synthase
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
530
structure length
521
Chain Sequence
PSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGDRSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRVLMVEAQWLNEGHIPTTEELDSIAVNLGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAEKDNFTRMGEEYKNLVKSLLVYPMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
molecule tags Lyase
total genus 202
structure length 521
sequence length 530
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4fjqA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4fjqA02
2PS7A 1YYRA 4KVIA 3CP6A 4RXDA 5DHIA 4WK5A 4XQTF 1WL3A 5AFXA 2P1CA 5E8HA 2Z4YA 4KVWA 3VJBA 4Q23A 3WSBA 2ONGA 3CKEA 2Q80A 3W7FA 5IMNA 5DGMF 3LOMA 3S4JA 4EA1A 4P0VA 1WMWA 4LXWA 4DWBA 1KIYA 3WCIA 3V66A 2ZY1A 4OMGA 3SDRA 3TS7A 3ASXA 3N6KF 5IMPA 1ZW5A 4RXEA 4NFKF 3WCJA 3WCFA 4EA0A 4NFIF 2Z7IA 3N1WF 1VG2A 5H9DA 4KPDA 3M00A 3KRCA 3PDEA 5DJPF 5AELA 2Z78A 2AZLA 3QKCA 3M9UA 3WEFA 3UCAA 4DZWA 3SDVA 3Q30A 4DI5A 4KQ5A 2Z52A 5JV2F 3P8RA 1N22A 2Z4XA 4LTZA 4KQSA 2Q9YA 1VG4A 3M02A 5IK9A 1VG7A 5ER8A 3KB9A 4GA3A 1HXAA 5IKHA 1V4HA 1JFGA 3MZVA 5ILZA 5ILHA 3ZMBA 3N45F 4LA5A 5E8LA 3LLWA 1WL0A 2AZKA 4KVDA 1V4IA 3SDQA 5IM1A 3KRCB 3VJAA 2EWGA 1N20A 3N3DA 4LLSA 4LZ0A 4NG6A 5IK6A 3EFQA 2OPMA 2F8ZF 2OGDA 4E1EA 5E8KA 3P41A 3OACA 3RYEA 3WSAA 2F92F 2QISA 3ICKA 4MC8A 2ZCOA 4LUUA 4MC0A 4F62A 3TFVA 5DHKA 5HN8A 4LFEA 1VG3A 1YHLA 3ACXA 4RXCA 3LZ9A 2H8OA 4FP4A 4RYPA 4RNQA 5ILYA 3SDUA 5JV1F 3WCLA 5HN9A 3AQ0A 5ILJA 3KROA 5HN7A 3WCMA 4LIXA 2E93A 3RMGA 1DGPA 4KUXA 4LTVA 3BNYA 1HXGA 2AETA 2J1PA 3N5HF 3PYBA 2PS8A 2F8CF 5DIQF 2FORA 3WC9A 1EZFA 1YYUA 1UBWA 3OACB 2J1OA 3LEEA 1RQJA 3SAEA 1RTRA 4F6VA 3Q1OA 4LLTA 5B0MA 3PYAA 3Q2ZA 1N24A 1WL1A 2E8WA 2Q9ZA 2ZCRA 5ERNA 3V1VA 4JZXA 2AELA 2E92A 3N0GA 2ZEVA 2E8UA 3WCHA 3ICNA 2AZJA 3ZL6A 3LVSA 3ZMCA 2I19A 3N1VF 3KROB 4LOBA 3RBMA 3S9VA 3P5RA 3ID0A 4OKMA 4JXNA 5DGSF 3LGZB 3LGKA 4P0XA 4JXYA 3KBKA 1WL2A 2FTZA 1WY0A 3WCBA 4KKMA 1YJ4A 4LZCA 1YV5A 5HNAA 4KQUA 2J5CA 3WCAA 2AEKA 5IKAA 3NF2A 4JZBA 3WEIA 5ILIA 3KRAA 5DGNF 1V4KA 1V4JA 3APZA 1N23A 3OYRA 3WCDA 3AE0A 4LPGF 3EZ3A 3KRFA 4KVYA 5ERMA 1HXCA 1PS1A 5EROA 5JA0F 4DWGA 4OKZA 1N1BA 3RYWA 3WE9A 4KFAA 5IMIA 4F6XA 2ZCQA 4DEMF 3Q2QA 5DW7A 3VJ8A 5DJVF 1YYSA 4NKEA 3ICZA 5I1UA 1YQ7A 5C05A 3LG5A 5B01A 3DYHA 4KWDA 1UBVA 4N1ZF 5IL3A 5B0JA 3ADZA 3KRAB 5DJRF 3TFNA 1YYQA 3CC9A 3KRFB 3BNXA 1N21A 2E90A 4FJQA 2F94F 2Z4WA 5IVGA 3QQVA 4LFGA 2Z50A 3IBAA 5CG6A 4EA2A 2O1OA 4JYXA 4RXAA 5AYPA 3NPRA 1HM7A 2Z4ZA 5JV0F 2ONHA 1FPSA 5B03A 3LDWA 2ZEUA 3VJEA 4LZ3A 5A0KA 4KPJA 2OA6A 2PS6A 3ZCDA 2F89F 3G4FA 3N0FA 3LMDA 4GAXA 5IK0A 3VJCA 2E95A 4L2XF 4H5EF 3M01A 1JFAA 1YHMA 4E9ZA 4H5CF 2E4OA 3WJNA 1VG6A 3TFPA 1UBXA 1YHKA 3OABA 2E8VA 1YYTA 5AHUB 2F7MF 3DYFA 3LJIA 3PKOA 5CG5A 3WCEA 2Z7HA 5ILKA 2DH4A 4LA6A 3DYGA 2ZCSA 4LPHF 3NRIA 3ICMA 5EATA 1N1ZA 3WCCA 4ZQ8A 3KRPA 5EAUA 4NKFA 4P0WA 4DHDA 4H5DF 3B7LA 5JUZF 5ILDA 4K10A 3P5PA 3WEGA 5EASA 5DZ2A 4QPFA 3WJKA 3G4DA 4LFVF 3AQBB 5B02A 1DI1A 3EGTA 4PVYF 3PH7A 2PS5A 3WCGA 3MAVA 2VF6A 4N9UA 1RQIA 3LSNA 3OABB 4OGUA 1WKZA 2F9KF 4UMJA 3N49F 3NPKA 3N5JF 4XQRF 3M0GA 3ACYA 3AQCB 3P8LA 2E94A 4OMHA 2E8TA 4XQSF 2OPNA 5B0KA 3LK5A 5IL8A 1KIZA 5A0IA 3IPIA 3WEJA 1UBYA 4MC3A 3SDTA 3V1XA 3N46F 4E9UA 4PVXF 3WEKA 2RAHA 2E8XA 4NUAA 5B00A 3KRPB 1V4EA 5IN8A 3VJDA 2Z4VA 4GP1A 5KSXF 4KK2A 1HM4A 3N3LF 1HX9A 2E91A 2PS4A 4NFJF 2Q58A 4GP2A 5B0IA 3ACWA 3TC1A 4JVJF 3WEHA 3VJ9A 4QXSF 5A0JA 3WJOA 3ZOUA 4DXJA 5B0LA 4HD1A
chains in the Genus database with same CATH superfamily
3CU7A 2PS7A 1YYRA 4KVIA 5AGDA 3CP6A 4RXDA 5DHIA 3D5RA 1GAHA 2NOJA 4WK5A 3M75A 1RW9A 5FO9B 4XQTF 2WY7A 3KSQB 1WL3A 3QT3A 1EGUA 3RJ3A 3PZ3B 1H13A 3E37B 5AFXA 2P1CA 1LF9A 5E8HA 1N7PA 2Z4YA 4KVWA 3VJBA 4Q23A 3WSBA 1LOHA 1C82A 2ONGA 2H6FB 2XWJB 4GTPB 4QT9A 1GXNA 1H54A 3CKEA 2ZIRB 5CA3A 1KRFA 1MZCB 2X03A 2Q80A 3W7FA 5IMNA 5DGMF 2G0DA 1N4RB 4OK4A 3GT5A 1W6KA 3LOMA 5FO7B 3S4JA 4EA1A 4P0VA 1WMWA 1N9AB 1F1SA 4LXWA 1J0MA 4DWBA 1KIYA 3WCIA 3V66A 2ZY1A 3E6UA 4OMGA 3SDRA 4GL3A 3TS7A 3ASXA 3N6KF 5IMPA 2H6HB 1ZW5A 5DGRA 4RXEA 2B4FA 4EL8A 1CB8A 3GZKA 4NFKF 3P2CA 4KTPA 3WCJA 3WCFA 4EA0A 4NFIF 1HMUA 4FXKB 2Z7IA 3WKGA 3N1WF 2PN5A 4CJ1A 2DROA 1VD5A 1VG2A 1UG9A 1D8DB 2BRPA 3EU5B 5H9DA 3HXFB 1GLMA 4KPDA 1IS9A 3M00A 3W7XA 3KRCA 1H12A 1OJPA 3M77A 3T33A 3PDEA 2RI8A 5DJPF 5AELA 2Z78A 2AZLA 3QKCA 3M9UA 1NI1B 3WEFA 4GTQB 2G02A 1H3CA 1KSDA 1N4PB 3UCAA 4DZWA 3SDVA 3W5NA 5E2JA 1H36A 4AYRA 3Q30A 4DI5A 2DRSA 4KQ5A 2Z52A 1RWAA 3QRYA 1RWFA 5JV2F 3P8RA 1N22A 2Z4XA 4LTZA 1H39A 4KQSA 2Q9YA 1VG4A 4GTMB 3M02A 4CJ0A 5IK9A 1VG7A 2BBCA 4AYOA 5ER8A 1JCQB 1DCEB 3KB9A 1KSCA 4GA3A 1HXAA 3K7XA 5IKHA 1V4HA 1O1TB 1JFGA 3MZVA 1N7RA 1O6HA 5ILZA 1X81B 5ILHA 2EAEA 3M78A 3ZMBA 3OXUA 3RENA 2Q1FA 4YDOB 3N45F 4Q2BA 1X1IA 4LNBB 4LA5A 5E8LA 2V8KA 4OZVA 1QSJA 3DPYB 3LLWA 1WL0A 2AZKA 2V8IA 4KKIA 5JMDA 1FO2A 4KVDA 1V4IA 3SDQA 5IM1A 4FXGB 3KRCB 1FT2B 3VJAA 2EWGA 3ACSA 1N20A 3N3DA 1FCEA 3X17A 3WKIA 2BEDB 2ZZRA 4M76A 5DGQA 4LLSA 4LZ0A 4KKJA 4NG6A 5GW7A 5IK6A 3SFXB 3EFQA 2OPMA 2F8ZF 2OGDA 4E1EA 1KREA 5E8KA 1QBQB 1XWTA 1IA7A 3P41A 3OACA 4ZRPA 5JPMB 3ANKA 3RYEA 3WSAA 3QG0A 2E24A 2F92F 2QISA 3ICKA 4MC8A 1X1HA 3Q75B 1FMIA 1LXKA 2F6DA 2ZCOA 4LUUA 4MC0A 4F62A 3TFVA 5DHKA 5HN8A 4LFEA 1HMWA 5CD2A 1VG3A 4GTVB 1YHLA 3ACXA 4RXCA 4AYQA 3LZ9A 1TN6B 2OKXA 2H8OA 4FP4A 4RYPA 4RNQA 1FAEA 3D3IA 4MMIA 3VSMA 1AGMA 3E32B 5ILYA 1TNBB 3DSUB 2QNOA 3SDUA 5JV1F 3WCLA 5HN9A 3AQ0A 1OJMA 3DSSB 3NNBA 1QQFA 4OZWA 5ILJA 3KROA 5HN7A 3WCMA 1TF4A 1XW2A 4LIXA 2E93A 3RMGA 1DGPA 4GTRB 4L9PB 2WIIB 1HCUA 1RWHA 4KUXA 4LTVA 2V3PA 3BNYA 1NC5A 4F13A 4TF4A 1HXGA 2AETA 2J1PA 3N5HF 3PYBA 1ULVA 2FBAA 2PS8A 2F8CF 4L6XA 1V7XA 5DIQF 3CIHA 2BB5A 2FORA 3WC9A 1EZFA 1YYUA 5M7YA 4WU0A 3PZ2B 1F9OA 3W7UA 4YDEB 1UBWA 1V7WA 4YCRA 3OACB 2J1OA 3LEEA 1JCSB 2CQSA 1GA2A 3M73A 1RQJA 2H6IB 2PMVA 3VW5A 3SAEA 1RTRA 3Q7AB 4F6VA 3Q1OA 4LLTA 3E30B 5B0MA 1O1RB 1LTXB 3PYAA 3Q2ZA 1WU6A 2VN4A 2BRVX 1N24A 1WL1A 4Z4LA 3QFZA 2E8WA 2Q9ZA 2ZCRA 5ERNA 2SQCA 3V1VA 1OJNA 3ANJA 4JZXA 4ONTA 2AELA 1SQCA 1TN7B 5KKBA 3C72B 3AFLA 2E92A 1X1JA 2EADA 2H6GB 3N0GA 3GLYA 5GZKA 2ZEVA 2E8UA 3WCHA 3ICNA 2AZJA 3ZL6A 2WINB 3E34B 3LVSA 3ZMCA 2I19A 3N1VF 3KROB 3HXDB 4LOBA 3RBMA 3W7SA 3HXEB 1GHQA 3HXCB 2ZBLA 3W7TA 4D4DA 3S9VA 3M72A 3P5RA 3QXQA 3ID0A 4OKMA 4JXNA 4DODA 1V5DA 4F10A 1LF6A 5DGSF 2JJBA 1KWFA 1TNYB 2WY8A 4D4AA 3LGZB 3LGKA 4P0XA 3ANIA 1F9DA 4JXYA 2EACA 3E7JA 2V8JA 3M74A 2NVPA 3KBKA 1WL2A 2V3NA 2FTZA 1WY0A 4FNVA 3WCBA 4L0GA 4KKMA 1YJ4A 4LZCA 3WC3A 1YV5A 1N4SB 5HNAA 4KQUA 4WVAA 2J5CA 3WCAA 1O6QA 2AEKA 4GTOB 5FO8B 5IKAA 3HXBB 5M7IA 3NF2A 4JZBA 3WEIA 5ILIA 3KRAA 1N7QA 1TNZB 2YIKA 3QSPA 3WIQA 4E1YA 4TXTA 4KTRA 5DGNF 1GSZA 2I07B 1V4KA 1V4JA 1RWGA 2AHFA 5MEHA 3APZA 1N23A 3S4AA 3OYRA 3WCDA 1L1YA 3AE0A 2E22A 4LPGF 3EZ3A 1FBWA 3KRFA 4KVYA 5ERMA 1KZOB 2D8LA 1SA5B 1HXCA 1PS1A 1FT1B 5EROA 5JA0F 4DWGA 3A0OA 1X9DA 3H7LA 3M71A 4OKZA 1GXMA 1N1BA 2XFGA 4C1SA 3RYWA 4EHMB 4ZG8A 3WE9A 1HV6A 4KFAA 5IMIA 3S4BA 2R2LB 2FUTA 3S4CA 4F6XA 3QWTA 1KS8A 3G6JB 4ZH1A 2ZCQA 4DEMF 3Q2QA 5DW7A 3VJ8A 2WDAA 2Z07A 5DJVF 4D4BA 2FUQA 1YYSA 4NKEA 3AFJA 1F9GA 2BB6A 2IEJB 3ICZA 5I1UA 4MU9A 1JCRB 2RGKA 4LNGB 2DRRA 2BRWA 4MMHA 1YQ7A 5C05A 1XWQA 5FOBB 3LG5A 1L2AA 3RX7A 5B01A 1G6IA 3DYHA 4KWDA 1UBVA 1V5CA 3H2WA 4N1ZF 5IL3A 5B0JA 3ADZA 3KRAB 5DJRF 1H35A 2A73B 3S4DA 2JF4A 3TFNA 3WUXA 2JG0A 3H3KA 1YYQA 1NXCA 1HZFA 1CEMA 3CC9A 2B39A 4GTTB 3WKFA 2EABA 3KRFB 4MBGB 3BNXA 1J0NA 1N21A 1O6RA 2E90A 4FJQA 3ON6A 2F94F 2Z4WA 5IVGA 3QQVA 1G9JA 4LFGA 3W7WA 1D8EB 1H14A 2Z50A 3IBAA 5CG6A 1O1SB 4D4CA 3DSTB 2AFAA 4EA2A 4OK2A 3VXDA 2O1OA 4CE7A 4D94A 4JYXA 1KFGA 4RXAA 5AYPA 4JJJA 5JPNB 3NPRA 1HM3A 1HM7A 2FV1A 2Z4ZA 1OJOA 5JV0F 1JS4A 3W5MA 2ONHA 3M76A 1FPSA 5B03A 1N4QB 3LDWA 2WYNA 1R76A 2ZEUA 3K11A 4WVBA 1SA4B 3VJEA 3DRAB 4LZ3A 5A0KA 4KPJA 1FBOA 2ZISB 3A3VA 1G87A 1DL2A 5JMFA 2OA6A 2PS6A 3DSXB 3ZCDA 1O79A 2F89F 3G4FA 3N0FA 3LMDA 4GAXA 5GY3A 1AYXA 1LD7B 3QT9A 5IK0A 3VJCA 1FP3A 2E95A 4L2XF 1DOGA 3KQ4A 4XUVA 4H5EF 3M01A 1TNOB 4ZH5A 1JFAA 2GH4A 1YHMA 1W6JA 2A8ZA 4DOEA 4E9ZA 3M7BA 4H5CF 2E4OA 3WJNA 1VG6A 1TN8B 3VSNA 1S63B 3TFPA 1V7VA 3SQCA 1QAZA 4J5TA 1UBXA 3NFVA 1YHKA 3OABA 3RSYA 2E8VA 1YYTA 5AHUB 1LD8B 2F7MF 3DYFA 1I8QA 1GXOA 1KZPB 4AYPA 3LJIA 2AHGA 2D5JA 1N7OA 3Q78B 4GTSB 3RX5A 3PKOA 3EQAA 5CG5A 3WCEA 2Z7HA 5ILKA 1W3YA 2F0YB 3RX8A 2DH4A 4LA6A 3DYGA 3OEDA 1CLCA 2ZCSA 3Q73B 4LPHF 3NRIA 2GOXA 5CZLA 3ICMA 4WVCA 5EATA 2GZ6A 3RRSA 3KSLB 1N1ZA 3WCCA 4ZQ8A 2WCOA 3QFYA 4Z4JA 3KRPA 5EAUA 3E73A 1TNUB 4NKFA 4P0WA 4DHDA 4H5DF 3M7EA 1GAIA 3B7LA 5JUZF 5ILDA 4K10A 3P5PA 1WZZA 3WEGA 3DSWB 5EASA 5DZ2A 2FUZA 4QPFA 3KLSA 3M7CA 1UMPA 3WJKA 4LNVA 3G4DA 1N95B 2VN7A 3SFYB 1RWCA 4LFVF 3AQBB 5B02A 2DRQA 1DI1A 4OJZA 1WU5A 3EGTA 1HM2A 1NL4B 4PVYF 3PH7A 1FPPB 4V1RA 2PS5A 1FO3A 3WCGA 3MAVA 2VF6A 4N9UA 1KKTA 1RQIA 3LSNA 3OABB 4OGUA 1S64B 1WKZA 3E80A 3M7LA 3PZ4B 2F9KF 1G9GA 4UMJA 3N49F 3NPKA 3N5JF 4XQRF 3M0GA 3QXFA 3QDEA 3ACYA 3AQCB 3P8LA 2E94A 1IA6A 1N94B 4BOJA 1RQ5A 4OMHA 2RI9A 2E8TA 4XQSF 3WIWA 2OPNA 5B0KA 3LK5A 5IL8A 2XWBB 3D5SA 1KIZA 5A0IA 3IPIA 3WEJA 1UBYA 4MC3A 3SDTA 3V1XA 3N46F 4E9UA 1H3AA 4PVXF 3WEKA 4V1SA 2RAHA 2E8XA 1N7NA 1K72A 2FV0A 3Q7FB 4Q88A 1H37A 4ZRQA 1H3BA 3E33B 4NUAA 3EZ8A 5B00A 3KRPB 3ACTA 4NEIA 1V4EA 5IN8A 3VJDA 2Z4VA 1O5MB 2P0VA 4GP1A 5KSXF 3DSVB 4KK2A 1HM4A 1HN0A 3N3LF 2CQTA 3Q79B 1HX9A 2E91A 2PS4A 4NFJF 2Q58A 3WKHA 4GP2A 4FUSA 5B0IA 3TF4A 3ACWA 1C3DA 3TC1A 1WU4A 4JVJF 3WEHA 4BOKA 3PZ1B 3EU8A 3VJ9A 4QXSF 5A0JA 3EUVB 1UT9A 3WJOA 3ZOUA 3PMMA 4DXJA 2XQWA 1LXMA 3WIRA 3QPFA 5B0LA 4HD1A
chains in the Genus database with same CATH topology
2PS7A 1YYRA 4KVIA 3CP6A 4RXDA 5DHIA 4WK5A 4XQTF 1WL3A 5AFXA 2P1CA 5E8HA 2Z4YA 4KVWA 3VJBA 4Q23A 3WSBA 2ONGA 3CKEA 2Q80A 3W7FA 5IMNA 5DGMF 3LOMA 3S4JA 4EA1A 4P0VA 1WMWA 4LXWA 4DWBA 1KIYA 3WCIA 3V66A 2ZY1A 4OMGA 3SDRA 3TS7A 3ASXA 3N6KF 5IMPA 1ZW5A 4RXEA 4NFKF 3WCJA 3WCFA 4EA0A 4NFIF 2Z7IA 3N1WF 1VG2A 5H9DA 4KPDA 3M00A 3KRCA 3PDEA 5DJPF 5AELA 2Z78A 2AZLA 3QKCA 3M9UA 3WEFA 3UCAA 4DZWA 3SDVA 3Q30A 4DI5A 4KQ5A 2Z52A 5JV2F 3P8RA 1N22A 2Z4XA 4LTZA 4KQSA 2Q9YA 1VG4A 3M02A 5IK9A 1VG7A 5ER8A 3KB9A 4GA3A 1HXAA 5IKHA 1V4HA 1JFGA 3MZVA 5ILZA 5ILHA 3ZMBA 3N45F 4LA5A 5E8LA 3LLWA 1WL0A 2AZKA 4KVDA 1V4IA 3SDQA 5IM1A 3KRCB 3VJAA 2EWGA 1N20A 3N3DA 4LLSA 4LZ0A 4NG6A 5IK6A 3EFQA 2OPMA 2F8ZF 2OGDA 4E1EA 5E8KA 3P41A 3OACA 3RYEA 3WSAA 2F92F 2QISA 3ICKA 4MC8A 2ZCOA 4LUUA 4MC0A 4F62A 3TFVA 5DHKA 5HN8A 4LFEA 1VG3A 1YHLA 3ACXA 4RXCA 3LZ9A 2H8OA 4FP4A 4RYPA 4RNQA 5ILYA 3SDUA 5JV1F 3WCLA 5HN9A 3AQ0A 5ILJA 3KROA 5HN7A 3WCMA 4LIXA 2E93A 3RMGA 1DGPA 4KUXA 4LTVA 3BNYA 1HXGA 2AETA 2J1PA 3N5HF 3PYBA 2PS8A 2F8CF 5DIQF 2FORA 3WC9A 1EZFA 1YYUA 1UBWA 3OACB 2J1OA 3LEEA 1RQJA 3SAEA 1RTRA 4F6VA 3Q1OA 4LLTA 5B0MA 3PYAA 3Q2ZA 1N24A 1WL1A 2E8WA 2Q9ZA 2ZCRA 5ERNA 3V1VA 4JZXA 2AELA 2E92A 3N0GA 2ZEVA 2E8UA 3WCHA 3ICNA 2AZJA 3ZL6A 3LVSA 3ZMCA 2I19A 3N1VF 3KROB 4LOBA 3RBMA 3S9VA 3P5RA 3ID0A 4OKMA 4JXNA 5DGSF 3LGZB 3LGKA 4P0XA 4JXYA 3KBKA 1WL2A 2FTZA 1WY0A 3WCBA 4KKMA 1YJ4A 4LZCA 1YV5A 5HNAA 4KQUA 2J5CA 3WCAA 2AEKA 5IKAA 3NF2A 4JZBA 3WEIA 5ILIA 3KRAA 5DGNF 1V4KA 1V4JA 3APZA 1N23A 3OYRA 3WCDA 3AE0A 4LPGF 3EZ3A 3KRFA 4KVYA 5ERMA 1HXCA 1PS1A 5EROA 5JA0F 4DWGA 4OKZA 1N1BA 3RYWA 3WE9A 4KFAA 5IMIA 4F6XA 2ZCQA 4DEMF 3Q2QA 5DW7A 3VJ8A 5DJVF 1YYSA 4NKEA 3ICZA 5I1UA 1YQ7A 5C05A 3LG5A 5B01A 3DYHA 4KWDA 1UBVA 4N1ZF 5IL3A 5B0JA 3ADZA 3KRAB 5DJRF 3TFNA 1YYQA 3CC9A 3KRFB 3BNXA 1N21A 2E90A 4FJQA 2F94F 2Z4WA 5IVGA 3QQVA 4LFGA 2Z50A 3IBAA 5CG6A 4EA2A 2O1OA 4JYXA 4RXAA 5AYPA 3NPRA 1HM7A 2Z4ZA 5JV0F 2ONHA 1FPSA 5B03A 3LDWA 2ZEUA 3VJEA 4LZ3A 5A0KA 4KPJA 2OA6A 2PS6A 3ZCDA 2F89F 3G4FA 3N0FA 3LMDA 4GAXA 5IK0A 3VJCA 2E95A 4L2XF 4H5EF 3M01A 1JFAA 1YHMA 4E9ZA 4H5CF 2E4OA 3WJNA 1VG6A 3TFPA 1UBXA 1YHKA 3OABA 2E8VA 1YYTA 5AHUB 2F7MF 3DYFA 3LJIA 3PKOA 5CG5A 3WCEA 2Z7HA 5ILKA 2DH4A 4LA6A 3DYGA 2ZCSA 4LPHF 3NRIA 3ICMA 5EATA 1N1ZA 3WCCA 4ZQ8A 3KRPA 5EAUA 4NKFA 4P0WA 4DHDA 4H5DF 3B7LA 5JUZF 5ILDA 4K10A 3P5PA 3WEGA 5EASA 5DZ2A 4QPFA 3WJKA 3G4DA 4LFVF 3AQBB 5B02A 1DI1A 3EGTA 4PVYF 3PH7A 2PS5A 3WCGA 3MAVA 2VF6A 4N9UA 1RQIA 3LSNA 3OABB 4OGUA 1WKZA 2F9KF 4UMJA 3N49F 3NPKA 3N5JF 4XQRF 3M0GA 3ACYA 3AQCB 3P8LA 2E94A 4OMHA 2E8TA 4XQSF 2OPNA 5B0KA 3LK5A 5IL8A 1KIZA 5A0IA 3IPIA 3WEJA 1UBYA 4MC3A 3SDTA 3V1XA 3N46F 4E9UA 4PVXF 3WEKA 2RAHA 2E8XA 4NUAA 5B00A 3KRPB 1V4EA 5IN8A 3VJDA 2Z4VA 4GP1A 5KSXF 4KK2A 1HM4A 3N3LF 1HX9A 2E91A 2PS4A 4NFJF 2Q58A 4GP2A 5B0IA 3ACWA 3TC1A 4JVJF 3WEHA 3VJ9A 4QXSF 5A0JA 3WJOA 3ZOUA 4DXJA 5B0LA 4HD1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PS7 A;  1YYR A;  4KVI A;  3CP6 A;  4RXD A;  5DHI A;  4WK5 A;  4XQT F;  1WL3 A;  5AFX A;  2P1C A;  5E8H A;  2Z4Y A;  4KVW A;  3VJB A;  4Q23 A;  3WSB A;  2ONG A;  3CKE A;  2Q80 A;  3W7F A;  5IMN A;  5DGM F;  3LOM A;  3S4J A;  4EA1 A;  4P0V A;  1WMW A;  4LXW A;  4DWB A;  1KIY A;  3WCI A;  3V66 A;  2ZY1 A;  4OMG A;  3SDR A;  3TS7 A;  3ASX A;  3N6K F;  5IMP A;  1ZW5 A;  4RXE A;  4NFK F;  3WCJ A;  3WCF A;  4EA0 A;  4NFI F;  2Z7I A;  3N1W F;  1VG2 A;  5H9D A;  4KPD A;  3M00 A;  3KRC A;  3PDE A;  5DJP F;  5AEL A;  2Z78 A;  2AZL A;  3QKC A;  3M9U A;  3WEF A;  3UCA A;  4DZW A;  3SDV A;  3Q30 A;  4DI5 A;  4KQ5 A;  2Z52 A;  5JV2 F;  3P8R A;  1N22 A;  2Z4X A;  4LTZ A;  4KQS A;  2Q9Y A;  1VG4 A;  3M02 A;  5IK9 A;  1VG7 A;  5ER8 A;  3KB9 A;  4GA3 A;  1HXA A;  5IKH A;  1V4H A;  1JFG A;  3MZV A;  5ILZ A;  5ILH A;  3ZMB A;  3N45 F;  4LA5 A;  5E8L A;  3LLW A;  1WL0 A;  2AZK A;  4KVD A;  1V4I A;  3SDQ A;  5IM1 A;  3KRC B;  3VJA A;  2EWG A;  1N20 A;  3N3D A;  4LLS A;  4LZ0 A;  4NG6 A;  5IK6 A;  3EFQ A;  2OPM A;  2F8Z F;  2OGD A;  4E1E A;  5E8K A;  3P41 A;  3OAC A;  3RYE A;  3WSA A;  2F92 F;  2QIS A;  3ICK A;  4MC8 A;  2ZCO A;  4LUU A;  4MC0 A;  4F62 A;  3TFV A;  5DHK A;  5HN8 A;  4LFE A;  1VG3 A;  1YHL A;  3ACX A;  4RXC A;  3LZ9 A;  2H8O A;  4FP4 A;  4RYP A;  4RNQ A;  5ILY A;  3SDU A;  5JV1 F;  3WCL A;  5HN9 A;  3AQ0 A;  5ILJ A;  3KRO A;  5HN7 A;  3WCM A;  4LIX A;  2E93 A;  3RMG A;  1DGP A;  4KUX A;  4LTV A;  3BNY A;  1HXG A;  2AET A;  2J1P A;  3N5H F;  3PYB A;  2PS8 A;  2F8C F;  5DIQ F;  2FOR A;  3WC9 A;  1EZF A;  1YYU A;  1UBW A;  3OAC B;  2J1O A;  3LEE A;  1RQJ A;  3SAE A;  1RTR A;  4F6V A;  3Q1O A;  4LLT A;  5B0M A;  3PYA A;  3Q2Z A;  1N24 A;  1WL1 A;  2E8W A;  2Q9Z A;  2ZCR A;  5ERN A;  3V1V A;  4JZX A;  2AEL A;  2E92 A;  3N0G A;  2ZEV A;  2E8U A;  3WCH A;  3ICN A;  2AZJ A;  3ZL6 A;  3LVS A;  3ZMC A;  2I19 A;  3N1V F;  3KRO B;  4LOB A;  3RBM A;  3S9V A;  3P5R A;  3ID0 A;  4OKM A;  4JXN A;  5DGS F;  3LGZ B;  3LGK A;  4P0X A;  4JXY A;  3KBK A;  1WL2 A;  2FTZ A;  1WY0 A;  3WCB A;  4KKM A;  1YJ4 A;  4LZC A;  1YV5 A;  5HNA A;  4KQU A;  2J5C A;  3WCA A;  2AEK A;  5IKA A;  3NF2 A;  4JZB A;  3WEI A;  5ILI A;  3KRA A;  5DGN F;  1V4K A;  1V4J A;  3APZ A;  1N23 A;  3OYR A;  3WCD A;  3AE0 A;  4LPG F;  3EZ3 A;  3KRF A;  4KVY A;  5ERM A;  1HXC A;  1PS1 A;  5ERO A;  5JA0 F;  4DWG A;  4OKZ A;  1N1B A;  3RYW A;  3WE9 A;  4KFA A;  5IMI A;  4F6X A;  2ZCQ A;  4DEM F;  3Q2Q A;  5DW7 A;  3VJ8 A;  5DJV F;  1YYS A;  4NKE A;  3ICZ A;  5I1U A;  1YQ7 A;  5C05 A;  3LG5 A;  5B01 A;  3DYH A;  4KWD A;  1UBV A;  4N1Z F;  5IL3 A;  5B0J A;  3ADZ A;  3KRA B;  5DJR F;  3TFN A;  1YYQ A;  3CC9 A;  3KRF B;  3BNX A;  1N21 A;  2E90 A;  4FJQ A;  2F94 F;  2Z4W A;  5IVG A;  3QQV A;  4LFG A;  2Z50 A;  3IBA A;  5CG6 A;  4EA2 A;  2O1O A;  4JYX A;  4RXA A;  5AYP A;  3NPR A;  1HM7 A;  2Z4Z A;  5JV0 F;  2ONH A;  1FPS A;  5B03 A;  3LDW A;  2ZEU A;  3VJE A;  4LZ3 A;  5A0K A;  4KPJ A;  2OA6 A;  2PS6 A;  3ZCD A;  2F89 F;  3G4F A;  3N0F A;  3LMD A;  4GAX A;  5IK0 A;  3VJC A;  2E95 A;  4L2X F;  4H5E F;  3M01 A;  1JFA A;  1YHM A;  4E9Z A;  4H5C F;  2E4O A;  3WJN A;  1VG6 A;  3TFP A;  1UBX A;  1YHK A;  3OAB A;  2E8V A;  1YYT A;  5AHU B;  2F7M F;  3DYF A;  3LJI A;  3PKO A;  5CG5 A;  3WCE A;  2Z7H A;  5ILK A;  2DH4 A;  4LA6 A;  3DYG A;  2ZCS A;  4LPH F;  3NRI A;  3ICM A;  5EAT A;  1N1Z A;  3WCC A;  4ZQ8 A;  3KRP A;  5EAU A;  4NKF A;  4P0W A;  4DHD A;  4H5D F;  3B7L A;  5JUZ F;  5ILD A;  4K10 A;  3P5P A;  3WEG A;  5EAS A;  5DZ2 A;  4QPF A;  3WJK A;  3G4D A;  4LFV F;  3AQB B;  5B02 A;  1DI1 A;  3EGT A;  4PVY F;  3PH7 A;  2PS5 A;  3WCG A;  3MAV A;  2VF6 A;  4N9U A;  1RQI A;  3LSN A;  3OAB B;  4OGU A;  1WKZ A;  2F9K F;  4UMJ A;  3N49 F;  3NPK A;  3N5J F;  4XQR F;  3M0G A;  3ACY A;  3AQC B;  3P8L A;  2E94 A;  4OMH A;  2E8T A;  4XQS F;  2OPN A;  5B0K A;  3LK5 A;  5IL8 A;  1KIZ A;  5A0I A;  3IPI A;  3WEJ A;  1UBY A;  4MC3 A;  3SDT A;  3V1X A;  3N46 F;  4E9U A;  4PVX F;  3WEK A;  2RAH A;  2E8X A;  4NUA A;  5B00 A;  3KRP B;  1V4E A;  5IN8 A;  3VJD A;  2Z4V A;  4GP1 A;  5KSX F;  4KK2 A;  1HM4 A;  3N3L F;  1HX9 A;  2E91 A;  2PS4 A;  4NFJ F;  2Q58 A;  4GP2 A;  5B0I A;  3ACW A;  3TC1 A;  4JVJ F;  3WEH A;  3VJ9 A;  4QXS F;  5A0J A;  3WJO A;  3ZOU A;  4DXJ A;  5B0L A;  4HD1 A; 
#chains in the Genus database with same CATH topology
 3CU7 A;  2PS7 A;  1YYR A;  4KVI A;  5AGD A;  3CP6 A;  4RXD A;  5DHI A;  3D5R A;  1GAH A;  2NOJ A;  4WK5 A;  3M75 A;  1RW9 A;  5FO9 B;  4XQT F;  2WY7 A;  3KSQ B;  1WL3 A;  3QT3 A;  1EGU A;  3RJ3 A;  3PZ3 B;  1H13 A;  3E37 B;  5AFX A;  2P1C A;  1LF9 A;  5E8H A;  1N7P A;  2Z4Y A;  4KVW A;  3VJB A;  4Q23 A;  3WSB A;  1LOH A;  1C82 A;  2ONG A;  2H6F B;  2XWJ B;  4GTP B;  4QT9 A;  1GXN A;  1H54 A;  3CKE A;  2ZIR B;  5CA3 A;  1KRF A;  1MZC B;  2X03 A;  2Q80 A;  3W7F A;  5IMN A;  5DGM F;  2G0D A;  1N4R B;  4OK4 A;  3GT5 A;  1W6K A;  3LOM A;  5FO7 B;  3S4J A;  4EA1 A;  4P0V A;  1WMW A;  1N9A B;  1F1S A;  4LXW A;  1J0M A;  4DWB A;  1KIY A;  3WCI A;  3V66 A;  2ZY1 A;  3E6U A;  4OMG A;  3SDR A;  4GL3 A;  3TS7 A;  3ASX A;  3N6K F;  5IMP A;  2H6H B;  1ZW5 A;  5DGR A;  4RXE A;  2B4F A;  4EL8 A;  1CB8 A;  3GZK A;  4NFK F;  3P2C A;  4KTP A;  3WCJ A;  3WCF A;  4EA0 A;  4NFI F;  1HMU A;  4FXK B;  2Z7I A;  3WKG A;  3N1W F;  2PN5 A;  4CJ1 A;  2DRO A;  1VD5 A;  1VG2 A;  1UG9 A;  1D8D B;  2BRP A;  3EU5 B;  5H9D A;  3HXF B;  1GLM A;  4KPD A;  1IS9 A;  3M00 A;  3W7X A;  3KRC A;  1H12 A;  1OJP A;  3M77 A;  3T33 A;  3PDE A;  2RI8 A;  5DJP F;  5AEL A;  2Z78 A;  2AZL A;  3QKC A;  3M9U A;  1NI1 B;  3WEF A;  4GTQ B;  2G02 A;  1H3C A;  1KSD A;  1N4P B;  3UCA A;  4DZW A;  3SDV A;  3W5N A;  5E2J A;  1H36 A;  4AYR A;  3Q30 A;  4DI5 A;  2DRS A;  4KQ5 A;  2Z52 A;  1RWA A;  3QRY A;  1RWF A;  5JV2 F;  3P8R A;  1N22 A;  2Z4X A;  4LTZ A;  1H39 A;  4KQS A;  2Q9Y A;  1VG4 A;  4GTM B;  3M02 A;  4CJ0 A;  5IK9 A;  1VG7 A;  2BBC A;  4AYO A;  5ER8 A;  1JCQ B;  1DCE B;  3KB9 A;  1KSC A;  4GA3 A;  1HXA A;  3K7X A;  5IKH A;  1V4H A;  1O1T B;  1JFG A;  3MZV A;  1N7R A;  1O6H A;  5ILZ A;  1X81 B;  5ILH A;  2EAE A;  3M78 A;  3ZMB A;  3OXU A;  3REN A;  2Q1F A;  4YDO B;  3N45 F;  4Q2B A;  1X1I A;  4LNB B;  4LA5 A;  5E8L A;  2V8K A;  4OZV A;  1QSJ A;  3DPY B;  3LLW A;  1WL0 A;  2AZK A;  2V8I A;  4KKI A;  5JMD A;  1FO2 A;  4KVD A;  1V4I A;  3SDQ A;  5IM1 A;  4FXG B;  3KRC B;  1FT2 B;  3VJA A;  2EWG A;  3ACS A;  1N20 A;  3N3D A;  1FCE A;  3X17 A;  3WKI A;  2BED B;  2ZZR A;  4M76 A;  5DGQ A;  4LLS A;  4LZ0 A;  4KKJ A;  4NG6 A;  5GW7 A;  5IK6 A;  3SFX B;  3EFQ A;  2OPM A;  2F8Z F;  2OGD A;  4E1E A;  1KRE A;  5E8K A;  1QBQ B;  1XWT A;  1IA7 A;  3P41 A;  3OAC A;  4ZRP A;  5JPM B;  3ANK A;  3RYE A;  3WSA A;  3QG0 A;  2E24 A;  2F92 F;  2QIS A;  3ICK A;  4MC8 A;  1X1H A;  3Q75 B;  1FMI A;  1LXK A;  2F6D A;  2ZCO A;  4LUU A;  4MC0 A;  4F62 A;  3TFV A;  5DHK A;  5HN8 A;  4LFE A;  1HMW A;  5CD2 A;  1VG3 A;  4GTV B;  1YHL A;  3ACX A;  4RXC A;  4AYQ A;  3LZ9 A;  1TN6 B;  2OKX A;  2H8O A;  4FP4 A;  4RYP A;  4RNQ A;  1FAE A;  3D3I A;  4MMI A;  3VSM A;  1AGM A;  3E32 B;  5ILY A;  1TNB B;  3DSU B;  2QNO A;  3SDU A;  5JV1 F;  3WCL A;  5HN9 A;  3AQ0 A;  1OJM A;  3DSS B;  3NNB A;  1QQF A;  4OZW A;  5ILJ A;  3KRO A;  5HN7 A;  3WCM A;  1TF4 A;  1XW2 A;  4LIX A;  2E93 A;  3RMG A;  1DGP A;  4GTR B;  4L9P B;  2WII B;  1HCU A;  1RWH A;  4KUX A;  4LTV A;  2V3P A;  3BNY A;  1NC5 A;  4F13 A;  4TF4 A;  1HXG A;  2AET A;  2J1P A;  3N5H F;  3PYB A;  1ULV A;  2FBA A;  2PS8 A;  2F8C F;  4L6X A;  1V7X A;  5DIQ F;  3CIH A;  2BB5 A;  2FOR A;  3WC9 A;  1EZF A;  1YYU A;  5M7Y A;  4WU0 A;  3PZ2 B;  1F9O A;  3W7U A;  4YDE B;  1UBW A;  1V7W A;  4YCR A;  3OAC B;  2J1O A;  3LEE A;  1JCS B;  2CQS A;  1GA2 A;  3M73 A;  1RQJ A;  2H6I B;  2PMV A;  3VW5 A;  3SAE A;  1RTR A;  3Q7A B;  4F6V A;  3Q1O A;  4LLT A;  3E30 B;  5B0M A;  1O1R B;  1LTX B;  3PYA A;  3Q2Z A;  1WU6 A;  2VN4 A;  2BRV X;  1N24 A;  1WL1 A;  4Z4L A;  3QFZ A;  2E8W A;  2Q9Z A;  2ZCR A;  5ERN A;  2SQC A;  3V1V A;  1OJN A;  3ANJ A;  4JZX A;  4ONT A;  2AEL A;  1SQC A;  1TN7 B;  5KKB A;  3C72 B;  3AFL A;  2E92 A;  1X1J A;  2EAD A;  2H6G B;  3N0G A;  3GLY A;  5GZK A;  2ZEV A;  2E8U A;  3WCH A;  3ICN A;  2AZJ A;  3ZL6 A;  2WIN B;  3E34 B;  3LVS A;  3ZMC A;  2I19 A;  3N1V F;  3KRO B;  3HXD B;  4LOB A;  3RBM A;  3W7S A;  3HXE B;  1GHQ A;  3HXC B;  2ZBL A;  3W7T A;  4D4D A;  3S9V A;  3M72 A;  3P5R A;  3QXQ A;  3ID0 A;  4OKM A;  4JXN A;  4DOD A;  1V5D A;  4F10 A;  1LF6 A;  5DGS F;  2JJB A;  1KWF A;  1TNY B;  2WY8 A;  4D4A A;  3LGZ B;  3LGK A;  4P0X A;  3ANI A;  1F9D A;  4JXY A;  2EAC A;  3E7J A;  2V8J A;  3M74 A;  2NVP A;  3KBK A;  1WL2 A;  2V3N A;  2FTZ A;  1WY0 A;  4FNV A;  3WCB A;  4L0G A;  4KKM A;  1YJ4 A;  4LZC A;  3WC3 A;  1YV5 A;  1N4S B;  5HNA A;  4KQU A;  4WVA A;  2J5C A;  3WCA A;  1O6Q A;  2AEK A;  4GTO B;  5FO8 B;  5IKA A;  3HXB B;  5M7I A;  3NF2 A;  4JZB A;  3WEI A;  5ILI A;  3KRA A;  1N7Q A;  1TNZ B;  2YIK A;  3QSP A;  3WIQ A;  4E1Y A;  4TXT A;  4KTR A;  5DGN F;  1GSZ A;  2I07 B;  1V4K A;  1V4J A;  1RWG A;  2AHF A;  5MEH A;  3APZ A;  1N23 A;  3S4A A;  3OYR A;  3WCD A;  1L1Y A;  3AE0 A;  2E22 A;  4LPG F;  3EZ3 A;  1FBW A;  3KRF A;  4KVY A;  5ERM A;  1KZO B;  2D8L A;  1SA5 B;  1HXC A;  1PS1 A;  1FT1 B;  5ERO A;  5JA0 F;  4DWG A;  3A0O A;  1X9D A;  3H7L A;  3M71 A;  4OKZ A;  1GXM A;  1N1B A;  2XFG A;  4C1S A;  3RYW A;  4EHM B;  4ZG8 A;  3WE9 A;  1HV6 A;  4KFA A;  5IMI A;  3S4B A;  2R2L B;  2FUT A;  3S4C A;  4F6X A;  3QWT A;  1KS8 A;  3G6J B;  4ZH1 A;  2ZCQ A;  4DEM F;  3Q2Q A;  5DW7 A;  3VJ8 A;  2WDA A;  2Z07 A;  5DJV F;  4D4B A;  2FUQ A;  1YYS A;  4NKE A;  3AFJ A;  1F9G A;  2BB6 A;  2IEJ B;  3ICZ A;  5I1U A;  4MU9 A;  1JCR B;  2RGK A;  4LNG B;  2DRR A;  2BRW A;  4MMH A;  1YQ7 A;  5C05 A;  1XWQ A;  5FOB B;  3LG5 A;  1L2A A;  3RX7 A;  5B01 A;  1G6I A;  3DYH A;  4KWD A;  1UBV A;  1V5C A;  3H2W A;  4N1Z F;  5IL3 A;  5B0J A;  3ADZ A;  3KRA B;  5DJR F;  1H35 A;  2A73 B;  3S4D A;  2JF4 A;  3TFN A;  3WUX A;  2JG0 A;  3H3K A;  1YYQ A;  1NXC A;  1HZF A;  1CEM A;  3CC9 A;  2B39 A;  4GTT B;  3WKF A;  2EAB A;  3KRF B;  4MBG B;  3BNX A;  1J0N A;  1N21 A;  1O6R A;  2E90 A;  4FJQ A;  3ON6 A;  2F94 F;  2Z4W A;  5IVG A;  3QQV A;  1G9J A;  4LFG A;  3W7W A;  1D8E B;  1H14 A;  2Z50 A;  3IBA A;  5CG6 A;  1O1S B;  4D4C A;  3DST B;  2AFA A;  4EA2 A;  4OK2 A;  3VXD A;  2O1O A;  4CE7 A;  4D94 A;  4JYX A;  1KFG A;  4RXA A;  5AYP A;  4JJJ A;  5JPN B;  3NPR A;  1HM3 A;  1HM7 A;  2FV1 A;  2Z4Z A;  1OJO A;  5JV0 F;  1JS4 A;  3W5M A;  2ONH A;  3M76 A;  1FPS A;  5B03 A;  1N4Q B;  3LDW A;  2WYN A;  1R76 A;  2ZEU A;  3K11 A;  4WVB A;  1SA4 B;  3VJE A;  3DRA B;  4LZ3 A;  5A0K A;  4KPJ A;  1FBO A;  2ZIS B;  3A3V A;  1G87 A;  1DL2 A;  5JMF A;  2OA6 A;  2PS6 A;  3DSX B;  3ZCD A;  1O79 A;  2F89 F;  3G4F A;  3N0F A;  3LMD A;  4GAX A;  5GY3 A;  1AYX A;  1LD7 B;  3QT9 A;  5IK0 A;  3VJC A;  1FP3 A;  2E95 A;  4L2X F;  1DOG A;  3KQ4 A;  4XUV A;  4H5E F;  3M01 A;  1TNO B;  4ZH5 A;  1JFA A;  2GH4 A;  1YHM A;  1W6J A;  2A8Z A;  4DOE A;  4E9Z A;  3M7B A;  4H5C F;  2E4O A;  3WJN A;  1VG6 A;  1TN8 B;  3VSN A;  1S63 B;  3TFP A;  1V7V A;  3SQC A;  1QAZ A;  4J5T A;  1UBX A;  3NFV A;  1YHK A;  3OAB A;  3RSY A;  2E8V A;  1YYT A;  5AHU B;  1LD8 B;  2F7M F;  3DYF A;  1I8Q A;  1GXO A;  1KZP B;  4AYP A;  3LJI A;  2AHG A;  2D5J A;  1N7O A;  3Q78 B;  4GTS B;  3RX5 A;  3PKO A;  3EQA A;  5CG5 A;  3WCE A;  2Z7H A;  5ILK A;  1W3Y A;  2F0Y B;  3RX8 A;  2DH4 A;  4LA6 A;  3DYG A;  3OED A;  1CLC A;  2ZCS A;  3Q73 B;  4LPH F;  3NRI A;  2GOX A;  5CZL A;  3ICM A;  4WVC A;  5EAT A;  2GZ6 A;  3RRS A;  3KSL B;  1N1Z A;  3WCC A;  4ZQ8 A;  2WCO A;  3QFY A;  4Z4J A;  3KRP A;  5EAU A;  3E73 A;  1TNU B;  4NKF A;  4P0W A;  4DHD A;  4H5D F;  3M7E A;  1GAI A;  3B7L A;  5JUZ F;  5ILD A;  4K10 A;  3P5P A;  1WZZ A;  3WEG A;  3DSW B;  5EAS A;  5DZ2 A;  2FUZ A;  4QPF A;  3KLS A;  3M7C A;  1UMP A;  3WJK A;  4LNV A;  3G4D A;  1N95 B;  2VN7 A;  3SFY B;  1RWC A;  4LFV F;  3AQB B;  5B02 A;  2DRQ A;  1DI1 A;  4OJZ A;  1WU5 A;  3EGT A;  1HM2 A;  1NL4 B;  4PVY F;  3PH7 A;  1FPP B;  4V1R A;  2PS5 A;  1FO3 A;  3WCG A;  3MAV A;  2VF6 A;  4N9U A;  1KKT A;  1RQI A;  3LSN A;  3OAB B;  4OGU A;  1S64 B;  1WKZ A;  3E80 A;  3M7L A;  3PZ4 B;  2F9K F;  1G9G A;  4UMJ A;  3N49 F;  3NPK A;  3N5J F;  4XQR F;  3M0G A;  3QXF A;  3QDE A;  3ACY A;  3AQC B;  3P8L A;  2E94 A;  1IA6 A;  1N94 B;  4BOJ A;  1RQ5 A;  4OMH A;  2RI9 A;  2E8T A;  4XQS F;  3WIW A;  2OPN A;  5B0K A;  3LK5 A;  5IL8 A;  2XWB B;  3D5S A;  1KIZ A;  5A0I A;  3IPI A;  3WEJ A;  1UBY A;  4MC3 A;  3SDT A;  3V1X A;  3N46 F;  4E9U A;  1H3A A;  4PVX F;  3WEK A;  4V1S A;  2RAH A;  2E8X A;  1N7N A;  1K72 A;  2FV0 A;  3Q7F B;  4Q88 A;  1H37 A;  4ZRQ A;  1H3B A;  3E33 B;  4NUA A;  3EZ8 A;  5B00 A;  3KRP B;  3ACT A;  4NEI A;  1V4E A;  5IN8 A;  3VJD A;  2Z4V A;  1O5M B;  2P0V A;  4GP1 A;  5KSX F;  3DSV B;  4KK2 A;  1HM4 A;  1HN0 A;  3N3L F;  2CQT A;  3Q79 B;  1HX9 A;  2E91 A;  2PS4 A;  4NFJ F;  2Q58 A;  3WKH A;  4GP2 A;  4FUS A;  5B0I A;  3TF4 A;  3ACW A;  1C3D A;  3TC1 A;  1WU4 A;  4JVJ F;  3WEH A;  4BOK A;  3PZ1 B;  3EU8 A;  3VJ9 A;  4QXS F;  5A0J A;  3EUV B;  1UT9 A;  3WJO A;  3ZOU A;  3PMM A;  4DXJ A;  2XQW A;  1LXM A;  3WIR A;  3QPF A;  5B0L A;  4HD1 A; 
#chains in the Genus database with same CATH homology
 2PS7 A;  1YYR A;  4KVI A;  3CP6 A;  4RXD A;  5DHI A;  4WK5 A;  4XQT F;  1WL3 A;  5AFX A;  2P1C A;  5E8H A;  2Z4Y A;  4KVW A;  3VJB A;  4Q23 A;  3WSB A;  2ONG A;  3CKE A;  2Q80 A;  3W7F A;  5IMN A;  5DGM F;  3LOM A;  3S4J A;  4EA1 A;  4P0V A;  1WMW A;  4LXW A;  4DWB A;  1KIY A;  3WCI A;  3V66 A;  2ZY1 A;  4OMG A;  3SDR A;  3TS7 A;  3ASX A;  3N6K F;  5IMP A;  1ZW5 A;  4RXE A;  4NFK F;  3WCJ A;  3WCF A;  4EA0 A;  4NFI F;  2Z7I A;  3N1W F;  1VG2 A;  5H9D A;  4KPD A;  3M00 A;  3KRC A;  3PDE A;  5DJP F;  5AEL A;  2Z78 A;  2AZL A;  3QKC A;  3M9U A;  3WEF A;  3UCA A;  4DZW A;  3SDV A;  3Q30 A;  4DI5 A;  4KQ5 A;  2Z52 A;  5JV2 F;  3P8R A;  1N22 A;  2Z4X A;  4LTZ A;  4KQS A;  2Q9Y A;  1VG4 A;  3M02 A;  5IK9 A;  1VG7 A;  5ER8 A;  3KB9 A;  4GA3 A;  1HXA A;  5IKH A;  1V4H A;  1JFG A;  3MZV A;  5ILZ A;  5ILH A;  3ZMB A;  3N45 F;  4LA5 A;  5E8L A;  3LLW A;  1WL0 A;  2AZK A;  4KVD A;  1V4I A;  3SDQ A;  5IM1 A;  3KRC B;  3VJA A;  2EWG A;  1N20 A;  3N3D A;  4LLS A;  4LZ0 A;  4NG6 A;  5IK6 A;  3EFQ A;  2OPM A;  2F8Z F;  2OGD A;  4E1E A;  5E8K A;  3P41 A;  3OAC A;  3RYE A;  3WSA A;  2F92 F;  2QIS A;  3ICK A;  4MC8 A;  2ZCO A;  4LUU A;  4MC0 A;  4F62 A;  3TFV A;  5DHK A;  5HN8 A;  4LFE A;  1VG3 A;  1YHL A;  3ACX A;  4RXC A;  3LZ9 A;  2H8O A;  4FP4 A;  4RYP A;  4RNQ A;  5ILY A;  3SDU A;  5JV1 F;  3WCL A;  5HN9 A;  3AQ0 A;  5ILJ A;  3KRO A;  5HN7 A;  3WCM A;  4LIX A;  2E93 A;  3RMG A;  1DGP A;  4KUX A;  4LTV A;  3BNY A;  1HXG A;  2AET A;  2J1P A;  3N5H F;  3PYB A;  2PS8 A;  2F8C F;  5DIQ F;  2FOR A;  3WC9 A;  1EZF A;  1YYU A;  1UBW A;  3OAC B;  2J1O A;  3LEE A;  1RQJ A;  3SAE A;  1RTR A;  4F6V A;  3Q1O A;  4LLT A;  5B0M A;  3PYA A;  3Q2Z A;  1N24 A;  1WL1 A;  2E8W A;  2Q9Z A;  2ZCR A;  5ERN A;  3V1V A;  4JZX A;  2AEL A;  2E92 A;  3N0G A;  2ZEV A;  2E8U A;  3WCH A;  3ICN A;  2AZJ A;  3ZL6 A;  3LVS A;  3ZMC A;  2I19 A;  3N1V F;  3KRO B;  4LOB A;  3RBM A;  3S9V A;  3P5R A;  3ID0 A;  4OKM A;  4JXN A;  5DGS F;  3LGZ B;  3LGK A;  4P0X A;  4JXY A;  3KBK A;  1WL2 A;  2FTZ A;  1WY0 A;  3WCB A;  4KKM A;  1YJ4 A;  4LZC A;  1YV5 A;  5HNA A;  4KQU A;  2J5C A;  3WCA A;  2AEK A;  5IKA A;  3NF2 A;  4JZB A;  3WEI A;  5ILI A;  3KRA A;  5DGN F;  1V4K A;  1V4J A;  3APZ A;  1N23 A;  3OYR A;  3WCD A;  3AE0 A;  4LPG F;  3EZ3 A;  3KRF A;  4KVY A;  5ERM A;  1HXC A;  1PS1 A;  5ERO A;  5JA0 F;  4DWG A;  4OKZ A;  1N1B A;  3RYW A;  3WE9 A;  4KFA A;  5IMI A;  4F6X A;  2ZCQ A;  4DEM F;  3Q2Q A;  5DW7 A;  3VJ8 A;  5DJV F;  1YYS A;  4NKE A;  3ICZ A;  5I1U A;  1YQ7 A;  5C05 A;  3LG5 A;  5B01 A;  3DYH A;  4KWD A;  1UBV A;  4N1Z F;  5IL3 A;  5B0J A;  3ADZ A;  3KRA B;  5DJR F;  3TFN A;  1YYQ A;  3CC9 A;  3KRF B;  3BNX A;  1N21 A;  2E90 A;  4FJQ A;  2F94 F;  2Z4W A;  5IVG A;  3QQV A;  4LFG A;  2Z50 A;  3IBA A;  5CG6 A;  4EA2 A;  2O1O A;  4JYX A;  4RXA A;  5AYP A;  3NPR A;  1HM7 A;  2Z4Z A;  5JV0 F;  2ONH A;  1FPS A;  5B03 A;  3LDW A;  2ZEU A;  3VJE A;  4LZ3 A;  5A0K A;  4KPJ A;  2OA6 A;  2PS6 A;  3ZCD A;  2F89 F;  3G4F A;  3N0F A;  3LMD A;  4GAX A;  5IK0 A;  3VJC A;  2E95 A;  4L2X F;  4H5E F;  3M01 A;  1JFA A;  1YHM A;  4E9Z A;  4H5C F;  2E4O A;  3WJN A;  1VG6 A;  3TFP A;  1UBX A;  1YHK A;  3OAB A;  2E8V A;  1YYT A;  5AHU B;  2F7M F;  3DYF A;  3LJI A;  3PKO A;  5CG5 A;  3WCE A;  2Z7H A;  5ILK A;  2DH4 A;  4LA6 A;  3DYG A;  2ZCS A;  4LPH F;  3NRI A;  3ICM A;  5EAT A;  1N1Z A;  3WCC A;  4ZQ8 A;  3KRP A;  5EAU A;  4NKF A;  4P0W A;  4DHD A;  4H5D F;  3B7L A;  5JUZ F;  5ILD A;  4K10 A;  3P5P A;  3WEG A;  5EAS A;  5DZ2 A;  4QPF A;  3WJK A;  3G4D A;  4LFV F;  3AQB B;  5B02 A;  1DI1 A;  3EGT A;  4PVY F;  3PH7 A;  2PS5 A;  3WCG A;  3MAV A;  2VF6 A;  4N9U A;  1RQI A;  3LSN A;  3OAB B;  4OGU A;  1WKZ A;  2F9K F;  4UMJ A;  3N49 F;  3NPK A;  3N5J F;  4XQR F;  3M0G A;  3ACY A;  3AQC B;  3P8L A;  2E94 A;  4OMH A;  2E8T A;  4XQS F;  2OPN A;  5B0K A;  3LK5 A;  5IL8 A;  1KIZ A;  5A0I A;  3IPI A;  3WEJ A;  1UBY A;  4MC3 A;  3SDT A;  3V1X A;  3N46 F;  4E9U A;  4PVX F;  3WEK A;  2RAH A;  2E8X A;  4NUA A;  5B00 A;  3KRP B;  1V4E A;  5IN8 A;  3VJD A;  2Z4V A;  4GP1 A;  5KSX F;  4KK2 A;  1HM4 A;  3N3L F;  1HX9 A;  2E91 A;  2PS4 A;  4NFJ F;  2Q58 A;  4GP2 A;  5B0I A;  3ACW A;  3TC1 A;  4JVJ F;  3WEH A;  3VJ9 A;  4QXS F;  5A0J A;  3WJO A;  3ZOU A;  4DXJ A;  5B0L A;  4HD1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...