4FJQA

Crystal structure of an alpha-bisabolol synthase
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
530
structure length
521
Chain Sequence
b'PSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGDRSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRVLMVEAQWLNEGHIPTTEELDSIAVNLGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAEKDNFTRMGEEYKNLVKSLLVYPMSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
molecule tags Lyase
total genus 202
structure length 521
sequence length 530
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4fjqA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4fjqA02
4NUAA 2E8UA 3OYRA 4JYXA 4JZXA 5IKAA 3WEHA 4NFKF 5JV0F 1RQJA 3WC9A 3LMDA 4DWBA 5CG5A 4LLTA 4LXWA 2ONHA 4JXNA 5IMNA 3WCEA 3BNYA 3IPIA 5ER8A 2EWGA 3VJBA 5IK9A 1YV5A 2Z4WA 4QPFA 3ICNA 5B02A 1YYSA 3PDEA 3SDTA 5EAUA 5B0JA 3N3DA 1N1BA 2F89F 3VJCA 3RMGA 2OGDA 4NKFA 4KK2A 2AELA 5DJRF 5IN8A 2PS7A 3ZMBA 3KROB 4PVYF 2F7MF 5H9DA 2FORA 5DHKA 1EZFA 5ERMA 4XQTF 4XQRF 4FJQA 4NKEA 3V1VA 3WEGA 5IK0A 5E8HA 3ACXA 3WJOA 3Q2QA 3MZVA 1N20A 1VG2A 1WY0A 4LOBA 4MC3A 5DGNF 2J5CA 3PKOA 4FP4A 3SDVA 4GP2A 1N24A 4LZCA 2Q58A 2E91A 2Q9ZA 3RYEA 1HXCA 4OKMA 5JV2F 1KIZA 3WCCA 3QQVA 4LFGA 5DW7A 1RTRA 3SAEA 4KQ5A 3ADZA 5I1UA 3MAVA 3WE9A 1WMWA 5EASA 1UBVA 5HN7A 3ZMCA 2AZJA 4OMGA 5B0KA 4E9ZA 1V4EA 3WCJA 4KQUA 4LA5A 3NPRA 2E4OA 4ZQ8A 2E8VA 4DEMF 2QISA 3WCLA 2ZCRA 5DGSF 3ICMA 4DHDA 5A0IA 3KRFA 4GA3A 2E92A 3SDRA 2F92F 3LDWA 3WEFA 3RBMA 5B0LA 3N0FA 5A0KA 1VG3A 3ZOUA 4MC0A 4LLSA 5IKHA 3ACYA 5B00A 2E8XA 4E9UA 2AZLA 1RQIA 3N6KF 5ILJA 5IK6A 3G4FA 3WSBA 3OACB 5B0IA 3PYAA 5HN9A 5E8KA 4KQSA 3CP6A 3OABA 5B0MA 2Z78A 5EATA 4GAXA 4RXEA 5IMIA 3EGTA 4RNQA 3AQCB 4UMJA 2Z7IA 2ZCSA 3KRCB 2PS6A 3KRAB 4NG6A 2FTZA 4KPJA 4P0XA 2Z4VA 4RXCA 3ZL6A 1HM4A 3KRPB 1YYRA 3N49F 2E95A 3WCMA 1YHLA 3AQBB 3LEEA 3LK5A 3KROA 2F9KF 3LSNA 1DI1A 4H5EF 3DYFA 1UBWA 4H5CF 5ILDA 4DZWA 4LZ3A 3WCGA 1V4KA 2OA6A 5AHUB 2Z4XA 2J1PA 5AYPA 1YHKA 5IL3A 4KVDA 4F62A 1VG7A 4KVIA 2H8OA 3TFPA 3NPKA 3V66A 4MC8A 3M00A 4N1ZF 1WL0A 3P41A 4KFAA 3WEJA 1YYQA 4N9UA 4LUUA 1V4IA 4KVYA 3VJDA 1N22A 3WCDA 2ZEUA 4LTVA 3WSAA 4KWDA 2E8WA 3UCAA 5JA0F 4KPDA 5C05A 2ZEVA 1VG6A 4H5DF 1ZW5A 4RXDA 1VG4A 3KBKA 3LZ9A 5B03A 2OPMA 4RXAA 4P0VA 2ONGA 3TFVA 3M9UA 2Z50A 3N5JF 3RYWA 3B7LA 3WCBA 2O1OA 4GP1A 3Q1OA 4LA6A 4WK5A 2F94F 2VF6A 2Q9YA 3M02A 3ZCDA 2Z4YA 2J1OA 4LPHF 3KRCA 3WCAA 2RAHA 3M0GA 3AE0A 2E8TA 5JV1F 2ZY1A 4LFEA 3G4DA 4KUXA 5HN8A 1N1ZA 3N0GA 1YHMA 3IBAA 4NFJF 2PS5A 2AZKA 3S9VA 5IVGA 4LZ0A 3DYHA 5IM1A 4NFIF 3TS7A 3LLWA 1HXAA 5AFXA 4L2XF 4F6XA 1WL1A 3WJKA 5ERNA 3WEIA 4DWGA 1FPSA 3P5RA 5IL8A 3TFNA 2P1CA 2ZCQA 1KIYA 3ASXA 3CC9A 3SDUA 3ID0A 5A0JA 5IMPA 4RYPA 3VJ9A 1WL3A 3PH7A 3WCFA 1DGPA 3OABB 3VJEA 4OGUA 4E1EA 3P8RA 4JZBA 2Z7HA 3WCHA 2OPNA 5DZ2A 3APZA 2F8ZF 4JVJF 3N45F 4KKMA 4OKZA 4OMHA 2Z52A 4JXYA 3LVSA 3Q2ZA 3N5HF 5DJVF 3P5PA 4XQSF 1JFGA 3N3LF 3PYBA 3QKCA 4PVXF 5KSXF 3ICZA 1WL2A 2PS8A 2Q80A 1YJ4A 4HD1A 4LFVF 2DH4A 3CKEA 3LOMA 1N21A 3N1WF 4LTZA 4EA2A 4EA1A 3Q30A 2E94A 5DHIA 4K10A 3LJIA 1V4JA 5B01A 1UBYA 3VJ8A 3BNXA 1HM7A 5ILYA 5CG6A 1YQ7A 3N1VF 3EFQA 2AEKA 3N46F 5E8LA 3M01A 2F8CF 2Z4ZA 4LPGF 2E93A 3LGKA 3NF2A 3VJAA 2AETA 3TC1A 3NRIA 2E90A 3OACA 4P0WA 3W7FA 3LGZB 5ILIA 4DI5A 5DIQF 5EROA 1PS1A 1JFAA 1N23A 3WEKA 1UBXA 1HXGA 1WKZA 3KB9A 5DJPF 2PS4A 3KRAA 3V1XA 5HNAA 1YYTA 3P8LA 3LG5A 1V4HA 4F6VA 5ILKA 3ACWA 1HX9A 4EA0A 3KRPA 4Q23A 3ICKA 4LIXA 3EZ3A 3S4JA 3DYGA 3AQ0A 5DGMF 5AELA 4DXJA 5JUZF 3WCIA 3WJNA 5ILHA 2ZCOA 5ILZA 3KRFB 4QXSF 1YYUA 2I19A 4KVWA 3SDQA
chains in the Genus database with same CATH superfamily
4NUAA 2E8UA 3OYRA 1CB8A 1GLMA 1XWTA 1O1SB 3E7JA 4JYXA 2SQCA 3E37B 1KKTA 4JZXA 5IKAA 1TN8B 1GA2A 4WU0A 3WEHA 3GLYA 3QT3A 4NFKF 5JV0F 1SA4B 1RQJA 1NL4B 2BRPA 3WC9A 4D4CA 1LF6A 3LMDA 4DWBA 5CG5A 1RWGA 3SFXB 4LLTA 4D94A 5FOBB 4LXWA 2ONHA 2ZBLA 4JXNA 5IMNA 3WCEA 2VN4A 3BNYA 3IPIA 5ER8A 1HMUA 1WU6A 4BOKA 3W7TA 2EWGA 3VJBA 2AHGA 2Z07A 5IK9A 1TNOB 2FBAA 1YV5A 4LNGB 2Z4WA 4QPFA 2IEJB 3E33B 2AFAA 3W7WA 3CU7A 3ICNA 1W3YA 5B02A 2DRRA 1YYSA 3DSSB 2NOJA 3PDEA 3SDTA 5EAUA 1N9AB 2JJBA 1G87A 5B0JA 3ANJA 3N3DA 1N1BA 2F89F 3VJCA 4J5TA 3RMGA 2OGDA 3PMMA 5JMFA 4NKFA 4KK2A 2AELA 5DJRF 4FXGB 4TF4A 4OZVA 1F1SA 2FUTA 5IN8A 2PS7A 3ZMBA 1N4RB 3KROB 4PVYF 3NFVA 2F7MF 5H9DA 1I8QA 3P2CA 2FORA 1MZCB 5DHKA 1H14A 2WY7A 3S4CA 1EZFA 2JG0A 3PZ4B 5ERMA 5M7YA 3D5SA 4XQTF 4XQRF 1FAEA 2BB6A 4FJQA 3WKGA 4NKEA 3V1VA 3WEGA 2ZZRA 1FP3A 5MEHA 1LTXB 3E32B 2D5JA 1FMIA 5IK0A 5E8HA 4YCRA 3ACXA 1N7NA 3WJOA 3Q2QA 1OJOA 2RI9A 2OKXA 2BBCA 3MZVA 3QFZA 1KRFA 4GTPB 1N20A 1JCSB 1KFGA 2X03A 1X9DA 4FNVA 1VG2A 2EADA 1WY0A 4LOBA 4MC3A 5DGNF 3AFJA 2J5CA 3PKOA 4FP4A 3SDVA 2R2LB 3QPFA 1JCQB 4GP2A 4WVAA 2EACA 3E6UA 1N24A 4LZCA 2Q58A 3ANIA 2E91A 1FO2A 2WDAA 4ONTA 3Q7AB 1KSCA 3A3VA 1D8DB 1F9DA 2Q9ZA 3RYEA 1HXCA 4OKMA 1CEMA 5JV2F 3PZ3B 1KZPB 3W5NA 1KIZA 2ZISB 3WCCA 1NXCA 3QQVA 2ZIRB 4LFGA 1O6RA 2PMVA 4D4AA 5DW7A 1RTRA 3QFYA 3DSWB 3SAEA 4KQ5A 3S4AA 3ADZA 5I1UA 2I07B 3MAVA 3WE9A 1WMWA 5EASA 4MU9A 1UBVA 5HN7A 3ZMCA 4Q2BA 2AZJA 2BRVX 1KWFA 1G9GA 4OMGA 5B0KA 2D8LA 3S4DA 4F10A 1K72A 4E9ZA 1LD8B 1V4EA 3WCJA 1NI1B 4KQUA 4LA5A 3NPRA 2E4OA 3S4BA 4ZQ8A 2E8VA 4DEMF 2QISA 3WCLA 2ZCRA 1H3BA 1H54A 4OK2A 1KS8A 2WY8A 1JS4A 1O6QA 5DGSF 3ICMA 4L9PB 4DHDA 5A0IA 3KRFA 4GA3A 2E92A 3SDRA 1DCEB 2F0YB 2F92F 3LDWA 3WEFA 1QQFA 3Q78B 3QT9A 1RWAA 3RBMA 5B0LA 3N0FA 1QSJA 5A0KA 1VG3A 4L0GA 3ZOUA 4MC0A 2CQTA 4LLSA 5IKHA 1V7XA 3DSTB 1VD5A 2FUQA 3ACYA 5B00A 3M78A 3HXCB 1GSZA 2E8XA 4E9UA 2AZLA 1RQIA 3N6KF 5ILJA 1RWFA 1RWHA 5CA3A 1RWCA 2XWBB 5IK6A 3G4FA 3WSBA 1O5MB 2WYNA 2Q1FA 1RW9A 3OACB 5B0IA 1W6KA 1N7PA 3PYAA 3TF4A 5HN9A 4ZG8A 5E8KA 3W5MA 3RENA 4KQSA 2H6IB 1X1JA 1DL2A 3WUXA 1H36A 3CP6A 3OABA 5B0MA 2EABA 2YIKA 3Q73B 2Z78A 4GTMB 5EATA 4GAXA 4RXEA 5IMIA 3EGTA 1O1RB 2BEDB 1V7VA 4RNQA 3AQCB 4UMJA 2Z7IA 2ZCSA 3KRCB 2PS6A 3H2WA 4GTTB 3G6JB 3KRAB 1UT9A 2WINB 4NG6A 1N94B 2FTZA 3D5RA 3M7EA 3A0OA 4KPJA 4P0XA 1OJMA 2JF4A 3QXQA 2Z4VA 4RXCA 3ZL6A 4GL3A 1HM4A 3KRPB 1YYRA 3QSPA 3N49F 3D3IA 2E95A 3WCMA 1RQ5A 1YHLA 1GHQA 3H7LA 3AQBB 3LEEA 1N4PB 3LK5A 3KROA 1KZOB 3QG0A 5M7IA 2XWJB 2F9KF 3OXUA 3LSNA 3M77A 1DI1A 4EHMB 1W6JA 4H5EF 3DYFA 3VSNA 3W7XA 1UBWA 4H5CF 3T33A 5ILDA 3KQ4A 1KSDA 1R76A 4DZWA 1CLCA 5DGRA 3RSYA 3SQCA 1TNZB 2NVPA 1GAIA 4LZ3A 1L2AA 3WCGA 1V4KA 3EQAA 2OA6A 5AHUB 4AYOA 4ZH1A 1TNYB 2Z4XA 2J1PA 3KLSA 3RRSA 5FO9B 4KKIA 2B39A 3X17A 5AYPA 1YHKA 5IL3A 4KVDA 4F62A 3RJ3A 4F13A 4DOEA 1VG7A 4KVIA 2H8OA 3TFPA 1LF9A 3NPKA 3V66A 4MC8A 3GZKA 1HM2A 3M7CA 1H39A 4LNBB 3M00A 4E1YA 4N1ZF 2PN5A 1WL0A 3VW5A 3P41A 4KFAA 3HXEB 1LXMA 3WEJA 3SFYB 1YYQA 4N9UA 1S64B 4LUUA 1V4IA 1HMWA 4FUSA 4GTRB 1L1YA 4KVYA 1N7OA 3VJDA 2G02A 3H3KA 1N22A 2QNOA 3M71A 3WCDA 2ZEUA 4LTVA 3WSAA 1XWQA 4YDOB 4KWDA 1GXNA 2E8WA 3UCAA 5JA0F 4KPDA 2V8KA 4L6XA 1FT2B 1H13A 5C05A 2ZEVA 4Q88A 1VG6A 1FBOA 1LXKA 5FO8B 3AFLA 4H5DF 1O1TB 3KSQB 1ZW5A 1C82A 3QWTA 4RXDA 5FO7B 1VG4A 1TF4A 1N95B 1QBQB 1OJPA 4LNVA 3WC3A 2XQWA 3KBKA 1C3DA 1TN7B 3EU8A 3KSLB 3LZ9A 3PZ1B 3ACTA 5JPMB 4QT9A 2XFGA 3DPYB 4D4DA 5B03A 2OPMA 4RXAA 4WVCA 4P0VA 2ONGA 3TFVA 1X1HA 2H6HB 5CD2A 3M9UA 2Z50A 3N5JF 3RYWA 5JMDA 4OJZA 1HV6A 3B7LA 3WCBA 2O1OA 1QAZA 1UG9A 4GP1A 3Q1OA 4LA6A 4WK5A 2F94F 2VF6A 2Q9YA 3M02A 1J0MA 3HXFB 3ZCDA 1HN0A 2Z4YA 2J1OA 4OK4A 4XUVA 1O6HA 4LPHF 1TNBB 3KRCA 1S63B 3WCAA 1N4QB 2RAHA 3M0GA 3AE0A 2E8TA 4AYRA 5JV1F 2ZY1A 4LFEA 3G4DA 4KUXA 5HN8A 1N1ZA 3N0GA 1FCEA 4BOJA 1YHMA 3PZ2B 1ULVA 3IBAA 4NFJF 2GOXA 2PS5A 2AZKA 3S9VA 1IS9A 3W7UA 3DSUB 5IVGA 2BB5A 4V1RA 4AYPA 3ON6A 4LZ0A 3DYHA 5IM1A 4NFIF 3TS7A 3LLWA 1GXMA 1HXAA 5AFXA 3DSVB 4L2XF 4F6XA 3HXBB 4ZH5A 1WL1A 1FO3A 3WJKA 2G0DA 5ERNA 3WEIA 4DWGA 3W7SA 1FPSA 3P5RA 5IL8A 2V8JA 3TFNA 2P1CA 3WIQA 1H3CA 3HXDB 2ZCQA 1KIYA 3ASXA 3CC9A 3M75A 3SDUA 3E80A 3M76A 1WU4A 3ID0A 5A0JA 5IMPA 2H6GB 4RYPA 1X81B 4TXTA 5AGDA 3VJ9A 1JCRB 4MMHA 1GXOA 1WL3A 3PH7A 4D4BA 4C1SA 3WCFA 1H37A 3M7BA 1DGPA 3WKHA 3RX7A 1XW2A 3K11A 3OABB 3VJEA 1SA5B 4OGUA 5DGQA 4E1EA 1V7WA 2V3PA 3P8RA 1H35A 4JZBA 2Z7HA 3WCHA 2OPNA 5DZ2A 3M7LA 3APZA 2F8ZF 3ANKA 4JVJF 2EAEA 3Q75B 3EU5B 3N45F 3RX5A 4KKMA 2FV1A 4OKZA 2E24A 1HM3A 4OMHA 2CQSA 2WIIB 2Z52A 4JXYA 1IA6A 3LVSA 1FT1B 3Q2ZA 3N5HF 5DJVF 2H6FB 3P5PA 1FBWA 4EL8A 2B4FA 4XQSF 3VSMA 1HCUA 4MBGB 2F6DA 1X1IA 1G9JA 1JFGA 2FUZA 3N3LF 2RI8A 4M76A 1D8EB 3PYBA 3QKCA 1V5DA 4PVXF 5KSXF 3ICZA 1WL2A 2PS8A 2Q80A 1YJ4A 4HD1A 3Q7FB 4LFVF 1G6IA 1UMPA 3OEDA 4CJ1A 2DH4A 3QDEA 3DRAB 3CKEA 1WZZA 3LOMA 1N21A 1FPPB 2GZ6A 3QXFA 2P0VA 3N1WF 4LTZA 2V8IA 4EA2A 4EA1A 3Q30A 1H3AA 4KKJA 2E94A 1O79A 5DHIA 2A8ZA 4GTQB 4K10A 3GT5A 3LJIA 1V4JA 5B01A 2WCOA 1UBYA 3C72B 3VJ8A 2GH4A 3BNXA 3M72A 1HM7A 5ILYA 1N7RA 3VXDA 5CG6A 1YQ7A 5GW7A 3ACSA 3N1VF 3EFQA 5JPNB 2AEKA 3N46F 1AGMA 5E8LA 3E34B 3DSXB 4DODA 1SQCA 3M01A 4GTVB 1LD7B 4WVBA 3M74A 2F8CF 2Z4ZA 4LPGF 2E93A 3LGKA 3NF2A 3VJAA 2E22A 3WKFA 3K7XA 4GTOB 4AYQA 4YDEB 4JJJA 2AETA 1AYXA 4KTRA 5GZKA 4V1SA 3M73A 3CIHA 2V3NA 3TC1A 3NRIA 2E90A 1IA7A 3OACA 4P0WA 4ZRPA 3W7FA 3LGZB 5ILIA 3EUVB 4OZWA 4DI5A 1TN6B 5DIQF 5EROA 1GAHA 5CZLA 1HZFA 1PS1A 1LOHA 1JFAA 4NEIA 1N23A 3WEKA 3Q79B 1F9GA 1H12A 4MMIA 1UBXA 3WKIA 1HXGA 3QRYA 1WKZA 3KB9A 5DJPF 2PS4A 3KRAA 2BRWA 2A73B 3V1XA 5HNAA 3EZ8A 1YYTA 2DRQA 3P8LA 2FV0A 3LG5A 3WIWA 2AHFA 4GTSB 1V4HA 4F6VA 5ILKA 3ACWA 1HX9A 4EA0A 1NC5A 3KRPA 4Q23A 2VN7A 4FXKB 3ICKA 1V5CA 4LIXA 3EZ3A 2DROA 5GY3A 3S4JA 1KREA 3RX8A 4CE7A 3DYGA 3AQ0A 1F9OA 5DGMF 5AELA 1DOGA 4DXJA 5JUZF 3WCIA 5KKBA 3WJNA 5ILHA 2ZCOA 4Z4JA 4Z4LA 1OJNA 5ILZA 4ZRQA 3KRFB 1TNUB 3WIRA 4QXSF 1N7QA 1EGUA 1YYUA 3E30B 3E73A 4CJ0A 4KTPA 1J0NA 2RGKA 3NNBA 1WU5A 1N4SB 5E2JA 2I19A 4KVWA 2DRSA 3SDQA
chains in the Genus database with same CATH topology
4NUAA 2E8UA 3OYRA 4JYXA 4JZXA 5IKAA 3WEHA 4NFKF 5JV0F 1RQJA 3WC9A 3LMDA 4DWBA 5CG5A 4LLTA 4LXWA 2ONHA 4JXNA 5IMNA 3WCEA 3BNYA 3IPIA 5ER8A 2EWGA 3VJBA 5IK9A 1YV5A 2Z4WA 4QPFA 3ICNA 5B02A 1YYSA 3PDEA 3SDTA 5EAUA 5B0JA 3N3DA 1N1BA 2F89F 3VJCA 3RMGA 2OGDA 4NKFA 4KK2A 2AELA 5DJRF 5IN8A 2PS7A 3ZMBA 3KROB 4PVYF 2F7MF 5H9DA 2FORA 5DHKA 1EZFA 5ERMA 4XQTF 4XQRF 4FJQA 4NKEA 3V1VA 3WEGA 5IK0A 5E8HA 3ACXA 3WJOA 3Q2QA 3MZVA 1N20A 1VG2A 1WY0A 4LOBA 4MC3A 5DGNF 2J5CA 3PKOA 4FP4A 3SDVA 4GP2A 1N24A 4LZCA 2Q58A 2E91A 2Q9ZA 3RYEA 1HXCA 4OKMA 5JV2F 1KIZA 3WCCA 3QQVA 4LFGA 5DW7A 1RTRA 3SAEA 4KQ5A 3ADZA 5I1UA 3MAVA 3WE9A 1WMWA 5EASA 1UBVA 5HN7A 3ZMCA 2AZJA 4OMGA 5B0KA 4E9ZA 1V4EA 3WCJA 4KQUA 4LA5A 3NPRA 2E4OA 4ZQ8A 2E8VA 4DEMF 2QISA 3WCLA 2ZCRA 5DGSF 3ICMA 4DHDA 5A0IA 3KRFA 4GA3A 2E92A 3SDRA 2F92F 3LDWA 3WEFA 3RBMA 5B0LA 3N0FA 5A0KA 1VG3A 3ZOUA 4MC0A 4LLSA 5IKHA 3ACYA 5B00A 2E8XA 4E9UA 2AZLA 1RQIA 3N6KF 5ILJA 5IK6A 3G4FA 3WSBA 3OACB 5B0IA 3PYAA 5HN9A 5E8KA 4KQSA 3CP6A 3OABA 5B0MA 2Z78A 5EATA 4GAXA 4RXEA 5IMIA 3EGTA 4RNQA 3AQCB 4UMJA 2Z7IA 2ZCSA 3KRCB 2PS6A 3KRAB 4NG6A 2FTZA 4KPJA 4P0XA 2Z4VA 4RXCA 3ZL6A 1HM4A 3KRPB 1YYRA 3N49F 2E95A 3WCMA 1YHLA 3AQBB 3LEEA 3LK5A 3KROA 2F9KF 3LSNA 1DI1A 4H5EF 3DYFA 1UBWA 4H5CF 5ILDA 4DZWA 4LZ3A 3WCGA 1V4KA 2OA6A 5AHUB 2Z4XA 2J1PA 5AYPA 1YHKA 5IL3A 4KVDA 4F62A 1VG7A 4KVIA 2H8OA 3TFPA 3NPKA 3V66A 4MC8A 3M00A 4N1ZF 1WL0A 3P41A 4KFAA 3WEJA 1YYQA 4N9UA 4LUUA 1V4IA 4KVYA 3VJDA 1N22A 3WCDA 2ZEUA 4LTVA 3WSAA 4KWDA 2E8WA 3UCAA 5JA0F 4KPDA 5C05A 2ZEVA 1VG6A 4H5DF 1ZW5A 4RXDA 1VG4A 3KBKA 3LZ9A 5B03A 2OPMA 4RXAA 4P0VA 2ONGA 3TFVA 3M9UA 2Z50A 3N5JF 3RYWA 3B7LA 3WCBA 2O1OA 4GP1A 3Q1OA 4LA6A 4WK5A 2F94F 2VF6A 2Q9YA 3M02A 3ZCDA 2Z4YA 2J1OA 4LPHF 3KRCA 3WCAA 2RAHA 3M0GA 3AE0A 2E8TA 5JV1F 2ZY1A 4LFEA 3G4DA 4KUXA 5HN8A 1N1ZA 3N0GA 1YHMA 3IBAA 4NFJF 2PS5A 2AZKA 3S9VA 5IVGA 4LZ0A 3DYHA 5IM1A 4NFIF 3TS7A 3LLWA 1HXAA 5AFXA 4L2XF 4F6XA 1WL1A 3WJKA 5ERNA 3WEIA 4DWGA 1FPSA 3P5RA 5IL8A 3TFNA 2P1CA 2ZCQA 1KIYA 3ASXA 3CC9A 3SDUA 3ID0A 5A0JA 5IMPA 4RYPA 3VJ9A 1WL3A 3PH7A 3WCFA 1DGPA 3OABB 3VJEA 4OGUA 4E1EA 3P8RA 4JZBA 2Z7HA 3WCHA 2OPNA 5DZ2A 3APZA 2F8ZF 4JVJF 3N45F 4KKMA 4OKZA 4OMHA 2Z52A 4JXYA 3LVSA 3Q2ZA 3N5HF 5DJVF 3P5PA 4XQSF 1JFGA 3N3LF 3PYBA 3QKCA 4PVXF 5KSXF 3ICZA 1WL2A 2PS8A 2Q80A 1YJ4A 4HD1A 4LFVF 2DH4A 3CKEA 3LOMA 1N21A 3N1WF 4LTZA 4EA2A 4EA1A 3Q30A 2E94A 5DHIA 4K10A 3LJIA 1V4JA 5B01A 1UBYA 3VJ8A 3BNXA 1HM7A 5ILYA 5CG6A 1YQ7A 3N1VF 3EFQA 2AEKA 3N46F 5E8LA 3M01A 2F8CF 2Z4ZA 4LPGF 2E93A 3LGKA 3NF2A 3VJAA 2AETA 3TC1A 3NRIA 2E90A 3OACA 4P0WA 3W7FA 3LGZB 5ILIA 4DI5A 5DIQF 5EROA 1PS1A 1JFAA 1N23A 3WEKA 1UBXA 1HXGA 1WKZA 3KB9A 5DJPF 2PS4A 3KRAA 3V1XA 5HNAA 1YYTA 3P8LA 3LG5A 1V4HA 4F6VA 5ILKA 3ACWA 1HX9A 4EA0A 3KRPA 4Q23A 3ICKA 4LIXA 3EZ3A 3S4JA 3DYGA 3AQ0A 5DGMF 5AELA 4DXJA 5JUZF 3WCIA 3WJNA 5ILHA 2ZCOA 5ILZA 3KRFB 4QXSF 1YYUA 2I19A 4KVWA 3SDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NUA A;  2E8U A;  3OYR A;  4JYX A;  4JZX A;  5IKA A;  3WEH A;  4NFK F;  5JV0 F;  1RQJ A;  3WC9 A;  3LMD A;  4DWB A;  5CG5 A;  4LLT A;  4LXW A;  2ONH A;  4JXN A;  5IMN A;  3WCE A;  3BNY A;  3IPI A;  5ER8 A;  2EWG A;  3VJB A;  5IK9 A;  1YV5 A;  2Z4W A;  4QPF A;  3ICN A;  5B02 A;  1YYS A;  3PDE A;  3SDT A;  5EAU A;  5B0J A;  3N3D A;  1N1B A;  2F89 F;  3VJC A;  3RMG A;  2OGD A;  4NKF A;  4KK2 A;  2AEL A;  5DJR F;  5IN8 A;  2PS7 A;  3ZMB A;  3KRO B;  4PVY F;  2F7M F;  5H9D A;  2FOR A;  5DHK A;  1EZF A;  5ERM A;  4XQT F;  4XQR F;  4FJQ A;  4NKE A;  3V1V A;  3WEG A;  5IK0 A;  5E8H A;  3ACX A;  3WJO A;  3Q2Q A;  3MZV A;  1N20 A;  1VG2 A;  1WY0 A;  4LOB A;  4MC3 A;  5DGN F;  2J5C A;  3PKO A;  4FP4 A;  3SDV A;  4GP2 A;  1N24 A;  4LZC A;  2Q58 A;  2E91 A;  2Q9Z A;  3RYE A;  1HXC A;  4OKM A;  5JV2 F;  1KIZ A;  3WCC A;  3QQV A;  4LFG A;  5DW7 A;  1RTR A;  3SAE A;  4KQ5 A;  3ADZ A;  5I1U A;  3MAV A;  3WE9 A;  1WMW A;  5EAS A;  1UBV A;  5HN7 A;  3ZMC A;  2AZJ A;  4OMG A;  5B0K A;  4E9Z A;  1V4E A;  3WCJ A;  4KQU A;  4LA5 A;  3NPR A;  2E4O A;  4ZQ8 A;  2E8V A;  4DEM F;  2QIS A;  3WCL A;  2ZCR A;  5DGS F;  3ICM A;  4DHD A;  5A0I A;  3KRF A;  4GA3 A;  2E92 A;  3SDR A;  2F92 F;  3LDW A;  3WEF A;  3RBM A;  5B0L A;  3N0F A;  5A0K A;  1VG3 A;  3ZOU A;  4MC0 A;  4LLS A;  5IKH A;  3ACY A;  5B00 A;  2E8X A;  4E9U A;  2AZL A;  1RQI A;  3N6K F;  5ILJ A;  5IK6 A;  3G4F A;  3WSB A;  3OAC B;  5B0I A;  3PYA A;  5HN9 A;  5E8K A;  4KQS A;  3CP6 A;  3OAB A;  5B0M A;  2Z78 A;  5EAT A;  4GAX A;  4RXE A;  5IMI A;  3EGT A;  4RNQ A;  3AQC B;  4UMJ A;  2Z7I A;  2ZCS A;  3KRC B;  2PS6 A;  3KRA B;  4NG6 A;  2FTZ A;  4KPJ A;  4P0X A;  2Z4V A;  4RXC A;  3ZL6 A;  1HM4 A;  3KRP B;  1YYR A;  3N49 F;  2E95 A;  3WCM A;  1YHL A;  3AQB B;  3LEE A;  3LK5 A;  3KRO A;  2F9K F;  3LSN A;  1DI1 A;  4H5E F;  3DYF A;  1UBW A;  4H5C F;  5ILD A;  4DZW A;  4LZ3 A;  3WCG A;  1V4K A;  2OA6 A;  5AHU B;  2Z4X A;  2J1P A;  5AYP A;  1YHK A;  5IL3 A;  4KVD A;  4F62 A;  1VG7 A;  4KVI A;  2H8O A;  3TFP A;  3NPK A;  3V66 A;  4MC8 A;  3M00 A;  4N1Z F;  1WL0 A;  3P41 A;  4KFA A;  3WEJ A;  1YYQ A;  4N9U A;  4LUU A;  1V4I A;  4KVY A;  3VJD A;  1N22 A;  3WCD A;  2ZEU A;  4LTV A;  3WSA A;  4KWD A;  2E8W A;  3UCA A;  5JA0 F;  4KPD A;  5C05 A;  2ZEV A;  1VG6 A;  4H5D F;  1ZW5 A;  4RXD A;  1VG4 A;  3KBK A;  3LZ9 A;  5B03 A;  2OPM A;  4RXA A;  4P0V A;  2ONG A;  3TFV A;  3M9U A;  2Z50 A;  3N5J F;  3RYW A;  3B7L A;  3WCB A;  2O1O A;  4GP1 A;  3Q1O A;  4LA6 A;  4WK5 A;  2F94 F;  2VF6 A;  2Q9Y A;  3M02 A;  3ZCD A;  2Z4Y A;  2J1O A;  4LPH F;  3KRC A;  3WCA A;  2RAH A;  3M0G A;  3AE0 A;  2E8T A;  5JV1 F;  2ZY1 A;  4LFE A;  3G4D A;  4KUX A;  5HN8 A;  1N1Z A;  3N0G A;  1YHM A;  3IBA A;  4NFJ F;  2PS5 A;  2AZK A;  3S9V A;  5IVG A;  4LZ0 A;  3DYH A;  5IM1 A;  4NFI F;  3TS7 A;  3LLW A;  1HXA A;  5AFX A;  4L2X F;  4F6X A;  1WL1 A;  3WJK A;  5ERN A;  3WEI A;  4DWG A;  1FPS A;  3P5R A;  5IL8 A;  3TFN A;  2P1C A;  2ZCQ A;  1KIY A;  3ASX A;  3CC9 A;  3SDU A;  3ID0 A;  5A0J A;  5IMP A;  4RYP A;  3VJ9 A;  1WL3 A;  3PH7 A;  3WCF A;  1DGP A;  3OAB B;  3VJE A;  4OGU A;  4E1E A;  3P8R A;  4JZB A;  2Z7H A;  3WCH A;  2OPN A;  5DZ2 A;  3APZ A;  2F8Z F;  4JVJ F;  3N45 F;  4KKM A;  4OKZ A;  4OMH A;  2Z52 A;  4JXY A;  3LVS A;  3Q2Z A;  3N5H F;  5DJV F;  3P5P A;  4XQS F;  1JFG A;  3N3L F;  3PYB A;  3QKC A;  4PVX F;  5KSX F;  3ICZ A;  1WL2 A;  2PS8 A;  2Q80 A;  1YJ4 A;  4HD1 A;  4LFV F;  2DH4 A;  3CKE A;  3LOM A;  1N21 A;  3N1W F;  4LTZ A;  4EA2 A;  4EA1 A;  3Q30 A;  2E94 A;  5DHI A;  4K10 A;  3LJI A;  1V4J A;  5B01 A;  1UBY A;  3VJ8 A;  3BNX A;  1HM7 A;  5ILY A;  5CG6 A;  1YQ7 A;  3N1V F;  3EFQ A;  2AEK A;  3N46 F;  5E8L A;  3M01 A;  2F8C F;  2Z4Z A;  4LPG F;  2E93 A;  3LGK A;  3NF2 A;  3VJA A;  2AET A;  3TC1 A;  3NRI A;  2E90 A;  3OAC A;  4P0W A;  3W7F A;  3LGZ B;  5ILI A;  4DI5 A;  5DIQ F;  5ERO A;  1PS1 A;  1JFA A;  1N23 A;  3WEK A;  1UBX A;  1HXG A;  1WKZ A;  3KB9 A;  5DJP F;  2PS4 A;  3KRA A;  3V1X A;  5HNA A;  1YYT A;  3P8L A;  3LG5 A;  1V4H A;  4F6V A;  5ILK A;  3ACW A;  1HX9 A;  4EA0 A;  3KRP A;  4Q23 A;  3ICK A;  4LIX A;  3EZ3 A;  3S4J A;  3DYG A;  3AQ0 A;  5DGM F;  5AEL A;  4DXJ A;  5JUZ F;  3WCI A;  3WJN A;  5ILH A;  2ZCO A;  5ILZ A;  3KRF B;  4QXS F;  1YYU A;  2I19 A;  4KVW A;  3SDQ A; 
#chains in the Genus database with same CATH topology
 4NUA A;  2E8U A;  3OYR A;  1CB8 A;  1GLM A;  1XWT A;  1O1S B;  3E7J A;  4JYX A;  2SQC A;  3E37 B;  1KKT A;  4JZX A;  5IKA A;  1TN8 B;  1GA2 A;  4WU0 A;  3WEH A;  3GLY A;  3QT3 A;  4NFK F;  5JV0 F;  1SA4 B;  1RQJ A;  1NL4 B;  2BRP A;  3WC9 A;  4D4C A;  1LF6 A;  3LMD A;  4DWB A;  5CG5 A;  1RWG A;  3SFX B;  4LLT A;  4D94 A;  5FOB B;  4LXW A;  2ONH A;  2ZBL A;  4JXN A;  5IMN A;  3WCE A;  2VN4 A;  3BNY A;  3IPI A;  5ER8 A;  1HMU A;  1WU6 A;  4BOK A;  3W7T A;  2EWG A;  3VJB A;  2AHG A;  2Z07 A;  5IK9 A;  1TNO B;  2FBA A;  1YV5 A;  4LNG B;  2Z4W A;  4QPF A;  2IEJ B;  3E33 B;  2AFA A;  3W7W A;  3CU7 A;  3ICN A;  1W3Y A;  5B02 A;  2DRR A;  1YYS A;  3DSS B;  2NOJ A;  3PDE A;  3SDT A;  5EAU A;  1N9A B;  2JJB A;  1G87 A;  5B0J A;  3ANJ A;  3N3D A;  1N1B A;  2F89 F;  3VJC A;  4J5T A;  3RMG A;  2OGD A;  3PMM A;  5JMF A;  4NKF A;  4KK2 A;  2AEL A;  5DJR F;  4FXG B;  4TF4 A;  4OZV A;  1F1S A;  2FUT A;  5IN8 A;  2PS7 A;  3ZMB A;  1N4R B;  3KRO B;  4PVY F;  3NFV A;  2F7M F;  5H9D A;  1I8Q A;  3P2C A;  2FOR A;  1MZC B;  5DHK A;  1H14 A;  2WY7 A;  3S4C A;  1EZF A;  2JG0 A;  3PZ4 B;  5ERM A;  5M7Y A;  3D5S A;  4XQT F;  4XQR F;  1FAE A;  2BB6 A;  4FJQ A;  3WKG A;  4NKE A;  3V1V A;  3WEG A;  2ZZR A;  1FP3 A;  5MEH A;  1LTX B;  3E32 B;  2D5J A;  1FMI A;  5IK0 A;  5E8H A;  4YCR A;  3ACX A;  1N7N A;  3WJO A;  3Q2Q A;  1OJO A;  2RI9 A;  2OKX A;  2BBC A;  3MZV A;  3QFZ A;  1KRF A;  4GTP B;  1N20 A;  1JCS B;  1KFG A;  2X03 A;  1X9D A;  4FNV A;  1VG2 A;  2EAD A;  1WY0 A;  4LOB A;  4MC3 A;  5DGN F;  3AFJ A;  2J5C A;  3PKO A;  4FP4 A;  3SDV A;  2R2L B;  3QPF A;  1JCQ B;  4GP2 A;  4WVA A;  2EAC A;  3E6U A;  1N24 A;  4LZC A;  2Q58 A;  3ANI A;  2E91 A;  1FO2 A;  2WDA A;  4ONT A;  3Q7A B;  1KSC A;  3A3V A;  1D8D B;  1F9D A;  2Q9Z A;  3RYE A;  1HXC A;  4OKM A;  1CEM A;  5JV2 F;  3PZ3 B;  1KZP B;  3W5N A;  1KIZ A;  2ZIS B;  3WCC A;  1NXC A;  3QQV A;  2ZIR B;  4LFG A;  1O6R A;  2PMV A;  4D4A A;  5DW7 A;  1RTR A;  3QFY A;  3DSW B;  3SAE A;  4KQ5 A;  3S4A A;  3ADZ A;  5I1U A;  2I07 B;  3MAV A;  3WE9 A;  1WMW A;  5EAS A;  4MU9 A;  1UBV A;  5HN7 A;  3ZMC A;  4Q2B A;  2AZJ A;  2BRV X;  1KWF A;  1G9G A;  4OMG A;  5B0K A;  2D8L A;  3S4D A;  4F10 A;  1K72 A;  4E9Z A;  1LD8 B;  1V4E A;  3WCJ A;  1NI1 B;  4KQU A;  4LA5 A;  3NPR A;  2E4O A;  3S4B A;  4ZQ8 A;  2E8V A;  4DEM F;  2QIS A;  3WCL A;  2ZCR A;  1H3B A;  1H54 A;  4OK2 A;  1KS8 A;  2WY8 A;  1JS4 A;  1O6Q A;  5DGS F;  3ICM A;  4L9P B;  4DHD A;  5A0I A;  3KRF A;  4GA3 A;  2E92 A;  3SDR A;  1DCE B;  2F0Y B;  2F92 F;  3LDW A;  3WEF A;  1QQF A;  3Q78 B;  3QT9 A;  1RWA A;  3RBM A;  5B0L A;  3N0F A;  1QSJ A;  5A0K A;  1VG3 A;  4L0G A;  3ZOU A;  4MC0 A;  2CQT A;  4LLS A;  5IKH A;  1V7X A;  3DST B;  1VD5 A;  2FUQ A;  3ACY A;  5B00 A;  3M78 A;  3HXC B;  1GSZ A;  2E8X A;  4E9U A;  2AZL A;  1RQI A;  3N6K F;  5ILJ A;  1RWF A;  1RWH A;  5CA3 A;  1RWC A;  2XWB B;  5IK6 A;  3G4F A;  3WSB A;  1O5M B;  2WYN A;  2Q1F A;  1RW9 A;  3OAC B;  5B0I A;  1W6K A;  1N7P A;  3PYA A;  3TF4 A;  5HN9 A;  4ZG8 A;  5E8K A;  3W5M A;  3REN A;  4KQS A;  2H6I B;  1X1J A;  1DL2 A;  3WUX A;  1H36 A;  3CP6 A;  3OAB A;  5B0M A;  2EAB A;  2YIK A;  3Q73 B;  2Z78 A;  4GTM B;  5EAT A;  4GAX A;  4RXE A;  5IMI A;  3EGT A;  1O1R B;  2BED B;  1V7V A;  4RNQ A;  3AQC B;  4UMJ A;  2Z7I A;  2ZCS A;  3KRC B;  2PS6 A;  3H2W A;  4GTT B;  3G6J B;  3KRA B;  1UT9 A;  2WIN B;  4NG6 A;  1N94 B;  2FTZ A;  3D5R A;  3M7E A;  3A0O A;  4KPJ A;  4P0X A;  1OJM A;  2JF4 A;  3QXQ A;  2Z4V A;  4RXC A;  3ZL6 A;  4GL3 A;  1HM4 A;  3KRP B;  1YYR A;  3QSP A;  3N49 F;  3D3I A;  2E95 A;  3WCM A;  1RQ5 A;  1YHL A;  1GHQ A;  3H7L A;  3AQB B;  3LEE A;  1N4P B;  3LK5 A;  3KRO A;  1KZO B;  3QG0 A;  5M7I A;  2XWJ B;  2F9K F;  3OXU A;  3LSN A;  3M77 A;  1DI1 A;  4EHM B;  1W6J A;  4H5E F;  3DYF A;  3VSN A;  3W7X A;  1UBW A;  4H5C F;  3T33 A;  5ILD A;  3KQ4 A;  1KSD A;  1R76 A;  4DZW A;  1CLC A;  5DGR A;  3RSY A;  3SQC A;  1TNZ B;  2NVP A;  1GAI A;  4LZ3 A;  1L2A A;  3WCG A;  1V4K A;  3EQA A;  2OA6 A;  5AHU B;  4AYO A;  4ZH1 A;  1TNY B;  2Z4X A;  2J1P A;  3KLS A;  3RRS A;  5FO9 B;  4KKI A;  2B39 A;  3X17 A;  5AYP A;  1YHK A;  5IL3 A;  4KVD A;  4F62 A;  3RJ3 A;  4F13 A;  4DOE A;  1VG7 A;  4KVI A;  2H8O A;  3TFP A;  1LF9 A;  3NPK A;  3V66 A;  4MC8 A;  3GZK A;  1HM2 A;  3M7C A;  1H39 A;  4LNB B;  3M00 A;  4E1Y A;  4N1Z F;  2PN5 A;  1WL0 A;  3VW5 A;  3P41 A;  4KFA A;  3HXE B;  1LXM A;  3WEJ A;  3SFY B;  1YYQ A;  4N9U A;  1S64 B;  4LUU A;  1V4I A;  1HMW A;  4FUS A;  4GTR B;  1L1Y A;  4KVY A;  1N7O A;  3VJD A;  2G02 A;  3H3K A;  1N22 A;  2QNO A;  3M71 A;  3WCD A;  2ZEU A;  4LTV A;  3WSA A;  1XWQ A;  4YDO B;  4KWD A;  1GXN A;  2E8W A;  3UCA A;  5JA0 F;  4KPD A;  2V8K A;  4L6X A;  1FT2 B;  1H13 A;  5C05 A;  2ZEV A;  4Q88 A;  1VG6 A;  1FBO A;  1LXK A;  5FO8 B;  3AFL A;  4H5D F;  1O1T B;  3KSQ B;  1ZW5 A;  1C82 A;  3QWT A;  4RXD A;  5FO7 B;  1VG4 A;  1TF4 A;  1N95 B;  1QBQ B;  1OJP A;  4LNV A;  3WC3 A;  2XQW A;  3KBK A;  1C3D A;  1TN7 B;  3EU8 A;  3KSL B;  3LZ9 A;  3PZ1 B;  3ACT A;  5JPM B;  4QT9 A;  2XFG A;  3DPY B;  4D4D A;  5B03 A;  2OPM A;  4RXA A;  4WVC A;  4P0V A;  2ONG A;  3TFV A;  1X1H A;  2H6H B;  5CD2 A;  3M9U A;  2Z50 A;  3N5J F;  3RYW A;  5JMD A;  4OJZ A;  1HV6 A;  3B7L A;  3WCB A;  2O1O A;  1QAZ A;  1UG9 A;  4GP1 A;  3Q1O A;  4LA6 A;  4WK5 A;  2F94 F;  2VF6 A;  2Q9Y A;  3M02 A;  1J0M A;  3HXF B;  3ZCD A;  1HN0 A;  2Z4Y A;  2J1O A;  4OK4 A;  4XUV A;  1O6H A;  4LPH F;  1TNB B;  3KRC A;  1S63 B;  3WCA A;  1N4Q B;  2RAH A;  3M0G A;  3AE0 A;  2E8T A;  4AYR A;  5JV1 F;  2ZY1 A;  4LFE A;  3G4D A;  4KUX A;  5HN8 A;  1N1Z A;  3N0G A;  1FCE A;  4BOJ A;  1YHM A;  3PZ2 B;  1ULV A;  3IBA A;  4NFJ F;  2GOX A;  2PS5 A;  2AZK A;  3S9V A;  1IS9 A;  3W7U A;  3DSU B;  5IVG A;  2BB5 A;  4V1R A;  4AYP A;  3ON6 A;  4LZ0 A;  3DYH A;  5IM1 A;  4NFI F;  3TS7 A;  3LLW A;  1GXM A;  1HXA A;  5AFX A;  3DSV B;  4L2X F;  4F6X A;  3HXB B;  4ZH5 A;  1WL1 A;  1FO3 A;  3WJK A;  2G0D A;  5ERN A;  3WEI A;  4DWG A;  3W7S A;  1FPS A;  3P5R A;  5IL8 A;  2V8J A;  3TFN A;  2P1C A;  3WIQ A;  1H3C A;  3HXD B;  2ZCQ A;  1KIY A;  3ASX A;  3CC9 A;  3M75 A;  3SDU A;  3E80 A;  3M76 A;  1WU4 A;  3ID0 A;  5A0J A;  5IMP A;  2H6G B;  4RYP A;  1X81 B;  4TXT A;  5AGD A;  3VJ9 A;  1JCR B;  4MMH A;  1GXO A;  1WL3 A;  3PH7 A;  4D4B A;  4C1S A;  3WCF A;  1H37 A;  3M7B A;  1DGP A;  3WKH A;  3RX7 A;  1XW2 A;  3K11 A;  3OAB B;  3VJE A;  1SA5 B;  4OGU A;  5DGQ A;  4E1E A;  1V7W A;  2V3P A;  3P8R A;  1H35 A;  4JZB A;  2Z7H A;  3WCH A;  2OPN A;  5DZ2 A;  3M7L A;  3APZ A;  2F8Z F;  3ANK A;  4JVJ F;  2EAE A;  3Q75 B;  3EU5 B;  3N45 F;  3RX5 A;  4KKM A;  2FV1 A;  4OKZ A;  2E24 A;  1HM3 A;  4OMH A;  2CQS A;  2WII B;  2Z52 A;  4JXY A;  1IA6 A;  3LVS A;  1FT1 B;  3Q2Z A;  3N5H F;  5DJV F;  2H6F B;  3P5P A;  1FBW A;  4EL8 A;  2B4F A;  4XQS F;  3VSM A;  1HCU A;  4MBG B;  2F6D A;  1X1I A;  1G9J A;  1JFG A;  2FUZ A;  3N3L F;  2RI8 A;  4M76 A;  1D8E B;  3PYB A;  3QKC A;  1V5D A;  4PVX F;  5KSX F;  3ICZ A;  1WL2 A;  2PS8 A;  2Q80 A;  1YJ4 A;  4HD1 A;  3Q7F B;  4LFV F;  1G6I A;  1UMP A;  3OED A;  4CJ1 A;  2DH4 A;  3QDE A;  3DRA B;  3CKE A;  1WZZ A;  3LOM A;  1N21 A;  1FPP B;  2GZ6 A;  3QXF A;  2P0V A;  3N1W F;  4LTZ A;  2V8I A;  4EA2 A;  4EA1 A;  3Q30 A;  1H3A A;  4KKJ A;  2E94 A;  1O79 A;  5DHI A;  2A8Z A;  4GTQ B;  4K10 A;  3GT5 A;  3LJI A;  1V4J A;  5B01 A;  2WCO A;  1UBY A;  3C72 B;  3VJ8 A;  2GH4 A;  3BNX A;  3M72 A;  1HM7 A;  5ILY A;  1N7R A;  3VXD A;  5CG6 A;  1YQ7 A;  5GW7 A;  3ACS A;  3N1V F;  3EFQ A;  5JPN B;  2AEK A;  3N46 F;  1AGM A;  5E8L A;  3E34 B;  3DSX B;  4DOD A;  1SQC A;  3M01 A;  4GTV B;  1LD7 B;  4WVB A;  3M74 A;  2F8C F;  2Z4Z A;  4LPG F;  2E93 A;  3LGK A;  3NF2 A;  3VJA A;  2E22 A;  3WKF A;  3K7X A;  4GTO B;  4AYQ A;  4YDE B;  4JJJ A;  2AET A;  1AYX A;  4KTR A;  5GZK A;  4V1S A;  3M73 A;  3CIH A;  2V3N A;  3TC1 A;  3NRI A;  2E90 A;  1IA7 A;  3OAC A;  4P0W A;  4ZRP A;  3W7F A;  3LGZ B;  5ILI A;  3EUV B;  4OZW A;  4DI5 A;  1TN6 B;  5DIQ F;  5ERO A;  1GAH A;  5CZL A;  1HZF A;  1PS1 A;  1LOH A;  1JFA A;  4NEI A;  1N23 A;  3WEK A;  3Q79 B;  1F9G A;  1H12 A;  4MMI A;  1UBX A;  3WKI A;  1HXG A;  3QRY A;  1WKZ A;  3KB9 A;  5DJP F;  2PS4 A;  3KRA A;  2BRW A;  2A73 B;  3V1X A;  5HNA A;  3EZ8 A;  1YYT A;  2DRQ A;  3P8L A;  2FV0 A;  3LG5 A;  3WIW A;  2AHF A;  4GTS B;  1V4H A;  4F6V A;  5ILK A;  3ACW A;  1HX9 A;  4EA0 A;  1NC5 A;  3KRP A;  4Q23 A;  2VN7 A;  4FXK B;  3ICK A;  1V5C A;  4LIX A;  3EZ3 A;  2DRO A;  5GY3 A;  3S4J A;  1KRE A;  3RX8 A;  4CE7 A;  3DYG A;  3AQ0 A;  1F9O A;  5DGM F;  5AEL A;  1DOG A;  4DXJ A;  5JUZ F;  3WCI A;  5KKB A;  3WJN A;  5ILH A;  2ZCO A;  4Z4J A;  4Z4L A;  1OJN A;  5ILZ A;  4ZRQ A;  3KRF B;  1TNU B;  3WIR A;  4QXS F;  1N7Q A;  1EGU A;  1YYU A;  3E30 B;  3E73 A;  4CJ0 A;  4KTP A;  1J0N A;  2RGK A;  3NNB A;  1WU5 A;  1N4S B;  5E2J A;  2I19 A;  4KVW A;  2DRS A;  3SDQ A; 
#chains in the Genus database with same CATH homology
 4NUA A;  2E8U A;  3OYR A;  4JYX A;  4JZX A;  5IKA A;  3WEH A;  4NFK F;  5JV0 F;  1RQJ A;  3WC9 A;  3LMD A;  4DWB A;  5CG5 A;  4LLT A;  4LXW A;  2ONH A;  4JXN A;  5IMN A;  3WCE A;  3BNY A;  3IPI A;  5ER8 A;  2EWG A;  3VJB A;  5IK9 A;  1YV5 A;  2Z4W A;  4QPF A;  3ICN A;  5B02 A;  1YYS A;  3PDE A;  3SDT A;  5EAU A;  5B0J A;  3N3D A;  1N1B A;  2F89 F;  3VJC A;  3RMG A;  2OGD A;  4NKF A;  4KK2 A;  2AEL A;  5DJR F;  5IN8 A;  2PS7 A;  3ZMB A;  3KRO B;  4PVY F;  2F7M F;  5H9D A;  2FOR A;  5DHK A;  1EZF A;  5ERM A;  4XQT F;  4XQR F;  4FJQ A;  4NKE A;  3V1V A;  3WEG A;  5IK0 A;  5E8H A;  3ACX A;  3WJO A;  3Q2Q A;  3MZV A;  1N20 A;  1VG2 A;  1WY0 A;  4LOB A;  4MC3 A;  5DGN F;  2J5C A;  3PKO A;  4FP4 A;  3SDV A;  4GP2 A;  1N24 A;  4LZC A;  2Q58 A;  2E91 A;  2Q9Z A;  3RYE A;  1HXC A;  4OKM A;  5JV2 F;  1KIZ A;  3WCC A;  3QQV A;  4LFG A;  5DW7 A;  1RTR A;  3SAE A;  4KQ5 A;  3ADZ A;  5I1U A;  3MAV A;  3WE9 A;  1WMW A;  5EAS A;  1UBV A;  5HN7 A;  3ZMC A;  2AZJ A;  4OMG A;  5B0K A;  4E9Z A;  1V4E A;  3WCJ A;  4KQU A;  4LA5 A;  3NPR A;  2E4O A;  4ZQ8 A;  2E8V A;  4DEM F;  2QIS A;  3WCL A;  2ZCR A;  5DGS F;  3ICM A;  4DHD A;  5A0I A;  3KRF A;  4GA3 A;  2E92 A;  3SDR A;  2F92 F;  3LDW A;  3WEF A;  3RBM A;  5B0L A;  3N0F A;  5A0K A;  1VG3 A;  3ZOU A;  4MC0 A;  4LLS A;  5IKH A;  3ACY A;  5B00 A;  2E8X A;  4E9U A;  2AZL A;  1RQI A;  3N6K F;  5ILJ A;  5IK6 A;  3G4F A;  3WSB A;  3OAC B;  5B0I A;  3PYA A;  5HN9 A;  5E8K A;  4KQS A;  3CP6 A;  3OAB A;  5B0M A;  2Z78 A;  5EAT A;  4GAX A;  4RXE A;  5IMI A;  3EGT A;  4RNQ A;  3AQC B;  4UMJ A;  2Z7I A;  2ZCS A;  3KRC B;  2PS6 A;  3KRA B;  4NG6 A;  2FTZ A;  4KPJ A;  4P0X A;  2Z4V A;  4RXC A;  3ZL6 A;  1HM4 A;  3KRP B;  1YYR A;  3N49 F;  2E95 A;  3WCM A;  1YHL A;  3AQB B;  3LEE A;  3LK5 A;  3KRO A;  2F9K F;  3LSN A;  1DI1 A;  4H5E F;  3DYF A;  1UBW A;  4H5C F;  5ILD A;  4DZW A;  4LZ3 A;  3WCG A;  1V4K A;  2OA6 A;  5AHU B;  2Z4X A;  2J1P A;  5AYP A;  1YHK A;  5IL3 A;  4KVD A;  4F62 A;  1VG7 A;  4KVI A;  2H8O A;  3TFP A;  3NPK A;  3V66 A;  4MC8 A;  3M00 A;  4N1Z F;  1WL0 A;  3P41 A;  4KFA A;  3WEJ A;  1YYQ A;  4N9U A;  4LUU A;  1V4I A;  4KVY A;  3VJD A;  1N22 A;  3WCD A;  2ZEU A;  4LTV A;  3WSA A;  4KWD A;  2E8W A;  3UCA A;  5JA0 F;  4KPD A;  5C05 A;  2ZEV A;  1VG6 A;  4H5D F;  1ZW5 A;  4RXD A;  1VG4 A;  3KBK A;  3LZ9 A;  5B03 A;  2OPM A;  4RXA A;  4P0V A;  2ONG A;  3TFV A;  3M9U A;  2Z50 A;  3N5J F;  3RYW A;  3B7L A;  3WCB A;  2O1O A;  4GP1 A;  3Q1O A;  4LA6 A;  4WK5 A;  2F94 F;  2VF6 A;  2Q9Y A;  3M02 A;  3ZCD A;  2Z4Y A;  2J1O A;  4LPH F;  3KRC A;  3WCA A;  2RAH A;  3M0G A;  3AE0 A;  2E8T A;  5JV1 F;  2ZY1 A;  4LFE A;  3G4D A;  4KUX A;  5HN8 A;  1N1Z A;  3N0G A;  1YHM A;  3IBA A;  4NFJ F;  2PS5 A;  2AZK A;  3S9V A;  5IVG A;  4LZ0 A;  3DYH A;  5IM1 A;  4NFI F;  3TS7 A;  3LLW A;  1HXA A;  5AFX A;  4L2X F;  4F6X A;  1WL1 A;  3WJK A;  5ERN A;  3WEI A;  4DWG A;  1FPS A;  3P5R A;  5IL8 A;  3TFN A;  2P1C A;  2ZCQ A;  1KIY A;  3ASX A;  3CC9 A;  3SDU A;  3ID0 A;  5A0J A;  5IMP A;  4RYP A;  3VJ9 A;  1WL3 A;  3PH7 A;  3WCF A;  1DGP A;  3OAB B;  3VJE A;  4OGU A;  4E1E A;  3P8R A;  4JZB A;  2Z7H A;  3WCH A;  2OPN A;  5DZ2 A;  3APZ A;  2F8Z F;  4JVJ F;  3N45 F;  4KKM A;  4OKZ A;  4OMH A;  2Z52 A;  4JXY A;  3LVS A;  3Q2Z A;  3N5H F;  5DJV F;  3P5P A;  4XQS F;  1JFG A;  3N3L F;  3PYB A;  3QKC A;  4PVX F;  5KSX F;  3ICZ A;  1WL2 A;  2PS8 A;  2Q80 A;  1YJ4 A;  4HD1 A;  4LFV F;  2DH4 A;  3CKE A;  3LOM A;  1N21 A;  3N1W F;  4LTZ A;  4EA2 A;  4EA1 A;  3Q30 A;  2E94 A;  5DHI A;  4K10 A;  3LJI A;  1V4J A;  5B01 A;  1UBY A;  3VJ8 A;  3BNX A;  1HM7 A;  5ILY A;  5CG6 A;  1YQ7 A;  3N1V F;  3EFQ A;  2AEK A;  3N46 F;  5E8L A;  3M01 A;  2F8C F;  2Z4Z A;  4LPG F;  2E93 A;  3LGK A;  3NF2 A;  3VJA A;  2AET A;  3TC1 A;  3NRI A;  2E90 A;  3OAC A;  4P0W A;  3W7F A;  3LGZ B;  5ILI A;  4DI5 A;  5DIQ F;  5ERO A;  1PS1 A;  1JFA A;  1N23 A;  3WEK A;  1UBX A;  1HXG A;  1WKZ A;  3KB9 A;  5DJP F;  2PS4 A;  3KRA A;  3V1X A;  5HNA A;  1YYT A;  3P8L A;  3LG5 A;  1V4H A;  4F6V A;  5ILK A;  3ACW A;  1HX9 A;  4EA0 A;  3KRP A;  4Q23 A;  3ICK A;  4LIX A;  3EZ3 A;  3S4J A;  3DYG A;  3AQ0 A;  5DGM F;  5AEL A;  4DXJ A;  5JUZ F;  3WCI A;  3WJN A;  5ILH A;  2ZCO A;  5ILZ A;  3KRF B;  4QXS F;  1YYU A;  2I19 A;  4KVW A;  3SDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...