4FJQA

Crystal structure of an alpha-bisabolol synthase
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
530
structure length
521
Chain Sequence
PSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGDRSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRVLMVEAQWLNEGHIPTTEELDSIAVNLGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAEKDNFTRMGEEYKNLVKSLLVYPMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
total genus 202
structure length 521
sequence length 530
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4fjqA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4fjqA02
5ILYA 1JFGA 4XQRF 3RBMA 3WCMA 5AFXA 1WL1A 5IL3A 4ZQ8A 5AYPA 1N24A 1N21A 3N1VF 4LOBA 2E8VA 3OACB 5JV0F 3P41A 2PS4A 4QXSF 2OPMA 3EGTA 1JFAA 4LPHF 1RQJA 1ZW5A 2E8WA 2AZLA 2E93A 3M00A 3WCIA 3KRAB 3WJNA 5DHIA 1V4HA 1EZFA 1YHKA 4E1EA 4LLSA 4EA2A 1DI1A 3PYBA 4LZ0A 4NKEA 5B0JA 3V1VA 4LFEA 4LZCA 2Z78A 1N22A 3LGZB 3RYWA 2J5CA 4OKZA 4NFIF 3BNXA 5ILZA 4WK5A 5B03A 3ICZA 3P8RA 4DZWA 2Q9ZA 3AQ0A 2AELA 5B0MA 1HX9A 1YYUA 3SDTA 4NKFA 3SAEA 2F8ZF 5C05A 1V4EA 3DYGA 3TFVA 4H5DF 4RXDA 5E8HA 3EZ3A 3NRIA 3N45F 3ICMA 2E8TA 3EFQA 3WCGA 3ACYA 4DHDA 3UCAA 3OACA 5EATA 3SDRA 4LTZA 2ZEUA 1YYTA 3KRAA 3ASXA 3BNYA 3N5HF 3RMGA 1V4JA 5HNAA 2F9KF 3AE0A 5B0LA 1YJ4A 1KIZA 2F92F 1VG7A 4MC8A 5B0KA 3ICKA 2F94F 1DGPA 3WCLA 3TS7A 5DW7A 3VJAA 5A0JA 5CG6A 4L2XF 3WEIA 4KVWA 5IK9A 3G4FA 3KRCB 5IKHA 5DJPF 1YYSA 3LVSA 2ZCOA 2Q58A 3WEHA 4KVDA 4RYPA 1UBVA 3WEFA 2E94A 3LSNA 4KUXA 2Z4ZA 4PVYF 4LZ3A 4LXWA 4KQUA 2F8CF 5JV2F 2P1CA 2Z4VA 5JUZF 1VG6A 5JV1F 3N0GA 2E8XA 2OA6A 5DZ2A 3WCBA 5EASA 5IN8A 5DGMF 3LDWA 3CC9A 5IVGA 4LUUA 3LGKA 5DGSF 2Z4YA 4KFAA 1YYQA 3MZVA 2PS5A 3WCCA 2QISA 5IMNA 4KKMA 3WC9A 4LA6A 3LEEA 2J1PA 3VJEA 5ILHA 5KSXF 3P8LA 3S9VA 5DIQF 1WMWA 3KROB 1WY0A 3QKCA 3LMDA 3WCFA 3IPIA 4KWDA 3SDVA 1WKZA 4EA0A 2RAHA 3DYFA 3QQVA 3LLWA 1WL2A 4N1ZF 5JA0F 4EA1A 3WCDA 4H5EF 3KRCA 4OMGA 3V66A 3N46F 5ILKA 4FP4A 3TC1A 5IM1A 4LFGA 4PVXF 3AQBB 4QPFA 4GA3A 3IBAA 3SDQA 3VJ9A 3WE9A 4RNQA 1YHLA 4NUAA 3M01A 5I1UA 4XQSF 5ILDA 2E91A 4OMHA 4P0XA 3KRPB 5DJVF 1YV5A 3RYEA 2AEKA 3WEGA 5ILJA 4KVIA 2H8OA 2Z50A 2E90A 5B0IA 2F7MF 3N3DA 5B00A 4GAXA 3KRFB 3N0FA 3VJ8A 2FORA 1HXAA 3MAVA 5B02A 3PDEA 3WJOA 1V4KA 3N1WF 1HM4A 3KB9A 3Q1OA 4UMJA 3M9UA 3WSBA 1VG4A 4MC3A 1V4IA 2F89F 3NPRA 3KROA 1PS1A 3OABB 4JYXA 3TFNA 3S4JA 3Q2QA 4DI5A 4RXAA 4N9UA 2Z4WA 4LIXA 4F6XA 3ZMCA 4MC0A 3DYHA 4RXCA 3APZA 2ONHA 4LA5A 4KQSA 4JXNA 1KIYA 3CKEA 4DWGA 4P0VA 4DWBA 4KQ5A 2FTZA 4LLTA 4XQTF 5ER8A 3Q2ZA 3NF2A 3AQCB 1YHMA 2ZCSA 3ADZA 5EROA 3SDUA 5ERMA 2OPNA 2PS8A 3KRFA 1HXCA 4P0WA 5HN9A 1VG2A 3B7LA 1YQ7A 5B01A 5IMPA 5DJRF 5H9DA 3LJIA 3WCJA 3ZL6A 3M0GA 1N1ZA 2Z4XA 3W7FA 3WCAA 5IMIA 3M02A 3ICNA 5IK0A 3VJDA 1RQIA 2ZCRA 3OYRA 4OGUA 4JVJF 5DHKA 3OABA 1RTRA 5IKAA 3N6KF 3CP6A 4GP1A 2Q9YA 3ACWA 3ID0A 3N5JF 1UBXA 4GP2A 4LPGF 4HD1A 5CG5A 3ZCDA 4OKMA 5E8KA 3KBKA 4NFJF 3P5PA 5A0KA 1YYRA 1HM7A 3PKOA 2ZY1A 4F6VA 4RXEA 2Z7HA 5HN8A 4JZXA 3N3LF 1UBYA 4KK2A 2PS7A 3PYAA 5HN7A 2AETA 3NPKA 2Q80A 4FJQA 2AZKA 2ZCQA 1WL3A 3P5RA 2I19A 1WL0A 2O1OA 4E9UA 1UBWA 4JZBA 3G4DA 2E8UA 3Q30A 4K10A 3LG5A 3VJBA 4H5CF 1HXGA 4NG6A 5ILIA 2PS6A 1VG3A 2DH4A 3LZ9A 2EWGA 4E9ZA 3LOMA 2OGDA 5DGNF 4KVYA 2ZEVA 5AELA 3WEJA 5AHUB 4Q23A 1FPSA 3TFPA 3WCHA 3VJCA 3ZMBA 3LK5A 5ERNA 5E8LA 2E4OA 2AZJA 3PH7A 5EAUA 2ONGA 3KRPA 2Z7IA 3ACXA 3V1XA 5A0IA 4LFVF 5IL8A 4F62A 2VF6A 2J1OA 4LTVA 3ZOUA 1N20A 3WJKA 5IK6A 1N1BA 2E92A 3WCEA 4DXJA 2E95A 4KPDA 4JXYA 4DEMF 4NFKF 3WSAA 1N23A 3N49F 3WEKA 4KPJA 2Z52A
chains in the Genus database with same CATH superfamily
4L0GA 2EACA 1N7NA 1NC5A 3S4AA 1CB8A 4AYPA 3DSXB 5ILYA 5JPMB 1JFGA 4XQRF 3RBMA 3HXDB 3WCMA 1FT2B 1HZFA 5AFXA 1WL1A 5IL3A 4GL3A 4ZQ8A 5AYPA 1R76A 1N24A 1N21A 3N1VF 4FNVA 1D8EB 1NI1B 4LOBA 3EQAA 2E8VA 3OACB 5JV0F 3P41A 2PS4A 1SQCA 3W7SA 1WZZA 4QXSF 2OPMA 3EGTA 3M77A 1JFAA 3CIHA 4XUVA 4Z4LA 1NXCA 4LPHF 1UT9A 1RQJA 3PZ4B 1ZW5A 2E8WA 2AZLA 2E93A 3M00A 5GZKA 3WCIA 3KRAB 1N7PA 3WJNA 2XQWA 1G6IA 2ZISB 3KQ4A 5MEHA 3Q73B 2BB5A 5DHIA 1V4HA 1EZFA 1YHKA 4E1EA 4LLSA 4EA2A 5KKBA 1N4PB 1N4RB 1HMWA 1DI1A 3PYBA 5DGRA 4LZ0A 3S4BA 4NKEA 1RWHA 5B0JA 3V1VA 4LFEA 4LZCA 2Z78A 1N22A 3LGZB 3RYWA 1J0MA 1QSJA 2J5CA 4OKZA 3EU8A 2ZZRA 3W7XA 4NFIF 3BNXA 2IEJB 5ILZA 1GXNA 4WK5A 1XWQA 1L1YA 5B03A 3ICZA 3M73A 3PZ3B 4KTPA 2FV1A 3P8RA 1H3CA 4DZWA 2Q9ZA 3E73A 2BRVX 3AQ0A 1FBOA 1O79A 1DL2A 5GY3A 1N4SB 2AELA 1L2AA 3QXQA 5FOBB 2G02A 5B0MA 1HX9A 1YYUA 3SDTA 4NKFA 3SAEA 2F8ZF 3W5MA 1LF9A 4F10A 1WU5A 5C05A 1G9JA 2XWJB 3AFJA 1V4EA 3DYGA 3E80A 3TFVA 2E24A 2V3PA 4L6XA 4M76A 1H13A 1XWTA 4H5DF 4RXDA 2BEDB 5E8HA 3EZ3A 3NRIA 3N45F 1H14A 1H36A 4AYOA 3M7LA 3ICMA 1LOHA 2JG0A 2E8TA 3EFQA 2FV0A 2JF4A 3WCGA 3ACYA 4DHDA 1JCRB 1RWCA 2SQCA 3UCAA 3OACA 1H37A 5EATA 1QAZA 2D5JA 3CU7A 3WKIA 3SDRA 4LTZA 2V8KA 2F0YB 3QDEA 3WC3A 4D4AA 1I8QA 1HN0A 1QQFA 2GOXA 4WVCA 2ZEUA 2CQTA 1YYTA 3VSMA 4MMHA 5CZLA 3KRAA 3ASXA 3E7JA 3BNYA 3N5HF 1GLMA 1TN8B 5FO7B 3RMGA 2H6HB 1V4JA 1FAEA 2RI9A 4V1RA 4KTRA 5HNAA 2F9KF 1O6QA 1V7WA 3AE0A 5B0LA 2CQSA 1NL4B 2DRQA 3QSPA 2H6GB 4KKJA 1YJ4A 1X1IA 1F9OA 3KSLB 3Q79B 1KIZA 2F92F 1VG7A 3M74A 3W7UA 1KWFA 4MC8A 1QBQB 5B0KA 3ICKA 2F94F 1DGPA 3WCLA 3TS7A 1FO3A 3SFYB 3AFLA 5DW7A 3HXBB 3VJAA 2Z07A 1S63B 5A0JA 5CG6A 4L2XF 3WEIA 1X81B 4KVWA 5IK9A 3G4FA 1LF6A 1IA7A 3KRCB 5IKHA 1TF4A 3C72B 4GTPB 3X17A 5DJPF 1YYSA 3M76A 3LVSA 2ZCOA 2Q58A 3WEHA 4KVDA 4L9PB 1C3DA 3E30B 4YDOB 4RYPA 1UBVA 3WEFA 2E94A 3LSNA 4KUXA 2Z4ZA 1KS8A 2A8ZA 4PVYF 1SA4B 4KKIA 4LZ3A 4Q88A 3HXEB 1TNOB 4LXWA 4KQUA 2F8CF 2A73B 5JV2F 1KFGA 2P1CA 2Z4VA 5JUZF 1VG6A 1S64B 5JV1F 2RGKA 3W7WA 3N0GA 2E8XA 2OA6A 5DZ2A 2P0VA 3ANKA 3ANIA 1TN6B 2WIIB 3DSWB 4YDEB 3WCBA 3K7XA 1F1SA 5EASA 5IN8A 1AYXA 5DGMF 1H35A 1N95B 3LDWA 3CC9A 1ULVA 5IVGA 4LUUA 4ZG8A 2GZ6A 3QT9A 3ACTA 3LGKA 5DGSF 3QFZA 2Z4YA 4TXTA 4KFAA 1WU6A 1YYQA 3MZVA 2PS5A 3WCCA 2QISA 5IMNA 1JS4A 3Q7AB 3G6JB 2BRPA 2I07B 2QNOA 4KKMA 3WC9A 4LA6A 5FO8B 1TNBB 3LEEA 2J1PA 4ZRPA 3VJEA 4OK4A 5ILHA 1V5DA 4CE7A 5KSXF 3P8LA 4OZWA 3S9VA 3E6UA 2V8JA 5DIQF 1WMWA 1N7RA 3KROB 1WY0A 2PN5A 3QKCA 3LMDA 4JJJA 3WCFA 3IPIA 4KWDA 3SDVA 1WKZA 4EA0A 2RAHA 3DYFA 3QQVA 3LLWA 1K72A 3GLYA 1KSCA 3KSQB 3DSTB 1WL2A 1TNUB 4N1ZF 5JA0F 4EA1A 3M7BA 3WCDA 5JMFA 4H5EF 3KRCA 4OMGA 1DOGA 1KSDA 3V66A 3N46F 5ILKA 2WDAA 4FP4A 3TC1A 1H12A 3NFVA 5IM1A 4LFGA 4PVXF 1GAHA 3AQBB 4QPFA 4GA3A 3IBAA 1G9GA 3SDQA 3VJ9A 3WE9A 3DSSB 3A0OA 4RNQA 1YHLA 4NUAA 1O5MB 1V7XA 3QWTA 3M01A 5I1UA 4DOEA 3PZ2B 4XQSF 5ILDA 4AYQA 1GSZA 2E91A 4OMHA 4P0XA 3KRPB 2EAEA 3W7TA 5DJVF 1O1SB 4LNBB 1YV5A 3RYEA 1JCSB 3PMMA 1V7VA 2AEKA 3WEGA 5ILJA 2WCOA 1N7OA 4KVIA 2H8OA 2Z50A 1N9AB 1HCUA 3S4DA 4GTVB 2E90A 5B0IA 3EU5B 2F7MF 3N3DA 5B00A 2WINB 2WYNA 4GAXA 3KRFB 2FBAA 3ON6A 1AGMA 3VW5A 3N0FA 2ZBLA 3VJ8A 1N7QA 2FORA 2OKXA 1VD5A 3D5SA 1HXAA 3MAVA 5B02A 1JCQB 3H3KA 3PDEA 4Q2BA 3WJOA 1V4KA 3QRYA 3N1WF 1HM4A 3A3VA 3KB9A 1FMIA 3Q78B 3Q1OA 1X1JA 4UMJA 3M9UA 2XWBB 3WSBA 2YIKA 1VG4A 2VN4A 4MC3A 1FO2A 1GAIA 1V4IA 2F89F 3NPRA 1G87A 3QG0A 4AYRA 4OJZA 5GW7A 3KROA 1OJPA 1HM2A 1PS1A 3OABB 1J0NA 4JYXA 3T33A 1EGUA 3WKHA 3TFNA 3S4JA 3E33B 3Q2QA 4DI5A 3WKFA 5E2JA 4RXAA 3D3IA 3RSYA 4N9UA 4GTRB 4WVAA 2Z4WA 4LIXA 2PMVA 4ZRQA 4F6XA 3ZMCA 4MC0A 2BBCA 1OJMA 3DYHA 4DODA 1RWGA 4RXCA 3APZA 2ONHA 1RQ5A 4EHMB 2FUQA 4LA5A 3DSVB 3QPFA 1W6JA 3H7LA 3WIRA 4KQSA 1KZPB 4JXNA 1GXMA 1KIYA 3CKEA 4DWGA 1F9GA 3RRSA 4P0VA 4DWBA 1MZCB 4KQ5A 4F13A 3PZ1B 2FTZA 4LLTA 3W5NA 3DSUB 4XQTF 2VN7A 5ER8A 3Q2ZA 3NF2A 3AQCB 1YHMA 1H3AA 1OJNA 3OEDA 2ZCSA 3ADZA 5EROA 3SDUA 3E37B 5ERMA 1N94B 2OPNA 2PS8A 3KRFA 1HXCA 4P0WA 4J5TA 2BB6A 5HN9A 2F6DA 3ACSA 1H3BA 1VG2A 3B7LA 4GTOB 1YQ7A 1RW9A 3DPYB 5B01A 4LNGB 1H54A 2AFAA 5IMPA 3E34B 4GTSB 5DJRF 5H9DA 3LJIA 3WCJA 3ZL6A 3M0GA 3GZKA 4OZVA 4BOJA 1N1ZA 1H39A 3RX8A 2Z4XA 3W7FA 3WCAA 5IMIA 3SFXB 3M02A 2DROA 3ICNA 4CJ1A 5IK0A 2FUZA 3VJDA 1KKTA 3HXCB 1RQIA 2ZCRA 1HV6A 3OYRA 1O6RA 1O1RB 4OGUA 2H6FB 4JVJF 1N4QB 5DHKA 3OABA 1RTRA 5IKAA 3M7CA 2AHGA 1LXMA 3N6KF 4FXGB 4BOKA 3CP6A 4GP1A 2Q9YA 1IA6A 3ACWA 3KLSA 3NNBA 2Q1FA 3ID0A 4LNVA 1TNYB 4V1SA 3N5JF 1UBXA 3DRAB 4TF4A 2D8LA 2R2LB 4GP2A 3QFYA 1CEMA 4LPGF 4HD1A 1GHQA 5CD2A 2BRWA 3S4CA 3WIQA 2V3NA 5CG5A 3ZCDA 4D4DA 4OKMA 5E8KA 1LD7B 2EADA 4ONTA 3KBKA 4GTTB 4NFJF 3P5PA 5A0KA 3Q75B 4CJ0A 2JJBA 1WU4A 1YYRA 2FUTA 2WY8A 1HM7A 1UG9A 3RJ3A 3PKOA 1UMPA 3WIWA 4ZH1A 2ZY1A 4F6VA 4FXKB 2WY7A 4RXEA 1O6HA 3M72A 2Z7HA 5HN8A 4JZXA 3N3LF 1UBYA 4KK2A 4EL8A 1W3YA 3P2CA 2PS7A 3PYAA 5HN7A 1CLCA 1OJOA 5M7IA 2NVPA 1FT1B 2AETA 3NPKA 2Q80A 2NOJA 4FJQA 2DRRA 2AZKA 2ZCQA 1WL3A 4WVBA 3QT3A 3P5RA 1HMUA 3M71A 4QT9A 1X1HA 1V5CA 2I19A 1HM3A 1WL0A 2O1OA 2EABA 5AGDA 1DCEB 3RENA 4D4CA 4E9UA 4GTMB 3QXFA 1UBWA 4YCRA 4JZBA 2DRSA 3G4DA 3M7EA 2E8UA 4Z4JA 3Q30A 4K10A 3LG5A 4C1SA 1RWFA 4MU9A 3VSNA 3E32B 3VJBA 5JPNB 4H5CF 1FP3A 2RI8A 1HXGA 4NG6A 1IS9A 5ILIA 2ZIRB 2PS6A 1F9DA 3M75A 1VG3A 4MBGB 2DH4A 3M78A 3D5RA 3RX7A 2E22A 4WU0A 5CA3A 3LZ9A 1O1TB 2EWGA 4E9ZA 1W6KA 1FPPB 3LOMA 1XW2A 4NEIA 3TF4A 1LTXB 4ZH5A 2OGDA 3HXFB 2V8IA 3GT5A 3K11A 2H6IB 3H2WA 5FO9B 5DGNF 4OK2A 4KVYA 2G0DA 2ZEVA 5AELA 2B4FA 1X9DA 3WEJA 1LXKA 2AHFA 1GXOA 5AHUB 5M7YA 4MMIA 4Q23A 3RX5A 1FPSA 3WUXA 3TFPA 3WCHA 1TNZB 3VJCA 3ZMBA 1KZOB 1RWAA 2B39A 3LK5A 5JMDA 3VXDA 5ERNA 5E8LA 2E4OA 2AZJA 3PH7A 4GTQB 3OXUA 1LD8B 3EUVB 5EAUA 1KREA 2ONGA 3KRPA 1SA5B 2Z7IA 3ACXA 2X03A 2XFGA 1TN7B 3ANJA 2GH4A 4FUSA 1FBWA 3Q7FB 1GA2A 3V1XA 5A0IA 3SQCA 4D4BA 4LFVF 5IL8A 4F62A 3WKGA 2VF6A 2J1OA 4LTVA 1D8DB 3ZOUA 1N20A 3WJKA 1FCEA 1C82A 5IK6A 1N1BA 2E92A 3WCEA 4DXJA 2E95A 4KPDA 4JXYA 4DEMF 1KRFA 4NFKF 5DGQA 3EZ8A 3WSAA 1N23A 3N49F 4E1YA 4D94A 3WEKA 4KPJA 2Z52A
chains in the Genus database with same CATH topology
5ILYA 1JFGA 4XQRF 3RBMA 3WCMA 5AFXA 1WL1A 5IL3A 4ZQ8A 5AYPA 1N24A 1N21A 3N1VF 4LOBA 2E8VA 3OACB 5JV0F 3P41A 2PS4A 4QXSF 2OPMA 3EGTA 1JFAA 4LPHF 1RQJA 1ZW5A 2E8WA 2AZLA 2E93A 3M00A 3WCIA 3KRAB 3WJNA 5DHIA 1V4HA 1EZFA 1YHKA 4E1EA 4LLSA 4EA2A 1DI1A 3PYBA 4LZ0A 4NKEA 5B0JA 3V1VA 4LFEA 4LZCA 2Z78A 1N22A 3LGZB 3RYWA 2J5CA 4OKZA 4NFIF 3BNXA 5ILZA 4WK5A 5B03A 3ICZA 3P8RA 4DZWA 2Q9ZA 3AQ0A 2AELA 5B0MA 1HX9A 1YYUA 3SDTA 4NKFA 3SAEA 2F8ZF 5C05A 1V4EA 3DYGA 3TFVA 4H5DF 4RXDA 5E8HA 3EZ3A 3NRIA 3N45F 3ICMA 2E8TA 3EFQA 3WCGA 3ACYA 4DHDA 3UCAA 3OACA 5EATA 3SDRA 4LTZA 2ZEUA 1YYTA 3KRAA 3ASXA 3BNYA 3N5HF 3RMGA 1V4JA 5HNAA 2F9KF 3AE0A 5B0LA 1YJ4A 1KIZA 2F92F 1VG7A 4MC8A 5B0KA 3ICKA 2F94F 1DGPA 3WCLA 3TS7A 5DW7A 3VJAA 5A0JA 5CG6A 4L2XF 3WEIA 4KVWA 5IK9A 3G4FA 3KRCB 5IKHA 5DJPF 1YYSA 3LVSA 2ZCOA 2Q58A 3WEHA 4KVDA 4RYPA 1UBVA 3WEFA 2E94A 3LSNA 4KUXA 2Z4ZA 4PVYF 4LZ3A 4LXWA 4KQUA 2F8CF 5JV2F 2P1CA 2Z4VA 5JUZF 1VG6A 5JV1F 3N0GA 2E8XA 2OA6A 5DZ2A 3WCBA 5EASA 5IN8A 5DGMF 3LDWA 3CC9A 5IVGA 4LUUA 3LGKA 5DGSF 2Z4YA 4KFAA 1YYQA 3MZVA 2PS5A 3WCCA 2QISA 5IMNA 4KKMA 3WC9A 4LA6A 3LEEA 2J1PA 3VJEA 5ILHA 5KSXF 3P8LA 3S9VA 5DIQF 1WMWA 3KROB 1WY0A 3QKCA 3LMDA 3WCFA 3IPIA 4KWDA 3SDVA 1WKZA 4EA0A 2RAHA 3DYFA 3QQVA 3LLWA 1WL2A 4N1ZF 5JA0F 4EA1A 3WCDA 4H5EF 3KRCA 4OMGA 3V66A 3N46F 5ILKA 4FP4A 3TC1A 5IM1A 4LFGA 4PVXF 3AQBB 4QPFA 4GA3A 3IBAA 3SDQA 3VJ9A 3WE9A 4RNQA 1YHLA 4NUAA 3M01A 5I1UA 4XQSF 5ILDA 2E91A 4OMHA 4P0XA 3KRPB 5DJVF 1YV5A 3RYEA 2AEKA 3WEGA 5ILJA 4KVIA 2H8OA 2Z50A 2E90A 5B0IA 2F7MF 3N3DA 5B00A 4GAXA 3KRFB 3N0FA 3VJ8A 2FORA 1HXAA 3MAVA 5B02A 3PDEA 3WJOA 1V4KA 3N1WF 1HM4A 3KB9A 3Q1OA 4UMJA 3M9UA 3WSBA 1VG4A 4MC3A 1V4IA 2F89F 3NPRA 3KROA 1PS1A 3OABB 4JYXA 3TFNA 3S4JA 3Q2QA 4DI5A 4RXAA 4N9UA 2Z4WA 4LIXA 4F6XA 3ZMCA 4MC0A 3DYHA 4RXCA 3APZA 2ONHA 4LA5A 4KQSA 4JXNA 1KIYA 3CKEA 4DWGA 4P0VA 4DWBA 4KQ5A 2FTZA 4LLTA 4XQTF 5ER8A 3Q2ZA 3NF2A 3AQCB 1YHMA 2ZCSA 3ADZA 5EROA 3SDUA 5ERMA 2OPNA 2PS8A 3KRFA 1HXCA 4P0WA 5HN9A 1VG2A 3B7LA 1YQ7A 5B01A 5IMPA 5DJRF 5H9DA 3LJIA 3WCJA 3ZL6A 3M0GA 1N1ZA 2Z4XA 3W7FA 3WCAA 5IMIA 3M02A 3ICNA 5IK0A 3VJDA 1RQIA 2ZCRA 3OYRA 4OGUA 4JVJF 5DHKA 3OABA 1RTRA 5IKAA 3N6KF 3CP6A 4GP1A 2Q9YA 3ACWA 3ID0A 3N5JF 1UBXA 4GP2A 4LPGF 4HD1A 5CG5A 3ZCDA 4OKMA 5E8KA 3KBKA 4NFJF 3P5PA 5A0KA 1YYRA 1HM7A 3PKOA 2ZY1A 4F6VA 4RXEA 2Z7HA 5HN8A 4JZXA 3N3LF 1UBYA 4KK2A 2PS7A 3PYAA 5HN7A 2AETA 3NPKA 2Q80A 4FJQA 2AZKA 2ZCQA 1WL3A 3P5RA 2I19A 1WL0A 2O1OA 4E9UA 1UBWA 4JZBA 3G4DA 2E8UA 3Q30A 4K10A 3LG5A 3VJBA 4H5CF 1HXGA 4NG6A 5ILIA 2PS6A 1VG3A 2DH4A 3LZ9A 2EWGA 4E9ZA 3LOMA 2OGDA 5DGNF 4KVYA 2ZEVA 5AELA 3WEJA 5AHUB 4Q23A 1FPSA 3TFPA 3WCHA 3VJCA 3ZMBA 3LK5A 5ERNA 5E8LA 2E4OA 2AZJA 3PH7A 5EAUA 2ONGA 3KRPA 2Z7IA 3ACXA 3V1XA 5A0IA 4LFVF 5IL8A 4F62A 2VF6A 2J1OA 4LTVA 3ZOUA 1N20A 3WJKA 5IK6A 1N1BA 2E92A 3WCEA 4DXJA 2E95A 4KPDA 4JXYA 4DEMF 4NFKF 3WSAA 1N23A 3N49F 3WEKA 4KPJA 2Z52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILY A;  1JFG A;  4XQR F;  3RBM A;  3WCM A;  5AFX A;  1WL1 A;  5IL3 A;  4ZQ8 A;  5AYP A;  1N24 A;  1N21 A;  3N1V F;  4LOB A;  2E8V A;  3OAC B;  5JV0 F;  3P41 A;  2PS4 A;  4QXS F;  2OPM A;  3EGT A;  1JFA A;  4LPH F;  1RQJ A;  1ZW5 A;  2E8W A;  2AZL A;  2E93 A;  3M00 A;  3WCI A;  3KRA B;  3WJN A;  5DHI A;  1V4H A;  1EZF A;  1YHK A;  4E1E A;  4LLS A;  4EA2 A;  1DI1 A;  3PYB A;  4LZ0 A;  4NKE A;  5B0J A;  3V1V A;  4LFE A;  4LZC A;  2Z78 A;  1N22 A;  3LGZ B;  3RYW A;  2J5C A;  4OKZ A;  4NFI F;  3BNX A;  5ILZ A;  4WK5 A;  5B03 A;  3ICZ A;  3P8R A;  4DZW A;  2Q9Z A;  3AQ0 A;  2AEL A;  5B0M A;  1HX9 A;  1YYU A;  3SDT A;  4NKF A;  3SAE A;  2F8Z F;  5C05 A;  1V4E A;  3DYG A;  3TFV A;  4H5D F;  4RXD A;  5E8H A;  3EZ3 A;  3NRI A;  3N45 F;  3ICM A;  2E8T A;  3EFQ A;  3WCG A;  3ACY A;  4DHD A;  3UCA A;  3OAC A;  5EAT A;  3SDR A;  4LTZ A;  2ZEU A;  1YYT A;  3KRA A;  3ASX A;  3BNY A;  3N5H F;  3RMG A;  1V4J A;  5HNA A;  2F9K F;  3AE0 A;  5B0L A;  1YJ4 A;  1KIZ A;  2F92 F;  1VG7 A;  4MC8 A;  5B0K A;  3ICK A;  2F94 F;  1DGP A;  3WCL A;  3TS7 A;  5DW7 A;  3VJA A;  5A0J A;  5CG6 A;  4L2X F;  3WEI A;  4KVW A;  5IK9 A;  3G4F A;  3KRC B;  5IKH A;  5DJP F;  1YYS A;  3LVS A;  2ZCO A;  2Q58 A;  3WEH A;  4KVD A;  4RYP A;  1UBV A;  3WEF A;  2E94 A;  3LSN A;  4KUX A;  2Z4Z A;  4PVY F;  4LZ3 A;  4LXW A;  4KQU A;  2F8C F;  5JV2 F;  2P1C A;  2Z4V A;  5JUZ F;  1VG6 A;  5JV1 F;  3N0G A;  2E8X A;  2OA6 A;  5DZ2 A;  3WCB A;  5EAS A;  5IN8 A;  5DGM F;  3LDW A;  3CC9 A;  5IVG A;  4LUU A;  3LGK A;  5DGS F;  2Z4Y A;  4KFA A;  1YYQ A;  3MZV A;  2PS5 A;  3WCC A;  2QIS A;  5IMN A;  4KKM A;  3WC9 A;  4LA6 A;  3LEE A;  2J1P A;  3VJE A;  5ILH A;  5KSX F;  3P8L A;  3S9V A;  5DIQ F;  1WMW A;  3KRO B;  1WY0 A;  3QKC A;  3LMD A;  3WCF A;  3IPI A;  4KWD A;  3SDV A;  1WKZ A;  4EA0 A;  2RAH A;  3DYF A;  3QQV A;  3LLW A;  1WL2 A;  4N1Z F;  5JA0 F;  4EA1 A;  3WCD A;  4H5E F;  3KRC A;  4OMG A;  3V66 A;  3N46 F;  5ILK A;  4FP4 A;  3TC1 A;  5IM1 A;  4LFG A;  4PVX F;  3AQB B;  4QPF A;  4GA3 A;  3IBA A;  3SDQ A;  3VJ9 A;  3WE9 A;  4RNQ A;  1YHL A;  4NUA A;  3M01 A;  5I1U A;  4XQS F;  5ILD A;  2E91 A;  4OMH A;  4P0X A;  3KRP B;  5DJV F;  1YV5 A;  3RYE A;  2AEK A;  3WEG A;  5ILJ A;  4KVI A;  2H8O A;  2Z50 A;  2E90 A;  5B0I A;  2F7M F;  3N3D A;  5B00 A;  4GAX A;  3KRF B;  3N0F A;  3VJ8 A;  2FOR A;  1HXA A;  3MAV A;  5B02 A;  3PDE A;  3WJO A;  1V4K A;  3N1W F;  1HM4 A;  3KB9 A;  3Q1O A;  4UMJ A;  3M9U A;  3WSB A;  1VG4 A;  4MC3 A;  1V4I A;  2F89 F;  3NPR A;  3KRO A;  1PS1 A;  3OAB B;  4JYX A;  3TFN A;  3S4J A;  3Q2Q A;  4DI5 A;  4RXA A;  4N9U A;  2Z4W A;  4LIX A;  4F6X A;  3ZMC A;  4MC0 A;  3DYH A;  4RXC A;  3APZ A;  2ONH A;  4LA5 A;  4KQS A;  4JXN A;  1KIY A;  3CKE A;  4DWG A;  4P0V A;  4DWB A;  4KQ5 A;  2FTZ A;  4LLT A;  4XQT F;  5ER8 A;  3Q2Z A;  3NF2 A;  3AQC B;  1YHM A;  2ZCS A;  3ADZ A;  5ERO A;  3SDU A;  5ERM A;  2OPN A;  2PS8 A;  3KRF A;  1HXC A;  4P0W A;  5HN9 A;  1VG2 A;  3B7L A;  1YQ7 A;  5B01 A;  5IMP A;  5DJR F;  5H9D A;  3LJI A;  3WCJ A;  3ZL6 A;  3M0G A;  1N1Z A;  2Z4X A;  3W7F A;  3WCA A;  5IMI A;  3M02 A;  3ICN A;  5IK0 A;  3VJD A;  1RQI A;  2ZCR A;  3OYR A;  4OGU A;  4JVJ F;  5DHK A;  3OAB A;  1RTR A;  5IKA A;  3N6K F;  3CP6 A;  4GP1 A;  2Q9Y A;  3ACW A;  3ID0 A;  3N5J F;  1UBX A;  4GP2 A;  4LPG F;  4HD1 A;  5CG5 A;  3ZCD A;  4OKM A;  5E8K A;  3KBK A;  4NFJ F;  3P5P A;  5A0K A;  1YYR A;  1HM7 A;  3PKO A;  2ZY1 A;  4F6V A;  4RXE A;  2Z7H A;  5HN8 A;  4JZX A;  3N3L F;  1UBY A;  4KK2 A;  2PS7 A;  3PYA A;  5HN7 A;  2AET A;  3NPK A;  2Q80 A;  4FJQ A;  2AZK A;  2ZCQ A;  1WL3 A;  3P5R A;  2I19 A;  1WL0 A;  2O1O A;  4E9U A;  1UBW A;  4JZB A;  3G4D A;  2E8U A;  3Q30 A;  4K10 A;  3LG5 A;  3VJB A;  4H5C F;  1HXG A;  4NG6 A;  5ILI A;  2PS6 A;  1VG3 A;  2DH4 A;  3LZ9 A;  2EWG A;  4E9Z A;  3LOM A;  2OGD A;  5DGN F;  4KVY A;  2ZEV A;  5AEL A;  3WEJ A;  5AHU B;  4Q23 A;  1FPS A;  3TFP A;  3WCH A;  3VJC A;  3ZMB A;  3LK5 A;  5ERN A;  5E8L A;  2E4O A;  2AZJ A;  3PH7 A;  5EAU A;  2ONG A;  3KRP A;  2Z7I A;  3ACX A;  3V1X A;  5A0I A;  4LFV F;  5IL8 A;  4F62 A;  2VF6 A;  2J1O A;  4LTV A;  3ZOU A;  1N20 A;  3WJK A;  5IK6 A;  1N1B A;  2E92 A;  3WCE A;  4DXJ A;  2E95 A;  4KPD A;  4JXY A;  4DEM F;  4NFK F;  3WSA A;  1N23 A;  3N49 F;  3WEK A;  4KPJ A;  2Z52 A; 
#chains in the Genus database with same CATH topology
 4L0G A;  2EAC A;  1N7N A;  1NC5 A;  3S4A A;  1CB8 A;  4AYP A;  3DSX B;  5ILY A;  5JPM B;  1JFG A;  4XQR F;  3RBM A;  3HXD B;  3WCM A;  1FT2 B;  1HZF A;  5AFX A;  1WL1 A;  5IL3 A;  4GL3 A;  4ZQ8 A;  5AYP A;  1R76 A;  1N24 A;  1N21 A;  3N1V F;  4FNV A;  1D8E B;  1NI1 B;  4LOB A;  3EQA A;  2E8V A;  3OAC B;  5JV0 F;  3P41 A;  2PS4 A;  1SQC A;  3W7S A;  1WZZ A;  4QXS F;  2OPM A;  3EGT A;  3M77 A;  1JFA A;  3CIH A;  4XUV A;  4Z4L A;  1NXC A;  4LPH F;  1UT9 A;  1RQJ A;  3PZ4 B;  1ZW5 A;  2E8W A;  2AZL A;  2E93 A;  3M00 A;  5GZK A;  3WCI A;  3KRA B;  1N7P A;  3WJN A;  2XQW A;  1G6I A;  2ZIS B;  3KQ4 A;  5MEH A;  3Q73 B;  2BB5 A;  5DHI A;  1V4H A;  1EZF A;  1YHK A;  4E1E A;  4LLS A;  4EA2 A;  5KKB A;  1N4P B;  1N4R B;  1HMW A;  1DI1 A;  3PYB A;  5DGR A;  4LZ0 A;  3S4B A;  4NKE A;  1RWH A;  5B0J A;  3V1V A;  4LFE A;  4LZC A;  2Z78 A;  1N22 A;  3LGZ B;  3RYW A;  1J0M A;  1QSJ A;  2J5C A;  4OKZ A;  3EU8 A;  2ZZR A;  3W7X A;  4NFI F;  3BNX A;  2IEJ B;  5ILZ A;  1GXN A;  4WK5 A;  1XWQ A;  1L1Y A;  5B03 A;  3ICZ A;  3M73 A;  3PZ3 B;  4KTP A;  2FV1 A;  3P8R A;  1H3C A;  4DZW A;  2Q9Z A;  3E73 A;  2BRV X;  3AQ0 A;  1FBO A;  1O79 A;  1DL2 A;  5GY3 A;  1N4S B;  2AEL A;  1L2A A;  3QXQ A;  5FOB B;  2G02 A;  5B0M A;  1HX9 A;  1YYU A;  3SDT A;  4NKF A;  3SAE A;  2F8Z F;  3W5M A;  1LF9 A;  4F10 A;  1WU5 A;  5C05 A;  1G9J A;  2XWJ B;  3AFJ A;  1V4E A;  3DYG A;  3E80 A;  3TFV A;  2E24 A;  2V3P A;  4L6X A;  4M76 A;  1H13 A;  1XWT A;  4H5D F;  4RXD A;  2BED B;  5E8H A;  3EZ3 A;  3NRI A;  3N45 F;  1H14 A;  1H36 A;  4AYO A;  3M7L A;  3ICM A;  1LOH A;  2JG0 A;  2E8T A;  3EFQ A;  2FV0 A;  2JF4 A;  3WCG A;  3ACY A;  4DHD A;  1JCR B;  1RWC A;  2SQC A;  3UCA A;  3OAC A;  1H37 A;  5EAT A;  1QAZ A;  2D5J A;  3CU7 A;  3WKI A;  3SDR A;  4LTZ A;  2V8K A;  2F0Y B;  3QDE A;  3WC3 A;  4D4A A;  1I8Q A;  1HN0 A;  1QQF A;  2GOX A;  4WVC A;  2ZEU A;  2CQT A;  1YYT A;  3VSM A;  4MMH A;  5CZL A;  3KRA A;  3ASX A;  3E7J A;  3BNY A;  3N5H F;  1GLM A;  1TN8 B;  5FO7 B;  3RMG A;  2H6H B;  1V4J A;  1FAE A;  2RI9 A;  4V1R A;  4KTR A;  5HNA A;  2F9K F;  1O6Q A;  1V7W A;  3AE0 A;  5B0L A;  2CQS A;  1NL4 B;  2DRQ A;  3QSP A;  2H6G B;  4KKJ A;  1YJ4 A;  1X1I A;  1F9O A;  3KSL B;  3Q79 B;  1KIZ A;  2F92 F;  1VG7 A;  3M74 A;  3W7U A;  1KWF A;  4MC8 A;  1QBQ B;  5B0K A;  3ICK A;  2F94 F;  1DGP A;  3WCL A;  3TS7 A;  1FO3 A;  3SFY B;  3AFL A;  5DW7 A;  3HXB B;  3VJA A;  2Z07 A;  1S63 B;  5A0J A;  5CG6 A;  4L2X F;  3WEI A;  1X81 B;  4KVW A;  5IK9 A;  3G4F A;  1LF6 A;  1IA7 A;  3KRC B;  5IKH A;  1TF4 A;  3C72 B;  4GTP B;  3X17 A;  5DJP F;  1YYS A;  3M76 A;  3LVS A;  2ZCO A;  2Q58 A;  3WEH A;  4KVD A;  4L9P B;  1C3D A;  3E30 B;  4YDO B;  4RYP A;  1UBV A;  3WEF A;  2E94 A;  3LSN A;  4KUX A;  2Z4Z A;  1KS8 A;  2A8Z A;  4PVY F;  1SA4 B;  4KKI A;  4LZ3 A;  4Q88 A;  3HXE B;  1TNO B;  4LXW A;  4KQU A;  2F8C F;  2A73 B;  5JV2 F;  1KFG A;  2P1C A;  2Z4V A;  5JUZ F;  1VG6 A;  1S64 B;  5JV1 F;  2RGK A;  3W7W A;  3N0G A;  2E8X A;  2OA6 A;  5DZ2 A;  2P0V A;  3ANK A;  3ANI A;  1TN6 B;  2WII B;  3DSW B;  4YDE B;  3WCB A;  3K7X A;  1F1S A;  5EAS A;  5IN8 A;  1AYX A;  5DGM F;  1H35 A;  1N95 B;  3LDW A;  3CC9 A;  1ULV A;  5IVG A;  4LUU A;  4ZG8 A;  2GZ6 A;  3QT9 A;  3ACT A;  3LGK A;  5DGS F;  3QFZ A;  2Z4Y A;  4TXT A;  4KFA A;  1WU6 A;  1YYQ A;  3MZV A;  2PS5 A;  3WCC A;  2QIS A;  5IMN A;  1JS4 A;  3Q7A B;  3G6J B;  2BRP A;  2I07 B;  2QNO A;  4KKM A;  3WC9 A;  4LA6 A;  5FO8 B;  1TNB B;  3LEE A;  2J1P A;  4ZRP A;  3VJE A;  4OK4 A;  5ILH A;  1V5D A;  4CE7 A;  5KSX F;  3P8L A;  4OZW A;  3S9V A;  3E6U A;  2V8J A;  5DIQ F;  1WMW A;  1N7R A;  3KRO B;  1WY0 A;  2PN5 A;  3QKC A;  3LMD A;  4JJJ A;  3WCF A;  3IPI A;  4KWD A;  3SDV A;  1WKZ A;  4EA0 A;  2RAH A;  3DYF A;  3QQV A;  3LLW A;  1K72 A;  3GLY A;  1KSC A;  3KSQ B;  3DST B;  1WL2 A;  1TNU B;  4N1Z F;  5JA0 F;  4EA1 A;  3M7B A;  3WCD A;  5JMF A;  4H5E F;  3KRC A;  4OMG A;  1DOG A;  1KSD A;  3V66 A;  3N46 F;  5ILK A;  2WDA A;  4FP4 A;  3TC1 A;  1H12 A;  3NFV A;  5IM1 A;  4LFG A;  4PVX F;  1GAH A;  3AQB B;  4QPF A;  4GA3 A;  3IBA A;  1G9G A;  3SDQ A;  3VJ9 A;  3WE9 A;  3DSS B;  3A0O A;  4RNQ A;  1YHL A;  4NUA A;  1O5M B;  1V7X A;  3QWT A;  3M01 A;  5I1U A;  4DOE A;  3PZ2 B;  4XQS F;  5ILD A;  4AYQ A;  1GSZ A;  2E91 A;  4OMH A;  4P0X A;  3KRP B;  2EAE A;  3W7T A;  5DJV F;  1O1S B;  4LNB B;  1YV5 A;  3RYE A;  1JCS B;  3PMM A;  1V7V A;  2AEK A;  3WEG A;  5ILJ A;  2WCO A;  1N7O A;  4KVI A;  2H8O A;  2Z50 A;  1N9A B;  1HCU A;  3S4D A;  4GTV B;  2E90 A;  5B0I A;  3EU5 B;  2F7M F;  3N3D A;  5B00 A;  2WIN B;  2WYN A;  4GAX A;  3KRF B;  2FBA A;  3ON6 A;  1AGM A;  3VW5 A;  3N0F A;  2ZBL A;  3VJ8 A;  1N7Q A;  2FOR A;  2OKX A;  1VD5 A;  3D5S A;  1HXA A;  3MAV A;  5B02 A;  1JCQ B;  3H3K A;  3PDE A;  4Q2B A;  3WJO A;  1V4K A;  3QRY A;  3N1W F;  1HM4 A;  3A3V A;  3KB9 A;  1FMI A;  3Q78 B;  3Q1O A;  1X1J A;  4UMJ A;  3M9U A;  2XWB B;  3WSB A;  2YIK A;  1VG4 A;  2VN4 A;  4MC3 A;  1FO2 A;  1GAI A;  1V4I A;  2F89 F;  3NPR A;  1G87 A;  3QG0 A;  4AYR A;  4OJZ A;  5GW7 A;  3KRO A;  1OJP A;  1HM2 A;  1PS1 A;  3OAB B;  1J0N A;  4JYX A;  3T33 A;  1EGU A;  3WKH A;  3TFN A;  3S4J A;  3E33 B;  3Q2Q A;  4DI5 A;  3WKF A;  5E2J A;  4RXA A;  3D3I A;  3RSY A;  4N9U A;  4GTR B;  4WVA A;  2Z4W A;  4LIX A;  2PMV A;  4ZRQ A;  4F6X A;  3ZMC A;  4MC0 A;  2BBC A;  1OJM A;  3DYH A;  4DOD A;  1RWG A;  4RXC A;  3APZ A;  2ONH A;  1RQ5 A;  4EHM B;  2FUQ A;  4LA5 A;  3DSV B;  3QPF A;  1W6J A;  3H7L A;  3WIR A;  4KQS A;  1KZP B;  4JXN A;  1GXM A;  1KIY A;  3CKE A;  4DWG A;  1F9G A;  3RRS A;  4P0V A;  4DWB A;  1MZC B;  4KQ5 A;  4F13 A;  3PZ1 B;  2FTZ A;  4LLT A;  3W5N A;  3DSU B;  4XQT F;  2VN7 A;  5ER8 A;  3Q2Z A;  3NF2 A;  3AQC B;  1YHM A;  1H3A A;  1OJN A;  3OED A;  2ZCS A;  3ADZ A;  5ERO A;  3SDU A;  3E37 B;  5ERM A;  1N94 B;  2OPN A;  2PS8 A;  3KRF A;  1HXC A;  4P0W A;  4J5T A;  2BB6 A;  5HN9 A;  2F6D A;  3ACS A;  1H3B A;  1VG2 A;  3B7L A;  4GTO B;  1YQ7 A;  1RW9 A;  3DPY B;  5B01 A;  4LNG B;  1H54 A;  2AFA A;  5IMP A;  3E34 B;  4GTS B;  5DJR F;  5H9D A;  3LJI A;  3WCJ A;  3ZL6 A;  3M0G A;  3GZK A;  4OZV A;  4BOJ A;  1N1Z A;  1H39 A;  3RX8 A;  2Z4X A;  3W7F A;  3WCA A;  5IMI A;  3SFX B;  3M02 A;  2DRO A;  3ICN A;  4CJ1 A;  5IK0 A;  2FUZ A;  3VJD A;  1KKT A;  3HXC B;  1RQI A;  2ZCR A;  1HV6 A;  3OYR A;  1O6R A;  1O1R B;  4OGU A;  2H6F B;  4JVJ F;  1N4Q B;  5DHK A;  3OAB A;  1RTR A;  5IKA A;  3M7C A;  2AHG A;  1LXM A;  3N6K F;  4FXG B;  4BOK A;  3CP6 A;  4GP1 A;  2Q9Y A;  1IA6 A;  3ACW A;  3KLS A;  3NNB A;  2Q1F A;  3ID0 A;  4LNV A;  1TNY B;  4V1S A;  3N5J F;  1UBX A;  3DRA B;  4TF4 A;  2D8L A;  2R2L B;  4GP2 A;  3QFY A;  1CEM A;  4LPG F;  4HD1 A;  1GHQ A;  5CD2 A;  2BRW A;  3S4C A;  3WIQ A;  2V3N A;  5CG5 A;  3ZCD A;  4D4D A;  4OKM A;  5E8K A;  1LD7 B;  2EAD A;  4ONT A;  3KBK A;  4GTT B;  4NFJ F;  3P5P A;  5A0K A;  3Q75 B;  4CJ0 A;  2JJB A;  1WU4 A;  1YYR A;  2FUT A;  2WY8 A;  1HM7 A;  1UG9 A;  3RJ3 A;  3PKO A;  1UMP A;  3WIW A;  4ZH1 A;  2ZY1 A;  4F6V A;  4FXK B;  2WY7 A;  4RXE A;  1O6H A;  3M72 A;  2Z7H A;  5HN8 A;  4JZX A;  3N3L F;  1UBY A;  4KK2 A;  4EL8 A;  1W3Y A;  3P2C A;  2PS7 A;  3PYA A;  5HN7 A;  1CLC A;  1OJO A;  5M7I A;  2NVP A;  1FT1 B;  2AET A;  3NPK A;  2Q80 A;  2NOJ A;  4FJQ A;  2DRR A;  2AZK A;  2ZCQ A;  1WL3 A;  4WVB A;  3QT3 A;  3P5R A;  1HMU A;  3M71 A;  4QT9 A;  1X1H A;  1V5C A;  2I19 A;  1HM3 A;  1WL0 A;  2O1O A;  2EAB A;  5AGD A;  1DCE B;  3REN A;  4D4C A;  4E9U A;  4GTM B;  3QXF A;  1UBW A;  4YCR A;  4JZB A;  2DRS A;  3G4D A;  3M7E A;  2E8U A;  4Z4J A;  3Q30 A;  4K10 A;  3LG5 A;  4C1S A;  1RWF A;  4MU9 A;  3VSN A;  3E32 B;  3VJB A;  5JPN B;  4H5C F;  1FP3 A;  2RI8 A;  1HXG A;  4NG6 A;  1IS9 A;  5ILI A;  2ZIR B;  2PS6 A;  1F9D A;  3M75 A;  1VG3 A;  4MBG B;  2DH4 A;  3M78 A;  3D5R A;  3RX7 A;  2E22 A;  4WU0 A;  5CA3 A;  3LZ9 A;  1O1T B;  2EWG A;  4E9Z A;  1W6K A;  1FPP B;  3LOM A;  1XW2 A;  4NEI A;  3TF4 A;  1LTX B;  4ZH5 A;  2OGD A;  3HXF B;  2V8I A;  3GT5 A;  3K11 A;  2H6I B;  3H2W A;  5FO9 B;  5DGN F;  4OK2 A;  4KVY A;  2G0D A;  2ZEV A;  5AEL A;  2B4F A;  1X9D A;  3WEJ A;  1LXK A;  2AHF A;  1GXO A;  5AHU B;  5M7Y A;  4MMI A;  4Q23 A;  3RX5 A;  1FPS A;  3WUX A;  3TFP A;  3WCH A;  1TNZ B;  3VJC A;  3ZMB A;  1KZO B;  1RWA A;  2B39 A;  3LK5 A;  5JMD A;  3VXD A;  5ERN A;  5E8L A;  2E4O A;  2AZJ A;  3PH7 A;  4GTQ B;  3OXU A;  1LD8 B;  3EUV B;  5EAU A;  1KRE A;  2ONG A;  3KRP A;  1SA5 B;  2Z7I A;  3ACX A;  2X03 A;  2XFG A;  1TN7 B;  3ANJ A;  2GH4 A;  4FUS A;  1FBW A;  3Q7F B;  1GA2 A;  3V1X A;  5A0I A;  3SQC A;  4D4B A;  4LFV F;  5IL8 A;  4F62 A;  3WKG A;  2VF6 A;  2J1O A;  4LTV A;  1D8D B;  3ZOU A;  1N20 A;  3WJK A;  1FCE A;  1C82 A;  5IK6 A;  1N1B A;  2E92 A;  3WCE A;  4DXJ A;  2E95 A;  4KPD A;  4JXY A;  4DEM F;  1KRF A;  4NFK F;  5DGQ A;  3EZ8 A;  3WSA A;  1N23 A;  3N49 F;  4E1Y A;  4D94 A;  3WEK A;  4KPJ A;  2Z52 A; 
#chains in the Genus database with same CATH homology
 5ILY A;  1JFG A;  4XQR F;  3RBM A;  3WCM A;  5AFX A;  1WL1 A;  5IL3 A;  4ZQ8 A;  5AYP A;  1N24 A;  1N21 A;  3N1V F;  4LOB A;  2E8V A;  3OAC B;  5JV0 F;  3P41 A;  2PS4 A;  4QXS F;  2OPM A;  3EGT A;  1JFA A;  4LPH F;  1RQJ A;  1ZW5 A;  2E8W A;  2AZL A;  2E93 A;  3M00 A;  3WCI A;  3KRA B;  3WJN A;  5DHI A;  1V4H A;  1EZF A;  1YHK A;  4E1E A;  4LLS A;  4EA2 A;  1DI1 A;  3PYB A;  4LZ0 A;  4NKE A;  5B0J A;  3V1V A;  4LFE A;  4LZC A;  2Z78 A;  1N22 A;  3LGZ B;  3RYW A;  2J5C A;  4OKZ A;  4NFI F;  3BNX A;  5ILZ A;  4WK5 A;  5B03 A;  3ICZ A;  3P8R A;  4DZW A;  2Q9Z A;  3AQ0 A;  2AEL A;  5B0M A;  1HX9 A;  1YYU A;  3SDT A;  4NKF A;  3SAE A;  2F8Z F;  5C05 A;  1V4E A;  3DYG A;  3TFV A;  4H5D F;  4RXD A;  5E8H A;  3EZ3 A;  3NRI A;  3N45 F;  3ICM A;  2E8T A;  3EFQ A;  3WCG A;  3ACY A;  4DHD A;  3UCA A;  3OAC A;  5EAT A;  3SDR A;  4LTZ A;  2ZEU A;  1YYT A;  3KRA A;  3ASX A;  3BNY A;  3N5H F;  3RMG A;  1V4J A;  5HNA A;  2F9K F;  3AE0 A;  5B0L A;  1YJ4 A;  1KIZ A;  2F92 F;  1VG7 A;  4MC8 A;  5B0K A;  3ICK A;  2F94 F;  1DGP A;  3WCL A;  3TS7 A;  5DW7 A;  3VJA A;  5A0J A;  5CG6 A;  4L2X F;  3WEI A;  4KVW A;  5IK9 A;  3G4F A;  3KRC B;  5IKH A;  5DJP F;  1YYS A;  3LVS A;  2ZCO A;  2Q58 A;  3WEH A;  4KVD A;  4RYP A;  1UBV A;  3WEF A;  2E94 A;  3LSN A;  4KUX A;  2Z4Z A;  4PVY F;  4LZ3 A;  4LXW A;  4KQU A;  2F8C F;  5JV2 F;  2P1C A;  2Z4V A;  5JUZ F;  1VG6 A;  5JV1 F;  3N0G A;  2E8X A;  2OA6 A;  5DZ2 A;  3WCB A;  5EAS A;  5IN8 A;  5DGM F;  3LDW A;  3CC9 A;  5IVG A;  4LUU A;  3LGK A;  5DGS F;  2Z4Y A;  4KFA A;  1YYQ A;  3MZV A;  2PS5 A;  3WCC A;  2QIS A;  5IMN A;  4KKM A;  3WC9 A;  4LA6 A;  3LEE A;  2J1P A;  3VJE A;  5ILH A;  5KSX F;  3P8L A;  3S9V A;  5DIQ F;  1WMW A;  3KRO B;  1WY0 A;  3QKC A;  3LMD A;  3WCF A;  3IPI A;  4KWD A;  3SDV A;  1WKZ A;  4EA0 A;  2RAH A;  3DYF A;  3QQV A;  3LLW A;  1WL2 A;  4N1Z F;  5JA0 F;  4EA1 A;  3WCD A;  4H5E F;  3KRC A;  4OMG A;  3V66 A;  3N46 F;  5ILK A;  4FP4 A;  3TC1 A;  5IM1 A;  4LFG A;  4PVX F;  3AQB B;  4QPF A;  4GA3 A;  3IBA A;  3SDQ A;  3VJ9 A;  3WE9 A;  4RNQ A;  1YHL A;  4NUA A;  3M01 A;  5I1U A;  4XQS F;  5ILD A;  2E91 A;  4OMH A;  4P0X A;  3KRP B;  5DJV F;  1YV5 A;  3RYE A;  2AEK A;  3WEG A;  5ILJ A;  4KVI A;  2H8O A;  2Z50 A;  2E90 A;  5B0I A;  2F7M F;  3N3D A;  5B00 A;  4GAX A;  3KRF B;  3N0F A;  3VJ8 A;  2FOR A;  1HXA A;  3MAV A;  5B02 A;  3PDE A;  3WJO A;  1V4K A;  3N1W F;  1HM4 A;  3KB9 A;  3Q1O A;  4UMJ A;  3M9U A;  3WSB A;  1VG4 A;  4MC3 A;  1V4I A;  2F89 F;  3NPR A;  3KRO A;  1PS1 A;  3OAB B;  4JYX A;  3TFN A;  3S4J A;  3Q2Q A;  4DI5 A;  4RXA A;  4N9U A;  2Z4W A;  4LIX A;  4F6X A;  3ZMC A;  4MC0 A;  3DYH A;  4RXC A;  3APZ A;  2ONH A;  4LA5 A;  4KQS A;  4JXN A;  1KIY A;  3CKE A;  4DWG A;  4P0V A;  4DWB A;  4KQ5 A;  2FTZ A;  4LLT A;  4XQT F;  5ER8 A;  3Q2Z A;  3NF2 A;  3AQC B;  1YHM A;  2ZCS A;  3ADZ A;  5ERO A;  3SDU A;  5ERM A;  2OPN A;  2PS8 A;  3KRF A;  1HXC A;  4P0W A;  5HN9 A;  1VG2 A;  3B7L A;  1YQ7 A;  5B01 A;  5IMP A;  5DJR F;  5H9D A;  3LJI A;  3WCJ A;  3ZL6 A;  3M0G A;  1N1Z A;  2Z4X A;  3W7F A;  3WCA A;  5IMI A;  3M02 A;  3ICN A;  5IK0 A;  3VJD A;  1RQI A;  2ZCR A;  3OYR A;  4OGU A;  4JVJ F;  5DHK A;  3OAB A;  1RTR A;  5IKA A;  3N6K F;  3CP6 A;  4GP1 A;  2Q9Y A;  3ACW A;  3ID0 A;  3N5J F;  1UBX A;  4GP2 A;  4LPG F;  4HD1 A;  5CG5 A;  3ZCD A;  4OKM A;  5E8K A;  3KBK A;  4NFJ F;  3P5P A;  5A0K A;  1YYR A;  1HM7 A;  3PKO A;  2ZY1 A;  4F6V A;  4RXE A;  2Z7H A;  5HN8 A;  4JZX A;  3N3L F;  1UBY A;  4KK2 A;  2PS7 A;  3PYA A;  5HN7 A;  2AET A;  3NPK A;  2Q80 A;  4FJQ A;  2AZK A;  2ZCQ A;  1WL3 A;  3P5R A;  2I19 A;  1WL0 A;  2O1O A;  4E9U A;  1UBW A;  4JZB A;  3G4D A;  2E8U A;  3Q30 A;  4K10 A;  3LG5 A;  3VJB A;  4H5C F;  1HXG A;  4NG6 A;  5ILI A;  2PS6 A;  1VG3 A;  2DH4 A;  3LZ9 A;  2EWG A;  4E9Z A;  3LOM A;  2OGD A;  5DGN F;  4KVY A;  2ZEV A;  5AEL A;  3WEJ A;  5AHU B;  4Q23 A;  1FPS A;  3TFP A;  3WCH A;  3VJC A;  3ZMB A;  3LK5 A;  5ERN A;  5E8L A;  2E4O A;  2AZJ A;  3PH7 A;  5EAU A;  2ONG A;  3KRP A;  2Z7I A;  3ACX A;  3V1X A;  5A0I A;  4LFV F;  5IL8 A;  4F62 A;  2VF6 A;  2J1O A;  4LTV A;  3ZOU A;  1N20 A;  3WJK A;  5IK6 A;  1N1B A;  2E92 A;  3WCE A;  4DXJ A;  2E95 A;  4KPD A;  4JXY A;  4DEM F;  4NFK F;  3WSA A;  1N23 A;  3N49 F;  3WEK A;  4KPJ A;  2Z52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...