4FJQA

Crystal structure of an alpha-bisabolol synthase
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
530
structure length
521
Chain Sequence
PSIWGDQFLIVDNQVEQGVEQIVKDLKKEVRQLLKEALDIPMKHANLLKLVDEIQRLGISYLFEQEIDHALQHIYETYGDNWSGDRSSLWFRLMRKQGYFVTCDVFNNHKDESGVFKQSLKNHVEGLLELYEATSMRVPGEIILEDALVFTQSHLSIIAKDTLSINPALSTEIQRALKKPLWKRLPRIEAVQYIPFYEQQDSHNKTLIKLAKLEFNLLQSLHREELSQLSKWWKAFDVKNNAPYSRDRIVECYFWALASRFEPQYSRARIFLAKVIALVTLIDDIYDAYGTYEELKIFTEAIERWSITCLDMIPEYMKPIYKLFMDTYTEMEEILAKEGKTNIFNCGKEFVKDFVRVLMVEAQWLNEGHIPTTEELDSIAVNLGGANLLTTTCYLGMSDIVTKEAFEWAVSEPPLLRYKGILGRRLNDLAGHSSSVESYMKEYNVSEEYAKNLLYKQVEDLWKDINREYLITKTIPRPLLVAVINLVHFLDVLYAEKDNFTRMGEEYKNLVKSLLVYPMSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amorpha-4,11-diene synthase
publication title Rational engineering of plasticity residues of sesquiterpene synthases from Artemisia annua: product specificity and catalytic efficiency.
pubmed doi rcsb
source organism Artemisia annua
molecule tags Lyase
total genus 202
structure length 521
sequence length 530
ec nomenclature ec 4.2.3.24: Amorpha-4,11-diene synthase.
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01397 Terpene_synth Terpene synthase, N-terminal domain
A PF03936 Terpene_synth_C Terpene synthase family, metal binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4fjqA01
1.50.10.130 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Terpene synthase, N-terminal domain 4fjqA02
2Z4WA 5AFXA 1YJ4A 2F9KF 2E90A 3PDEA 2E8WA 4F6XA 4KVYA 3MAVA 4KVWA 2PS4A 4JZBA 2F92F 4LZ0A 3SDVA 4LZ3A 5IKHA 2RAHA 3TS7A 1HM7A 3N1WF 4KVIA 4K10A 5B0MA 2E92A 1V4JA 3G4FA 4OGUA 5B00A 5EASA 5B0KA 1N23A 4GP2A 3BNYA 3APZA 2E91A 2ONGA 1RQJA 1UBWA 4OKZA 4RXAA 3ADZA 5JV2F 3VJEA 1HXCA 4KUXA 4EA2A 4N9UA 4P0WA 3V1XA 2Z52A 5A0KA 5DJVF 2Z4XA 2FORA 5ILKA 5JUZF 5ERNA 3AQ0A 3EFQA 3EZ3A 3PYAA 4JYXA 5EAUA 5EROA 3SDQA 2FTZA 1HX9A 2PS7A 2Q9ZA 5CG5A 1DI1A 5B0IA 1DGPA 1UBVA 1YHLA 4KPJA 3WEFA 4E1EA 5IN8A 2OPNA 3Q1OA 3ACWA 5E8HA 5IMIA 4LIXA 3WCAA 2ZCQA 5DJPF 3KROB 3LMDA 2ZCOA 3WCCA 1HXGA 2ZY1A 3WCEA 5DHIA 3LJIA 3P5RA 5DJRF 2F7MF 4NG6A 5EATA 2OA6A 3PYBA 5AHUB 3ICMA 1KIYA 2AETA 4Q23A 2ZCSA 3S9VA 5CG6A 4XQRF 5HN9A 5DGSF 3WJNA 4LXWA 3TFNA 3M00A 3WC9A 3SAEA 4DZWA 4NUAA 3DYGA 4LTZA 1N21A 5DGNF 4E9ZA 3MZVA 4H5CF 4GA3A 1V4HA 3G4DA 2AZKA 3ACYA 3N3LF 3WJOA 3WSAA 5DW7A 5DZ2A 3AQBB 5AYPA 5DGMF 5AELA 3M9UA 4NFIF 3B7LA 4DEMF 3WEKA 4JXNA 5HN8A 4N1ZF 1RTRA 5ILZA 1V4KA 1WKZA 2E4OA 4KQSA 2PS5A 4MC0A 2F8CF 3TC1A 5IMPA 2VF6A 3VJAA 2E93A 4L2XF 3SDUA 2Q80A 1V4IA 3ZCDA 1YYTA 2J1OA 4KKMA 1VG3A 5ILYA 3ICNA 4LFVF 4NKEA 4QPFA 2J1PA 4KQUA 3WE9A 2Z7HA 5KSXF 4OMGA 4LOBA 3LVSA 4PVXF 4LTVA 4KVDA 4LFEA 1N22A 3M01A 3NPRA 3ZMCA 4OMHA 3ID0A 1ZW5A 4DXJA 3ZOUA 3S4JA 4HD1A 4EA1A 3WEGA 2OGDA 2H8OA 3ICKA 1YV5A 2AELA 3IPIA 4KK2A 3N45F 5ERMA 3VJCA 4RXCA 5ILHA 4NKFA 3LGKA 4MC8A 3WCGA 2ZEVA 3KRAB 5IVGA 1YQ7A 5IL3A 1RQIA 1N24A 4F62A 3WEJA 5B01A 2P1CA 3DYHA 5ER8A 3VJ8A 1WL3A 5DHKA 4E9UA 3CC9A 2OPMA 3LEEA 3IBAA 2PS6A 5IK0A 2E94A 4EA0A 3OACA 1VG4A 1FPSA 3WCFA 3N3DA 1UBYA 3N6KF 5ILJA 4RXDA 3KRAA 1YYRA 3P8LA 3N0FA 4F6VA 4KPDA 3EGTA 3KB9A 3OABA 1HXAA 3WCHA 5C05A 3KRCB 1VG6A 3WJKA 1VG7A 3LK5A 3NRIA 4DHDA 4LZCA 3M02A 3LG5A 3NPKA 3TFPA 3Q2ZA 3AQCB 5JV1F 5DIQF 3VJBA 5E8LA 4JZXA 2EWGA 3PKOA 1N1BA 4DWBA 2Z50A 4LPGF 3N46F 1YHMA 4LPHF 3AE0A 1JFGA 3KRCA 3Q2QA 3WCIA 4LFGA 3BNXA 3N0GA 3PH7A 3WCDA 4JXYA 1YHKA 3LZ9A 2AEKA 2O1OA 4H5EF 3TFVA 4ZQ8A 4FP4A 3VJDA 5IK9A 1JFAA 2E8UA 3NF2A 2E8TA 4JVJF 5A0IA 4LLSA 4PVYF 3CP6A 5IKAA 4RXEA 4XQTF 1WL2A 5ILDA 2E95A 5JA0F 1V4EA 5B02A 4XQSF 4LA6A 3N1VF 3DYFA 3QQVA 4KWDA 2Z4VA 3KRFB 3LLWA 4NFJF 1HM4A 1WL1A 3SDRA 3Q30A 3OACB 1YYSA 5IL8A 3WCBA 3LSNA 3ZL6A 3N49F 1EZFA 5B0JA 3WCJA 5JV0F 2DH4A 2Z4ZA 1KIZA 4RYPA 4DWGA 3CKEA 3P5PA 5B0LA 2I19A 4KQ5A 4KFAA 3VJ9A 3RMGA 3ZMBA 4WK5A 4H5DF 3P41A 3OABB 2Z78A 5E8KA 2ONHA 3W7FA 3KBKA 2Q9YA 3P8RA 3KRFA 4LLTA 4MC3A 2PS8A 5B03A 3WCMA 2F8ZF 1YYQA 2F94F 1WL0A 5IM1A 4DI5A 3LOMA 3V66A 2ZEUA 4FJQA 3WEHA 2Z7IA 3N5JF 4UMJA 3LDWA 3WEIA 4LUUA 3RYEA 1N20A 4OKMA 5ILIA 4GAXA 3WSBA 3OYRA 3LGZB 3QKCA 5HNAA 2J5CA 3N5HF 3SDTA 3UCAA 2Q58A 1WY0A 3KRPB 3ACXA 5H9DA 5HN7A 2E8XA 2ZCRA 4QXSF 5IK6A 3V1VA 2AZJA 3ASXA 2Z4YA 4LA5A 1YYUA 3WCLA 4P0VA 4GP1A 3KROA 2F89F 3RYWA 3RBMA 3ICZA 2E8VA 1UBXA 5IMNA 4NFKF 1WMWA 1VG2A 1PS1A 4P0XA 5A0JA 5I1UA 1N1ZA 3KRPA 2AZLA 2QISA 4RNQA 3M0GA
chains in the Genus database with same CATH superfamily
2Z4WA 5AFXA 1HZFA 1YJ4A 5FO9B 1LXMA 2F9KF 5GW7A 2E90A 3PDEA 5JMFA 2E8WA 4F6XA 1G87A 1LD8B 4KVYA 3MAVA 1TN6B 4KVWA 1KWFA 2PS4A 4JZBA 1H3AA 3QSPA 2F92F 3VXDA 5AGDA 4AYOA 4LZ0A 3SDVA 3RENA 3EUVB 1QSJA 4LZ3A 3EU5B 1V7VA 5IKHA 2RAHA 3TS7A 1HM7A 3H7LA 3N1WF 2X03A 1R76A 4KVIA 3E7JA 4FNVA 4K10A 2XFGA 3GT5A 5B0MA 4L6XA 2E92A 1V4JA 3G4FA 4GL3A 3PZ3B 2FV1A 3E33B 1LXKA 3M74A 1SA4B 4OGUA 2AFAA 2D5JA 5B00A 5EASA 5B0KA 1N23A 4GP2A 2PMVA 3BNYA 3PZ4B 4TF4A 3APZA 2E91A 4KKIA 2ONGA 2EAEA 1RQJA 1UBWA 4OKZA 4RXAA 3ADZA 2BBCA 4GTOB 5JV2F 4BOJA 3VJEA 1HXCA 4KUXA 4EA2A 3WKHA 4N9UA 4P0WA 3V1XA 4MU9A 2Z52A 2DRSA 3RSYA 4QT9A 5A0KA 4YCRA 5DJVF 3CU7A 2Z4XA 2FORA 5ILKA 5JUZF 5ERNA 2EACA 4OJZA 1HM2A 4EHMB 3AQ0A 3EFQA 3EZ3A 3PYAA 4JYXA 5EAUA 5EROA 3DSWB 3SDQA 3G6JB 2FTZA 1HX9A 4JJJA 2PS7A 2Q9ZA 5CG5A 3QFYA 1DI1A 4LNGB 4WVAA 5B0IA 3QXQA 1DGPA 1UBVA 2WYNA 3QG0A 5GY3A 4YDOB 1YHLA 4KPJA 3WEFA 4E1EA 5IN8A 1FT2B 2OPNA 1FCEA 3Q1OA 2XWBB 3ACWA 5E8HA 5IMIA 3WKGA 3M73A 4LIXA 3WCAA 2ZCQA 5DJPF 1H54A 2H6GB 3SFYB 3KROB 3LMDA 1QAZA 1QQFA 2ZCOA 3WCCA 1HXGA 2ZY1A 3WCEA 1H3CA 4Q2BA 3RX8A 5DHIA 4GTQB 3LJIA 5E2JA 3T33A 2ZZRA 3P5RA 2E22A 5DJRF 2F7MF 4NG6A 5EATA 3QT3A 1V5DA 1D8DB 1CEMA 2OA6A 4DOEA 3PYBA 5AHUB 3QRYA 3ICMA 1KIYA 2AETA 4ZRQA 1VD5A 4Q23A 4KKJA 4BOKA 2ZCSA 2BRVX 2H6IB 3S9VA 1RQ5A 5CG6A 2CQSA 4XQRF 5HN9A 5DGSF 3WJNA 1WU5A 2IEJB 2V3NA 1JCSB 4LXWA 3TFNA 3M00A 2BEDB 3WC9A 1RWHA 1L2AA 1UG9A 5JPMB 3SAEA 4DZWA 4NUAA 3DYGA 4LTZA 3WC3A 2Z07A 2BRWA 3AFJA 1XW2A 2V8IA 1N21A 2F6DA 5DGNF 4E9ZA 3W7TA 3MZVA 4H5CF 4GA3A 4GTPB 4V1SA 1CB8A 1V4HA 3G4DA 2AZKA 3ACYA 3N3LF 3WJOA 1FO3A 5JPNB 4J5TA 3WSAA 5DW7A 1N7OA 2GH4A 5DZ2A 3AQBB 4ZH1A 5AYPA 4TXTA 5DGMF 1N4QB 5AELA 3M9UA 2FUTA 2RI9A 4NFIF 1GAHA 1KFGA 3B7LA 2FUZA 3EU8A 4DEMF 3WEKA 4JXNA 2A73B 3D3IA 5HN8A 2RI8A 4N1ZF 1RTRA 5ILZA 1V4KA 1RWFA 1WKZA 3S4AA 1WU4A 3E80A 2EADA 5KKBA 2E4OA 3QWTA 4KQSA 5DGRA 2RGKA 2PS5A 1N7RA 1EGUA 3RX7A 4MC0A 1V5CA 2F8CF 3TC1A 5IMPA 2VF6A 3A3VA 3VJAA 2E93A 4L2XF 3SDUA 2Q80A 1H39A 1TNZB 3CIHA 1N4SB 1I8QA 1V4IA 3HXDB 5FOBB 3ZCDA 1FMIA 1YYTA 2J1OA 1OJMA 2OKXA 4KKMA 1VG3A 5ILYA 3ICNA 4LFVF 4NKEA 4QPFA 1KRFA 2J1PA 3E32B 2WINB 1H37A 1G9GA 3QDEA 2NOJA 4KQUA 3WE9A 3HXFB 2Z7HA 5KSXF 4OMGA 1DL2A 3KSLB 4LOBA 2ZIRB 3LVSA 3C72B 4PVXF 4LTVA 3W5NA 2AHGA 1KZPB 4KVDA 2BB6A 4LNVA 4LFEA 1N22A 3M01A 3NPRA 1K72A 3ZMCA 4OMHA 3ID0A 1ZW5A 4DXJA 2A8ZA 4C1SA 4D4CA 3ZOUA 5M7IA 3S4JA 1IA6A 4HD1A 4EA1A 3WEGA 2OGDA 2YIKA 3K11A 3WIQA 4AYRA 2H8OA 4D4DA 3ICKA 1UT9A 1D8EB 3ANKA 1TNOB 1YV5A 4GTTB 2AELA 3IPIA 4KK2A 3N45F 5ERMA 3NFVA 3VJCA 2EABA 4RXCA 5ILHA 1X1IA 4FUSA 4NKFA 3LGKA 4MC8A 3WCGA 1GXMA 2ZEVA 4V1RA 3KRAB 1FT1B 5IVGA 1YQ7A 5IL3A 3WKFA 1RQIA 4CJ1A 4CE7A 1N24A 4F62A 3QPFA 3PZ1B 2GZ6A 3WEJA 5B01A 3QT9A 2BRPA 2P1CA 2JF4A 2CQTA 2GOXA 3DYHA 1IS9A 3W5MA 5ER8A 3OXUA 1W6JA 3VJ8A 1NI1B 1WL3A 5DHKA 4E9UA 3CC9A 2OPMA 1LD7B 3RJ3A 1H13A 1WU6A 5MEHA 3LEEA 1N7PA 3IBAA 2PS6A 3DSTB 5IK0A 2E94A 4EA0A 2Q1FA 3OACA 3D5RA 3PMMA 3E37B 2DRQA 1VG4A 1TNBB 1X1JA 1FPSA 3M71A 3WCFA 4NEIA 3N3DA 4FXKB 2VN7A 3RX5A 1UBYA 3N6KF 5ILJA 4RXDA 1KSCA 3KRAA 1AYXA 1RWAA 1YYRA 3H3KA 5GZKA 1N7NA 3P8LA 3N0FA 4L9PB 1GA2A 4F6VA 2E24A 4KPDA 3EGTA 1ULVA 3KB9A 3OABA 1KSDA 1HXAA 5JMDA 2XQWA 2ZISB 4AYPA 1J0NA 4AYQA 4OZVA 5DGQA 3WCHA 5C05A 2V3PA 3KRCB 1VG6A 3WJKA 1VG7A 1GXNA 3LK5A 3NRIA 4DHDA 4LZCA 3M02A 3QXFA 3LG5A 1HMUA 3KSQB 3WIWA 3NPKA 4YDEB 3TFPA 3Q2ZA 3EZ8A 4M76A 1O1RB 3AQCB 1LOHA 5JV1F 5DIQF 1O1SB 3WIRA 3VJBA 5E8LA 4JZXA 2EWGA 3PKOA 1O6QA 2ZBLA 1RWGA 3ANJA 2FBAA 4KTPA 3OEDA 1N1BA 4DWBA 2Z50A 1WZZA 4LPGF 1IA7A 1O1TB 4OK4A 3M76A 3N46F 4ZG8A 1YHMA 4E1YA 1F9GA 1KS8A 3M7EA 1SA5B 4LPHF 1HMWA 1TNUB 3W7UA 3AE0A 1JFGA 2PN5A 1F1SA 3KRCA 2B4FA 3Q2QA 3WCIA 4LFGA 3BNXA 3N0GA 3PH7A 3ANIA 3ACTA 3WCDA 3Q75B 3W7XA 2D8LA 1J0MA 3X17A 3Q73B 1FP3A 1LF6A 4L0GA 4JXYA 1FAEA 1YHKA 1GLMA 1N4RB 3LZ9A 2AEKA 2O1OA 4H5EF 3TFVA 4ZQ8A 3DSXB 4MMIA 4FP4A 3WKIA 3VJDA 5IK9A 1DOGA 1JFAA 2E8UA 4MBGB 1X9DA 1JCQB 3NF2A 1MZCB 2E8TA 4JVJF 5A0IA 4LLSA 3DPYB 4PVYF 3ON6A 2G02A 3AFLA 1G9JA 3CP6A 4D4BA 5IKAA 1X81B 4RXEA 1FO2A 3VSNA 3M72A 4KTRA 3S4BA 4XQTF 1RWCA 3KLSA 3E30B 2XWJB 1WL2A 5ILDA 2H6FB 2E95A 2DROA 4OZWA 4Z4JA 5JA0F 1V4EA 5B02A 1N95B 4ONTA 2WIIB 4XQSF 1XWQA 4LA6A 3N1VF 2B39A 4MMHA 3DYFA 3TF4A 1SQCA 3QQVA 4KWDA 2Z4VA 3KRFB 3LLWA 4D94A 3VW5A 4NFJF 1FBWA 1HM4A 1KKTA 1WL1A 1GHQA 3SDRA 3Q30A 5CZLA 3M77A 3OACB 1YYSA 3QFZA 5IL8A 4DODA 3WCBA 3LSNA 3ZL6A 5FO8B 3N49F 1EZFA 5CD2A 5B0JA 3WCJA 5JV0F 1NL4B 2DH4A 1DCEB 3Q7AB 2Z4ZA 3KQ4A 4Q88A 1KIZA 4RYPA 4DWGA 3M75A 3CKEA 3P5PA 5B0LA 2I07B 2I19A 4KQ5A 4KFAA 3VJ9A 3RMGA 1JCRB 3HXEB 2V8KA 3ZMBA 1HN0A 4WK5A 2NVPA 3WUXA 4H5DF 3P41A 3OABB 2V8JA 2Z78A 3S4DA 5E8KA 1AGMA 2ONHA 1N4PB 4ZRPA 1KZOB 1TN7B 3W7FA 1O6RA 2BB5A 1RW9A 1UMPA 3K7XA 1O5MB 3KBKA 1LF9A 1TNYB 2Q9YA 3M78A 3Q79B 1O79A 3P8RA 1NC5A 1V7XA 2DRRA 3KRFA 4LLTA 1C3DA 2F0YB 2VN4A 4WVCA 3PZ2B 2P0VA 2QNOA 4MC3A 1L1YA 1C82A 3H2WA 1V7WA 2PS8A 5B03A 1GSZA 1W3YA 1GXOA 4GTRB 1H14A 4F10A 2WCOA 3WCMA 2WDAA 1HCUA 3GLYA 2F8ZF 1YYQA 4CJ0A 2F94F 4WVBA 1WL0A 5IM1A 4DI5A 3LOMA 3V66A 2ZEUA 4FJQA 3WEHA 5FO7B 2H6HB 3A0OA 1KREA 2Z7IA 3N5JF 1F9OA 1H3BA 1TF4A 3M7BA 4UMJA 3LDWA 4ZH5A 3WEIA 2SQCA 4Z4LA 4LUUA 3RYEA 3SQCA 5M7YA 1N20A 4OKMA 5ILIA 4GAXA 4GTMB 1OJOA 2JJBA 3WSBA 1CLCA 3OYRA 1N9AB 1X1HA 1FPPB 4OK2A 1XWTA 1N94B 1TN8B 3LGZB 3QKCA 5HNAA 2JG0A 3NNBA 1HV6A 2J5CA 3N5HF 3SDTA 2G0DA 3Q7FB 3UCAA 2Q58A 3M7CA 2WY8A 3DRAB 4GTVB 1WY0A 3KRPB 3ACXA 5H9DA 5HN7A 3RRSA 2E8XA 2ZCRA 3DSUB 1H12A 4QXSF 4F13A 1OJPA 5IK6A 3E34B 3V1VA 3W7SA 2AZJA 3DSVB 3ASXA 3EQAA 3GZKA 4XUVA 2Z4YA 4LA5A 1YYUA 3WCLA 3D5SA 4P0VA 4GP1A 3KROA 2WY7A 1NXCA 2R2LB 3DSSB 1W6KA 2F89F 1G6IA 3Q78B 4WU0A 3E73A 3RYWA 3RBMA 1O6HA 1HM3A 3ICZA 3SFXB 1S64B 4D4AA 1LTXB 1FBOA 1H36A 1GAIA 1N7QA 4EL8A 3P2CA 1F9DA 2AHFA 1JS4A 2E8VA 1OJNA 1UBXA 2FV0A 5IMNA 4LNBB 3S4CA 4NFKF 4FXGB 1WMWA 1S63B 2FUQA 1VG2A 3W7WA 1QBQB 3VSMA 1PS1A 4P0XA 5A0JA 3E6UA 3M7LA 5CA3A 5I1UA 1N1ZA 4GTSB 3KRPA 2AZLA 3HXBB 2QISA 3HXCB 4RNQA 1H35A 3ACSA 3M0GA
chains in the Genus database with same CATH topology
2Z4WA 5AFXA 1YJ4A 2F9KF 2E90A 3PDEA 2E8WA 4F6XA 4KVYA 3MAVA 4KVWA 2PS4A 4JZBA 2F92F 4LZ0A 3SDVA 4LZ3A 5IKHA 2RAHA 3TS7A 1HM7A 3N1WF 4KVIA 4K10A 5B0MA 2E92A 1V4JA 3G4FA 4OGUA 5B00A 5EASA 5B0KA 1N23A 4GP2A 3BNYA 3APZA 2E91A 2ONGA 1RQJA 1UBWA 4OKZA 4RXAA 3ADZA 5JV2F 3VJEA 1HXCA 4KUXA 4EA2A 4N9UA 4P0WA 3V1XA 2Z52A 5A0KA 5DJVF 2Z4XA 2FORA 5ILKA 5JUZF 5ERNA 3AQ0A 3EFQA 3EZ3A 3PYAA 4JYXA 5EAUA 5EROA 3SDQA 2FTZA 1HX9A 2PS7A 2Q9ZA 5CG5A 1DI1A 5B0IA 1DGPA 1UBVA 1YHLA 4KPJA 3WEFA 4E1EA 5IN8A 2OPNA 3Q1OA 3ACWA 5E8HA 5IMIA 4LIXA 3WCAA 2ZCQA 5DJPF 3KROB 3LMDA 2ZCOA 3WCCA 1HXGA 2ZY1A 3WCEA 5DHIA 3LJIA 3P5RA 5DJRF 2F7MF 4NG6A 5EATA 2OA6A 3PYBA 5AHUB 3ICMA 1KIYA 2AETA 4Q23A 2ZCSA 3S9VA 5CG6A 4XQRF 5HN9A 5DGSF 3WJNA 4LXWA 3TFNA 3M00A 3WC9A 3SAEA 4DZWA 4NUAA 3DYGA 4LTZA 1N21A 5DGNF 4E9ZA 3MZVA 4H5CF 4GA3A 1V4HA 3G4DA 2AZKA 3ACYA 3N3LF 3WJOA 3WSAA 5DW7A 5DZ2A 3AQBB 5AYPA 5DGMF 5AELA 3M9UA 4NFIF 3B7LA 4DEMF 3WEKA 4JXNA 5HN8A 4N1ZF 1RTRA 5ILZA 1V4KA 1WKZA 2E4OA 4KQSA 2PS5A 4MC0A 2F8CF 3TC1A 5IMPA 2VF6A 3VJAA 2E93A 4L2XF 3SDUA 2Q80A 1V4IA 3ZCDA 1YYTA 2J1OA 4KKMA 1VG3A 5ILYA 3ICNA 4LFVF 4NKEA 4QPFA 2J1PA 4KQUA 3WE9A 2Z7HA 5KSXF 4OMGA 4LOBA 3LVSA 4PVXF 4LTVA 4KVDA 4LFEA 1N22A 3M01A 3NPRA 3ZMCA 4OMHA 3ID0A 1ZW5A 4DXJA 3ZOUA 3S4JA 4HD1A 4EA1A 3WEGA 2OGDA 2H8OA 3ICKA 1YV5A 2AELA 3IPIA 4KK2A 3N45F 5ERMA 3VJCA 4RXCA 5ILHA 4NKFA 3LGKA 4MC8A 3WCGA 2ZEVA 3KRAB 5IVGA 1YQ7A 5IL3A 1RQIA 1N24A 4F62A 3WEJA 5B01A 2P1CA 3DYHA 5ER8A 3VJ8A 1WL3A 5DHKA 4E9UA 3CC9A 2OPMA 3LEEA 3IBAA 2PS6A 5IK0A 2E94A 4EA0A 3OACA 1VG4A 1FPSA 3WCFA 3N3DA 1UBYA 3N6KF 5ILJA 4RXDA 3KRAA 1YYRA 3P8LA 3N0FA 4F6VA 4KPDA 3EGTA 3KB9A 3OABA 1HXAA 3WCHA 5C05A 3KRCB 1VG6A 3WJKA 1VG7A 3LK5A 3NRIA 4DHDA 4LZCA 3M02A 3LG5A 3NPKA 3TFPA 3Q2ZA 3AQCB 5JV1F 5DIQF 3VJBA 5E8LA 4JZXA 2EWGA 3PKOA 1N1BA 4DWBA 2Z50A 4LPGF 3N46F 1YHMA 4LPHF 3AE0A 1JFGA 3KRCA 3Q2QA 3WCIA 4LFGA 3BNXA 3N0GA 3PH7A 3WCDA 4JXYA 1YHKA 3LZ9A 2AEKA 2O1OA 4H5EF 3TFVA 4ZQ8A 4FP4A 3VJDA 5IK9A 1JFAA 2E8UA 3NF2A 2E8TA 4JVJF 5A0IA 4LLSA 4PVYF 3CP6A 5IKAA 4RXEA 4XQTF 1WL2A 5ILDA 2E95A 5JA0F 1V4EA 5B02A 4XQSF 4LA6A 3N1VF 3DYFA 3QQVA 4KWDA 2Z4VA 3KRFB 3LLWA 4NFJF 1HM4A 1WL1A 3SDRA 3Q30A 3OACB 1YYSA 5IL8A 3WCBA 3LSNA 3ZL6A 3N49F 1EZFA 5B0JA 3WCJA 5JV0F 2DH4A 2Z4ZA 1KIZA 4RYPA 4DWGA 3CKEA 3P5PA 5B0LA 2I19A 4KQ5A 4KFAA 3VJ9A 3RMGA 3ZMBA 4WK5A 4H5DF 3P41A 3OABB 2Z78A 5E8KA 2ONHA 3W7FA 3KBKA 2Q9YA 3P8RA 3KRFA 4LLTA 4MC3A 2PS8A 5B03A 3WCMA 2F8ZF 1YYQA 2F94F 1WL0A 5IM1A 4DI5A 3LOMA 3V66A 2ZEUA 4FJQA 3WEHA 2Z7IA 3N5JF 4UMJA 3LDWA 3WEIA 4LUUA 3RYEA 1N20A 4OKMA 5ILIA 4GAXA 3WSBA 3OYRA 3LGZB 3QKCA 5HNAA 2J5CA 3N5HF 3SDTA 3UCAA 2Q58A 1WY0A 3KRPB 3ACXA 5H9DA 5HN7A 2E8XA 2ZCRA 4QXSF 5IK6A 3V1VA 2AZJA 3ASXA 2Z4YA 4LA5A 1YYUA 3WCLA 4P0VA 4GP1A 3KROA 2F89F 3RYWA 3RBMA 3ICZA 2E8VA 1UBXA 5IMNA 4NFKF 1WMWA 1VG2A 1PS1A 4P0XA 5A0JA 5I1UA 1N1ZA 3KRPA 2AZLA 2QISA 4RNQA 3M0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4W A;  5AFX A;  1YJ4 A;  2F9K F;  2E90 A;  3PDE A;  2E8W A;  4F6X A;  4KVY A;  3MAV A;  4KVW A;  2PS4 A;  4JZB A;  2F92 F;  4LZ0 A;  3SDV A;  4LZ3 A;  5IKH A;  2RAH A;  3TS7 A;  1HM7 A;  3N1W F;  4KVI A;  4K10 A;  5B0M A;  2E92 A;  1V4J A;  3G4F A;  4OGU A;  5B00 A;  5EAS A;  5B0K A;  1N23 A;  4GP2 A;  3BNY A;  3APZ A;  2E91 A;  2ONG A;  1RQJ A;  1UBW A;  4OKZ A;  4RXA A;  3ADZ A;  5JV2 F;  3VJE A;  1HXC A;  4KUX A;  4EA2 A;  4N9U A;  4P0W A;  3V1X A;  2Z52 A;  5A0K A;  5DJV F;  2Z4X A;  2FOR A;  5ILK A;  5JUZ F;  5ERN A;  3AQ0 A;  3EFQ A;  3EZ3 A;  3PYA A;  4JYX A;  5EAU A;  5ERO A;  3SDQ A;  2FTZ A;  1HX9 A;  2PS7 A;  2Q9Z A;  5CG5 A;  1DI1 A;  5B0I A;  1DGP A;  1UBV A;  1YHL A;  4KPJ A;  3WEF A;  4E1E A;  5IN8 A;  2OPN A;  3Q1O A;  3ACW A;  5E8H A;  5IMI A;  4LIX A;  3WCA A;  2ZCQ A;  5DJP F;  3KRO B;  3LMD A;  2ZCO A;  3WCC A;  1HXG A;  2ZY1 A;  3WCE A;  5DHI A;  3LJI A;  3P5R A;  5DJR F;  2F7M F;  4NG6 A;  5EAT A;  2OA6 A;  3PYB A;  5AHU B;  3ICM A;  1KIY A;  2AET A;  4Q23 A;  2ZCS A;  3S9V A;  5CG6 A;  4XQR F;  5HN9 A;  5DGS F;  3WJN A;  4LXW A;  3TFN A;  3M00 A;  3WC9 A;  3SAE A;  4DZW A;  4NUA A;  3DYG A;  4LTZ A;  1N21 A;  5DGN F;  4E9Z A;  3MZV A;  4H5C F;  4GA3 A;  1V4H A;  3G4D A;  2AZK A;  3ACY A;  3N3L F;  3WJO A;  3WSA A;  5DW7 A;  5DZ2 A;  3AQB B;  5AYP A;  5DGM F;  5AEL A;  3M9U A;  4NFI F;  3B7L A;  4DEM F;  3WEK A;  4JXN A;  5HN8 A;  4N1Z F;  1RTR A;  5ILZ A;  1V4K A;  1WKZ A;  2E4O A;  4KQS A;  2PS5 A;  4MC0 A;  2F8C F;  3TC1 A;  5IMP A;  2VF6 A;  3VJA A;  2E93 A;  4L2X F;  3SDU A;  2Q80 A;  1V4I A;  3ZCD A;  1YYT A;  2J1O A;  4KKM A;  1VG3 A;  5ILY A;  3ICN A;  4LFV F;  4NKE A;  4QPF A;  2J1P A;  4KQU A;  3WE9 A;  2Z7H A;  5KSX F;  4OMG A;  4LOB A;  3LVS A;  4PVX F;  4LTV A;  4KVD A;  4LFE A;  1N22 A;  3M01 A;  3NPR A;  3ZMC A;  4OMH A;  3ID0 A;  1ZW5 A;  4DXJ A;  3ZOU A;  3S4J A;  4HD1 A;  4EA1 A;  3WEG A;  2OGD A;  2H8O A;  3ICK A;  1YV5 A;  2AEL A;  3IPI A;  4KK2 A;  3N45 F;  5ERM A;  3VJC A;  4RXC A;  5ILH A;  4NKF A;  3LGK A;  4MC8 A;  3WCG A;  2ZEV A;  3KRA B;  5IVG A;  1YQ7 A;  5IL3 A;  1RQI A;  1N24 A;  4F62 A;  3WEJ A;  5B01 A;  2P1C A;  3DYH A;  5ER8 A;  3VJ8 A;  1WL3 A;  5DHK A;  4E9U A;  3CC9 A;  2OPM A;  3LEE A;  3IBA A;  2PS6 A;  5IK0 A;  2E94 A;  4EA0 A;  3OAC A;  1VG4 A;  1FPS A;  3WCF A;  3N3D A;  1UBY A;  3N6K F;  5ILJ A;  4RXD A;  3KRA A;  1YYR A;  3P8L A;  3N0F A;  4F6V A;  4KPD A;  3EGT A;  3KB9 A;  3OAB A;  1HXA A;  3WCH A;  5C05 A;  3KRC B;  1VG6 A;  3WJK A;  1VG7 A;  3LK5 A;  3NRI A;  4DHD A;  4LZC A;  3M02 A;  3LG5 A;  3NPK A;  3TFP A;  3Q2Z A;  3AQC B;  5JV1 F;  5DIQ F;  3VJB A;  5E8L A;  4JZX A;  2EWG A;  3PKO A;  1N1B A;  4DWB A;  2Z50 A;  4LPG F;  3N46 F;  1YHM A;  4LPH F;  3AE0 A;  1JFG A;  3KRC A;  3Q2Q A;  3WCI A;  4LFG A;  3BNX A;  3N0G A;  3PH7 A;  3WCD A;  4JXY A;  1YHK A;  3LZ9 A;  2AEK A;  2O1O A;  4H5E F;  3TFV A;  4ZQ8 A;  4FP4 A;  3VJD A;  5IK9 A;  1JFA A;  2E8U A;  3NF2 A;  2E8T A;  4JVJ F;  5A0I A;  4LLS A;  4PVY F;  3CP6 A;  5IKA A;  4RXE A;  4XQT F;  1WL2 A;  5ILD A;  2E95 A;  5JA0 F;  1V4E A;  5B02 A;  4XQS F;  4LA6 A;  3N1V F;  3DYF A;  3QQV A;  4KWD A;  2Z4V A;  3KRF B;  3LLW A;  4NFJ F;  1HM4 A;  1WL1 A;  3SDR A;  3Q30 A;  3OAC B;  1YYS A;  5IL8 A;  3WCB A;  3LSN A;  3ZL6 A;  3N49 F;  1EZF A;  5B0J A;  3WCJ A;  5JV0 F;  2DH4 A;  2Z4Z A;  1KIZ A;  4RYP A;  4DWG A;  3CKE A;  3P5P A;  5B0L A;  2I19 A;  4KQ5 A;  4KFA A;  3VJ9 A;  3RMG A;  3ZMB A;  4WK5 A;  4H5D F;  3P41 A;  3OAB B;  2Z78 A;  5E8K A;  2ONH A;  3W7F A;  3KBK A;  2Q9Y A;  3P8R A;  3KRF A;  4LLT A;  4MC3 A;  2PS8 A;  5B03 A;  3WCM A;  2F8Z F;  1YYQ A;  2F94 F;  1WL0 A;  5IM1 A;  4DI5 A;  3LOM A;  3V66 A;  2ZEU A;  4FJQ A;  3WEH A;  2Z7I A;  3N5J F;  4UMJ A;  3LDW A;  3WEI A;  4LUU A;  3RYE A;  1N20 A;  4OKM A;  5ILI A;  4GAX A;  3WSB A;  3OYR A;  3LGZ B;  3QKC A;  5HNA A;  2J5C A;  3N5H F;  3SDT A;  3UCA A;  2Q58 A;  1WY0 A;  3KRP B;  3ACX A;  5H9D A;  5HN7 A;  2E8X A;  2ZCR A;  4QXS F;  5IK6 A;  3V1V A;  2AZJ A;  3ASX A;  2Z4Y A;  4LA5 A;  1YYU A;  3WCL A;  4P0V A;  4GP1 A;  3KRO A;  2F89 F;  3RYW A;  3RBM A;  3ICZ A;  2E8V A;  1UBX A;  5IMN A;  4NFK F;  1WMW A;  1VG2 A;  1PS1 A;  4P0X A;  5A0J A;  5I1U A;  1N1Z A;  3KRP A;  2AZL A;  2QIS A;  4RNQ A;  3M0G A; 
#chains in the Genus database with same CATH topology
 2Z4W A;  5AFX A;  1HZF A;  1YJ4 A;  5FO9 B;  1LXM A;  2F9K F;  5GW7 A;  2E90 A;  3PDE A;  5JMF A;  2E8W A;  4F6X A;  1G87 A;  1LD8 B;  4KVY A;  3MAV A;  1TN6 B;  4KVW A;  1KWF A;  2PS4 A;  4JZB A;  1H3A A;  3QSP A;  2F92 F;  3VXD A;  5AGD A;  4AYO A;  4LZ0 A;  3SDV A;  3REN A;  3EUV B;  1QSJ A;  4LZ3 A;  3EU5 B;  1V7V A;  5IKH A;  2RAH A;  3TS7 A;  1HM7 A;  3H7L A;  3N1W F;  2X03 A;  1R76 A;  4KVI A;  3E7J A;  4FNV A;  4K10 A;  2XFG A;  3GT5 A;  5B0M A;  4L6X A;  2E92 A;  1V4J A;  3G4F A;  4GL3 A;  3PZ3 B;  2FV1 A;  3E33 B;  1LXK A;  3M74 A;  1SA4 B;  4OGU A;  2AFA A;  2D5J A;  5B00 A;  5EAS A;  5B0K A;  1N23 A;  4GP2 A;  2PMV A;  3BNY A;  3PZ4 B;  4TF4 A;  3APZ A;  2E91 A;  4KKI A;  2ONG A;  2EAE A;  1RQJ A;  1UBW A;  4OKZ A;  4RXA A;  3ADZ A;  2BBC A;  4GTO B;  5JV2 F;  4BOJ A;  3VJE A;  1HXC A;  4KUX A;  4EA2 A;  3WKH A;  4N9U A;  4P0W A;  3V1X A;  4MU9 A;  2Z52 A;  2DRS A;  3RSY A;  4QT9 A;  5A0K A;  4YCR A;  5DJV F;  3CU7 A;  2Z4X A;  2FOR A;  5ILK A;  5JUZ F;  5ERN A;  2EAC A;  4OJZ A;  1HM2 A;  4EHM B;  3AQ0 A;  3EFQ A;  3EZ3 A;  3PYA A;  4JYX A;  5EAU A;  5ERO A;  3DSW B;  3SDQ A;  3G6J B;  2FTZ A;  1HX9 A;  4JJJ A;  2PS7 A;  2Q9Z A;  5CG5 A;  3QFY A;  1DI1 A;  4LNG B;  4WVA A;  5B0I A;  3QXQ A;  1DGP A;  1UBV A;  2WYN A;  3QG0 A;  5GY3 A;  4YDO B;  1YHL A;  4KPJ A;  3WEF A;  4E1E A;  5IN8 A;  1FT2 B;  2OPN A;  1FCE A;  3Q1O A;  2XWB B;  3ACW A;  5E8H A;  5IMI A;  3WKG A;  3M73 A;  4LIX A;  3WCA A;  2ZCQ A;  5DJP F;  1H54 A;  2H6G B;  3SFY B;  3KRO B;  3LMD A;  1QAZ A;  1QQF A;  2ZCO A;  3WCC A;  1HXG A;  2ZY1 A;  3WCE A;  1H3C A;  4Q2B A;  3RX8 A;  5DHI A;  4GTQ B;  3LJI A;  5E2J A;  3T33 A;  2ZZR A;  3P5R A;  2E22 A;  5DJR F;  2F7M F;  4NG6 A;  5EAT A;  3QT3 A;  1V5D A;  1D8D B;  1CEM A;  2OA6 A;  4DOE A;  3PYB A;  5AHU B;  3QRY A;  3ICM A;  1KIY A;  2AET A;  4ZRQ A;  1VD5 A;  4Q23 A;  4KKJ A;  4BOK A;  2ZCS A;  2BRV X;  2H6I B;  3S9V A;  1RQ5 A;  5CG6 A;  2CQS A;  4XQR F;  5HN9 A;  5DGS F;  3WJN A;  1WU5 A;  2IEJ B;  2V3N A;  1JCS B;  4LXW A;  3TFN A;  3M00 A;  2BED B;  3WC9 A;  1RWH A;  1L2A A;  1UG9 A;  5JPM B;  3SAE A;  4DZW A;  4NUA A;  3DYG A;  4LTZ A;  3WC3 A;  2Z07 A;  2BRW A;  3AFJ A;  1XW2 A;  2V8I A;  1N21 A;  2F6D A;  5DGN F;  4E9Z A;  3W7T A;  3MZV A;  4H5C F;  4GA3 A;  4GTP B;  4V1S A;  1CB8 A;  1V4H A;  3G4D A;  2AZK A;  3ACY A;  3N3L F;  3WJO A;  1FO3 A;  5JPN B;  4J5T A;  3WSA A;  5DW7 A;  1N7O A;  2GH4 A;  5DZ2 A;  3AQB B;  4ZH1 A;  5AYP A;  4TXT A;  5DGM F;  1N4Q B;  5AEL A;  3M9U A;  2FUT A;  2RI9 A;  4NFI F;  1GAH A;  1KFG A;  3B7L A;  2FUZ A;  3EU8 A;  4DEM F;  3WEK A;  4JXN A;  2A73 B;  3D3I A;  5HN8 A;  2RI8 A;  4N1Z F;  1RTR A;  5ILZ A;  1V4K A;  1RWF A;  1WKZ A;  3S4A A;  1WU4 A;  3E80 A;  2EAD A;  5KKB A;  2E4O A;  3QWT A;  4KQS A;  5DGR A;  2RGK A;  2PS5 A;  1N7R A;  1EGU A;  3RX7 A;  4MC0 A;  1V5C A;  2F8C F;  3TC1 A;  5IMP A;  2VF6 A;  3A3V A;  3VJA A;  2E93 A;  4L2X F;  3SDU A;  2Q80 A;  1H39 A;  1TNZ B;  3CIH A;  1N4S B;  1I8Q A;  1V4I A;  3HXD B;  5FOB B;  3ZCD A;  1FMI A;  1YYT A;  2J1O A;  1OJM A;  2OKX A;  4KKM A;  1VG3 A;  5ILY A;  3ICN A;  4LFV F;  4NKE A;  4QPF A;  1KRF A;  2J1P A;  3E32 B;  2WIN B;  1H37 A;  1G9G A;  3QDE A;  2NOJ A;  4KQU A;  3WE9 A;  3HXF B;  2Z7H A;  5KSX F;  4OMG A;  1DL2 A;  3KSL B;  4LOB A;  2ZIR B;  3LVS A;  3C72 B;  4PVX F;  4LTV A;  3W5N A;  2AHG A;  1KZP B;  4KVD A;  2BB6 A;  4LNV A;  4LFE A;  1N22 A;  3M01 A;  3NPR A;  1K72 A;  3ZMC A;  4OMH A;  3ID0 A;  1ZW5 A;  4DXJ A;  2A8Z A;  4C1S A;  4D4C A;  3ZOU A;  5M7I A;  3S4J A;  1IA6 A;  4HD1 A;  4EA1 A;  3WEG A;  2OGD A;  2YIK A;  3K11 A;  3WIQ A;  4AYR A;  2H8O A;  4D4D A;  3ICK A;  1UT9 A;  1D8E B;  3ANK A;  1TNO B;  1YV5 A;  4GTT B;  2AEL A;  3IPI A;  4KK2 A;  3N45 F;  5ERM A;  3NFV A;  3VJC A;  2EAB A;  4RXC A;  5ILH A;  1X1I A;  4FUS A;  4NKF A;  3LGK A;  4MC8 A;  3WCG A;  1GXM A;  2ZEV A;  4V1R A;  3KRA B;  1FT1 B;  5IVG A;  1YQ7 A;  5IL3 A;  3WKF A;  1RQI A;  4CJ1 A;  4CE7 A;  1N24 A;  4F62 A;  3QPF A;  3PZ1 B;  2GZ6 A;  3WEJ A;  5B01 A;  3QT9 A;  2BRP A;  2P1C A;  2JF4 A;  2CQT A;  2GOX A;  3DYH A;  1IS9 A;  3W5M A;  5ER8 A;  3OXU A;  1W6J A;  3VJ8 A;  1NI1 B;  1WL3 A;  5DHK A;  4E9U A;  3CC9 A;  2OPM A;  1LD7 B;  3RJ3 A;  1H13 A;  1WU6 A;  5MEH A;  3LEE A;  1N7P A;  3IBA A;  2PS6 A;  3DST B;  5IK0 A;  2E94 A;  4EA0 A;  2Q1F A;  3OAC A;  3D5R A;  3PMM A;  3E37 B;  2DRQ A;  1VG4 A;  1TNB B;  1X1J A;  1FPS A;  3M71 A;  3WCF A;  4NEI A;  3N3D A;  4FXK B;  2VN7 A;  3RX5 A;  1UBY A;  3N6K F;  5ILJ A;  4RXD A;  1KSC A;  3KRA A;  1AYX A;  1RWA A;  1YYR A;  3H3K A;  5GZK A;  1N7N A;  3P8L A;  3N0F A;  4L9P B;  1GA2 A;  4F6V A;  2E24 A;  4KPD A;  3EGT A;  1ULV A;  3KB9 A;  3OAB A;  1KSD A;  1HXA A;  5JMD A;  2XQW A;  2ZIS B;  4AYP A;  1J0N A;  4AYQ A;  4OZV A;  5DGQ A;  3WCH A;  5C05 A;  2V3P A;  3KRC B;  1VG6 A;  3WJK A;  1VG7 A;  1GXN A;  3LK5 A;  3NRI A;  4DHD A;  4LZC A;  3M02 A;  3QXF A;  3LG5 A;  1HMU A;  3KSQ B;  3WIW A;  3NPK A;  4YDE B;  3TFP A;  3Q2Z A;  3EZ8 A;  4M76 A;  1O1R B;  3AQC B;  1LOH A;  5JV1 F;  5DIQ F;  1O1S B;  3WIR A;  3VJB A;  5E8L A;  4JZX A;  2EWG A;  3PKO A;  1O6Q A;  2ZBL A;  1RWG A;  3ANJ A;  2FBA A;  4KTP A;  3OED A;  1N1B A;  4DWB A;  2Z50 A;  1WZZ A;  4LPG F;  1IA7 A;  1O1T B;  4OK4 A;  3M76 A;  3N46 F;  4ZG8 A;  1YHM A;  4E1Y A;  1F9G A;  1KS8 A;  3M7E A;  1SA5 B;  4LPH F;  1HMW A;  1TNU B;  3W7U A;  3AE0 A;  1JFG A;  2PN5 A;  1F1S A;  3KRC A;  2B4F A;  3Q2Q A;  3WCI A;  4LFG A;  3BNX A;  3N0G A;  3PH7 A;  3ANI A;  3ACT A;  3WCD A;  3Q75 B;  3W7X A;  2D8L A;  1J0M A;  3X17 A;  3Q73 B;  1FP3 A;  1LF6 A;  4L0G A;  4JXY A;  1FAE A;  1YHK A;  1GLM A;  1N4R B;  3LZ9 A;  2AEK A;  2O1O A;  4H5E F;  3TFV A;  4ZQ8 A;  3DSX B;  4MMI A;  4FP4 A;  3WKI A;  3VJD A;  5IK9 A;  1DOG A;  1JFA A;  2E8U A;  4MBG B;  1X9D A;  1JCQ B;  3NF2 A;  1MZC B;  2E8T A;  4JVJ F;  5A0I A;  4LLS A;  3DPY B;  4PVY F;  3ON6 A;  2G02 A;  3AFL A;  1G9J A;  3CP6 A;  4D4B A;  5IKA A;  1X81 B;  4RXE A;  1FO2 A;  3VSN A;  3M72 A;  4KTR A;  3S4B A;  4XQT F;  1RWC A;  3KLS A;  3E30 B;  2XWJ B;  1WL2 A;  5ILD A;  2H6F B;  2E95 A;  2DRO A;  4OZW A;  4Z4J A;  5JA0 F;  1V4E A;  5B02 A;  1N95 B;  4ONT A;  2WII B;  4XQS F;  1XWQ A;  4LA6 A;  3N1V F;  2B39 A;  4MMH A;  3DYF A;  3TF4 A;  1SQC A;  3QQV A;  4KWD A;  2Z4V A;  3KRF B;  3LLW A;  4D94 A;  3VW5 A;  4NFJ F;  1FBW A;  1HM4 A;  1KKT A;  1WL1 A;  1GHQ A;  3SDR A;  3Q30 A;  5CZL A;  3M77 A;  3OAC B;  1YYS A;  3QFZ A;  5IL8 A;  4DOD A;  3WCB A;  3LSN A;  3ZL6 A;  5FO8 B;  3N49 F;  1EZF A;  5CD2 A;  5B0J A;  3WCJ A;  5JV0 F;  1NL4 B;  2DH4 A;  1DCE B;  3Q7A B;  2Z4Z A;  3KQ4 A;  4Q88 A;  1KIZ A;  4RYP A;  4DWG A;  3M75 A;  3CKE A;  3P5P A;  5B0L A;  2I07 B;  2I19 A;  4KQ5 A;  4KFA A;  3VJ9 A;  3RMG A;  1JCR B;  3HXE B;  2V8K A;  3ZMB A;  1HN0 A;  4WK5 A;  2NVP A;  3WUX A;  4H5D F;  3P41 A;  3OAB B;  2V8J A;  2Z78 A;  3S4D A;  5E8K A;  1AGM A;  2ONH A;  1N4P B;  4ZRP A;  1KZO B;  1TN7 B;  3W7F A;  1O6R A;  2BB5 A;  1RW9 A;  1UMP A;  3K7X A;  1O5M B;  3KBK A;  1LF9 A;  1TNY B;  2Q9Y A;  3M78 A;  3Q79 B;  1O79 A;  3P8R A;  1NC5 A;  1V7X A;  2DRR A;  3KRF A;  4LLT A;  1C3D A;  2F0Y B;  2VN4 A;  4WVC A;  3PZ2 B;  2P0V A;  2QNO A;  4MC3 A;  1L1Y A;  1C82 A;  3H2W A;  1V7W A;  2PS8 A;  5B03 A;  1GSZ A;  1W3Y A;  1GXO A;  4GTR B;  1H14 A;  4F10 A;  2WCO A;  3WCM A;  2WDA A;  1HCU A;  3GLY A;  2F8Z F;  1YYQ A;  4CJ0 A;  2F94 F;  4WVB A;  1WL0 A;  5IM1 A;  4DI5 A;  3LOM A;  3V66 A;  2ZEU A;  4FJQ A;  3WEH A;  5FO7 B;  2H6H B;  3A0O A;  1KRE A;  2Z7I A;  3N5J F;  1F9O A;  1H3B A;  1TF4 A;  3M7B A;  4UMJ A;  3LDW A;  4ZH5 A;  3WEI A;  2SQC A;  4Z4L A;  4LUU A;  3RYE A;  3SQC A;  5M7Y A;  1N20 A;  4OKM A;  5ILI A;  4GAX A;  4GTM B;  1OJO A;  2JJB A;  3WSB A;  1CLC A;  3OYR A;  1N9A B;  1X1H A;  1FPP B;  4OK2 A;  1XWT A;  1N94 B;  1TN8 B;  3LGZ B;  3QKC A;  5HNA A;  2JG0 A;  3NNB A;  1HV6 A;  2J5C A;  3N5H F;  3SDT A;  2G0D A;  3Q7F B;  3UCA A;  2Q58 A;  3M7C A;  2WY8 A;  3DRA B;  4GTV B;  1WY0 A;  3KRP B;  3ACX A;  5H9D A;  5HN7 A;  3RRS A;  2E8X A;  2ZCR A;  3DSU B;  1H12 A;  4QXS F;  4F13 A;  1OJP A;  5IK6 A;  3E34 B;  3V1V A;  3W7S A;  2AZJ A;  3DSV B;  3ASX A;  3EQA A;  3GZK A;  4XUV A;  2Z4Y A;  4LA5 A;  1YYU A;  3WCL A;  3D5S A;  4P0V A;  4GP1 A;  3KRO A;  2WY7 A;  1NXC A;  2R2L B;  3DSS B;  1W6K A;  2F89 F;  1G6I A;  3Q78 B;  4WU0 A;  3E73 A;  3RYW A;  3RBM A;  1O6H A;  1HM3 A;  3ICZ A;  3SFX B;  1S64 B;  4D4A A;  1LTX B;  1FBO A;  1H36 A;  1GAI A;  1N7Q A;  4EL8 A;  3P2C A;  1F9D A;  2AHF A;  1JS4 A;  2E8V A;  1OJN A;  1UBX A;  2FV0 A;  5IMN A;  4LNB B;  3S4C A;  4NFK F;  4FXG B;  1WMW A;  1S63 B;  2FUQ A;  1VG2 A;  3W7W A;  1QBQ B;  3VSM A;  1PS1 A;  4P0X A;  5A0J A;  3E6U A;  3M7L A;  5CA3 A;  5I1U A;  1N1Z A;  4GTS B;  3KRP A;  2AZL A;  3HXB B;  2QIS A;  3HXC B;  4RNQ A;  1H35 A;  3ACS A;  3M0G A; 
#chains in the Genus database with same CATH homology
 2Z4W A;  5AFX A;  1YJ4 A;  2F9K F;  2E90 A;  3PDE A;  2E8W A;  4F6X A;  4KVY A;  3MAV A;  4KVW A;  2PS4 A;  4JZB A;  2F92 F;  4LZ0 A;  3SDV A;  4LZ3 A;  5IKH A;  2RAH A;  3TS7 A;  1HM7 A;  3N1W F;  4KVI A;  4K10 A;  5B0M A;  2E92 A;  1V4J A;  3G4F A;  4OGU A;  5B00 A;  5EAS A;  5B0K A;  1N23 A;  4GP2 A;  3BNY A;  3APZ A;  2E91 A;  2ONG A;  1RQJ A;  1UBW A;  4OKZ A;  4RXA A;  3ADZ A;  5JV2 F;  3VJE A;  1HXC A;  4KUX A;  4EA2 A;  4N9U A;  4P0W A;  3V1X A;  2Z52 A;  5A0K A;  5DJV F;  2Z4X A;  2FOR A;  5ILK A;  5JUZ F;  5ERN A;  3AQ0 A;  3EFQ A;  3EZ3 A;  3PYA A;  4JYX A;  5EAU A;  5ERO A;  3SDQ A;  2FTZ A;  1HX9 A;  2PS7 A;  2Q9Z A;  5CG5 A;  1DI1 A;  5B0I A;  1DGP A;  1UBV A;  1YHL A;  4KPJ A;  3WEF A;  4E1E A;  5IN8 A;  2OPN A;  3Q1O A;  3ACW A;  5E8H A;  5IMI A;  4LIX A;  3WCA A;  2ZCQ A;  5DJP F;  3KRO B;  3LMD A;  2ZCO A;  3WCC A;  1HXG A;  2ZY1 A;  3WCE A;  5DHI A;  3LJI A;  3P5R A;  5DJR F;  2F7M F;  4NG6 A;  5EAT A;  2OA6 A;  3PYB A;  5AHU B;  3ICM A;  1KIY A;  2AET A;  4Q23 A;  2ZCS A;  3S9V A;  5CG6 A;  4XQR F;  5HN9 A;  5DGS F;  3WJN A;  4LXW A;  3TFN A;  3M00 A;  3WC9 A;  3SAE A;  4DZW A;  4NUA A;  3DYG A;  4LTZ A;  1N21 A;  5DGN F;  4E9Z A;  3MZV A;  4H5C F;  4GA3 A;  1V4H A;  3G4D A;  2AZK A;  3ACY A;  3N3L F;  3WJO A;  3WSA A;  5DW7 A;  5DZ2 A;  3AQB B;  5AYP A;  5DGM F;  5AEL A;  3M9U A;  4NFI F;  3B7L A;  4DEM F;  3WEK A;  4JXN A;  5HN8 A;  4N1Z F;  1RTR A;  5ILZ A;  1V4K A;  1WKZ A;  2E4O A;  4KQS A;  2PS5 A;  4MC0 A;  2F8C F;  3TC1 A;  5IMP A;  2VF6 A;  3VJA A;  2E93 A;  4L2X F;  3SDU A;  2Q80 A;  1V4I A;  3ZCD A;  1YYT A;  2J1O A;  4KKM A;  1VG3 A;  5ILY A;  3ICN A;  4LFV F;  4NKE A;  4QPF A;  2J1P A;  4KQU A;  3WE9 A;  2Z7H A;  5KSX F;  4OMG A;  4LOB A;  3LVS A;  4PVX F;  4LTV A;  4KVD A;  4LFE A;  1N22 A;  3M01 A;  3NPR A;  3ZMC A;  4OMH A;  3ID0 A;  1ZW5 A;  4DXJ A;  3ZOU A;  3S4J A;  4HD1 A;  4EA1 A;  3WEG A;  2OGD A;  2H8O A;  3ICK A;  1YV5 A;  2AEL A;  3IPI A;  4KK2 A;  3N45 F;  5ERM A;  3VJC A;  4RXC A;  5ILH A;  4NKF A;  3LGK A;  4MC8 A;  3WCG A;  2ZEV A;  3KRA B;  5IVG A;  1YQ7 A;  5IL3 A;  1RQI A;  1N24 A;  4F62 A;  3WEJ A;  5B01 A;  2P1C A;  3DYH A;  5ER8 A;  3VJ8 A;  1WL3 A;  5DHK A;  4E9U A;  3CC9 A;  2OPM A;  3LEE A;  3IBA A;  2PS6 A;  5IK0 A;  2E94 A;  4EA0 A;  3OAC A;  1VG4 A;  1FPS A;  3WCF A;  3N3D A;  1UBY A;  3N6K F;  5ILJ A;  4RXD A;  3KRA A;  1YYR A;  3P8L A;  3N0F A;  4F6V A;  4KPD A;  3EGT A;  3KB9 A;  3OAB A;  1HXA A;  3WCH A;  5C05 A;  3KRC B;  1VG6 A;  3WJK A;  1VG7 A;  3LK5 A;  3NRI A;  4DHD A;  4LZC A;  3M02 A;  3LG5 A;  3NPK A;  3TFP A;  3Q2Z A;  3AQC B;  5JV1 F;  5DIQ F;  3VJB A;  5E8L A;  4JZX A;  2EWG A;  3PKO A;  1N1B A;  4DWB A;  2Z50 A;  4LPG F;  3N46 F;  1YHM A;  4LPH F;  3AE0 A;  1JFG A;  3KRC A;  3Q2Q A;  3WCI A;  4LFG A;  3BNX A;  3N0G A;  3PH7 A;  3WCD A;  4JXY A;  1YHK A;  3LZ9 A;  2AEK A;  2O1O A;  4H5E F;  3TFV A;  4ZQ8 A;  4FP4 A;  3VJD A;  5IK9 A;  1JFA A;  2E8U A;  3NF2 A;  2E8T A;  4JVJ F;  5A0I A;  4LLS A;  4PVY F;  3CP6 A;  5IKA A;  4RXE A;  4XQT F;  1WL2 A;  5ILD A;  2E95 A;  5JA0 F;  1V4E A;  5B02 A;  4XQS F;  4LA6 A;  3N1V F;  3DYF A;  3QQV A;  4KWD A;  2Z4V A;  3KRF B;  3LLW A;  4NFJ F;  1HM4 A;  1WL1 A;  3SDR A;  3Q30 A;  3OAC B;  1YYS A;  5IL8 A;  3WCB A;  3LSN A;  3ZL6 A;  3N49 F;  1EZF A;  5B0J A;  3WCJ A;  5JV0 F;  2DH4 A;  2Z4Z A;  1KIZ A;  4RYP A;  4DWG A;  3CKE A;  3P5P A;  5B0L A;  2I19 A;  4KQ5 A;  4KFA A;  3VJ9 A;  3RMG A;  3ZMB A;  4WK5 A;  4H5D F;  3P41 A;  3OAB B;  2Z78 A;  5E8K A;  2ONH A;  3W7F A;  3KBK A;  2Q9Y A;  3P8R A;  3KRF A;  4LLT A;  4MC3 A;  2PS8 A;  5B03 A;  3WCM A;  2F8Z F;  1YYQ A;  2F94 F;  1WL0 A;  5IM1 A;  4DI5 A;  3LOM A;  3V66 A;  2ZEU A;  4FJQ A;  3WEH A;  2Z7I A;  3N5J F;  4UMJ A;  3LDW A;  3WEI A;  4LUU A;  3RYE A;  1N20 A;  4OKM A;  5ILI A;  4GAX A;  3WSB A;  3OYR A;  3LGZ B;  3QKC A;  5HNA A;  2J5C A;  3N5H F;  3SDT A;  3UCA A;  2Q58 A;  1WY0 A;  3KRP B;  3ACX A;  5H9D A;  5HN7 A;  2E8X A;  2ZCR A;  4QXS F;  5IK6 A;  3V1V A;  2AZJ A;  3ASX A;  2Z4Y A;  4LA5 A;  1YYU A;  3WCL A;  4P0V A;  4GP1 A;  3KRO A;  2F89 F;  3RYW A;  3RBM A;  3ICZ A;  2E8V A;  1UBX A;  5IMN A;  4NFK F;  1WMW A;  1VG2 A;  1PS1 A;  4P0X A;  5A0J A;  5I1U A;  1N1Z A;  3KRP A;  2AZL A;  2QIS A;  4RNQ A;  3M0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...